(data stored in ACNUC16935 zone)

EMBL: BT001165

ID   BT001165; SV 1; linear; mRNA; STD; PLN; 787 BP.
XX
AC   BT001165;
XX
DT   13-NOV-2002 (Rel. 73, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana Unknown protein (At4g02890) mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-787
RA   Tripp M., Southwick A., Karlin-Neumann G., Nguyen M., Miranda M.,
RA   Palm C.J., Bowser L., Jones T., Banh J., Carninci P., Chen H., Cheuk R.,
RA   Chung M.K., Hayashizaki Y., Ishida J., Kamiya A., Kawai J., Kim C., Lin J.,
RA   Liu S.X., Narusaka M., Pham P.K., Sakano H., Sakurai T., Satou M., Seki M.,
RA   Shinn P., Yamada K., Shinozaki K., Ecker J., Theologis A., Davis R.W.;
RT   ;
RL   Submitted (12-NOV-2002) to the INSDC.
RL   DNA Sequencing and Technology Center, Stanford University, 855 California
RL   Avenue, Palo Alto, CA 94304, USA
XX
DR   MD5; 03bd0fa7e2d325dfc41e6aa36fa0561a.
XX
CC   e-mail for correspondence: arab@sequence.stanford.edu
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis  Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and Sh inozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Tripp,M.,
CC   Southwick,A., Nguyen,M., Palm,C.J., Jones,T., Wu,T., Chen,H.,
CC   Cheuk,R., Chan,M.M., Chang,C.H., Dale,J.M., Deng,J.M., Hsuan,V.W.,
CC   Lee,J.M., Kim,C.J., Quach,H.L., Shinn,P., Tang,C.C., Toroumi,M.,
CC   Wallender,E.K., Wong,C., Wu,H.C., Yamada,K., Yu,G., Yuan,S.,
CC   Ecker,J., Theologis,A. and Davis,R.W.
CC   Tripp,M. (SSP/Stanford) and Seki,M. (RIKEN GSC) contributed equally
CC   to this work.  Shinozaki,K. (RIKEN GSC) and Davis,R.W.
CC   (SSP/Stanford) contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /mol_type="mRNA"
FT                   /clone="U15735"
FT                   /note="This clone is in pENTR/SD-dTopo   This is a cloned
FT                   PCR product using RIKEN clone RAFL04-16-G03 (AY042884) as a
FT                   template ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..690
FT                   /codon_start=1
FT                   /gene="At4g02890"
FT                   /product="Unknown protein"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q8H0Y0"
FT                   /protein_id="AAN65052.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
FT                   LRLRGGF"
XX
SQ   Sequence 787 BP; 215 A; 180 C; 196 G; 196 T; 0 other;
     atgcagatct ttgttaagac tctcaccgga aagactatca ccctcgaggt ggaaagctct        60
     gacaccatcg acaacgtcaa ggccaagatc caagacaagg agggtattcc tccggaccag       120
     cagaggttga tcttcgctgg aaagcagttg gaggatggca gaactcttgc tgactacaac       180
     atccagaagg agtccacact tcatcttgtt ctcaggctcc gtggtggtat gcagatcttt       240
     gtcaagacgt tgactggaaa gactatcact ttggaggtgg agagctctga cactatcgac       300
     aatgtcaaag ccaagatcca ggacaaagag ggtatcccac cggaccagca gagattgatc       360
     ttcgccggaa aacaacttga agatggtaga actttggctg actacaacat tcagaaggag       420
     tctacacttc acttggtgtt gcgtctccgt ggaggtatgc agattttcgt gaagactctc       480
     actggaaaga ccattactct tgaagttgag agctccgaca ccattgacaa cgtgaaggct       540
     aagatccagg acaaggaagg tatccctccg gaccagcagc gtctcatctt cgctggaaaa       600
     cagcttgagg atggtcgtac tttggccgac tacaacatcc agaaggagtc tacccttcac       660
     ttggtgctaa ggctccgtgg tggtttctaa aaacttatct ctgttatgaa tcagaagaag       720
     ttcatgtctc gtttcattta aaactttggt ggtttgtgtt ttggggcctt gtaaagcccc       780
     tgatgaa                                                                 787
//

If you have problems or comments...

PBIL Back to PBIL home page