(data stored in ACNUC26462 zone)

EMBL: BT083707

ID   BT083707; SV 1; linear; mRNA; STD; PLN; 1945 BP.
XX
AC   BT083707;
XX
DT   25-MAY-2009 (Rel. 100, Created)
DT   14-JUN-2012 (Rel. 113, Last updated, Version 2)
XX
DE   Zea mays full-length cDNA clone ZM_BFb0030E24 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Zea mays
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade;
OC   Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-1945
RX   PUBMED; 19936069.
RA   Soderlund C., Descour A., Kudrna D., Bomhoff M., Boyd L., Currie J.,
RA   Angelova A., Collura K., Wissotski M., Ashley E., Morrow D., Fernandes J.,
RA   Walbot V., Yu Y.;
RT   "Sequencing, mapping, and analysis of 27,455 maize full-length cDNAs";
RL   PloS Genet. 5(11):E1000740-E1000740(2009).
XX
RN   [2]
RP   1-1945
RA   Yu Y., Currie J., Lomeli R., Angelova A., Collura K., Wissotski M.,
RA   Campos D., Kudrna D., Golser W., Ashely E., Descour A., Fernandes J.,
RA   Soderlund C., Walbot V.;
RT   ;
RL   Submitted (23-MAY-2009) to the INSDC.
RL   Plant Sciences, Arizona Genomics Institute, 1657 E. Helen Street, Thomas
RL   Keating Building, Tucson, AZ 85721, USA
XX
DR   MD5; 21d8f04dcd0fbc0a646cf562d1146164.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1945
FT                   /organism="Zea mays"
FT                   /strain="B73"
FT                   /mol_type="mRNA"
FT                   /clone="ZM_BFb0030E24"
FT                   /db_xref="taxon:4577"
FT   CDS_pept        378..1721
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /db_xref="GOA:C4IYR0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004041"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018451"
FT                   /db_xref="UniProtKB/TrEMBL:C4IYR0"
FT                   /protein_id="ACR34060.1"
FT                   /translation="MEIKDMKTRGKTLTERYEMGKLLGKGAFGKVHYARDLESNQGVAI
FT                   KIMDKDRVLKAGLSEQVKREITTMRLVEHKNIVRLHEVMATRNKIYIIMEYAKGGELLD
FT                   KVKRSGRLTEADTHRYFQQLIGALDHCHSRGVYHRDLKRENLLLDENGDLKVSDFGLSA
FT                   FSESRRTDGLLHTVCGTPVYIAPEVIKKTGYDGAKSDIWSCGVVLFVLAAGYLPFQGPN
FT                   MMEIYRKIHDSDFRCPSWFSHKLKRLLYKILNPNPSMRPSIQEIKESTWFRKGPREISA
FT                   VKEKVLSENATATNAAPVLAARRKEIAHEDKTLVATKLNAFEIIAFSAGLDLSGLFIKE
FT                   CRKETRFTSDKPALAIISKLEDVAKALNLRIRKKDNNTVIIQGRKHGGNGVLQFDTQIF
FT                   EITPSCHLVQMKQTSGDLLEYQKLLEEGIRPGLKDVVWAWHGDDLQQK"
XX
SQ   Sequence 1945 BP; 524 A; 440 C; 524 G; 457 T; 0 other;
     gtatctcaac tccgccaagc caagctcagc gaaaactcag gcgatcggac gacgccccaa        60
     ggaacaagtg cagcggaacg aagcttcggc gtcctcgtcg tcccgtcgca agtgcagatc       120
     acaagtccat aacaagaaag acaacaaaac tatgctgaaa gatgtgcttg catagaagag       180
     acttctgcag caacaccacc aagggcctgg tggttcttgc gcaaggtccg caggcctgct       240
     cgtctcttga cttgagcggc ggtcaccttg cctgcatcta ctccacgccc ttcagactcc       300
     gacgccaccg acccataagg cgcagtccac ctgattgaca acagaaagct agccctgtgc       360
     gtgatcacat agtttttatg gagataaaag atatgaagac cagagggaag actttgacgg       420
     agcggtacga gatggggaag ctgctgggga aaggcgcgtt cgggaaggtg cactatgcaa       480
     gggacctcga gtccaaccag ggtgttgcta tcaagatcat ggacaaggac agggtgctca       540
     aggccgggct ctcggagcag gtaaagcgtg agatcacgac tatgcggctg gtggaacaca       600
     aaaacatcgt tcgtctccat gaggtcatgg cgacacggaa caagatctac atcatcatgg       660
     agtatgccaa agggggtgag ctcttagaca aggttaagag gagcggcagg ctgacggagg       720
     ctgacacaca cagatacttc caacagctca ttggcgcact ggatcactgc cacagccgag       780
     gcgtgtacca ccgggacttg aagcgtgaga atctgttgtt ggatgagaat ggggacctta       840
     aggtgtctga ctttggactg agcgcgtttt cagagtcgag gaggacagat gggctgctcc       900
     atactgtctg tgggacacca gtgtatatag ctccggaggt gatcaagaag acgggatacg       960
     atggtgcaaa atcagacatc tggtcttgtg gtgtcgtcct gtttgttctc gctgctggct      1020
     acctcccttt ccagggccca aacatgatgg agatttatcg aaagatacat gatagtgatt      1080
     tcaggtgccc cagttggttt tcacacaaac tcaagaggct gctatacaag attctgaacc      1140
     ccaaccctag catgagacct tcaattcagg agataaaaga gtctacctgg tttcgaaaag      1200
     gtcctaggga gatcagtgca gtgaaggaga aagttcttag cgagaatgcc accgccacaa      1260
     atgctgcccc agtgcttgct gctaggcgca aggagattgc tcacgaagat aagaccctgg      1320
     ttgccacaaa actcaatgcc tttgaaatca tcgcgttctc agcagggttg gacctttctg      1380
     gtctgtttat caaggagtgc aggaaggaga cacggttcac ttcagataag cctgcattgg      1440
     ccatcatctc aaagcttgaa gatgtcgcga aagcactgaa tctcaggata aggaagaagg      1500
     acaacaacac tgtcatcatt caagggagga agcatggggg caatggtgtc cttcagtttg      1560
     acacgcagat ctttgagatc acaccatcct gccatctcgt tcagatgaaa caaactagtg      1620
     gcgatctact tgagtaccag aaactgttgg aagagggcat ccgaccaggg ctgaaggacg      1680
     ttgtctgggc ttggcatgga gatgatctgc agcagaagta ggagtagctt cagctgtctc      1740
     ccgtagatta tgttctacat tccattcctt attttttagc aacaacattc ccttttttgt      1800
     attggtggtg atatgaacca ttaggctatg ttttgtttga gcaataattg ttgtggagtt      1860
     gagttgttgt gttacattct gaagattgtt acagttttgt aatggctgtc aatatcagta      1920
     atgaaaataa atgttgttga tcctt                                            1945
//

If you have problems or comments...

PBIL Back to PBIL home page