(data stored in SCRATCH zone)

EMBL: BT005841

ID   BT005841; SV 1; linear; mRNA; STD; PLN; 360 BP.
XX
AC   BT005841;
XX
DT   19-MAR-2003 (Rel. 75, Created)
DT   19-MAR-2003 (Rel. 75, Last updated, Version 1)
XX
DE   Arabidopsis thaliana At4g26230 gene, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-360
RA   Cheuk R., Chen H., Kim C.J., Shinn P., Bowser L., Carninci P., Chan M.M.,
RA   Chang C.H., Dale J.M., Hayashizaki Y., Hsuan V.W., Ishida J., Jones T.,
RA   Kamiya A., Karlin-Neumann G., Kawai J., Lam B., Lee J.M., Lin J.,
RA   Miranda M., Narusaka M., Nguyen M., Onodera C.S., Palm C.J., Quach H.L.,
RA   Sakurai T., Satou M., Seki M., Southwick A., Tang C.C., Toriumi M.,
RA   Wong C., Wu H.C., Yamada K., Yu G., Yuan S., Shinozaki K., Davis R.W.,
RA   Theologis A., Ecker J.R.;
RT   "Arabidopsis ORF clones";
RL   Unpublished.
XX
RN   [2]
RP   1-360
RA   Cheuk R., Chen H., Kim C.J., Shinn P., Bowser L., Carninci P., Chan M.M.,
RA   Chang C.H., Dale J.M., Hayashizaki Y., Hsuan V.W., Ishida J., Jones T.,
RA   Kamiya A., Karlin-Neumann G., Kawai J., Lam B., Lee J.M., Lin J.,
RA   Miranda M., Narusaka M., Nguyen M., Onodera C.S., Palm C.J., Quach H.L.,
RA   Sakurai T., Satou M., Seki M., Southwick A., Tang C.C., Toriumi M.,
RA   Wong C., Wu H.C., Yamada K., Yu G., Yuan S., Shinozaki K., Davis R.W.,
RA   Theologis A., Ecker J.R.;
RT   ;
RL   Submitted (18-MAR-2003) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; 1941d9592c12a7786651f721c54100f6.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA') :  Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P.,  Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members constructed and
CC   sequenced the pUNI (ORF) clones using the RAFL cDNAs: Cheuk,R.,
CC   Chen,H., Kim,C.J., Shinn,P., Bowser,L., Chan, M.M., Chang,C.M.,
CC   Dale,J.M., Hsuan,V.W., Jones,T., Karlin-Neumann,G., Lam,B.,
CC   Lee,J.M., Lin,J., Miranda,M., Nguyen,M., Onodera, C.S., Palm,C.J.,
CC   Quach,H.L., Southwick,A., Tang,C.C., Toriumi,M., Wong,C., Wu,H.C.,
CC   Yamada,K., Yu,G., Yuan,S., Davis,R.W.,  Theologis,A., and
CC   Ecker,J.R.
CC   Cheuk,R. (SSP/Salk) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Ecker,J.R. (SSP/Salk)
CC   contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..360
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /mol_type="mRNA"
FT                   /clone="U23566"
FT                   /note="This clone is in pUNI 51 ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..360
FT                   /codon_start=1
FT                   /product="At4g26230"
FT                   /note="putative ribosomal protein"
FT                   /db_xref="GOA:Q9STR1"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR020052"
FT                   /db_xref="InterPro:IPR023621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STR1"
FT                   /protein_id="AAO64776.1"
FT                   /translation="MSEKKGRKEEVVTREYTINLHRRLHSCTFKKKAPKAIKEIRKFAE
FT                   KEMGTKDVRVDVKLNKQIWSKGIRGPPRRIRVRVARKRNDDEDAKEEFFSLVTVAEIPA
FT                   EGLSGLGTKIIEEED"
XX
SQ   Sequence 360 BP; 120 A; 59 C; 106 G; 75 T; 0 other;
     atgtcggaga agaagggaag gaaagaggag gtggtgacca gagagtacac catcaacctt        60
     cacagacgcc ttcatagctg tacctttaag aagaaggctc caaaggcgat caaggagata       120
     aggaagtttg ctgagaagga aatggggaca aaggatgtga gagtggatgt taaattgaac       180
     aagcagattt ggagcaaagg tatcagaggt cctccgagga gaatcagagt ccgagttgct       240
     cgtaagagaa atgatgatga agatgcaaag gaagagttct tctctcttgt cactgttgct       300
     gaaatccctg ctgaaggact ctctggcctc ggcactaaga tcattgaaga agaggattaa       360
//

If you have problems or comments...

PBIL Back to PBIL home page