(data stored in ACNUC4305 zone)

EMBL: BT007430

ID   BT007430; SV 1; linear; mRNA; STD; HUM; 609 BP.
XX
AC   BT007430;
XX
DT   15-MAY-2003 (Rel. 75, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens transmembrane 4 superfamily member 4 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-609
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   "Cloning of human full-length CDSs in BD Creator(TM) System Donor vector";
RL   Unpublished.
XX
RN   [2]
RP   1-609
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   ;
RL   Submitted (13-MAY-2003) to the INSDC.
RL   BD Biosciences Clontech, 1020 East Meadow Circle, Palo Alto, CA 94303, USA
XX
DR   MD5; 73c04878eb1311122655608b971575eb.
DR   Ensembl-Gn; ENSG00000169903; homo_sapiens.
DR   Ensembl-Tr; ENST00000305354; homo_sapiens.
XX
CC   This CDS clone is a part of a collection of human full length
CC   expression clones generated by BD Biosciences Clontech and the
CC   Harvard Institute of Proteomics. Each CDS has been cloned in two
CC   forms: with and without stop-codon (to allow fusion with C-terminal
CC   tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
CC   cloning system between the SalI  and HindIII sites of the pDNR-DUAL
CC   vector. Additional sequences in the clone:  'ACC' after SalI site
CC   and before 'ATG' to provide Kozak consensus sequence; 'GG' after
CC   last codon and before HindIII site to maintain reading frame.
CC   Clone distribution: http://bioinfo.clontech.com/orfclones.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..609
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH5alpha T1 resistant"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BD Creator(TM) CDS Library derived from MGC
FT                   collection"
FT                   /clone="GH00004X1.0"
FT                   /note="Vector: pDNR-Dual"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..609
FT                   /codon_start=1
FT                   /product="transmembrane 4 superfamily member 4"
FT                   /db_xref="GOA:P48230"
FT                   /db_xref="H-InvDB:HIT000100350.11"
FT                   /db_xref="HGNC:HGNC:11856"
FT                   /db_xref="InterPro:IPR008661"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48230"
FT                   /protein_id="AAP36098.1"
FT                   /translation="MCTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQE
FT                   IWFFGGILGSGVLMIFPALVFLGLKNNDCCGCCGNEGCGKRFAMFTSTIFAVVGFLGAG
FT                   YSFIISAISINKGPKCLMANSTWGYPFHDGDYLNDEALWNKCREPLNVVPWNLTLFSIL
FT                   LVVGGIQMVLCAIQVVNGLLGTLCGDCQCCGCCGGDGPV"
XX
SQ   Sequence 609 BP; 116 A; 145 C; 176 G; 172 T; 0 other;
     atgtgcactg ggggctgtgc cagatgcctg ggggggaccc tcattcccct tgcttttttt        60
     ggcttcctgg ctaacatcct gttatttttt cctggaggaa aagtgataga tgacaacgac       120
     cacctttccc aagagatctg gtttttcgga ggaatattag gaagcggtgt cttgatgatc       180
     ttccctgcgc tggtgttctt gggcctgaag aacaatgact gctgtgggtg ctgcggcaac       240
     gagggctgtg ggaagcgatt tgcgatgttc acctccacga tatttgctgt ggttggattc       300
     ttgggagctg gatactcgtt tatcatctca gccatttcaa tcaacaaggg tcctaaatgc       360
     ctcatggcca atagtacatg gggctacccc ttccacgacg gggattatct caatgatgag       420
     gccttatgga acaagtgccg agagcctctc aatgtggttc cctggaatct gaccctcttc       480
     tccatcctgc tggtcgtagg aggaatccag atggttctct gcgccatcca ggtggtcaat       540
     ggcctcctgg ggaccctctg tggggactgc cagtgttgtg gctgctgtgg gggagatgga       600
     cccgtttag                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page