(data stored in ACNUC13479 zone)

EMBL: BT030096

ID   BT030096; SV 1; linear; mRNA; STD; PLN; 969 BP.
XX
AC   BT030096;
XX
DT   01-FEB-2007 (Rel. 90, Created)
DT   01-FEB-2007 (Rel. 90, Last updated, Version 1)
XX
DE   Arabidopsis thaliana At5g01670 gene, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-969
RA   Kim C.J., Bautista V.R., Chen H., De Los Reyes C., Wu S.Y., Ecker J.R.;
RT   "Arabidopsis ORF clones";
RL   Unpublished.
XX
RN   [2]
RP   1-969
RA   Kim C.J., Bautista V.R., Chen H., De Los Reyes C., Wu S.Y., Ecker J.R.;
RT   ;
RL   Submitted (31-JAN-2007) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; d3c7b4e66ddfba51d833be9d86b36940.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..969
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /clone="U87182"
FT                   /note="This clone is in pUNI 51"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..969
FT                   /codon_start=1
FT                   /product="At5g01670"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q8GXW0"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q8GXW0"
FT                   /protein_id="ABN04834.1"
FT                   /translation="MAHATFTSEGQNMESFRLLSGHKIPAVGLGTWRSGSQAAHAVVTA
FT                   IVEGGYRHIDTAWEYGDQREVGQGIKRAMHAGLERRDLFVTSKLWCTELSPERVRPALQ
FT                   NTLKELQLEYLDLYLIHWPIRLREGASKPPKAGDVLDFDMEGVWREMENLSKDSLVRNI
FT                   GVCNFTVTKLNKLLGFAELIPAVCQMEMHPGWRNDRILEFCKKNEIHVTAYSPLGSQEG
FT                   GRDLIHDQTVDRIAKKLNKTPGQILVKWGLQRGTSVIPKSLNPERIKENIKVFDWVIPE
FT                   QDFQALNSITDQKRVIDGEDLFVNKTEGPFRSVADLWDHED"
XX
SQ   Sequence 969 BP; 274 A; 204 C; 267 G; 224 T; 0 other;
     atggcacatg ccacgtttac gtcggaaggg cagaatatgg agtcgtttcg actcttgagt        60
     ggccacaaaa tcccagccgt tggactcggc acgtggcgat ctgggtctca agccgcccac       120
     gccgttgtca ctgcaatcgt cgagggtggc tataggcaca tagatacagc ttgggagtat       180
     ggtgatcaga gagaggtcgg tcaaggaata aagagggcga tgcacgctgg ccttgaaagg       240
     agggacctct ttgtgacctc gaagctttgg tgcactgagt tatctcctga gagagtgcgt       300
     cctgctctgc aaaacaccct taaagagctt caattagagt accttgatct ctacttgatt       360
     cactggccta tccggctaag agaaggagcc agtaagccac caaaggcagg ggacgttctt       420
     gactttgaca tggaaggagt ttggagagaa atggagaatc tttccaagga cagtctcgtc       480
     aggaatatcg gtgtctgtaa ctttacagtc actaagctca ataagctgct aggatttgct       540
     gaactgatcc ctgccgtttg ccagatggaa atgcatcctg gttggagaaa cgataggata       600
     ctcgaattct gcaagaagaa tgagatccat gttactgcct attctccatt gggatctcaa       660
     gaaggcggga gagatctgat acacgatcag acggtggata ggatagcgaa gaagctgaat       720
     aagacaccgg gacagattct agtgaaatgg ggtttgcaga gaggaacaag tgtcatccct       780
     aagtcattga atccagagag gatcaaagag aacatcaaag tgtttgattg ggtgatccct       840
     gaacaagact tccaagctct caacagcatc actgaccaga aacgagtgat agacggtgag       900
     gatcttttcg tcaacaagac cgaaggtcca ttccgtagtg tggctgatct atgggaccat       960
     gaagactaa                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page