(data stored in SCRATCH zone)

EMBL: BT015324

ID   BT015324; SV 1; linear; mRNA; STD; PLN; 1308 BP.
XX
AC   BT015324;
XX
DT   18-AUG-2004 (Rel. 80, Created)
DT   18-AUG-2004 (Rel. 80, Last updated, Version 1)
XX
DE   Arabidopsis thaliana At5g01250 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1308
RA   Shinn P., Chen H., Cheuk R., Kim C.J., Ecker J.R.;
RT   "Arabidopsis cDNA clones";
RL   Unpublished.
XX
RN   [2]
RP   1-1308
RA   Shinn P., Chen H., Cheuk R., Kim C.J., Ecker J.R.;
RT   ;
RL   Submitted (17-AUG-2004) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; 5b88a745745ec7e07655211982ae9358.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1308
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="S67218"
FT                   /note="This clone is in pUNI 51"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        39..1262
FT                   /codon_start=1
FT                   /product="At5g01250"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q9LFB1"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR007652"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFB1"
FT                   /protein_id="AAT99803.1"
FT                   /translation="MDRHDIEKRFTVVIDNRRLNQSGSSSLFTAFAISFVTLIVVTTFT
FT                   LISNFSMQPHRDFSGVKIEIKRVIPHLPLSSEREGERSDLLKQQTQVNEKLQVIEVFSG
FT                   DNLSDKFQKRVNEFVGDGCEVNFVMTWISPADFFGNREVLAIESVFKSHPYGCLMILSA
FT                   TMDSPQGYATLKPFIDRGYKVLAVTPDLPFLLKGTAGELWLDEIKSGKRDPGKISLAQN
FT                   LSNLMRLAYLYKYGGVYLDTDMIVLKSFKGLRNVIGAQTLDPSSTNWTRLNNAVLIFDK
FT                   NHPLLLKFMEEFAKTFNGNIWGYNGPYLVSRVARAVEGSSGYNFTVMRPSVFYSVNWLE
FT                   IKKLFKVPKTEKDSKWVKTKLLHMQRNGYGLHLWNKFSRKYEIEQGSAMWKLVSEHCII
FT                   CEISSVSS"
XX
SQ   Sequence 1308 BP; 402 A; 245 C; 286 G; 375 T; 0 other;
     tggttccaac ttcagaacat ttcagttctg tgtttattat ggatcgtcat gatatagaaa        60
     agagattcac ggtggtgatt gataacagac gactaaacca atcaggatca tcatcacttt       120
     tcaccgcctt cgctatcagc tttgtaactc tgatcgtggt taccacgttt actctaattt       180
     ctaatttctc gatgcaaccg catagagatt tctcaggagt gaagatagag atcaagagag       240
     tgattccaca cttacctctg agttctgaga gagaaggtga aagaagtgat ctgctcaaac       300
     aacagacaca agtaaacgag aagctccaag ttatcgaagt tttcagtgga gataacttgt       360
     ctgacaagtt tcaaaagagg gtaaatgagt ttgtcggtga tggatgcgaa gtcaacttcg       420
     tcatgacatg gatatcacca gcagatttct ttggcaatag agaggtttta gctattgaaa       480
     gtgtctttaa gtctcatccg tatggttgct tgatgatctt atccgcaacc atggattctc       540
     ctcaaggtta tgcaactttg aagccgttta ttgatcgtgg ttacaaagtt cttgcagtca       600
     caccagattt gccttttctg ctcaaaggaa ccgcgggaga gttgtggctc gacgaaataa       660
     agagcggtaa aagagatccc ggaaagattt ctttagctca gaatctctca aatctcatga       720
     ggcttgctta cttgtacaaa tatggaggtg tgtacttaga cacagacatg attgttctaa       780
     aaagcttcaa aggtctgaga aacgtgattg gtgcacaaac acttgatcct tcatcaacga       840
     attggacaag actaaacaac gcggtactaa tattcgacaa gaaccatcct ctgttactca       900
     aattcatgga agagttcgct aaaactttca acggaaacat atggggatac aacggaccat       960
     accttgtttc acgagtggct agagctgtag aaggatcaag tggctataac ttcaccgtca      1020
     tgcgaccatc tgtgttctat tcggtaaact ggctcgagat taagaagttg ttcaaagtgc      1080
     ctaaaacaga gaaagattcg aaatgggtca aaaccaagct tcttcatatg cagaggaatg      1140
     gttatggttt gcatctgtgg aataagttta gcaggaaata cgaaattgaa caaggaagtg      1200
     ccatgtggaa actggtttca gagcattgca taatctgtga aattagttct gtatcatcat      1260
     agtctattgt ttgaatttgt tccattaatc acacacactg tagaggcc                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page