(data stored in ACNUC16935 zone)

EMBL: BT007297

ID   BT007297; SV 1; linear; mRNA; STD; HUM; 498 BP.
XX
AC   BT007297;
XX
DT   15-MAY-2003 (Rel. 75, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Homo sapiens interferon, alpha-inducible protein (clone IFI-15K) mRNA,
DE   complete cds.
XX
KW   FLI_CDNA.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-498
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   "Cloning of human full-length CDSs in BD Creator(TM) System Donor vector";
RL   Unpublished.
XX
RN   [2]
RP   1-498
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   ;
RL   Submitted (13-MAY-2003) to the INSDC.
RL   BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA
XX
DR   MD5; 4e2a3389d8c906fc42863ab4cd20277d.
DR   Ensembl-Gn; ENSG00000187608; homo_sapiens.
DR   Ensembl-Tr; ENST00000379389; homo_sapiens.
XX
CC   This CDS clone is a part of a collection of human full length
CC   expression clones generated by BD Biosciences Clontech and the
CC   Harvard Institute of Proteomics. Each CDS has been cloned in two
CC   forms: with and without stop-codon (to allow fusion with C-terminal
CC   tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
CC   cloning system between the SalI  and HindIII sites of the pDNR-DUAL
CC   vector. Additional sequences in the clone:  'ACC' after SalI site
CC   and before 'ATG' to provide Kozak consensus sequence; 'GG' after
CC   last codon and before HindIII site to maintain reading frame.
CC   Clone distribution: http://bioinfo.clontech.com/orfclones.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..498
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH5alpha T1 resistant"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BD Creator(TM) CDS Library derived from MGC
FT                   collection"
FT                   /clone="GH00877X1.0"
FT                   /note="Vector: pDNR-Dual"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..498
FT                   /codon_start=1
FT                   /product="interferon, alpha-inducible protein (clone
FT                   IFI-15K)"
FT                   /db_xref="GOA:P05161"
FT                   /db_xref="H-InvDB:HIT000100217.13"
FT                   /db_xref="HGNC:HGNC:4053"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="PDB:1Z2M"
FT                   /db_xref="PDB:2HJ8"
FT                   /db_xref="PDB:3PHX"
FT                   /db_xref="PDB:3PSE"
FT                   /db_xref="PDB:3R66"
FT                   /db_xref="PDB:3RT3"
FT                   /db_xref="PDB:3SDL"
FT                   /db_xref="PDB:5TL6"
FT                   /db_xref="PDB:5W8T"
FT                   /db_xref="PDB:5W8U"
FT                   /db_xref="PDB:6BI8"
FT                   /db_xref="PDB:6FFA"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05161"
FT                   /protein_id="AAP35961.1"
FT                   /translation="MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRL
FT                   AVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTV
FT                   AHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGG
FT                   RS"
XX
SQ   Sequence 498 BP; 95 A; 147 C; 180 G; 76 T; 0 other;
     atgggctggg acctgacggt gaagatgctg gcgggcaacg aattccaggt gtccctgagc        60
     agctccatgt cggtgtcaga gctgaaggcg cagatcaccc agaagatcgg cgtgcacgcc       120
     ttccagcagc gtctggctgt ccacccgagc ggtgtggcgc tgcaggacag ggtccccctt       180
     gccagccagg gcctgggccc cggcagcacg gtcctgctgg tggtggacaa atgcgacgaa       240
     cctctgaaca tcctggtgag gaataacaag ggccgcagca gcacctacga ggtgcggctg       300
     acgcagaccg tggcccacct gaagcagcaa gtgagcgggc tggagggtgt gcaggacgac       360
     ctgttctggc tgaccttcga ggggaagccc ctggaggacc agctcccgct gggggagtac       420
     ggcctcaagc ccctgagcac cgtgttcatg aatctgcgcc tgcggggagg cggcacagag       480
     cctggcgggc ggagctag                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page