(data stored in ACNUC31108 zone)

EMBL: BT007073

ID   BT007073; SV 1; linear; mRNA; STD; HUM; 717 BP.
XX
AC   BT007073;
XX
DT   15-MAY-2003 (Rel. 75, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens CD63 antigen (melanoma 1 antigen) mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-717
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   "Cloning of human full-length CDSs in BD Creator(TM) System Donor vector";
RL   Unpublished.
XX
RN   [2]
RP   1-717
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   ;
RL   Submitted (13-MAY-2003) to the INSDC.
RL   BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA
XX
DR   MD5; a0abc4146de16880e14009b7cde01cc8.
DR   Ensembl-Gn; ENSG00000135404; homo_sapiens.
DR   Ensembl-Tr; ENST00000257857; homo_sapiens.
DR   Ensembl-Tr; ENST00000420846; homo_sapiens.
DR   Ensembl-Tr; ENST00000546939; homo_sapiens.
DR   Ensembl-Tr; ENST00000549117; homo_sapiens.
DR   Ensembl-Tr; ENST00000550776; homo_sapiens.
DR   Ensembl-Tr; ENST00000552692; homo_sapiens.
DR   Ensembl-Tr; ENST00000552754; homo_sapiens.
XX
CC   This CDS clone is a part of a collection of human full length
CC   expression clones generated by BD Biosciences Clontech and the
CC   Harvard Institute of Proteomics. Each CDS has been cloned in two
CC   forms: with and without stop-codon (to allow fusion with C-terminal
CC   tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
CC   cloning system between the SalI  and HindIII sites of the pDNR-DUAL
CC   vector. Additional sequences in the clone:  'ACC' after SalI site
CC   and before 'ATG' to provide Kozak consensus sequence; 'GG' after
CC   last codon and before HindIII site to maintain reading frame.
CC   Clone distribution: http://bioinfo.clontech.com/orfclones.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..717
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH5alpha T1 resistant"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BD Creator(TM) CDS Library derived from MGC
FT                   collection"
FT                   /clone="GH00682X1.0"
FT                   /note="Vector: pDNR-Dual"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..717
FT                   /codon_start=1
FT                   /product="CD63 antigen (melanoma 1 antigen)"
FT                   /db_xref="GOA:P08962"
FT                   /db_xref="H-InvDB:HIT000099993.12"
FT                   /db_xref="HGNC:HGNC:1692"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="InterPro:IPR042028"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08962"
FT                   /protein_id="AAP35736.1"
FT                   /translation="MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQ
FT                   GATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAG
FT                   YVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKN
FT                   RVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIV
FT                   FACCLVKSIRSGYEVM"
XX
SQ   Sequence 717 BP; 148 A; 149 C; 221 G; 199 T; 0 other;
     atggcggtgg aaggaggaat gaaatgtgtg aagttcttgc tctacgtcct cctgctggcc        60
     ttttgcgcct gtgcagtggg actgattgcc gtgggtgtcg gggcacagct tgtcctgagt       120
     cagaccataa tccagggggc tacccctggc tctctgttgc cagtggtcat catcgcagtg       180
     ggtgtcttcc tcttcctggt ggcttttgtg ggctgctgcg gggcctgcaa ggagaactat       240
     tgtcttatga tcacgtttgc catctttctg tctcttatca tgttggtgga ggtggccgca       300
     gccattgctg gctatgtgtt tagagataag gtgatgtcag agtttaataa caacttccgg       360
     cagcagatgg agaattaccc gaaaaacaac cacactgctt cgatcctgga caggatgcag       420
     gcagatttta agtgctgtgg ggctgctaac tacacagatt gggagaaaat cccttccatg       480
     tcgaagaacc gagtccccga ctcctgctgc attaatgtta ctgtgggctg tgggattaat       540
     ttcaacgaga aggcgatcca taaggagggc tgtgtggaga agattggggg ctggctgagg       600
     aaaaatgtgc tggtggtagc tgcagcagcc cttggaattg cttttgtcga ggttttggga       660
     attgtctttg cctgctgcct cgtgaagagt atcagaagtg gctacgaggt gatgtag          717
//

If you have problems or comments...

PBIL Back to PBIL home page