(data stored in ACNUC8465 zone)

EMBL: BT006481

ID   BT006481; SV 1; linear; mRNA; STD; PLN; 1563 BP.
XX
AC   BT006481;
XX
DT   26-APR-2003 (Rel. 75, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Arabidopsis thaliana At5g40440 gene, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1563
RA   Cheuk R., Chen H., Kim C.J., Shinn P., Bowser L., Carninci P., Dale J.M.,
RA   Hayashizaki Y., Hsuan V.W., Ishida J., Jones T., Kamiya A.,
RA   Karlin-Neumann G., Kawai J., Lam B., Lin J., Miranda M., Narusaka M.,
RA   Nguyen M., Onodera C.S., Palm C.J., Quach H.L., Sakurai T., Satou M.,
RA   Seki M., Southwick A., Toriumi M., Wong C., Wu H.C., Yamada K., Yu G.,
RA   Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   "Arabidopsis ORF clones";
RL   Unpublished.
XX
RN   [2]
RP   1-1563
RA   Cheuk R., Chen H., Kim C.J., Shinn P., Bowser L., Carninci P., Dale J.M.,
RA   Hayashizaki Y., Hsuan V.W., Ishida J., Jones T., Kamiya A.,
RA   Karlin-Neumann G., Kawai J., Lam B., Lin J., Miranda M., Narusaka M.,
RA   Nguyen M., Onodera C.S., Palm C.J., Quach H.L., Sakurai T., Satou M.,
RA   Seki M., Southwick A., Toriumi M., Wong C., Wu H.C., Yamada K., Yu G.,
RA   Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   ;
RL   Submitted (25-APR-2003) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; 8cc81a2e611836b73f8b236a41c9d58a.
XX
CC   The discrepancy does not affect the protein sequence.
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA') :  Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P.,  Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members constructed and
CC   sequenced the pUNI (ORF) clones using the RAFL cDNAs: Cheuk,R.,
CC   Chen,H., Kim,C.J., Shinn,P., Bowser,L., Chan, M.M., Chang,C.M.,
CC   Dale,J.M., Hsuan,V.W., Jones,T., Karlin-Neumann,G., Lam,B.,
CC   Lee,J.M., Lin,J., Miranda,M., Nguyen,M., Onodera, C.S., Palm,C.J.,
CC   Quach,H.L., Southwick,A., Tang,C.C., Toriumi,M., Wong,C., Wu,H.C.,
CC   Yamada,K., Yu,G., Yuan,S., Davis,R.W.,  Theologis,A., and
CC   Ecker,J.R.
CC   Cheuk,R. (SSP/Salk) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Ecker,J.R. (SSP/Salk)
CC   contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1563
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /mol_type="mRNA"
FT                   /clone="U60021"
FT                   /note="This clone is in pUNI 51 ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..1563
FT                   /codon_start=1
FT                   /product="At5g40440"
FT                   /note="putative MAP kinase kinase 3 ATMKK3"
FT                   /db_xref="GOA:O80396"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/Swiss-Prot:O80396"
FT                   /protein_id="AAP21289.1"
FT                   /translation="MAALEELKKKLSPLFDAEKGFSSSSSLDPNDSYLLSDGGTVNLLS
FT                   RSYGVYNFNELGLQKCTSSHVDESESSETTYQCASHEMRVFGAIGSGASSVVQRAIHIP
FT                   NHRILALKKINIFEREKRQQLLTEIRTLCEAPCHEGLVDFHGAFYSPDSGQISIALEYM
FT                   NGGSLADILKVTKKIPEPVLSSLFHKLLQGLSYLHGVRHLVHRDIKPANLLINLKGEPK
FT                   ITDFGISAGLENSMAMCATFVGTVTYMSPERIRNDSYSYPADIWSLGLALFECGTGEFP
FT                   YIANEGPVNLMLQILDDPSPTPPKQEFSPEFCSFIDACLQKDPDARPTADQLLSHPFIT
FT                   KHEKERVDLATFVQSIFDPTQRLKDLADMLTIHYYSLFDGFDDLWHHAKSLYTETSVFS
FT                   FSGKHNTGSTEIFSALSDIRNTLTGDLPSEKLVHVVEKLHCKPCGSGGVIIRAVGSFIV
FT                   GNQFLICGDGVQAEGLPSFKDLGFDVASRRVGRFQEQFVVESGDLIGKYFLAKQELYIT
FT                   NLD"
FT   misc_difference 12
FT                   /replace="g"
FT                   /note="compared to genome"
XX
SQ   Sequence 1563 BP; 443 A; 287 C; 346 G; 487 T; 0 other;
     atggcggcat tagaggagct aaagaagaag ctgtctccat tgtttgatgc tgagaagggt        60
     ttttcttcat cttcatcttt ggatccaaac gattcatatt tattatctga tggtgggact       120
     gtgaatttac ttagtagatc atatggagtt tataatttta acgagctcgg gttacaaaaa       180
     tgtacatctt ctcatgtgga tgagtctgaa agttccgaga cgacgtatca atgtgcttct       240
     cacgaaatgc gggtttttgg agctatagga agcggagcta gcagcgttgt tcaacgagct       300
     attcatatcc ctaatcatag aattttagcg ttgaagaaga ttaatatctt tgaaagggag       360
     aaaaggcagc aattgcttac agagatacgg acattgtgtg aagctccttg tcatgaagga       420
     cttgtggatt ttcacggagc gttttatagt ccagactcgg gacaaatcag catagctctt       480
     gaatatatga atggaggatc tcttgctgat attttaaaag taacaaagaa gatacctgag       540
     ccggttcttt catcattgtt ccacaaactt ttgcaaggat tgagctactt gcatggagtg       600
     agacatcttg ttcatagaga cattaaacct gctaatttgc ttataaatct caaaggggaa       660
     ccgaagataa ccgattttgg cataagtgct ggccttgaga attcaatggc tatgtgtgct       720
     acttttgttg gaactgtcac ctacatgtca ccagagagga taaggaatga cagttattct       780
     tatccagctg atatatggag ccttggtctc gctctttttg aatgcggcac tggagagttt       840
     ccgtatatag ctaatgaagg gcctgttaat cttatgttgc agatattgga tgatccttca       900
     ccaacaccac caaaacaaga attctcacca gagttctgtt ccttcattga tgcttgcctc       960
     cagaaggatc cagatgctcg accaacagct gaccagctct tgtcacaccc ttttattaca      1020
     aaacacgaga aggaaagagt agatttggcg acttttgttc aaagcatctt tgatccaact      1080
     cagagattga aagatttagc tgatatgctc accatacatt attactccct ctttgatgga      1140
     tttgatgatc tttggcacca cgcaaaatcg ctctacactg aaacttcagt tttcagtttc      1200
     tctgggaaac ataacacagg atcaactgaa atcttctcag cattatcaga cattcgtaac      1260
     acattaacag gagatttacc gagtgagaaa cttgttcatg tcgttgagaa gcttcattgc      1320
     aaaccttgcg gcagtggtgg agtcataatt cgtgctgttg gatcgtttat tgttggaaat      1380
     cagtttctga tctgtggtga tggagtccaa gcagaagggc ttccgagttt caaagatctt      1440
     ggcttcgatg tcgcaagtag acgtgttggc cgatttcaag aacagtttgt tgttgaatct      1500
     ggtgatctta ttggaaagta ttttcttgct aagcaagagc tttatattac aaacttagat      1560
     tag                                                                    1563
//

If you have problems or comments...

PBIL Back to PBIL home page