(data stored in SCRATCH zone)

EMBL: BT002168

ID   BT002168; SV 1; linear; mRNA; STD; PLN; 1179 BP.
XX
AC   BT002168;
XX
DT   21-NOV-2002 (Rel. 73, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana protein kinase ATN1-like protein (At5g01850) mRNA,
DE   complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1179
RA   Nguyen M., Karlin-Neumann G., Southwick A., Tripp M., Miranda M.,
RA   Palm C.J., Bowser L., Jones T., Banh J., Carninci P., Chen H., Cheuk R.,
RA   Chung M.K., Hayashizaki Y., Ishida J., Kamiya A., Kawai J., Kim C., Lin J.,
RA   Liu S.X., Narusaka M., Pham P.K., Sakano H., Sakurai T., Satou M., Seki M.,
RA   Shinn P., Yamada K., Shinozaki K., Ecker J., Theologis A., Davis R.W.;
RT   ;
RL   Submitted (19-NOV-2002) to the INSDC.
RL   DNA Sequencing and Technology Center, Stanford University, 855 California
RL   Avenue, Palo Alto, CA 94304, USA
XX
DR   MD5; 8ee3fc7bbbe64d4696f58cc17fd113ff.
XX
CC   e-mail for correspondence: arab@sequence.stanford.edu
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis  Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and Sh inozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Nguyen,M.,
CC   Southwick,A., Tripp,M., Palm,C.J., Jones,T., Wu,T., Chen,H.,
CC   Cheuk,R., Chan,M.M., Chang,C.H., Dale,J.M., Deng,J.M., Hsuan,V.W.,
CC   Lee,J.M., Kim,C.J., Quach,H.L., Shinn,P., Tang,C.C., Toroumi,M.,
CC   Wallender,E.K., Wong,C., Wu,H.C., Yamada,K., Yu,G., Yuan,S.,
CC   Ecker,J., Theologis,A. and Davis,R.W.
CC   Nguyen,M., (SSP/Stanford) and Seki,M. (RIKEN GSC) contributed
CC   equally to this work.  Shinozaki,K. (RIKEN GSC) and Davis,R.W.
CC   (SSP/Stanford) contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1179
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /mol_type="mRNA"
FT                   /clone="U24815"
FT                   /note="This clone is in pENTR/SD-dTopo   This is a cloned
FT                   PCR product using RIKEN clone RAFL09-67-A02 (AY140072) as a
FT                   template ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..1002
FT                   /codon_start=1
FT                   /gene="At5g01850"
FT                   /product="protein kinase ATN1-like protein"
FT                   /db_xref="GOA:Q8L6Y9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q8L6Y9"
FT                   /protein_id="AAN72179.1"
FT                   /translation="MSSDDTIEESLLVDPKLLFIGSKIGEGAHGKVYQGRYGRQIVAIK
FT                   VVNRGSKPDQQSSLESRFVREVNMMSRVQHHNLVKFIGACKDPLMVIVTELLPGMSLRK
FT                   YLTSIRPQLLHLPLALSFALDIARALHCLHANGIIHRDLKPDNLLLTENHKSVKLADFG
FT                   LAREESVTEMMTAETGTYRWMAPELYSTVTLRQGEKKHYNNKVDVYSFGIVLWELLTNR
FT                   MPFEGMSNLQAAYAAAFKQERPVMPEGISPSLAFIVQSCWVEDPNMRPSFSQIIRLLNE
FT                   FLLTLTPPPPQPLPETATNRTNGRAITEFSIRPKGKFAFIRQLFAAKRNINS"
XX
SQ   Sequence 1179 BP; 300 A; 298 C; 272 G; 309 T; 0 other;
     atgagtagcg atgatacgat tgaggagagt ttgcttgtgg atcccaaatt gttgttcatc        60
     ggctccaaga ttggtgaagg cgctcacggc aaagtctacc aaggaaggta tggtcgtcag       120
     attgttgcaa tcaaagttgt caaccggggc tccaaacctg accagcaatc ttctctcgag       180
     agccgtttcg tccgtgaggt caatatgatg tcccgcgttc aacaccataa ccttgtcaag       240
     tttattggag cgtgcaaaga tcctttaatg gtaatagtaa cagagcttct cccagggatg       300
     tctctccgta aatatctcac cagcatccgt cctcagttgc tccatctccc tcttgctctc       360
     tcctttgccc ttgacatcgc ccgtgccttg cactgcttac acgccaatgg tatcattcac       420
     agagacctca aacctgacaa cttattgctc acggagaatc acaaatccgt caagcttgct       480
     gatttcgggc ttgctaggga agaatccgtg actgagatga tgactgctga gactgggact       540
     taccgttgga tggctcctga gctctacagt acagtgaccc tgcgtcaagg agagaagaag       600
     cattacaaca acaaagttga tgtctacagc tttggaatcg tgctttggga gcttctcact       660
     aatcgtatgc cattcgaggg catgtccaat ctgcaagccg cctacgcagc agcattcaag       720
     caggagaggc ccgtaatgcc agaggggata tctccgagtc tggcgttcat agtgcagtct       780
     tgttgggtgg aggacccaaa catgaggcca agcttcagtc aaattatcag actgctcaat       840
     gagttcctcc ttaccctgac tcctccgcct cctcagcctc tgcctgagac tgccaccaac       900
     aggaccaatg gccgagccat cactgagttc tccatccgtc caaaagggaa atttgccttc       960
     attcgccagc ttttcgctgc caagaggaac ataaactctt aggtacaaga aggggtcttc      1020
     tttgtctttg ccactgccac tgctttggtg gataaatgac attagcagag agagagaagt      1080
     agaaagttag acttacttaa agtctatagc gtagttaagt actcaatctt cttcttgtca      1140
     agtgattaac tggtagtatc acacgccaaa ctaattggt                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page