(data stored in SCRATCH zone)

EMBL: BT029390

ID   BT029390; SV 1; linear; mRNA; STD; PLN; 228 BP.
XX
AC   BT029390;
XX
DT   03-NOV-2006 (Rel. 89, Created)
DT   03-NOV-2006 (Rel. 89, Last updated, Version 1)
XX
DE   Arabidopsis thaliana At4g26290 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-228
RA   Bautista V.R., Kim C.J., Chen H., Quinitio C., Ecker J.R.;
RT   "Arabidopsis ORF clones";
RL   Unpublished.
XX
RN   [2]
RP   1-228
RA   Bautista V.R., Kim C.J., Chen H., Quinitio C., Ecker J.R.;
RT   ;
RL   Submitted (01-NOV-2006) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; b805d6e062c48b99a98b23b16df28206.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..228
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="U86278"
FT                   /note="This clone is in pUNI 51"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..228
FT                   /codon_start=1
FT                   /product="At4g26290"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q9STQ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q9STQ5"
FT                   /protein_id="ABK32204.1"
FT                   /translation="MRSERSSKGPFEEEEEEEEEEEASSVKSDEHIEIEDEDETFAEDP
FT                   ETPITPSSSFVVEIRLPSRMFISSSFVNYV"
XX
SQ   Sequence 228 BP; 82 A; 39 C; 46 G; 61 T; 0 other;
     atgaggtccg aaagatcgtc gaaaggccca tttgaagaag aagaagaaga agaagaagaa        60
     gaagaagcat cctctgttaa atcagatgaa cacatagaga tagaagatga agatgaaact       120
     tttgcagagg atcctgaaac tccaataaca ccctcttctt cttttgtagt cgaaataaga       180
     ttaccatcgc gaatgttcat ctcttcttct tttgtcaatt atgtttag                    228
//

If you have problems or comments...

PBIL Back to PBIL home page