(data stored in ACNUC13479 zone)

EMBL: BT028926

ID   BT028926; SV 1; linear; mRNA; STD; PLN; 972 BP.
XX
AC   BT028926;
XX
DT   07-SEP-2006 (Rel. 89, Created)
DT   07-SEP-2006 (Rel. 89, Last updated, Version 1)
XX
DE   Arabidopsis thaliana At5g01380 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-972
RA   Quinitio C., Chen H., Kim C.J., Shinn P., Ecker J.R.;
RT   "Arabidopsis ORF clones";
RL   Unpublished.
XX
RN   [2]
RP   1-972
RA   Quinitio C., Chen H., Kim C.J., Shinn P., Ecker J.R.;
RT   ;
RL   Submitted (06-SEP-2006) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; 34dcaf012ade3fae01ac60fc0e327ac7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..972
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="U85254"
FT                   /note="This clone is in pUNI 51"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..972
FT                   /codon_start=1
FT                   /product="At5g01380"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q9SDW0"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR027759"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SDW0"
FT                   /protein_id="ABI49473.1"
FT                   /translation="MDRRNPFQHHHHHHQLHHHLIQQQQLPPPPLSTTATMDPGGGGGG
FT                   GERIPQWSIEETKELLAIREELDQTFMETKRNKLLWEVVAAKMADKGFVRSAEQCKSKW
FT                   KNLVTRYKACETTEPDAIRQQFPFYNEIQSIFEARMQRMLWSEATEPSTSSKRKHHQFS
FT                   SDDEEEEVDEPNQDINEELLSLVETQKRETEVITTSTSTNPRKRAKKGKGVASGTKAET
FT                   AGNTLKDILEEFMRQTVKMEKEWRDAWEMKEIEREKREKEWRRRMAELEEERAATERRW
FT                   MEREEERRLREEARAQKRDSLIDALLNRLNRDHNDDHHNQGF"
XX
SQ   Sequence 972 BP; 342 A; 174 C; 272 G; 184 T; 0 other;
     atggaccgac gtaacccttt ccaacatcac caccaccacc atcagcttca tcatcacttg        60
     atccaacagc aacagcttcc tccgccgccg ctgagcacca cggcgacgat ggatcccggc       120
     ggaggaggag gaggtgggga gagaatccca cagtggagca tagaggagac aaaggagctt       180
     ttggctataa gagaagaact tgatcaaact ttcatggaga ccaaacgtaa taagcttctt       240
     tgggaagtcg tggctgctaa gatggccgac aagggttttg tccgaagcgc agaacaatgt       300
     aagagcaagt ggaagaacct cgtcactaga tacaaggcgt gtgagaccac tgagccagat       360
     gctattaggc agcagttccc attctacaat gagattcagt cgatttttga agcaagaatg       420
     caaagaatgc tgtggtcaga agccacagaa ccaagcactt cctcgaagag aaaacatcat       480
     caattttcat ctgatgatga agaagaagaa gttgacgaac caaatcaaga tatcaacgag       540
     gaattattgt ctttagtaga gacacagaaa agagagacag aagtgattac tactagtact       600
     tcgaccaatc caagaaaacg tgcaaaaaaa ggaaaaggcg ttgcgagtgg tacgaaagct       660
     gaaactgcgg gtaatacact aaaagatata ttggaggagt ttatgaggca aacggtgaag       720
     atggaaaagg aatggagaga tgcatgggag atgaaggaga tagagaggga gaagagagag       780
     aaagagtggc ggaggagaat ggcggagcta gaggaggaaa gagccgccac agaaaggagg       840
     tggatggaga gagaggaaga gagacggttg agagaagaag ctagggctca gaagagagat       900
     tctctcatcg atgctttgct taataggctt aatagagatc ataatgatga tcatcataat       960
     caaggtttct aa                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page