(data stored in SCRATCH zone)

EMBL: BT026404

ID   BT026404; SV 1; linear; mRNA; STD; PLN; 246 BP.
XX
AC   BT026404;
XX
DT   03-AUG-2006 (Rel. 88, Created)
DT   03-AUG-2006 (Rel. 88, Last updated, Version 1)
XX
DE   Arabidopsis thaliana At5g01075 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-246
RA   Quinitio C., Chen H., Kim C.J., Shinn P., Ecker J.R.;
RT   "Arabidopsis ORF Clones";
RL   Unpublished.
XX
RN   [2]
RP   1-246
RA   Quinitio C., Chen H., Kim C.J., Shinn P., Ecker J.R.;
RT   ;
RL   Submitted (02-AUG-2006) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; b373656de6e1b1a3dfcc6015ab4defe3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..246
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="U84451"
FT                   /note="This clone is in pUNI 51"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..246
FT                   /codon_start=1
FT                   /product="At5g01075"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q8LEW6"
FT                   /db_xref="UniProtKB/TrEMBL:Q8LEW6"
FT                   /protein_id="ABH04511.1"
FT                   /translation="MKTSSFVFLLVVIILSFSLLASSSEMKVGLEDYNFPVDPTPTTKA
FT                   SIKPGPIEHGTPLNPYIPKPPSPSSSPPPQQSQDGG"
XX
SQ   Sequence 246 BP; 63 A; 65 C; 42 G; 76 T; 0 other;
     atgaagacgt caagctttgt cttccttttg gttgtaataa tcctaagctt ctcactacta        60
     gcttcttctt ctgaaatgaa agtggggttg gaggattaca attttccagt ggatccaact       120
     ccgacgacaa aagcttcgat aaaaccaggt cctattgagc atggaactcc tctcaatcct       180
     tatattccta agcctccttc tccttcttcg tctcctcctc cacagcaatc ccaagacggt       240
     ggataa                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page