(data stored in ACNUC1829 zone)

EMBL: BT021800

ID   BT021800; SV 1; linear; mRNA; STD; MAM; 1099 BP.
XX
AC   BT021800;
XX
DT   26-MAR-2005 (Rel. 83, Created)
DT   27-NOV-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Bos taurus tetraspan 2 (TSPAN-2), mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RP   1-1099
RX   DOI; 10.1101/gr.170101.
RX   PUBMED; 11282978.
RA   Smith T.P., Grosse W.M., Freking B.A., Roberts A.J., Stone R.T., Casas E.,
RA   Wray J.E., White J., Cho J., Fahrenkrug S.C., Bennett G.L., Heaton M.P.,
RA   Laegreid W.W., Rohrer G.A., Chitko-McKown C.G., Pertea G., Holt I.,
RA   Karamycheva S., Liang F., Quackenbush J., Keele J.W.;
RT   "Sequence evaluation of four pooled-tissue normalized bovine cDNA libraries
RT   and construction of a gene index for cattle";
RL   Genome Res. 11(4):626-630(2001).
XX
RN   [2]
RP   1-1099
RX   DOI; 10.1186/1471-2164-6-166.
RX   PUBMED; 16305752.
RA   Harhay G.P., Sonstegard T.S., Keele J.W., Heaton M.P., Clawson M.L.,
RA   Snelling W.M., Wiedmann R.T., Van Tassell C.P., Smith T.P.;
RT   "Characterization of 954 bovine full-CDS cDNA sequences";
RL   BMC Genomics 6:166-166(2005).
XX
RN   [3]
RP   1-1099
RA   Harhay G.P., Sonstegard T.S., Van Tassell C.P., Clawson M.L., Heaton M.P.,
RA   Keele J.W., Snelling W.M., Weidmann R.T., Smith T.P.L.;
RT   ;
RL   Submitted (17-MAR-2005) to the INSDC.
RL   Molecular Genetic Research Unit, USDA-ARS U.S. Meat Animal Research Center,
RL   P.O. Box 166, Spur 18D, Clay Center, NE 68933, USA
XX
DR   MD5; 69e6a7ccec3aa9ecfccf9794cf34578c.
DR   Ensembl-Gn; ENSBTAG00000015961; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000021222; bos_taurus.
XX
CC   Contact: Gregory P. Harhay at harhay@email.marc.usda.gov.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1099
FT                   /organism="Bos taurus"
FT                   /lab_host="Escherichia coli DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="1BOV"
FT                   /clone="1BOV146F16; plate 146 row F column 16"
FT                   /tissue_type="pooled"
FT                   /note="Vector: pCMV SPORT6; Site_1: NotI; Site_2: SalI;
FT                   Library made from pooled tissue from lymph node, ovary,
FT                   fat, hypothalamus, and pituitary."
FT                   /db_xref="taxon:9913"
FT   gene            1..1099
FT                   /gene="TSPAN2"
FT                   /note="putative, similar to GeneID: 10100"
FT   CDS_pept        17..715
FT                   /codon_start=1
FT                   /gene="TSPAN2"
FT                   /product="tetraspan 2"
FT                   /db_xref="GOA:Q58CZ7"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/TrEMBL:Q58CZ7"
FT                   /protein_id="AAX46647.1"
FT                   /translation="MGRFRGGLRCIKYLLLGFNLLFWLAGSAVIAFGLWFRFGGSMKDF
FT                   SSEDKSPEYFYMGLYVLVGAGALMMAVGFFGCCGATRESQCVLGSFFTCLLVIFAAEIT
FT                   TGVFAFIGKDVAIRHVQTMYEEAYNDYLRDKEKGNGTLITFHSTFQCCGKESPEQVQPT
FT                   CPKELLGHKNCIDEIESIISVKLQLIGIVGIGIAGLTIQRECYNPAALSVHVIKQYENP
FT                   KTQINIWSSS"
FT   repeat_region   744..953
FT                   /rpt_family="Bov-B"
FT   repeat_region   963..1032
FT                   /rpt_family="Bov-tA2"
XX
SQ   Sequence 1099 BP; 312 A; 222 C; 276 G; 289 T; 0 other;
     ccgccggggc cgcagcatgg ggcgctttcg tgggggcctg cggtgcatca agtacctgct        60
     gctcggcttc aacctgctct tctggctggc aggatctgct gtcattgctt ttggactatg       120
     gtttcggttt ggaggctcca tgaaggattt ctcctcggag gacaagtccc cagagtactt       180
     ctacatgggg ctctatgtgc tggttggagc aggggccctg atgatggccg tgggcttctt       240
     cggatgctgt ggggccacga gggagtcgca gtgtgttctt ggatcttttt ttacctgcct       300
     attggtgata tttgctgctg aaataaccac tggagtattt gctttcatag gcaaggatgt       360
     agcaatacga catgttcaga ccatgtatga agaagcttat aatgattacc ttagagacaa       420
     ggaaaaggga aatgggactc tcatcacctt ccactcaacg tttcagtgct gtggaaaaga       480
     aagccctgaa caggtccaac ccacctgccc aaaggagctc ctaggacaca agaattgcat       540
     tgatgaaatt gagagcataa tcagtgttaa gctccagctc atcggaattg tcggtattgg       600
     aatcgcaggt ctcacgattc agagggaatg ttataatcct gcagctttaa gtgttcatgt       660
     catcaagcaa tacgagaacc cgaagaccca gattaatatt tggagctcat cctaatatca       720
     acttcagata ttaagcttga acatctgaag aaaatcaacc ctaaatattc attggtagga       780
     ttgatgctga agctgaagct ccaatacttt ggctacctga tgcgaatatc caactcattg       840
     gaagagaccc tgatgctggg aaagactgag ggcaggagaa aggggaacca gaggatgaga       900
     tggttggatg ccatcataaa ctcaatggac atgaacttgc acaaattccg ggatacagtg       960
     aaggacaggg aagtttgatg tgctgcagac catgggattg caaagagtta gatatgattt      1020
     agcaacctaa caacaattct ttaatagaga tcatttcata ttttgaataa taaaataata      1080
     aatacaacaa gataatttc                                                   1099
//

If you have problems or comments...

PBIL Back to PBIL home page