(data stored in ACNUC13479 zone)

EMBL: BT005662

ID   BT005662; SV 1; linear; mRNA; STD; PLN; 298 BP.
XX
AC   BT005662;
XX
DT   17-MAR-2003 (Rel. 75, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana clone U51347 putative small nuclear ribonucleoprotein
DE   E (At2g18740) mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-298
RA   Yamada K., Chan M.M., Chang C.H., Dale J.M., Hsuan V.W., Lee J.M.,
RA   Onodera C.S., Quach H.L., Tang C., Toriumi M., Wong C., Wu H.C., Yu G.,
RA   Yuan S., Carninci P., Chen H., Cheuk R., Hayashizaki Y., Ishida J.,
RA   Jones T., Kamiya A., Kawai J., Kim C.J., Narusaka M., Nguyen M., Palm C.J.,
RA   Sakurai T., Satou M., Seki M., Shinn P., Southwick A., Tripp M.G., Wu T.,
RA   Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   "Arabidopsis Open Reading Frame (ORF) Clones";
RL   Unpublished.
XX
RN   [2]
RP   1-298
RA   Yamada K., Chan M.M., Chang C.H., Dale J.M., Hsuan V.W., Lee J.M.,
RA   Onodera C.S., Quach H.L., Tang C.C., Toriumi M., Wong C., Wu H.C., Yu G.,
RA   Yuan S., Carninci P., Chen H., Cheuk R., Hayashizaki Y., Ishida J.,
RA   Jones T., Kamiya A., Kawai J., Kim C.J., Narusaka M., Nguyen M., Palm C.J.,
RA   Sakurai T., Satou M., Seki M., Shinn P., Southwick A., Tripp M.G., Wu T.,
RA   Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   ;
RL   Submitted (15-MAR-2003) to the INSDC.
RL   Plant Gene Expression Center, 800 Buchanan Street, Albany, CA 94710, USA
XX
DR   MD5; 46546ff61410d6ba7543bcbb6a857aea.
XX
CC   The RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis  Full-Length  cDNA'): Seki,M., Narusaka,M.,  Ishida,J.,
CC    Satou,M.,  Kamiya,A., Sakurai,T., Carninci,P.,  Kawai, J.,
CC   Hayashizaki,Y.  and  Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members constructed and
CC   sequenced the pUNI (ORF) clones using the RAFL cDNAs: Yamada,K.,
CC   Chan,M.M., Chang,C.H., Dale,J.M., Hsuan,V.W., Lee,J.M.,
CC   Onodera,C.S.,  Quach,H.L., Tang,C.C., Toriumi,M., Wong,C., Wu,H.C.,
CC    Yu,G., Yuan,S., Chen,H., Cheuk,R., Jones,T., Kim,C.J., Nguyen,M.,
CC   Palm,C.J., Shinn,P., Southwick,A., Tripp,M.G., Wu,T., Davis,R.W.,
CC   Ecker,J.R. and Theologis,A.
CC   Yamada,K. (SSP/PGEC) and Seki, M. (RIKEN GSC) contributed equally
CC   to  this work.  Shinozaki,K. (RIKEN GSC) and Theologis,A. (SSP
CC   /PGEC)  contributed equally to this work as PIs.
CC   Annotation based on July 2002 version of the Arabidopsis genome
CC   submitted to Genbank.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..298
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="2"
FT                   /mol_type="mRNA"
FT                   /clone="U51347"
FT                   /note="This clone is in pUNI 51. ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..267
FT                   /codon_start=1
FT                   /gene="At2g18740"
FT                   /product="putative small nuclear ribonucleoprotein E"
FT                   /db_xref="GOA:Q9ZV45"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR027078"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZV45"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAO64082.1"
FT                   /translation="MASTKVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRITG
FT                   FDEYMNLVLDEAEEVSIKKNTRKPLGRILLKGDNITLMMNTGK"
FT   3'UTR           268..298
FT                   /gene="At2g18740"
XX
SQ   Sequence 298 BP; 103 A; 51 C; 68 G; 76 T; 0 other;
     atggcgagca ccaaagttca aaggattatg acccaaccta tcaacttgat ttttaggttt        60
     cttcaaagta aagctaggat ccagatttgg ctatttgagc agaaagattt gaggattgaa       120
     ggaagaatca ctggttttga cgaatacatg aatctagttt tggatgaggc tgaagaagtg       180
     agcatcaaga agaacaccag gaaaccactt ggaaggattt tactcaaagg agacaacata       240
     actctgatga tgaacacggg aaagtgatgt ctgtctcaaa caactctctt cgatgacc         298
//

If you have problems or comments...

PBIL Back to PBIL home page