(data stored in ACNUC8465 zone)

EMBL: BT065734

ID   BT065734; SV 1; linear; mRNA; STD; PLN; 1641 BP.
XX
AC   BT065734;
XX
DT   25-FEB-2009 (Rel. 99, Created)
DT   14-JUN-2012 (Rel. 113, Last updated, Version 2)
XX
DE   Zea mays full-length cDNA clone ZM_BFc0051O10 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Zea mays
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade;
OC   Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-1641
RX   PUBMED; 19936069.
RA   Soderlund C., Descour A., Kudrna D., Bomhoff M., Boyd L., Currie J.,
RA   Angelova A., Collura K., Wissotski M., Ashley E., Morrow D., Fernandes J.,
RA   Walbot V., Yu Y.;
RT   "Sequencing, mapping, and analysis of 27,455 maize full-length cDNAs";
RL   PloS Genet. 5(11):E1000740-E1000740(2009).
XX
RN   [2]
RP   1-1641
RA   Yu Y., Currie J., Lomeli R., Angelova A., Collura K., Wissotski M.,
RA   Campos D., Kudrna D., Golser W., Ashely E., Haller K., Descour A.,
RA   Fernandes J., Soderlund C., Walbot V.;
RT   ;
RL   Submitted (24-FEB-2009) to the INSDC.
RL   Plant Sciences, Arizona Genomics Institute, 1657 E. Helen Street, Thomas
RL   Keating Building, Tucson, AZ 85721, USA
XX
DR   MD5; 5f0552ed4c7529729daa3c822d8dcd87.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1641
FT                   /organism="Zea mays"
FT                   /strain="B73"
FT                   /mol_type="mRNA"
FT                   /clone="ZM_BFc0051O10"
FT                   /db_xref="taxon:4577"
FT   CDS_pept        320..1372
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /db_xref="GOA:C0PBR5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C0PBR5"
FT                   /protein_id="ACN31610.1"
FT                   /translation="MATPRKPIKLTLPSHETTIGKFLTHSGTFTDGDLRVNKDGLRIVS
FT                   RREGGEAPPIEPLDSQLSLDDLDVIKVIGKGSSGNVQLVRHKFTGQFFALKVIQLNIDE
FT                   SIRKQIAKELKINLSTQCQYVVVFYQCFYFNGAISIVLEYMDGGSLADFLKTVKTIPEA
FT                   YLAAICTQMLKGLIYLHNEKRVIHRDLKPSNILINHRGEVKISDFGVSAIISSSSSQRD
FT                   TFIGTRNYMAPERIDGKKHGSMSDIWSLGLVILECATGIFPFPPCESFYELLVAVVDQP
FT                   PPSAPPDQFSPEFCGFISACLQKDANDRSSAQALLDHPFLSMYDDLHVDLASYFTTAGS
FT                   PLATFNSRQL"
XX
SQ   Sequence 1641 BP; 419 A; 382 C; 411 G; 429 T; 0 other;
     ggttttcaat ggcattgacc ggtagaacac gtgcccggac gccaattatc tcgccctttc        60
     agatttgaga acaacaagga ggaaaagtaa acgcaagttc aggaaagggg agcctcaaaa       120
     ggagagggag agtgagaggg aggggaagtg cgctgcagtg ctgcgcagct gcgctgggga       180
     gaagagaaga aggtgccaac cacttcccaa ggagaccgcc agctctgctg ctgcacgacc       240
     gaccagcccg tccactcgcc tcgccttcct ccgagccccg gcgaggaaga ggaacccggc       300
     gccgccggac gcacttccga tggcgacgcc acggaagccg atcaagctca cgctgccgtc       360
     ccacgagacc accatcggca agttcctgac gcacagcggg acgttcacgg acggggatct       420
     gcgcgtcaac aaggacggcc tccgcatcgt ctcgcggagg gagggaggcg aggctcctcc       480
     tatagagccg ttggatagtc aactgagctt agatgatcta gacgttataa aagtgatcgg       540
     gaaaggtagc agcggaaatg tgcaattggt ccgccacaaa tttactggcc agttttttgc       600
     tctgaaggtt attcaactaa atattgatga gagtatacgc aaacagattg ccaaggagtt       660
     gaagataaac ttatcaacac agtgccaata tgttgttgtg ttctatcagt gtttctattt       720
     caatggtgcc atttctattg ttttggaata catggatggt ggctcccttg cagatttcct       780
     gaagactgtt aaaaccattc cagaggccta cctcgctgct atctgtacgc agatgctaaa       840
     aggactgatc tatttgcata acgagaagcg cgttatacac cgagatctga aaccatcaaa       900
     tatattgata aatcataggg gtgaagtaaa aatatcagat tttggtgtga gtgccattat       960
     atctagttcc tcttcgcaac gagatacatt tattggcaca cgcaactaca tggcgccaga      1020
     aagaatcgat ggaaagaaac atggttctat gagtgatatc tggagtttgg gactagtgat      1080
     actggaatgt gcaaccggca tctttccatt tcctccttgt gaaagcttct acgaacttct      1140
     cgtggctgtt gttgatcaac cgccaccttc tgcgccgccg gatcagtttt caccagaatt      1200
     ctgtgggttc atttctgcat gtctccagaa ggatgctaat gacaggtcat cagcccaagc      1260
     cttattggac catccgttcc tgagcatgta tgatgacctg catgtagatc ttgcttcgta      1320
     cttcacgaca gcaggatctc ctctcgccac cttcaattcc aggcaactct aatttttttg      1380
     tcctccttat tacgcgaacg gtgtggcgac aaatttctct ttttggacaa ggcttggatt      1440
     gtgtactgag ctgtaatgat cttgtgtgtg tcaggtcggt gattggctcc atcactttac      1500
     atatatgaca tacatgtaca gccttttagg ataaaaatga gcactgaagt tttgcctatc      1560
     tgtatatcgg cagcaaacgt ttggtcatgt ttgtttcacc ttgtaatgta ttgactcaga      1620
     tatgggattg gtcattgtct c                                                1641
//

If you have problems or comments...

PBIL Back to PBIL home page