(data stored in ACNUC31108 zone)

EMBL: BT019851

ID   BT019851; SV 1; linear; mRNA; STD; HUM; 846 BP.
XX
AC   BT019851;
XX
DT   29-OCT-2004 (Rel. 81, Created)
DT   16-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens CD37 antigen mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-846
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   "Cloning of human full-length CDSs in BD Creator(TM) System Donor vector";
RL   Unpublished.
XX
RN   [2]
RP   1-846
RA   Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
RA   Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
RA   Phelan M., Farmer A.;
RT   ;
RL   Submitted (28-OCT-2004) to the INSDC.
RL   BD Biosciences Clontech, 1020 East Meadow circle, Palo Alto, California
RL   94303, USA
XX
DR   MD5; 4425d84c3a596da4c0f960d1aeb0dcc1.
DR   Ensembl-Gn; ENSG00000104894; homo_sapiens.
DR   Ensembl-Tr; ENST00000323906; homo_sapiens.
DR   Ensembl-Tr; ENST00000426897; homo_sapiens.
DR   Ensembl-Tr; ENST00000598095; homo_sapiens.
XX
CC   This CDS clone is a part of a collection of human full length
CC   expression clones generated by BD Biosciences Clontech and the
CC   Harvard Institute of Proteomics. Each CDS has been cloned in two
CC   forms: with and without stop-codon (to allow fusion with C-terminal
CC   tag). The CDS has been  directionally cloned using BD In-Fusion(TM)
CC    cloning system between the SalI  and HindIII sites of the
CC   pDNR-DUAL  vector. Additional sequences in the clone:  'ACC' after
CC   SalI site  and before 'ATG' to provide Kozak consensus sequence;
CC   'GG' after  last codon and before HindIII site to maintain reading
CC   frame.  Clone distribution: http://bioinfo.clontech.com/orfclones.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..846
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH5alpha T1 resistant"
FT                   /mol_type="mRNA"
FT                   /clone_lib="BD Creator(TM) CDS Library derived from MGC
FT                   collection"
FT                   /clone="GH01244X1.0"
FT                   /note="Vector: pDNR-Dual"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..846
FT                   /codon_start=1
FT                   /product="CD37 antigen"
FT                   /db_xref="GOA:P11049"
FT                   /db_xref="H-InvDB:HIT000266691.12"
FT                   /db_xref="HGNC:HGNC:1666"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:P11049"
FT                   /protein_id="AAV38654.1"
FT                   /translation="MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVS
FT                   FVGLAFVPLQIWSKVLAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITL
FT                   GILISTQRAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQ
FT                   VLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAE
FT                   SHIYREGCAQGLQKWLHNNLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARYR
FT                   "
XX
SQ   Sequence 846 BP; 157 A; 273 C; 227 G; 189 T; 0 other;
     atgtcagccc aggagagctg cctcagcctc atcaagtact tcctcttcgt tttcaacctc        60
     ttcttcttcg tcctcggcag cctgatcttc tgcttcggca tctggatcct catcgacaag       120
     accagcttcg tgtcctttgt gggcttggcc ttcgtgcctc tgcagatctg gtccaaagtc       180
     ctggccatct caggaatctt caccatgggc atcgccctcc tgggttgtgt gggggccctc       240
     aaggagctcc gctgcctcct gggcctgtat tttgggatgc tgctgctcct gtttgccaca       300
     cagatcaccc tgggaatcct catctccact cagcgggccc agctggagcg aagcttgcgg       360
     gacgtcgtag agaaaaccat ccaaaagtac ggcaccaacc ccgaggagac cgcggccgag       420
     gagagctggg actatgtgca gttccagctg cgctgctgcg gctggcacta cccgcaggac       480
     tggttccaag tcctcatcct gagaggtaac gggtcggagg cgcaccgcgt gccctgctcc       540
     tgctacaact tgtcggcgac caacgactcc acaatcctag ataaggtgat cttgccccag       600
     ctcagcaggc ttggacacct ggcgcggtcc agacacagtg cagacatctg cgctgtccct       660
     gcagagagcc acatctaccg cgagggctgc gcgcagggcc tccagaagtg gctgcacaac       720
     aaccttattt ccatagtggg catttgcctg ggcgtcggcc tactcgagct cgggttcatg       780
     acgctctcga tattcctgtg cagaaacctg gaccacgtct acaaccggct cgctcgatac       840
     cgttag                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page