(data stored in ACNUC13479 zone)

EMBL: BT006455

ID   BT006455; SV 1; linear; mRNA; STD; PLN; 1779 BP.
XX
AC   BT006455;
XX
DT   26-APR-2003 (Rel. 75, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana At5g01330 gene, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1779
RA   Cheuk R., Chen H., Kim C.J., Shinn P., Bowser L., Carninci P., Dale J.M.,
RA   Hayashizaki Y., Hsuan V.W., Ishida J., Jones T., Kamiya A.,
RA   Karlin-Neumann G., Kawai J., Lam B., Lin J., Miranda M., Narusaka M.,
RA   Nguyen M., Onodera C.S., Palm C.J., Quach H.L., Sakurai T., Satou M.,
RA   Seki M., Southwick A., Toriumi M., Wong C., Wu H.C., Yamada K., Yu G.,
RA   Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   "Arabidopsis ORF clones";
RL   Unpublished.
XX
RN   [2]
RP   1-1779
RA   Cheuk R., Chen H., Kim C.J., Shinn P., Bowser L., Carninci P., Dale J.M.,
RA   Hayashizaki Y., Hsuan V.W., Ishida J., Jones T., Kamiya A.,
RA   Karlin-Neumann G., Kawai J., Lam B., Lin J., Miranda M., Narusaka M.,
RA   Nguyen M., Onodera C.S., Palm C.J., Quach H.L., Sakurai T., Satou M.,
RA   Seki M., Southwick A., Toriumi M., Wong C., Wu H.C., Yamada K., Yu G.,
RA   Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   ;
RL   Submitted (25-APR-2003) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; 25a5b07f76ffa05370bec9eea04c4ad9.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA') :  Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P.,  Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members constructed and
CC   sequenced the pUNI (ORF) clones using the RAFL cDNAs: Cheuk,R.,
CC   Chen,H., Kim,C.J., Shinn,P., Bowser,L., Chan, M.M., Chang,C.M.,
CC   Dale,J.M., Hsuan,V.W., Jones,T., Karlin-Neumann,G., Lam,B.,
CC   Lee,J.M., Lin,J., Miranda,M., Nguyen,M., Onodera, C.S., Palm,C.J.,
CC   Quach,H.L., Southwick,A., Tang,C.C., Toriumi,M., Wong,C., Wu,H.C.,
CC   Yamada,K., Yu,G., Yuan,S., Davis,R.W.,  Theologis,A., and
CC   Ecker,J.R.
CC   Cheuk,R. (SSP/Salk) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Ecker,J.R. (SSP/Salk)
CC   contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1779
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /mol_type="mRNA"
FT                   /clone="U22953"
FT                   /note="This clone is in pUNI 51 ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..1779
FT                   /codon_start=1
FT                   /product="At5g01330"
FT                   /note="pyruvate decarboxylase-like protein"
FT                   /db_xref="GOA:Q9M039"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M039"
FT                   /protein_id="AAP21263.1"
FT                   /translation="MDVRSLPSNGVATIQDSAPTAATILGSSAATLGRHLSRRLVQAGV
FT                   TDIFTVPGDFNLSLLDQLIANPELNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGG
FT                   LSVLNAIAGAYSENLPVICIVGGPNSNDFGTNRILHHTIGLPDFSQELRCFQTVTCYQA
FT                   VVNHLEDAHEQIDKAIATALRESKPVYISISCNLAAIPHPTFASYPVPFDLTPRLSNKD
FT                   CLEAAVEATLEFLNKAVKPVMVGGPKLRVAKARDAFVELADASGYPVAVMPSAKGFVPE
