(data stored in ACNUC1829 zone)

EMBL: BT007397

ID   BT007397; SV 1; linear; mRNA; STD; HUM; 762 BP.
XX
AC   BT007397;
XX
DT   15-MAY-2003 (Rel. 75, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens CD151 antigen mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-762
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   "Cloning of human full-length CDSs in BD Creator(TM) System Donor vector";
RL   Unpublished.
XX
RN   [2]
RP   1-762
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   ;
RL   Submitted (13-MAY-2003) to the INSDC.
RL   BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA
XX
DR   MD5; 26c058f4dc4aecdee9cc0ccf1bd9f471.
DR   Ensembl-Gn; ENSG00000177697; homo_sapiens.
DR   Ensembl-Tr; ENST00000322008; homo_sapiens.
DR   Ensembl-Tr; ENST00000397420; homo_sapiens.
DR   Ensembl-Tr; ENST00000397421; homo_sapiens.
DR   Ensembl-Tr; ENST00000530726; homo_sapiens.
XX
CC   This CDS clone is a part of a collection of human full length
CC   expression clones generated by BD Biosciences Clontech and the
CC   Harvard Institute of Proteomics. Each CDS has been cloned in two
CC   forms: with and without stop-codon (to allow fusion with C-terminal
CC   tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
CC   cloning system between the SalI  and HindIII sites of the pDNR-DUAL
CC   vector. Additional sequences in the clone:  'ACC' after SalI site
CC   and before 'ATG' to provide Kozak consensus sequence; 'GG' after
CC   last codon and before HindIII site to maintain reading frame.
CC   Clone distribution: http://bioinfo.clontech.com/orfclones.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..762
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH5alpha T1 resistant"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BD Creator(TM) CDS Library derived from MGC
FT                   collection"
FT                   /clone="GH00987X1.0"
FT                   /note="Vector: pDNR-Dual"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..762
FT                   /codon_start=1
FT                   /product="CD151 antigen"
FT                   /db_xref="GOA:P48509"
FT                   /db_xref="H-InvDB:HIT000100317.12"
FT                   /db_xref="HGNC:HGNC:1630"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48509"
FT                   /protein_id="AAP36061.1"
FT                   /translation="MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALK
FT                   SDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLE
FT                   IIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQD
FT                   WRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRV
FT                   IGAVGIGIACVQVFGMIFTCCLYRSLKLEHY"
XX
SQ   Sequence 762 BP; 152 A; 217 C; 230 G; 163 T; 0 other;
     atgggtgagt tcaacgagaa gaagacaaca tgtggcaccg tttgcctcaa gtacctgctg        60
     tttacctaca attgctgctt ctggctggct ggcctggctg tcatggcagt gggcatctgg       120
     acgctggccc tcaagagtga ctacatcagc ctgctggcct caggcaccta cctggccaca       180
     gcctacatcc tggtggtggc gggcactgtc gtcatggtga ctggggtctt gggctgctgc       240
     gccaccttca aggagcgtcg gaacctgctg cgcctgtact tcatcctgct cctcatcatc       300
     tttctgctgg agatcatcgc tggtatcctc gcctacgcct actaccagca gctgaacacg       360
     gagctcaagg agaacctgaa ggacaccatg accaagcgct accaccagcc gggccatgag       420
     gctgtgacca gcgctgtgga ccagctgcag caggagttcc actgctgtgg cagcaacaac       480
     tcacaggact ggcgagacag tgagtggatc cgctcacagg aggccggtgg ccgtgtggtc       540
     ccagacagct gctgcaagac ggtggtggct ctttgtggac agcgagacca tgcctccaac       600
     atctacaagg tggagggcgg ctgcatcacc aagttggaga ccttcatcca ggagcacctg       660
     agggtcattg gggctgtggg gatcggcatt gcctgtgtgc aggtctttgg catgatcttc       720
     acgtgctgcc tgtacaggag tctcaagctg gagcactact ag                          762
//

If you have problems or comments...

PBIL Back to PBIL home page