(data stored in ACNUC7421 zone)

EMBL: BT002198

ID   BT002198; SV 1; linear; mRNA; STD; PLN; 1011 BP.
XX
AC   BT002198;
XX
DT   21-NOV-2002 (Rel. 73, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana enoyl CoA hydratase-like protein (At5g43280) mRNA,
DE   complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1011
RA   Nguyen M., Karlin-Neumann G., Southwick A., Tripp M., Miranda M.,
RA   Palm C.J., Bowser L., Jones T., Banh J., Carninci P., Chen H., Cheuk R.,
RA   Chung M.K., Hayashizaki Y., Ishida J., Kamiya A., Kawai J., Kim C., Lin J.,
RA   Liu S.X., Narusaka M., Pham P.K., Sakano H., Sakurai T., Satou M., Seki M.,
RA   Shinn P., Yamada K., Shinozaki K., Ecker J., Theologis A., Davis R.W.;
RT   ;
RL   Submitted (19-NOV-2002) to the INSDC.
RL   DNA Sequencing and Technology Center, Stanford University, 855 California
RL   Avenue, Palo Alto, CA 94304, USA
XX
DR   MD5; df8983fe224da2d49e4a5533310e0eea.
XX
CC   e-mail for correspondence: arab@sequence.stanford.edu
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis  Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and Sh inozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Nguyen,M.,
CC   Southwick,A., Tripp,M., Palm,C.J., Jones,T., Wu,T., Chen,H.,
CC   Cheuk,R., Chan,M.M., Chang,C.H., Dale,J.M., Deng,J.M., Hsuan,V.W.,
CC   Lee,J.M., Kim,C.J., Quach,H.L., Shinn,P., Tang,C.C., Toroumi,M.,
CC   Wallender,E.K., Wong,C., Wu,H.C., Yamada,K., Yu,G., Yuan,S.,
CC   Ecker,J., Theologis,A. and Davis,R.W.
CC   Nguyen,M., (SSP/Stanford) and Seki,M. (RIKEN GSC) contributed
CC   equally to this work.  Shinozaki,K. (RIKEN GSC) and Davis,R.W.
CC   (SSP/Stanford) contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1011
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /mol_type="mRNA"
FT                   /clone="U17434"
FT                   /note="This clone is in pENTR/SD-dTopo   This is a cloned
FT                   PCR product using RIKEN clone RAFL11-10-D22 (AY072351) as a
FT                   template ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..837
FT                   /codon_start=1
FT                   /gene="At5g43280"
FT                   /product="enoyl CoA hydratase-like protein"
FT                   /db_xref="GOA:Q9FHR8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FHR8"
FT                   /protein_id="AAN72209.1"
FT                   /translation="MTMESYKTLEIIRKNTDSSVFHLIINRPSHLNALSLDFFIEFPKA
FT                   LSSLDQNPDVSVIILSGAGKHFCSGIDLNSLSSISTQSSSGNDRGRSSEQLRRKIKSMQ
FT                   AAITAIEQCRKPVIAAIHGACIGGGVDLITACDIRYCSEDAFFSIKEVDLAIVADLGTL
FT                   QRLPSIVGYANAMELALTARRFSGSEAKDLGLVSKVFGSKSELDNGVTTIAEGIGGKSP
FT                   LAVTGTKAVLLRSREVSVEQGLDYVATWNSAMLISDDLNEAVSAQMMKRKPRFAKL"
XX
SQ   Sequence 1011 BP; 279 A; 224 C; 214 G; 294 T; 0 other;
     atgacaatgg agtcatacaa aaccctagaa atcattcgca agaacactga ttcctccgta        60
     tttcatctca tcatcaacag accatcacat ctcaacgcct tatctctcga tttcttcatc       120
     gaattcccca aagctctctc atctctcgac caaaatccag atgtctccgt catcatcctc       180
     tccggcgccg gaaaacactt ctgctccggt atcgatctca attccctctc ttcaatctcg       240
     acacaatcct cctccggtaa cgacagagga cgatctagcg agcagctacg ccgtaagatc       300
     aagtcgatgc aagcggcgat tacagcgatt gaacaatgcc ggaaacctgt aatcgccgct       360
     attcacggcg cgtgtatcgg tggcggtgtt gatctgatta ccgcttgtga tattaggtat       420
     tgctctgagg atgcgttttt ctcgattaaa gaggttgatc tagcgattgt tgcggatctt       480
     ggtacacttc agcgattacc gagtatcgtt gggtatgcta acgccatgga attggcttta       540
     actgctcgga gattctctgg aagtgaagca aaggatcttg gtttggtttc taaagttttc       600
     ggatctaaat cggagcttga taatggcgtc actacaatcg ccgaaggaat aggaggcaag       660
     tctcctttag ctgtgacagg gacaaaggca gtgttattaa gaagcagaga ggtgagtgta       720
     gaacaaggac ttgactatgt agcaacttgg aactcggcta tgcttatatc agatgatctc       780
     aacgaagctg tttctgctca gatgatgaaa agaaaacctc ggtttgctaa actttgatac       840
     agtctctctg ttgcttcttt atctttcaaa gctcttctgg taactaaagt aataagatat       900
     tacttcaaat aagtttagtt attgatagtt ccctaattac ggattagggc tatagataaa       960
     atggtcttct acacatgaga atatgattaa tactctgcac aatgcatatt g               1011
//

If you have problems or comments...

PBIL Back to PBIL home page