(data stored in ACNUC8465 zone)

EMBL: BT068528

ID   BT068528; SV 1; linear; mRNA; STD; PLN; 1498 BP.
XX
AC   BT068528;
XX
DT   27-FEB-2009 (Rel. 100, Created)
DT   14-JUN-2012 (Rel. 113, Last updated, Version 2)
XX
DE   Zea mays full-length cDNA clone ZM_BFb0292I12 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Zea mays
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade;
OC   Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-1498
RX   PUBMED; 19936069.
RA   Soderlund C., Descour A., Kudrna D., Bomhoff M., Boyd L., Currie J.,
RA   Angelova A., Collura K., Wissotski M., Ashley E., Morrow D., Fernandes J.,
RA   Walbot V., Yu Y.;
RT   "Sequencing, mapping, and analysis of 27,455 maize full-length cDNAs";
RL   PloS Genet. 5(11):E1000740-E1000740(2009).
XX
RN   [2]
RP   1-1498
RA   Yu Y., Currie J., Lomeli R., Angelova A., Collura K., Wissotski M.,
RA   Campos D., Kudrna D., Golser W., Ashely E., Haller K., Descour A.,
RA   Fernandes J., Soderlund C., Walbot V.;
RT   ;
RL   Submitted (25-FEB-2009) to the INSDC.
RL   Plant Sciences, Arizona Genomics Institute, 1657 E. Helen Street, Thomas
RL   Keating Building, Tucson, AZ 85721, USA
XX
DR   MD5; 002fc54e2e637e9219a11c2248110833.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1498
FT                   /organism="Zea mays"
FT                   /strain="B73"
FT                   /mol_type="mRNA"
FT                   /clone="ZM_BFb0292I12"
FT                   /db_xref="taxon:4577"
FT   CDS_pept        147..1214
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /db_xref="GOA:O49975"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:O49975"
FT                   /protein_id="ACN35425.1"
FT                   /translation="MKGKKPVKELKLTVPAQETPVDKFLTASGTFKDGELRLNQSGLRL
FT                   ISEENGDEDESTKLKVEDVQLSMDDLEMIQVIGKGSGGVVQLVRHKWVGTLFALKGIQM
FT                   NIQESVRKQIVQELKINQATQSPHIVMCHQSFYHNGVIYLVLEYMDRGSLADIVKQVKT
FT                   ILEPYLAVLCKQVLEGLLYLHHQRHVIHRDIKPSNLLVNRKGEVKITDFGVSAVLASSI
FT                   GQRDTFVGTYNYMAPERISGSTYDYKSDIWSLGLVILECAIGRFPYIPSEGEGWLSFYE
FT                   LLEAIVDQPPPSAPADQFSPEFCSFISSCIQKDPAQRMSASELLNHPFLKKFEDKDLNL
FT                   GILVENLEPPMNIPE"
XX
SQ   Sequence 1498 BP; 388 A; 332 C; 365 G; 413 T; 0 other;
     cggcaagggt gtcaaggtcc cgtaaaatct ggcttttctc cctccccata ccccgcagtc        60
     ccgcacacac actcgctttc ttcggttctt cctcctcgag cagccacttc cgtctctaac       120
     cctacagcga cgacgagagc gaggccatga aggggaagaa gccggtcaag gagctcaagc       180
     tcaccgtgcc ggcgcaggag accccggtag acaagttcct gacggcaagt ggcacgttca       240
     aggatggtga gctgaggctc aatcagagcg gcttgcggct tatctctgag gaaaacgggg       300
     atgaagatga atctacaaag ctgaaggtgg aagatgtgca gttatcaatg gatgatcttg       360
     agatgattca agtcattggc aaaggaagcg gtggtgttgt ccagctagtg aggcacaaat       420
     gggtgggcac attatttgcc ttaaagggta ttcaaatgaa cattcaggag tcagttcgta       480
     aacaaatagt acaggagctc aaaataaacc aagcaacaca gagccctcat atagttatgt       540
     gccatcaatc tttttaccac aatggtgtaa tatatcttgt tcttgagtac atggaccgtg       600
     gatcgcttgc agacattgtt aagcaagtga agactattct ggagccatac cttgcagtac       660
     tttgtaagca ggtcttggag ggtttattgt atcttcatca tcaaaggcac gtgattcaca       720
     gggacataaa accatctaac ttgttggtca accgtaaagg tgaagtcaag attaccgact       780
     tcggagtgag tgctgtgcta gcaagctcaa taggtcagcg agatacattt gttggaacct       840
     acaactatat ggcgcctgag cggattagtg gtagcactta tgactacaaa agtgacatat       900
     ggagtttggg cttagttata cttgagtgtg ccattggccg gttcccttat ataccttcgg       960
     aaggtgaagg ttggttaagc ttttatgaac ttctggaggc cattgtcgat cagccaccac      1020
     cttctgcacc tgcagatcag ttctctccag aattctgctc atttatctcc tcttgcatac      1080
     agaaagatcc ggctcagagg atgtctgctt cagaactctt gaatcaccct tttttgaaga      1140
     agttcgagga taaggactta aacctgggga ttcttgtgga gaacctggaa cctccaatga      1200
     atatacccga atagcctgtc gtttttagtg atgaagcctt tgttgtgcct tcagggtttg      1260
     gcctcgaagc ctcttggcat ctgctcctca actgcagcct ccctacctga atatgctata      1320
     acatcattgt atgattcaag ccccttatct gagcataaga gtagagggaa ctatgctgca      1380
     ttccgtgtat ggtcacctta ttgtagctat tgttgcgacg ggccttgtga ttttgagtct      1440
     tgttttaact tttgcagtct tatcggctgt ggattcaaaa tgaacgaact gaatattc        1498
//

If you have problems or comments...

PBIL Back to PBIL home page