(data stored in ACNUC16935 zone)

EMBL: BT025868

ID   BT025868; SV 1; linear; mRNA; STD; PLN; 921 BP.
XX
AC   BT025868;
XX
DT   08-JUN-2006 (Rel. 88, Created)
DT   08-JUN-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Arabidopsis thaliana At5g03240 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-921
RA   Quinitio C., Chen H., Kim C.J., Shinn P., Ecker J.R.;
RT   "Arabidopsis ORF clones";
RL   Unpublished.
XX
RN   [2]
RP   1-921
RA   Quinitio C., Chen H., Kim C.J., Shinn P., Ecker J.R.;
RT   ;
RL   Submitted (07-JUN-2006) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; 6821a24d5eb718fcecfc7a9c86a5021b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..921
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="U82414"
FT                   /note="This clone is in pUNI 51"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..921
FT                   /codon_start=1
FT                   /product="At5g03240"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q1EC66"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1EC66"
FT                   /protein_id="ABF85770.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLADYNIQKESTLHLVLRLRGGSF"
XX
SQ   Sequence 921 BP; 276 A; 214 C; 212 G; 219 T; 0 other;
     atgcaaatct tcgtgaaaac actcactggc aagactatca ctctcgaggt tgagagctct        60
     gacaccatcg acaatgttaa ggcaaagatt caggacaagg aaggcattcc tccggatcag       120
     caaagattaa tattcgccgg taaacagcta gaagatggcc gtaccttggc cgattacaac       180
     attcagaaag aatcaaccct tcatttggtt ctccgtttaa gaggtggtat gcaaatcttt       240
     gtcaagactc tgactggcaa gaccattact ttggaggttg agagctctga cactattgac       300
     aacgtcaaag caaagatcca ggacaaggaa ggaatccctc cggatcagca gagacttatc       360
     tttgccggta agcagcttga agacggaaga actcttgctg actacaacat tcaaaaggag       420
     tcgacccttc atttggtgct tcgtctcaga ggtggtatgc aaatctttgt caagaccctc       480
     actggtaaaa caatcaccct tgaggttgag agttcagaca ccattgacaa tgtcaaagct       540
     aagatccaag ataaagaggg aattcctccg gatcagcaga ggcttatctt tgccggtaag       600
     cagctcgaag atggacgcac ccttgcagat tacaacatcc aaaaggagtc gacacttcat       660
     cttgtgcttc gtctccgtgg tggtatgcag atctttgtga agacccttac cggaaagacc       720
     attactctgg aggttgaaag ctcagacacc atcgataatg tcaaggctaa gattcaggac       780
     aaggaaggga tcccaccaga ccaacagaga ctcatcttcg ctggaaaaca gcttgaggat       840
     ggtcgcacac ttgcagatta caacatccag aaggagtcga ctcttcactt ggttcttcgt       900
     cttcgtggtg gaagcttcta a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page