FT                   NHPHFIGTYWGAVSTLFCSEIVESADAYIFAGPIFNDYSSVGYSLLLKKEKAIIVHPDS
FT                   VVVANGPTFGCVRMSEFFRELAKRVKPNKTAYENYHRIFVPEGKPLKCKPREPLRINAM
FT                   FQHIQKMLSNETAVIAETGDSWFNCQKLKLPKGCGYEFQMQYGSIGWSVGATLGYAQAT
FT                   PEKRVLSFIGDGSFQVTAQDVSTMIRNGQKTIIFLINNGGYTIEVEIHDGPYNVIKNWN
FT                   YTGLVDAIHNGEGKCWTTKVRYEEELVEAINTATLEKKDSLCFIEVIVHKDDTSKELLE
FT                   WGSRVSAANGRPPNPQ"
XX
SQ   Sequence 1779 BP; 447 A; 421 C; 439 G; 472 T; 0 other;
     atggacgtcc gaagtctacc aagcaacggc gtcgcaacaa tccaagactc cgctcccacc        60
     gccgcaacca tactcggctc ctctgcagcg actcttggac gtcacttatc ccgccgtctt       120
     gtccaagccg gagtcaccga cattttcact gttcccggtg atttcaacct atctctgctt       180
     gaccagctca tcgccaaccc ggagctcaac aacatcgggt gctgtaacga gctaaacgcc       240
     ggttacgccg ccgatggata cgctcgatct cgtggagtcg gtgcttgcgt cgtgactttc       300
     accgttggtg gactcagcgt tttgaacgct atcgctggtg cgtacagtga gaacctacca       360
     gttatatgta tcgttggagg tcctaactcc aacgattttg gcactaaccg gattcttcat       420
     cacaccattg gtttacctga ttttagccaa gagcttaggt gtttccaaac tgttacttgc       480
     tatcaggctg tggtgaacca tttagaggat gctcatgaac agatcgacaa ggcgatagca       540
     acagctctga gagagagcaa gcctgtgtac attagcatca gctgtaactt agctgccatt       600
     cctcatccta catttgctag ttatcctgtc ccttttgacc taactccaag gttgagcaac       660
     aaggattgtt tagaagctgc cgtggaagca acattggagt ttctaaacaa ggccgtgaag       720
     cccgttatgg tcggtggtcc caagttgcgt gtggctaaag ctagggatgc ctttgtggag       780
     ctagctgatg cttcaggcta ccccgtggca gtgatgccat ctgccaaagg ctttgtccca       840
     gagaaccatc ctcatttcat tggcacttac tggggagcag tgagcactct tttctgctct       900
     gagattgtcg agtccgcgga tgcttacatc ttcgcaggtc caatcttcaa cgactacagc       960
     tccgttggtt actcacttct cctcaagaaa gaaaaagcca tcattgtgca tcctgatagt      1020
     gtcgttgtgg ctaatggtcc tacctttggt tgcgttcgga tgagcgaatt cttcagggag      1080
     ttggctaaga gggtgaaacc taacaagacg gcttatgaga actaccatag aatctttgtc      1140
     cctgaaggta agcctttgaa atgcaaacca agagagcctt tgagaatcaa cgcaatgttc      1200
     caacacattc agaagatgct ctctaatgaa accgctgtga ttgctgaaac tggtgattct      1260
     tggttcaatt gtcagaaact taagctgcct aaaggatgtg ggtacgagtt tcaaatgcag      1320
     tatggatcaa ttggttggtc tgttggtgcg actctaggat acgctcaagc aacaccggag      1380
     aagagagtgt tgtctttcat tggagacgga agtttccaag tgacggctca ggacgtttcc      1440
     acaatgattc gtaacggaca gaagaccatc atcttcctga tcaacaacgg tggctacacc      1500
     attgaagttg agattcatga tggtccttac aatgtgatca agaattggaa ctacactggt      1560
     cttgtcgatg ctattcataa tggtgaaggc aaatgctgga ccacaaaggt gagatacgag      1620
     gaggagttag tggaagcgat taacacggcg acattggaga agaaagatag tctttgtttc      1680
     attgaagtga ttgttcacaa ggatgatacg agcaaagagt tgcttgagtg gggctctcgc      1740
     gtctcagctg ctaatggtcg tcctcccaat cctcagtag                             1779
//

If you have problems or comments...

PBIL Back to PBIL home page