(data stored in ACNUC1829 zone)

EMBL: BT006776

ID   BT006776; SV 1; linear; mRNA; STD; HUM; 717 BP.
XX
AC   BT006776;
XX
DT   15-MAY-2003 (Rel. 75, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens transmembrane 4 superfamily member 7 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-717
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   "Cloning of human full-length CDSs in BD Creator(TM) System Donor vector";
RL   Unpublished.
XX
RN   [2]
RP   1-717
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   ;
RL   Submitted (13-MAY-2003) to the INSDC.
RL   BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA
XX
DR   MD5; 92c8c0cd4861cd33ec00949048fc10cb.
DR   Ensembl-Gn; ENSG00000214063; homo_sapiens.
DR   Ensembl-Tr; ENST00000397397; homo_sapiens.
DR   Ensembl-Tr; ENST00000397404; homo_sapiens.
DR   Ensembl-Tr; ENST00000397406; homo_sapiens.
DR   Ensembl-Tr; ENST00000397408; homo_sapiens.
DR   Ensembl-Tr; ENST00000397411; homo_sapiens.
DR   Ensembl-Tr; ENST00000409543; homo_sapiens.
XX
CC   This CDS clone is a part of a collection of human full length
CC   expression clones generated by BD Biosciences Clontech and the
CC   Harvard Institute of Proteomics. Each CDS has been cloned in two
CC   forms: with and without stop-codon (to allow fusion with C-terminal
CC   tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
CC   cloning system between the SalI  and HindIII sites of the pDNR-DUAL
CC   vector. Additional sequences in the clone:  'ACC' after SalI site
CC   and before 'ATG' to provide Kozak consensus sequence; 'GG' after
CC   last codon and before HindIII site to maintain reading frame.
CC   Clone distribution: http://bioinfo.clontech.com/orfclones.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..717
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH5alpha T1 resistant"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BD Creator(TM) CDS Library derived from MGC
FT                   collection"
FT                   /clone="GH00554X1.0"
FT                   /note="Vector: pDNR-Dual"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..717
FT                   /codon_start=1
FT                   /product="transmembrane 4 superfamily member 7"
FT                   /db_xref="GOA:O14817"
FT                   /db_xref="H-InvDB:HIT000099696.12"
FT                   /db_xref="HGNC:HGNC:11859"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:O14817"
FT                   /protein_id="AAP35422.1"
FT                   /translation="MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLS
FT                   SSFPSLSAANLLIITGAFVMAIGFVGCLGAIKENKCLLLTFFLLLLLVFLLEATIAILF
FT                   FAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNAT
FT                   RVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQENLLAVGIFGLCTALVQILGLTF
FT                   AMTMYCQVVKADTYCA"
XX
SQ   Sequence 717 BP; 115 A; 230 C; 213 G; 159 T; 0 other;
     atggcgcgcg cctgcctcca ggccgtcaag tacctcatgt tcgccttcaa cctgctcttc        60
     tggctgggag gctgtggcgt gctgggtgtc ggcatctggc tggccgccac acaggggagc       120
     ttcgccacgc tgtcctcttc cttcccgtcc ctgtcggctg ccaacctgct catcatcacc       180
     ggcgcctttg tcatggccat cggcttcgtg ggctgcctgg gtgccatcaa ggagaacaag       240
     tgcctcctgc tcactttctt cctgctgctg ctgctggtgt tcctgctgga ggccaccatc       300
     gccatcctct tcttcgccta cacggacaag attgacaggt atgcccagca agacctgaag       360
     aaaggcttgc acctgtacgg cacgcagggc aacgtgggcc tcaccaacgc ctggagcatc       420
     atccagaccg acttccgctg ctgtggcgtc tccaactaca ctgactggtt cgaggtgtac       480
     aacgccacgc gggtacctga ctcctgctgc ttggagttca gtgagagctg tgggctgcac       540
     gcccccggca cctggtggaa ggcgccgtgc tacgagacgg tgaaggtgtg gcttcaggag       600
     aacctgctgg ctgtgggcat ctttgggctg tgcacggcgc tggtgcagat cctgggcctg       660
     accttcgcca tgaccatgta ctgccaagtg gtcaaggcag acacctactg cgcgtag          717
//

If you have problems or comments...

PBIL Back to PBIL home page