(data stored in SCRATCH zone)

EMBL: BT024797

ID   BT024797; SV 1; linear; mRNA; STD; PLN; 180 BP.
XX
AC   BT024797;
XX
DT   03-MAR-2006 (Rel. 87, Created)
DT   03-MAR-2006 (Rel. 87, Last updated, Version 1)
XX
DE   Arabidopsis thaliana At4g26320 gene, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-180
RA   Kim C.J., Chen H., Shinn P., Ecker J.R.;
RT   "Arabidopsis ORF clones";
RL   Unpublished.
XX
RN   [2]
RP   1-180
RA   Kim C.J., Chen H., Shinn P., Ecker J.R.;
RT   ;
RL   Submitted (02-MAR-2006) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; 44b314265aedb56318e34e5d2afcbc5d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..180
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="U84112"
FT                   /note="This clone is in pUNI 51"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..180
FT                   /codon_start=1
FT                   /product="At4g26320"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q9STQ3"
FT                   /db_xref="InterPro:IPR039281"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STQ3"
FT                   /protein_id="ABD60680.1"
FT                   /translation="MEAMKMRLFVAVLVAAMAFSAVQQAAAVEAPAPSPTSDASLAIPA
FT                   FFASVATLAFGFLF"
XX
SQ   Sequence 180 BP; 23 A; 51 C; 53 G; 53 T; 0 other;
     atggaggcaa tgaagatgag actctttgtg gcggttttgg tggcagcgat ggctttctct        60
     gcggtgcaac aggctgccgc ggtggaggct ccagctccga gtcctacctc cgatgcttcc       120
     ttggccatcc ccgctttctt cgcctcggta gccactttgg cctttgggtt tctcttctag       180
//

If you have problems or comments...

PBIL Back to PBIL home page