(data stored in ACNUC30630 zone)

EMBL: BX248354

ID   BX248354; SV 1; linear; genomic DNA; STD; PRO; 348517 BP.
XX
AC   BX248354;
XX
DT   06-NOV-2003 (Rel. 77, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 6)
XX
DE   Corynebacterium diphtheriae gravis NCTC13129, complete genome; segment 1/8
XX
KW   complete genome.
XX
OS   Corynebacterium diphtheriae
OC   Bacteria; Actinobacteria; Corynebacteriales; Corynebacteriaceae;
OC   Corynebacterium.
XX
RN   [1]
RP   1-348517
RX   DOI; 10.1093/nar/gkg874.
RX   PUBMED; 14602910.
RA   Cerdeno-Tarraga A.M., Efstratiou A., Dover L.G., Holden M.T.G., Pallen M.,
RA   Bentley S.D., Besra G.S., Churcher C., James K.D., De Zoysa A.,
RA   Chillingworth T., Cronin A., Dowd L., Feltwell T., Hamlin N., Holroyd S.,
RA   Jagels K., Moule S., Quail M.A., Rabbinowitsch E., Rutherford K.,
RA   Thomson N.R., Unwin L., Whitehead S., Barrell B.G.Parkhill.J.;
RT   "The complete genome sequence and analysis of Corynebacterium diphtheriae
RT   NCTC13129";
RL   Nucleic Acids Res. 31(22):6516-6523(2003).
XX
RN   [2]
RP   1-348517
RA   Cerdeno-Tarraga A.M.;
RT   ;
RL   Submitted (03-OCT-2003) to the INSDC.
RL   Cerdeno-Tarraga A.M., submitted on behalf of the Pathogen Sequencing Unit,
RL   Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA
RL   E-mail: amct@sanger.ac.uk
XX
DR   MD5; 33f7946ef2e0fd5453a894d9d0989b33.
DR   ENA-CON; BX248353.
DR   BioSample; SAMEA1705951.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01766; cspA.
DR   StrainInfo; 118780; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..348517
FT                   /organism="Corynebacterium diphtheriae"
FT                   /strain="NCTC13129"
FT                   /mol_type="genomic DNA"
FT                   /note="biotype gravis"
FT                   /db_xref="taxon:1717"
FT   CDS_pept        19..1677
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="DIP0001"
FT                   /product="chromosomal replication initiator protein"
FT                   /note="Similar to Mycobacterium tuberculosis chromosomal
FT                   replication initiator protein DnaA or Rv0001 or MT0001 or
FT                   MTV029.01 SW:DNAA_MYCTU (P49993) (507 aa) fasta scores:
FT                   E(): 6.4e-73, 49.1% id in 556 aa"
FT                   /db_xref="GOA:Q6NKL7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NKL7"
FT                   /protein_id="CAE48512.1"
FT                   /translation="MWNETWNEITNELIQLSREPESEIPRITAEQRAYLKLVRPAAFVE
FT                   GIAVLRVPHSRAKETIETHLGQAITSVLSRRMGRPFTVAVTVDPTLDVIQDLPHDVPEQ
FT                   HIVQHHVPEHPHYSPVSQGYPPHYAPEQSEYNTEYSDEYPSGWATYHVQTPQPSQSSQS
FT                   AQQQPAQRMPDRRRYAEQQQVPQRSEEPVMGQRRAREKPAHDPDRNGSLNPRYTFDTYV
FT                   VSDSNKLPWSAAWAVAEKPARAYNPLFIWGDSGLGKTHLMHAIGNYAQELDPKLKVKYV
FT                   SSEEFTNDYINSVRDDRQEAFKRRYRDLDILMVDDIQFLQGKEGTQEEFFHTFNALQQA
FT                   DKQIVLSSDRPPKQLTTLEDRLRTRFQSGLIADIYPPDLETRIAILLNKASAEGITADR
FT                   DVLELIASRFNASIRELEGAFIRVSAYASLNEAPINMATAQEALRDMMPEQADIEITAG
FT                   MIMSVTAEYFHIDVDTLKGSGKSRSVAHPRQLAMYLCRELTDLSLPKIGEHFGGKDHTT
FT                   VMYAYRKIGKEITEKRDTYDEIQQLTQQIKSSDRA"
FT   misc_feature    652..1593
FT                   /note="HMMPfam hit to PF00308, Bacterial dnaA protein"
FT   misc_feature    748..1134
FT                   /note="HMMSmart hit to SM00382, ATPases associated with a
FT                   variety of cellular activities"
FT   misc_feature    751..813
FT                   /note="FPrintScan hit to PR00051, Bacterial chromosomal
FT                   replication initiator (DNAA) signature"
FT   misc_feature    772..795
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    847..891
FT                   /note="FPrintScan hit to PR00051, Bacterial chromosomal
FT                   replication initiator (DNAA) signature"
FT   misc_feature    943..987
FT                   /note="FPrintScan hit to PR00051, Bacterial chromosomal
FT                   replication initiator (DNAA) signature"
FT   misc_feature    1045..1128
FT                   /note="FPrintScan hit to PR00051, Bacterial chromosomal
FT                   replication initiator (DNAA) signature"
FT   misc_feature    1534..1593
FT                   /note="FPrintScan hit to PR00051, Bacterial chromosomal
FT                   replication initiator (DNAA) signature"
FT                   /note="ScanRegExp hit to PS01008, DnaA protein signature."
