(data stored in ACNUC8465 zone)

EMBL: BT038425

ID   BT038425; SV 1; linear; mRNA; STD; PLN; 1265 BP.
XX
AC   BT038425;
XX
DT   31-JUL-2008 (Rel. 96, Created)
DT   14-JUN-2012 (Rel. 113, Last updated, Version 2)
XX
DE   Zea mays full-length cDNA clone ZM_BFb0232G07 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Zea mays
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade;
OC   Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-1265
RX   PUBMED; 19936069.
RA   Soderlund C., Descour A., Kudrna D., Bomhoff M., Boyd L., Currie J.,
RA   Angelova A., Collura K., Wissotski M., Ashley E., Morrow D., Fernandes J.,
RA   Walbot V., Yu Y.;
RT   "Sequencing, mapping, and analysis of 27,455 maize full-length cDNAs";
RL   PloS Genet. 5(11):E1000740-E1000740(2009).
XX
RN   [2]
RP   1-1265
RA   Yu Y., Currie J., Lomeli R., Angelova A., Collura K., Wissotski M.,
RA   Campos D., Kudrna D., Golser W., Ashely E., Haller K., Descour A.,
RA   Fernandes J., Zuccolo A., Soderlund C., Walbot V.;
RT   ;
RL   Submitted (30-JUL-2008) to the INSDC.
RL   Plant Sciences, Arizona Genomics Institute, 1657 E. Helen Street, Thomas
RL   Keating Building, Tucson, AZ 85721, USA
XX
DR   MD5; e85902017d3d30ed586bc3f932433764.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1265
FT                   /organism="Zea mays"
FT                   /strain="B73"
FT                   /mol_type="mRNA"
FT                   /clone="ZM_BFb0232G07"
FT                   /db_xref="taxon:4577"
FT   CDS_pept        44..1036
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /db_xref="GOA:B4FMT7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B4FMT7"
FT                   /protein_id="ACF83430.1"
FT                   /translation="MALVRQRRQLPHLTLPLDHFALRVPPQPQPTAAPSTSTSDARLSD
FT                   YERLSVLGHGNGGTVYKARHRRSAQPVALKLFADGDTSAAREAEILMLAADAPHVVRLH
FT                   AVIPSAAGEAPAALALELMPGGSLSGLLRRLDRPMGERPIAAVARQALLGLAAVHALRV
FT                   VHRDLKPSNLLVGADGEVKIADFGAGKVLRRRLDPCASYVGTAAYMSPERFDPEAYSGD
FT                   YDPYAADVWSLGVAILELYRGHFPLLPAGQRPDWAALMCAICFGEAPEPPAAASEEFRD
FT                   FVARCLEKKAGRRASVAELLEHPFVAEREAAGAQEALAALVKEAEQLDL"
XX
SQ   Sequence 1265 BP; 209 A; 444 C; 402 G; 210 T; 0 other;
     ccggcaactc ctcaccccag aggccacaac tgccaacaag ccaatggctc tcgtccgcca        60
     gcgccgccag ctgccgcacc ttaccctccc gctggaccac ttcgccctgc gcgtgccacc       120
     gcagcctcag cccaccgccg cgccgtccac ctccacgtcc gacgcccgcc tctccgacta       180
     cgagaggctc tccgttctcg gccacggcaa cggcggcacc gtgtacaagg cgcggcaccg       240
     ccggtccgcg cagccggtcg cactcaagct attcgcggac ggggacacct cggcggcgcg       300
     cgaggccgag atactgatgc tcgccgcgga cgcgccccac gtcgtgcgcc tacacgcggt       360
     gatcccgtcg gccgccgggg aggctcccgc ggcgctggcg ctggagctca tgcccggggg       420
     ctccctgtcg ggcctgctgc gccggctgga ccggccgatg ggggagcgcc ccatcgccgc       480
     cgtggcgcgg caggcgctcc tcgggctcgc cgcggtccac gcgctccgcg tcgtgcaccg       540
     cgacctgaag ccgtcgaacc tgctcgtcgg cgccgacggc gaggtgaaga tcgccgactt       600
     cggcgcgggc aaggtgctgc gccggcggct ggatccctgc gcgtcctacg tcggcacggc       660
     ggcgtacatg tcccccgagc ggttcgaccc ggaggcgtac tcgggagact acgaccccta       720
     cgccgccgac gtgtggagcc tcggggtggc catcctggag ctgtaccggg gccacttccc       780
     tctcctgccc gcgggccagc gcccggactg ggccgcgctg atgtgcgcca tatgcttcgg       840
     cgaggcgccg gagccgccgg ccgcggcgtc ggaagagttc cgggatttcg tggcgcggtg       900
     cttagagaag aaggccgggc ggcgcgcgtc ggtggccgag ctgctggagc acccgttcgt       960
     cgccgagcgg gaagcggccg gcgcacagga ggcgctcgcc gcgctcgtga aagaggcgga      1020
     gcagctggac ctatagacag acttacagta attcacgttt aggacaagct gagatgtaaa      1080
     ttacgccata ttttttgttt atccgtttat tgagtttaat aatcaaatct cagaagtcaa      1140
     caaaattagt gaaattcaag attccctcga ccacgctgct cgctgcctag attgctgtta      1200
     aagtagttca tttgaagtga tgcttctaca ctatacagac atgaacaaac ctaaactgct      1260
     tcagc                                                                  1265
//

If you have problems or comments...

PBIL Back to PBIL home page