(data stored in ACNUC4305 zone)

EMBL: BT020983

ID   BT020983; SV 1; linear; mRNA; STD; MAM; 1534 BP.
XX
AC   BT020983;
XX
DT   17-FEB-2005 (Rel. 82, Created)
DT   27-NOV-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Bos taurus proteasome (prosome, macropain) 26S subunit, ATPase, 1 (PSMC1),
DE   mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RP   1-1534
RX   DOI; 10.1007/s00335-001-2145-4.
RX   PUBMED; 12140684.
RA   Sonstegard T.S., Capuco A.V., White J., Van Tassell C.P., Connor E.E.,
RA   Cho J., Sultana R., Shade L., Wray J.E., Wells K.D., Quackenbush J.;
RT   "Analysis of bovine mammary gland EST and functional annotation of the Bos
RT   taurus gene index";
RL   Mamm. Genome 13(7):373-379(2002).
XX
RN   [2]
RP   1-1534
RX   DOI; 10.1186/1471-2164-6-166.
RX   PUBMED; 16305752.
RA   Harhay G.P., Sonstegard T.S., Keele J.W., Heaton M.P., Clawson M.L.,
RA   Snelling W.M., Wiedmann R.T., Van Tassell C.P., Smith T.P.;
RT   "Characterization of 954 bovine full-CDS cDNA sequences";
RL   BMC Genomics 6:166-166(2005).
XX
RN   [3]
RP   1-1534
RA   Harhay G.P., Sonstegard T.S., Clawson M.L., Heaton M.P., Keele J.W.,
RA   Snelling W.M., Weidmann R.T., Smith T.P.L.;
RT   ;
RL   Submitted (16-FEB-2005) to the INSDC.
RL   Molecular Genetic Research Unit, USDA-ARS U.S. Meat Animal Research Center,
RL   P.O. Box 166, Spur 18D, Clay Center, NE 68933, USA
XX
DR   MD5; 094de222cce96aaf3cbce6bc9dd58512.
XX
CC   Contact: Gregory P. Harhay at harhay@email.marc.usda.gov.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1534
FT                   /organism="Bos taurus"
FT                   /lab_host="Escherichia coli DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="5BOV"
FT                   /clone="5BOV116L22; plate 116 row L column 22"
FT                   /tissue_type="pooled"
FT                   /note="Vector: pCMV SPORT6; Site_1: NotI; Site_2: SalI;
FT                   Library made from pooled mRNA isolated from mammary tissues
FT                   at eight physiological, developmental, and disease states."
FT                   /db_xref="taxon:9913"
FT   gene            1..1534
FT                   /gene="PSMC1"
FT                   /note="putative, similar to GeneID: 5700"
FT   CDS_pept        24..1346
FT                   /codon_start=1
FT                   /gene="PSMC1"
FT                   /product="proteasome 26S ATPase subunit 1"
FT                   /db_xref="GOA:Q5E9D7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR035244"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q5E9D7"
FT                   /protein_id="AAX09000.1"
FT                   /translation="MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDV
FT                   ASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRG
FT                   TPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVL
FT                   MDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGV
FT                   ILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSI
FT                   VFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPA
FT                   LIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAIC
FT                   TEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL"
XX
SQ   Sequence 1534 BP; 402 A; 390 C; 471 G; 271 T; 0 other;
     gcggctggag cggccggagc aagatgggtc aaagtcagag tggtggccac ggtcctggag        60
     gcggcaagaa ggacgataag gacaagaaaa agaaatatga acctcctgta ccaactcgag       120
     ttgggaaaaa gaagaagaag acaaagggac cagatgttgc cagcaaactg cccctggtga       180
     cgcctcacac tcagtgccgg ttaaaactgc tgaagctaga gagaattaaa gactatctcc       240
     tcatggagga ggagttcatt agaaaccagg agcagatgaa gccgttagaa gaaaagcaag       300
     aggaggagag gtcaaaggtg gatgacctcc gggggacgcc gatgtcagta gggaccctgg       360
     aggagatcat cgatgacaac cacgccatcg tgtccacgtc tgtgggctcg gagcactacg       420
     tcagcatcct ctcgttcgta gacaaggacc tgctggagcc cggctgctcc gtgctgctca       480
     accacaaggt gcacgcggtg atcggggtgc tgatggacga cacggacccc ttggtcacag       540
     tgatgaaggt ggaaaaggcg ccccaagaga cctacgccga catcgggggg ctggacaacc       600
     agatccagga aatcaaggag tccgtggagc ttcctctcac tcatcctgaa tactacgaag       660
     agatggggat caagcccccc aagggggtca ttctctatgg tccgcccggc acagggaaaa       720
     ccttattagc caaagcagtg gcgaaccaga cctcggccac cttcctgcga gtggtcggct       780
     ctgaactcat tcagaagtac ctgggcgacg gccccaagct cgttcgggaa ctgtttcgag       840
     tcgctgaaga acacgcacca tccattgtct ttattgatga aattgatgct attgggacga       900
     aaaggtacga ctccaactca ggcggggaga gggagattca gcgaacgatg ctggagctgc       960
     tgaaccagct ggacggcttt gactcaaggg gagacgtgaa agtcatcatg gccacaaacc      1020
     ggatagagac gctggacccg gccctcatca gaccaggccg catcgacagg aagatcgagt      1080
     tccccctgcc tgacgaaaag accaagaagc gcatcttcca gatccacacg agcaggatga      1140
     cgctggccga cgacgtgacc ctggacgact tgatcatggc taaagatgac ctctctggtg      1200
     ccgacatcaa ggcaatctgt acagaagctg gtctgatggc cttgagagag cgcagaatga      1260
     aagtaacaaa tgaagacttc aaaaagtcga aggaaaatgt tctttataaa aagcaggagg      1320
     gcaccccaga ggggctctat ctctagtagg ccagagctgc cttccagggg aggctgggag      1380
     ggccctggct gctggagggg tgaggtggga ggctgcctgc ctgggtgccc gtgtgctcac      1440
     tggccacggt tggcagagcg tttcgtgtcc ctcccgagcg cagcgtgtag gggcctggca      1500
     ggctgcctgc gtcccaataa agcgtgcttt ctct                                  1534
//

If you have problems or comments...

PBIL Back to PBIL home page