(data stored in SCRATCH zone)

EMBL: BT024551

ID   BT024551; SV 1; linear; mRNA; STD; PLN; 315 BP.
XX
AC   BT024551;
XX
DT   18-FEB-2006 (Rel. 86, Created)
DT   18-FEB-2006 (Rel. 86, Last updated, Version 1)
XX
DE   Arabidopsis thaliana At5g01015 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-315
RA   Shinn P., Chen H., Kim C.J., Ecker J.R.;
RT   "Arabidopsis ORF clones";
RL   Unpublished.
XX
RN   [2]
RP   1-315
RA   Shinn P., Chen H., Kim C.J., Ecker J.R.;
RT   ;
RL   Submitted (17-FEB-2006) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; 12b85beee510c9076f3a8fc21c7f91cf.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..315
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="U82050"
FT                   /note="This clone is in pUNI 51"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..315
FT                   /codon_start=1
FT                   /product="At5g01015"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q8LBK1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8LBK1"
FT                   /protein_id="ABD38890.1"
FT                   /translation="MESSLHSVIFLGLLATILVTTNGQGDGTGLNAEEMWPVEVGMEYR
FT                   VWRRKLMTPLELCLECKCCSSTTCATMPCCFGINCQLPNKPFGVCAFVPKSCHCNSCSI
FT                   "
XX
SQ   Sequence 315 BP; 69 A; 67 C; 90 G; 89 T; 0 other;
     atggagtcta gcttgcatag tgtgattttc ttaggtttgc ttgcgacgat tctggttacg        60
     accaatggcc aaggagacgg gacggggcta aatgcagaag aaatgtggcc agtggaggtg       120
     gggatggagt atagagtatg gaggagaaag ctgatgacgc cattggagct gtgcttggag       180
     tgcaaatgct gctcctccac cacttgtgcc accatgcctt gctgtttcgg catcaattgc       240
     cagcttccca acaagccatt tggcgtttgt gcctttgttc ccaagtcatg ccattgtaat       300
     tcttgctcca tttga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page