(data stored in ACNUC8465 zone)

EMBL: BT036838

ID   BT036838; SV 1; linear; mRNA; STD; PLN; 722 BP.
XX
AC   BT036838;
XX
DT   31-JUL-2008 (Rel. 96, Created)
DT   14-JUN-2012 (Rel. 113, Last updated, Version 2)
XX
DE   Zea mays full-length cDNA clone ZM_BFb0143B10 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Zea mays
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade;
OC   Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-722
RX   PUBMED; 19936069.
RA   Soderlund C., Descour A., Kudrna D., Bomhoff M., Boyd L., Currie J.,
RA   Angelova A., Collura K., Wissotski M., Ashley E., Morrow D., Fernandes J.,
RA   Walbot V., Yu Y.;
RT   "Sequencing, mapping, and analysis of 27,455 maize full-length cDNAs";
RL   PloS Genet. 5(11):E1000740-E1000740(2009).
XX
RN   [2]
RP   1-722
RA   Yu Y., Currie J., Lomeli R., Angelova A., Collura K., Wissotski M.,
RA   Campos D., Kudrna D., Golser W., Ashely E., Haller K., Descour A.,
RA   Fernandes J., Zuccolo A., Soderlund C., Walbot V.;
RT   ;
RL   Submitted (30-JUL-2008) to the INSDC.
RL   Plant Sciences, Arizona Genomics Institute, 1657 E. Helen Street, Thomas
RL   Keating Building, Tucson, AZ 85721, USA
XX
DR   MD5; 592f80747500a4f7fc47098d90174179.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..722
FT                   /organism="Zea mays"
FT                   /strain="B73"
FT                   /mol_type="mRNA"
FT                   /clone="ZM_BFb0143B10"
FT                   /db_xref="taxon:4577"
FT   CDS_pept        57..419
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /db_xref="GOA:B4FIA0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B4FIA0"
FT                   /protein_id="ACF81843.1"
FT                   /translation="MAPERIDGKKHGSMSDIWSLGLVILECATGIFPFPPCESFYELLV
FT                   AVVDQPPPSAPPDQFSPEFCGFISACLQKDANDRSSAQALLDHPFLSMYDDLHVDLASY
FT                   FTTAGSPLATFNSRQL"
XX
SQ   Sequence 722 BP; 168 A; 160 C; 157 G; 237 T; 0 other;
     ccattatatc tagttcctct tcgcaacgag atacatttat tggcacacgc aactacatgg        60
     cgccagaaag aatcgatgga aagaaacatg gttctatgag tgatatctgg agtttgggac       120
     tagtgatact ggaatgtgca accggcatct ttccatttcc tccttgtgaa agcttctacg       180
     aacttctcgt ggctgttgtt gatcaaccgc caccttctgc gccgccggat cagttttcac       240
     cagaattctg tgggttcatt tctgcatgtc tccagaagga tgctaatgac aggtcatcag       300
     cccaagcctt attggaccat ccgttcctga gcatgtatga tgacctgcat gtagatcttg       360
     cttcgtactt cacgacagca ggatctcctc tcgccacctt caattccagg caactctaat       420
     ttttttgtcc tccttattac gcgaacggtg tggcgacaaa tttctctttt tggacaaggc       480
     ttggattgtg tactgagctg taatgatctt gtgtgtgtca ggtcggtgat tggctccatc       540
     actttacata tatgacatac atgtacagcc ttttaggata aaaatgagca ctgaagtttt       600
     gcctatctgt atatcggcag caaacgtttg gtcatgtttg tttcaccttg taatgtattg       660
     actcagatat gggattggtc attgtctcat ttggtgtatg agtcaagtcc agattttctt       720
     gt                                                                      722
//

If you have problems or comments...

PBIL Back to PBIL home page