(data stored in ACNUC13479 zone)

EMBL: BT015877

ID   BT015877; SV 1; linear; mRNA; STD; PLN; 989 BP.
XX
AC   BT015877;
XX
DT   08-OCT-2004 (Rel. 81, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Arabidopsis thaliana At5g05670 gene, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-989
RA   Cheuk R., Chen H., Kim C.J., Shinn P., Ecker J.R.;
RT   "Arabidopsis ORF clones";
RL   Unpublished.
XX
RN   [2]
RP   1-989
RA   Cheuk R., Chen H., Kim C.J., Shinn P., Ecker J.R.;
RT   ;
RL   Submitted (07-OCT-2004) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; fb1794567ffb8bb372d8c8b7be0b5ce2.
XX
CC   The discrepancy does not affect the protein sequence.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..989
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="S67059"
FT                   /note="This clone is in pUNI 51"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        86..868
FT                   /codon_start=1
FT                   /product="At5g05670"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q9FFK7"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FFK7"
FT                   /protein_id="AAU95413.1"
FT                   /translation="MENLEDLKILAEQWSHQGIEYLQKIPPNQLYAAIGVLLFTTILLF
FT                   LSIRLVRRTKSNTVLLSGLTGSGKTVLFYQLRDGSSHQGTVTSMEPNEGTFVLHSENTK
FT                   KGKIKPVHLVDVPGHSRLRPKLEEFLPQAAAIVFVVDALEFLPNCRAASEYLYEILTNA
FT                   NVVKKKIPVLLCCNKTDKLTAHTKEFIRKQMEKEIEKLRASRSAVSTADIANDFTIGIE
FT                   GEVFSFTHCSNKVTVAEASGLTGETIQIEDFIREYIKP"
FT   misc_difference 142
FT                   /replace="t"
FT                   /note="compared to genome"
XX
SQ   Sequence 989 BP; 270 A; 225 C; 222 G; 272 T; 0 other;
     gtcaaggcct cgttgtattc gtcttccgcc tcctctccca tcggttttga acagctcggc        60
     agaagaagtg aaacttgaga gagtaatgga gaacttggaa gatctgaaaa ttctggctga       120
     gcagtggtcg catcaaggaa tcgaatatct tcagaagata ccaccgaatc agctgtatgc       180
     cgccattggt gttttgttgt ttacaaccat cttgctcttc ctatccattc gcctggtcag       240
     acgtaccaaa tccaacactg tactcctttc tgggctgacc ggaagtggaa agactgtgct       300
     cttttaccaa ctccgagatg gatcgtcgca tcagggcact gtaacatcaa tggaaccaaa       360
     tgaaggcact tttgttcttc acagtgaaaa tactaagaaa ggaaaaatca agcctgttca       420
     tcttgttgat gttcctgggc actctcggct tcgacccaag ctagaagaat tcttgcccca       480
     agcagctgcc attgtgttcg tagtggatgc cttggagttc ctcccaaact gtcgtgcagc       540
     ttcagagtac ctatacgaga ttctgaccaa tgcgaatgtt gtcaagaaga agattccagt       600
     cctcctttgc tgtaacaaga ccgataaact cactgcacac accaaggagt ttatccggaa       660
     gcaaatggag aaagaaattg agaaactgag ggcttcaagg agtgcagtct ctactgctga       720
     tatagcgaat gacttcacca ttggaattga gggagaagtg ttctccttca cgcattgctc       780
     caacaaagtc actgtcgctg aggcatctgg acttaccgga gaaaccatcc agattgaaga       840
     cttcattcga gaatacatca agccatgagc tccaacatgc cttcatagat tgaatctacc       900
     acaagtttct tatgctttgg gctgtgactt tgatttgagt ttagagatcc ttttgtatat       960
     gagatctttg gatgatttag ggtgttcaa                                         989
//

If you have problems or comments...

PBIL Back to PBIL home page