(data stored in ACNUC16935 zone)

EMBL: BT002420

ID   BT002420; SV 1; linear; mRNA; STD; PLN; 1230 BP.
XX
AC   BT002420;
XX
DT   24-DEC-2002 (Rel. 74, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana polyubiquitin (UBQ3) (At5g03240) mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1230
RA   Southwick A., Nguyen M., Tripp M., Palm C.J., Jones T., Wu T., Carninci P.,
RA   Chen H., Cheuk R., Chan M.M., Chang C.H., Dale J.M., Deng J.M.,
RA   Hayashizaki Y., Hsuan V.W., Lee J.M., Ishida J., Kamiya A., Kawai J.,
RA   Kim C.J., Narusaka M., Onodera C.S., Quach H.L., Sakurai T., Satou M.,
RA   Seki M., Shinn P., Tang C.C., Toroumi M., Wong C., Wu H.C., Yamada K.,
RA   Yu G., Yuan S., Shinozaki K., Ecker J., Theologis A., Davis R.W.;
RT   ;
RL   Submitted (20-DEC-2002) to the INSDC.
RL   DNA Sequencing and Technology Center, Stanford University, 855 California
RL   Avenue, Palo Alto, CA 94304, USA
XX
DR   MD5; a0559f082c5787d5da4c505aab4b6c96.
XX
CC   e-mail for correspondence: arab@sequence.stanford.edu
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis  Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Nguyen,M., Tripp,M.,
CC   Southwick,A., Palm,C.J., Jones,T., Wu,T., Chen,H., Cheuk,R.,
CC   Chan,M.M., Chang,C.H., Dale,J.M., Deng,J.M., Hsuan,V.W., Lee,J.M.,
CC   Kim,C.J., Quach,H.L., Onodera,C.S., Shinn,P., Tang,C.C.,
CC   Toroumi,M., Wong,C., Wu,H.C., Yamada,K., Yu,G., Yuan,S., Ecker,J.,
CC   Theologis,A. and Davis,R.W.
CC    Nguyen,M., (SSP/Stanford) and Seki,M. (RIKEN GSC) contributed
CC   equally to this work.  Shinozaki,K. (RIKEN GSC) and Davis,R.W.
CC   (SSP/Stanford) contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1230
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL06-08-I12 (R16959)"
FT                   /note="This clone is in pBluescript ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        85..1005
FT                   /codon_start=1
FT                   /gene="At5g03240"
FT                   /product="polyubiquitin (UBQ3)"
FT                   /db_xref="GOA:Q1EC66"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1EC66"
FT                   /protein_id="AAO00780.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLADYNIQKESTLHLVLRLRGGSF"
XX
SQ   Sequence 1230 BP; 336 A; 281 C; 268 G; 345 T; 0 other;
     atcctttcgt ctttttgtga ctcttcaatc tctcccaaag cctaaagcga tctctgcaaa        60
     tctctcgcga ctctctcttt caagatgcaa atcttcgtga aaacactcac tggcaagact       120
     atcactctcg aggttgagag ctctgacacc atcgacaatg ttaaggcaaa gattcaggac       180
     aaggaaggca ttcctccgga tcagcaaaga ttaatattcg ccggtaaaca gctagaagat       240
     ggccgtacct tggccgatta caacattcag aaagaatcaa cccttcattt ggttctccgt       300
     ttaagaggtg gtatgcaaat ctttgtcaag actctgactg gcaagaccat tactttggag       360
     gttgagagct ctgacactat tgacaacgtc aaagcaaaga tccaggacaa ggaaggaatc       420
     cctccggatc agcagagact tatctttgcc ggtaagcagc ttgaagacgg aagaactctt       480
     gctgactaca acattcaaaa ggagtcgacc cttcatttgg tgcttcgtct cagaggtggt       540
     atgcaaatct ttgtcaagac cctcactggt aaaacaatca cccttgaggt tgagagttca       600
     gacaccattg acaatgtcaa agctaagatc caagataaag agggaattcc tccggatcag       660
     cagaggctta tctttgccgg taagcagctc gaagatggac gcacccttgc agattacaac       720
     atccaaaagg agtcgacact tcatcttgtg cttcgtctcc gtggtggtat gcagatcttt       780
     gtgaagaccc ttaccggaaa gaccattact ctggaggttg aaagctcaga caccatcgat       840
     aatgtcaagg ctaagattca ggacaaggaa gggatcccac cagaccaaca gagactcatc       900
     ttcgctggaa aacagcttga ggatggtcgc acacttgcag attacaacat ccagaaggag       960
     tcgactcttc acttggttct tcgtcttcgt ggtggaagct tctaagcttt ttgtgatctg      1020
     atgataagtg gttggttcgt gtctcatgca cttgggaggt gatctatttc acctggtgta      1080
     gtttgtgttt ccgtcagttg gaaaaactta tccctatcga tttcgttttc attttctgct      1140
     tttcttttat gtaccttcgt ttgggcttgt aacgggcctt tgtatttcaa ctctcaataa      1200
     taatccaagt gcatgttaaa caatttgtct                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page