(data stored in ACNUC8465 zone)

EMBL: BT019676

ID   BT019676; SV 1; linear; mRNA; STD; HUM; 1200 BP.
XX
AC   BT019676;
XX
DT   29-OCT-2004 (Rel. 81, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens mitogen-activated protein kinase kinase 4 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1200
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   "Cloning of human full-length CDSs in BD Creator(TM) System Donor vector";
RL   Unpublished.
XX
RN   [2]
RP   1-1200
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   ;
RL   Submitted (28-OCT-2004) to the INSDC.
RL   BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California
RL   94303, USA
XX
DR   MD5; 5a467c5cfbb0f67014509b233f43f8d1.
DR   Ensembl-Gn; ENSG00000065559; homo_sapiens.
DR   Ensembl-Tr; ENST00000353533; homo_sapiens.
DR   Ensembl-Tr; ENST00000415385; homo_sapiens.
XX
CC   This CDS clone is a part of a collection of human full length
CC   expression clones generated by BD Biosciences Clontech and the
CC   Harvard Institute of Proteomics. Each CDS has been cloned in two
CC   forms: with and without stop-codon (to allow fusion with C-terminal
CC   tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
CC    cloning system between the SalI  and HindIII sites of the
CC   pDNR-DUAL  vector. Additional sequences in the clone:  'ACC' after
CC   SalI site  and before 'ATG' to provide Kozak consensus sequence;
CC   'GG' after  last codon and before HindIII site to maintain reading
CC   frame.  Clone distribution: http://bioinfo.clontech.com/orfclones.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1200
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH5alpha T1 resistant"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BD Creator(TM) CDS Library derived from MGC
FT                   collection"
FT                   /clone="GH01335X1.0"
FT                   /note="Vector: pDNR-Dual"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..1200
FT                   /codon_start=1
FT                   /product="mitogen-activated protein kinase kinase 4"
FT                   /note="Mutations: 1199:OK"
FT                   /db_xref="GOA:P45985"
FT                   /db_xref="H-InvDB:HIT000266605.13"
FT                   /db_xref="HGNC:HGNC:6844"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:3ALN"
FT                   /db_xref="PDB:3ALO"
FT                   /db_xref="PDB:3VUT"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45985"
FT                   /protein_id="AAV38482.1"
FT                   /translation="MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALK
FT                   LNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKD
FT                   LGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQ
FT                   FYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKEN
FT                   LKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASR
FT                   QGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSF
FT                   INFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
FT                   "
XX
SQ   Sequence 1200 BP; 363 A; 259 C; 283 G; 295 T; 0 other;
     atggcggctc cgagcccgag cggcggcggc ggctccgggg gcggcagcgg cagcggcacc        60
     cccggccccg tagggtcccc ggcgccaggc cacccggccg tcagcagcat gcagggtaaa       120
     cgcaaagcac tgaagttgaa ttttgcaaat ccacctttca aatctacagc aaggtttact       180
     ctgaatccca atcctacagg agttcaaaac ccacacatag agagactgag aacacacagc       240
     attgagtcat caggaaaact gaagatctcc cctgaacaac actgggattt cactgcagag       300
     gacttgaaag accttggaga aattggacga ggagcttatg gttctgtcaa caaaatggtc       360
     cacaaaccaa gtgggcaaat aatggcagtt aaaagaattc ggtcaacagt ggatgaaaaa       420
     gaacaaaaac aacttcttat ggatttggat gtagtaatgc ggagtagtga ttgcccatac       480
     attgttcagt tttatggtgc actcttcaga gagggtgact gttggatctg tatggaactc       540
     atgtctacct cgtttgataa gttttacaaa tatgtatata gtgtattaga tgatgttatt       600
     ccagaagaaa ttttaggcaa aatcacttta gcaactgtga aagcactaaa ccacttaaaa       660
     gaaaacttga aaattattca cagagatatc aaaccttcca atattcttct ggacagaagt       720
     ggaaatatta agctctgtga cttcggcatc agtggacagc ttgtggactc tattgccaag       780
     acaagagatg ctggctgtag gccatacatg gcacctgaaa gaatagaccc aagcgcatca       840
     cgacaaggat atgatgtccg ctctgatgtc tggagtttgg ggatcacatt gtatgagttg       900
     gccacaggcc gatttcctta tccaaagtgg aatagtgtat ttgatcaact aacacaagtc       960
     gtgaaaggag atcctccgca gctgagtaat tctgaggaaa gggaattctc cccgagtttc      1020
     atcaactttg tcaacttgtg ccttacgaag gatgaatcca aaaggccaaa gtataaagag      1080
     cttctgaaac atccctttat tttgatgtat gaagaacgtg ccgttgaggt cgcatgctat      1140
     gtttgtaaaa tcctggatca aatgccagct actcccagct ctcccatgta tgtcgattag      1200
//

If you have problems or comments...

PBIL Back to PBIL home page