(data stored in ACNUC13479 zone)

EMBL: BT020189

ID   BT020189; SV 1; linear; mRNA; STD; PLN; 783 BP.
XX
AC   BT020189;
XX
DT   03-NOV-2004 (Rel. 81, Created)
DT   03-NOV-2004 (Rel. 81, Last updated, Version 1)
XX
DE   Arabidopsis thaliana At5g05670 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-783
RA   Shinn P., Chen H., Cheuk R., Kim C.J., Ecker J.R.;
RT   "Aradidopsis ORF clones";
RL   Unpublished.
XX
RN   [2]
RP   1-783
RA   Shinn P., Chen H., Cheuk R., Kim C.J., Ecker J.R.;
RT   ;
RL   Submitted (02-NOV-2004) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; 82c48013d242a48f25c9eb6d92ba9c4a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..783
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="U67059"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..783
FT                   /codon_start=1
FT                   /product="At5g05670"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q9FFK7"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FFK7"
FT                   /protein_id="AAV43791.1"
FT                   /translation="MENLEDLKILAEQWSHQGIEYLQKIPPNQLYAAIGVLLFTTILLF
FT                   LSIRLVRRTKSNTVLLSGLTGSGKTVLFYQLRDGSSHQGTVTSMEPNEGTFVLHSENTK
FT                   KGKIKPVHLVDVPGHSRLRPKLEEFLPQAAAIVFVVDALEFLPNCRAASEYLYEILTNA
FT                   NVVKKKIPVLLCCNKTDKLTAHTKEFIRKQMEKEIEKLRASRSAVSTADIANDFTIGIE
FT                   GEVFSFTHCSNKVTVAEASGLTGETIQIEDFIREYIKP"
XX
SQ   Sequence 783 BP; 223 A; 184 C; 175 G; 201 T; 0 other;
     atggagaact tggaagatct gaaaattctg gctgagcagt ggtcgcatca aggaatcgaa        60
     tatcttcaga agataccacc gaatcagctg tatgccgcca ttggtgtttt gttgtttaca       120
     accatcttgc tcttcctatc cattcgcctg gtcagacgta ccaaatccaa cactgtactc       180
     ctttctgggc tgaccggaag tggaaagact gtgctctttt accaactccg agatggatcg       240
     tcgcatcagg gcactgtaac atcaatggaa ccaaatgaag gcacttttgt tcttcacagt       300
     gaaaatacta agaaaggaaa aatcaagcct gttcatcttg ttgatgttcc tgggcactct       360
     cggcttcgac ccaagctaga agaattcttg ccccaagcag ctgccattgt gttcgtagtg       420
     gatgccttgg agttcctccc aaactgtcgt gcagcttcag agtacctata cgagattctg       480
     accaatgcga atgttgtcaa gaagaagatt ccagtcctcc tttgctgtaa caagaccgat       540
     aaactcactg cacacaccaa ggagtttatc cggaagcaaa tggagaaaga aattgagaaa       600
     ctgagggctt caaggagtgc agtctctact gctgatatag cgaatgactt caccattgga       660
     attgagggag aagtgttctc cttcacgcat tgctccaaca aagtcactgt cgctgaggca       720
     tctggactta ccggagaaac catccagatt gaagacttca ttcgagaata catcaagcca       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page