(data stored in ACNUC13479 zone)

EMBL: BT014855

ID   BT014855; SV 1; linear; mRNA; STD; PLN; 1677 BP.
XX
AC   BT014855;
XX
DT   06-JUN-2004 (Rel. 80, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana At5g01190 gene, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1677
RA   Cheuk R., Chen H., Kim C.J., Shinn P., Ecker J.R.;
RT   "Arabidopsis ORF clones";
RL   Unpublished.
XX
RN   [2]
RP   1-1677
RA   Cheuk R., Chen H., Kim C.J., Shinn P., Ecker J.R.;
RT   ;
RL   Submitted (05-JUN-2004) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; cc559796456b9868468713b46fb6ee03.
XX
CC   Possible splice variant.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1677
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="U66575"
FT                   /note="This clone is in pUNI 51"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..1677
FT                   /codon_start=1
FT                   /product="At5g01190"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q6ID18"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR017761"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034285"
FT                   /db_xref="InterPro:IPR034288"
FT                   /db_xref="InterPro:IPR034289"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6ID18"
FT                   /protein_id="AAT41838.1"
FT                   /translation="MVFPIRILVLFALLAFPACVHGAIRKYTFNVVTKQVTRICSTKQI
FT                   VTVNGKFPGPTIYANEDDTILVNVVNNVKYNVSIHWHGIRQLRTGWADGPAYITQCPIK
FT                   PGHSYVYNFTVTGQRGTLWWHAHVLWLRATVHGAIVILPKLGLPYPFPKPHREEVIILG
FT                   EWWKSDTETVVNEALKSGLAPNVSDAHVINGHPGFVPNCPSQGNFKLAVESGKTYMLRL
FT                   INAALNEELFFKIAGHRFTVVEVDAVYVKPFNTDTILIAPGQTTTALVSAARPSGQYLI
FT                   AAAPFQDSAVVAVDNRTATATVHYSGTLSATPTKTTSPPPQNATSVANTFVNSLRSLNS
FT                   KTYPANVPITVDHDLLFTVGLGINRCHSCKAGNFSRVVAAINNITFKMPKTALLQAHYF
FT                   NLTGIYTTDFPAKPRRVFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPEN
FT                   HPIHLHGFNFFVVGLGTGNYNSKKDSNKFNLVDPVERNTVGVPSGGWAAIRFRADNPGV
FT                   WFMHCHLEVHTTWGLKMAFLVENGKGPNQSIRPPPSDLPKC"
XX
SQ   Sequence 1677 BP; 460 A; 452 C; 342 G; 423 T; 0 other;
     atggtatttc caattcggat tttggttctt ttcgcattgc tcgccttccc ggcatgcgtc        60
     cacggtgcaa tccgcaagta caccttcaac gtggtaacga aacaagtgac gcggatttgt       120
     tcaacgaaac agatcgttac cgttaacggt aaattcccag gacccacaat ctacgctaat       180
     gaagacgaca caattctcgt taacgtcgtt aacaacgtca agtataacgt ctctatccat       240
     tggcatggga taagacaatt aagaaccggt tgggctgacg gaccggccta cataactcaa       300
     tgtccaatta agccgggtca cagctacgtg tataatttca cggtcacggg tcaacgtggt       360
     acgctctggt ggcacgcaca tgttctctgg ctccgagcta cggttcatgg tgccatcgtg       420
     attctgccta aactgggtct accttacccg ttccctaaac cacatagaga agaagtcatc       480
     atactcggtg agtggtggaa atcagatacc gaaacggtag taaatgaagc attaaaatcc       540
     ggtttagcac caaatgtctc agatgctcac gtcattaacg gtcatcccgg tttcgttcca       600
     aattgtccgt cgcaaggtaa ttttaaatta gcggtagaga gcgggaaaac atacatgcta       660
     cgactaataa acgcagcatt gaacgaagaa ctcttcttca agatcgccgg ccaccgtttc       720
     accgttgtgg aagtcgacgc cgtatatgtc aaacccttca acaccgacac aatcctaatc       780
     gcccccggtc aaaccaccac cgccttagtc tccgccgcac gtccttccgg tcaatatcta       840
     atcgccgctg ctcctttcca agactccgcc gtcgtcgccg tcgataatcg caccgccacc       900
     gctaccgttc attactccgg cacgctctcc gccacaccca ccaaaaccac ttcaccaccg       960
     cctcaaaacg ccacctctgt cgcaaataca ttcgttaatt ccctcagaag tctcaattcc      1020
     aagacatatc cggctaacgt tccgatcacc gttgaccacg atcttctatt caccgttgga      1080
     ttaggaatca accgatgtca cagctgtaaa gccggaaact tctcacgagt cgtcgccgcc      1140
     ataaacaaca ttacattcaa gatgcctaaa acggctctgc ttcaagcgca ttactttaac      1200
     ctaaccggaa tatacacaac cgattttcct gcaaaaccaa gacgggtttt cgattttacc      1260
     ggaaaaccgc cttccaattt agcaaccatg aaggctacaa agctttacaa gcttccatat      1320
     aattcgacgg tgcaagttgt tttgcaagac accggaaatg tagcgccgga gaatcatccg      1380
     attcatctac atggatttaa tttctttgtg gttggtttag gaactggaaa ctataattcc      1440
     aagaaagatt ctaacaagtt taatcttgtt gatccggtgg agagaaatac cgtcggtgta      1500
     ccttccggtg gttgggcggc gatcagattc cgagcagata atccaggggt ttggtttatg      1560
     cattgccatt tagaggtaca tacaacatgg ggactaaaaa tggctttctt ggtggagaat      1620
     ggtaaaggcc ctaaccaatc aattcgtcct cctccaagtg atcttcccaa atgttga         1677
//

If you have problems or comments...

PBIL Back to PBIL home page