(data stored in ACNUC14511 zone)

EMBL: BT034279

ID   BT034279; SV 1; linear; mRNA; STD; PLN; 1329 BP.
XX
AC   BT034279;
XX
DT   31-JUL-2008 (Rel. 96, Created)
DT   14-JUN-2012 (Rel. 113, Last updated, Version 2)
XX
DE   Zea mays full-length cDNA clone ZM_BFc0028A24 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Zea mays
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade;
OC   Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-1329
RX   PUBMED; 19936069.
RA   Soderlund C., Descour A., Kudrna D., Bomhoff M., Boyd L., Currie J.,
RA   Angelova A., Collura K., Wissotski M., Ashley E., Morrow D., Fernandes J.,
RA   Walbot V., Yu Y.;
RT   "Sequencing, mapping, and analysis of 27,455 maize full-length cDNAs";
RL   PloS Genet. 5(11):E1000740-E1000740(2009).
XX
RN   [2]
RP   1-1329
RA   Yu Y., Currie J., Lomeli R., Angelova A., Collura K., Wissotski M.,
RA   Campos D., Kudrna D., Golser W., Ashely E., Haller K., Descour A.,
RA   Fernandes J., Zuccolo A., Soderlund C., Walbot V.;
RT   ;
RL   Submitted (30-JUL-2008) to the INSDC.
RL   Plant Sciences, Arizona Genomics Institute, 1657 E. Helen Street, Thomas
RL   Keating Building, Tucson, AZ 85721, USA
XX
DR   MD5; daee80dbe8d6babe057d16cd1e3c293f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1329
FT                   /organism="Zea mays"
FT                   /strain="B73"
FT                   /mol_type="mRNA"
FT                   /clone="ZM_BFc0028A24"
FT                   /db_xref="taxon:4577"
FT   CDS_pept        102..1169
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /db_xref="GOA:B4FAZ1"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="InterPro:IPR039702"
FT                   /db_xref="UniProtKB/TrEMBL:B4FAZ1"
FT                   /protein_id="ACF79284.1"
FT                   /translation="MATVEVVVANGLGGADTKTVFKETYSKLKEEMLDDPAFEFTDESL
FT                   QWIDRMLDYNVLGGKCNRGLSVIDSYRILKGVDVLSKEETFLACTLGWCIEWLQAYFLV
FT                   LDDIMDNSQTRRGQPCWFRVPQVGLIAVNDGIILRNHISRILQRHFKGKPYYVDVIDLF
FT                   NEVEFKTASGQMLDLITTHEGEKDLTKYNLTVRRHIVQYKTAYYSFYLPVACALLLAGE
FT                   NLDNFGDVKNILVEMGTYLQVQDDYLDCFGDPEFIGKIGTDIEDYKCSWLVVQALEHAD
FT                   EKQKNILFESYGKSDPACVAKVKDLYKELKLEEVFQAYERESYNKLIADIEAQPSKAVQ
FT                   SVLKSFLHKIYKRDK"
XX
SQ   Sequence 1329 BP; 346 A; 289 C; 337 G; 357 T; 0 other;
     gtactctctc cagtgtccac agaaacagaa ttccgctccc tccccgtgtc ctcctcccgc        60
     gcccgcgcat cgtgaggtgg agttcccacc ccgaggccgc aatggcgacg gtggaggtgg       120
     tggtggccaa cggcttgggt ggcgccgaca ccaagaccgt gtttaaggaa acatacagca       180
     agctcaagga ggagatgcta gacgaccccg ccttcgagtt caccgacgag tcgctacagt       240
     ggatcgaccg catgttggac tacaatgtgc tcggaggaaa gtgcaatcgc gggctctctg       300
     tcattgatag ctacaggata ttgaagggtg ttgatgttct gagcaaggag gagacatttc       360
     ttgcttgcac ccttggctgg tgcattgaat ggcttcaagc ttattttctt gtgcttgatg       420
     atattatgga caactcccag acacggcgtg gccaaccttg ctggtttaga gtgccacagg       480
     ttggcctcat tgctgtaaat gatgggatta tccttcgcaa tcatatttca cgaatccttc       540
     aacgccactt caaggggaag ccatattatg ttgatgtaat tgacctattc aatgaggttg       600
     agttcaagac agcttcaggg caaatgttgg atcttatcac tacccacgag ggtgaaaagg       660
     atctaactaa atataacttg acagttcgcc gccacatcgt tcagtacaag acagcttatt       720
     attcatttta ccttcctgtt gcatgtgcat tgctgctggc tggtgagaac ttggataact       780
     ttggcgatgt aaagaacatt cttgtcgaaa tgggaacata ccttcaagtt caggatgatt       840
     atttagattg tttcggtgat cctgaattca ttggcaagat cggaactgac attgaagact       900
     acaagtgttc ctggctagtc gtgcaagctc ttgaacacgc tgatgagaag caaaagaaca       960
     ttctgtttga aagttatgga aagtctgatc cagcgtgtgt tgcaaaggtg aaggacttgt      1020
     acaaagagct taaactggag gaggttttcc aggcgtacga gagggagagt tacaacaagc      1080
     tgattgccga catcgaggcc cagcccagca aggcagtcca gagtgttttg aagtccttcc      1140
     ttcacaagat ctacaagagg gacaagtaaa aacccagatc gtgaagaagc tgctccgtcg      1200
     acgcttgcat caaattagta gacttgattg atgcagatga gtaatttgta ctatgttgtt      1260
     tcatgttttc attctcctgt tgcgtgtact cctgaattat aataaaacag agtgctatta      1320
     gggttacgt                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page