(data stored in ACNUC8465 zone)

EMBL: BT019547

ID   BT019547; SV 1; linear; mRNA; STD; HUM; 591 BP.
XX
AC   BT019547;
XX
DT   29-OCT-2004 (Rel. 81, Created)
DT   29-OCT-2004 (Rel. 81, Last updated, Version 1)
XX
DE   Homo sapiens ras homolog gene family, member B mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-591
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   "Cloning of human full-length CDSs in BD Creator(TM) System Donor vector";
RL   Unpublished.
XX
RN   [2]
RP   1-591
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   ;
RL   Submitted (28-OCT-2004) to the INSDC.
RL   BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California
RL   94303, USA
XX
DR   MD5; 2ae4a2385019084b6836fbac241fc7cc.
DR   Ensembl-Gn; ENSG00000143878; homo_sapiens.
DR   Ensembl-Tr; ENST00000272233; homo_sapiens.
XX
CC   This CDS clone is a part of a collection of human full length
CC   expression clones generated by BD Biosciences Clontech and the
CC   Harvard Institute of Proteomics. Each CDS has been cloned in two
CC   forms: with and without stop-codon (to allow fusion with C-terminal
CC   tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
CC    cloning system between the SalI  and HindIII sites of the
CC   pDNR-DUAL  vector. Additional sequences in the clone:  'ACC' after
CC   SalI site  and before 'ATG' to provide Kozak consensus sequence;
CC   'GG' after  last codon and before HindIII site to maintain reading
CC   frame.  Clone distribution: http://bioinfo.clontech.com/orfclones.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..591
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH5alpha T1 resistant"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BD Creator(TM) CDS Library derived from MGC
FT                   collection"
FT                   /clone="GH01401X1.1"
FT                   /note="Vector: pDNR-Dual"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..591
FT                   /codon_start=1
FT                   /product="ras homolog gene family, member B"
FT                   /note="Mutations: 590:OK"
FT                   /db_xref="GOA:P62745"
FT                   /db_xref="H-InvDB:HIT000266548.13"
FT                   /db_xref="HGNC:HGNC:668"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="PDB:2FV8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62745"
FT                   /protein_id="AAV38354.1"
FT                   /translation="MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVAD
FT                   IEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVK
FT                   HFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKT
FT                   KEGVREVFETATRAALQKRYGSQNGCINCCKVL"
XX
SQ   Sequence 591 BP; 120 A; 182 C; 194 G; 95 T; 0 other;
     atggcggcca tccgcaagaa gctggtggtg gtgggcgacg gcgcgtgtgg caagacgtgc        60
     ctgctgatcg tgttcagtaa ggacgagttc cccgaggtgt acgtgcccac cgtcttcgag       120
     aactatgtgg ccgacattga ggtggacggc aagcaggtgg agctggcgct gtgggacacg       180
     gcgggccagg aggactacga ccgcctgcgg ccgctctcct acccggacac cgacgtcatt       240
     ctcatgtgct tctcggtgga cagcccggac tcgctggaga acatccccga gaagtgggtc       300
     cccgaggtga agcacttctg tcccaatgtg cccatcatcc tggtggccaa caaaaaagac       360
     ctgcgcagcg acgagcatgt ccgcacagag ctggcccgca tgaagcagga acccgtgcgc       420
     acggatgacg gccgcgccat ggccgtgcgc atccaagcct acgactacct cgagtgctct       480
     gccaagacca aggaaggcgt gcgcgaggtc ttcgagacgg ccacgcgcgc cgcgctgcag       540
     aagcgctacg gctcccagaa cggctgcatc aactgctgca aggtgctata g                591
//

If you have problems or comments...

PBIL Back to PBIL home page