FT   CDS_pept        2286..3503
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="DIP0002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /note="Similar to Mycobacterium smegmatis DNA polymerase
FT                   III, beta chain DnaN SW:DP3B_MYCSM (P52851) (397 aa) fasta
FT                   scores: E(): 1.3e-76, 50.51% id in 390 aa"
FT                   /db_xref="GOA:Q6NKL6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKL6"
FT                   /protein_id="CAE48513.1"
FT                   /translation="MINHIEEPSSMDAHAVSFRVEKDDLSGAVSWVARNLPTKPTQPVL
FT                   RAVVITADDEGLEFAGFDYEVSTKVHINADVRQPGRIAVAGKLMSDIIGTLPNKTIEVF
FT                   VEGTQVQVVCGSSRFELPLIPLDEYPPLPQLPAVTGAIDPNLFTDAVLQVAAAAGRDET
FT                   LPMLTGIHMEIDGENVTLTATDRFRLALRRFTWSPANPEAKAKLLIPAKNLSDNARSLD
FT                   SGSTEPVEIAVGTGENIGAEGLFGIHIDNRQTTTRMLDADFPNVSPLLPKVHNAMASVE
FT                   ISALSDAIRRVALVAERNAQIRMQFTRDEVILSAGGSDAGHAEESVPCAFTGDQEFLIA
FT                   FNSAYLRDGLSVIRTSRVVFGFTEPSRPAIMIPEPETLPEASADGTYPTPDTEFTYLLM
FT                   PVRLPG"
FT   misc_feature    2331..2684
FT                   /note="HMMPfam hit to PF00712, DNA polymerase III beta
FT                   subunit, N-terminal domain"
FT   misc_feature    2379..3443
FT                   /note="HMMSmart hit to SM00480, DNA polymerase III beta
FT                   catalytic subunit"
FT   misc_feature    2706..3080
FT                   /note="HMMPfam hit to PF02767, DNA polymerase III beta
FT                   subunit, central domain"
FT   misc_feature    3084..3395
FT                   /note="HMMPfam hit to PF02768, DNA polymerase III beta
FT                   subunit, C-terminal domain"
FT   CDS_pept        3542..4735
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="DIP0003"
FT                   /product="DNA replication and repair protein"
FT                   /note="Similar to Mycobacterium smegmatis DNA replication
FT                   and repair protein RecF SW:RECF_MYCSM (P50916) (384 aa)
FT                   fasta scores: E(): 1.1e-75, 55.38% id in 390 aa"
FT                   /db_xref="GOA:Q6NKL5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NKL5"
FT                   /protein_id="CAE48514.1"
FT                   /translation="MYIRELSLRDFRSWPECTVTLEPGVTLFVGRNGFGKTNIVEAIGY
FT                   VAHLGSHRVFHDSALVRQGKESARVSVTAVNHGRELTAHLLIKAKGANQAQINRTRLKS
FT                   PRELLGVVKTVLFSPEDLSLVRGDPAERRRYLDHVIATRKPRLGGVKADYDKVLRQRNS
FT                   LLKTAGAALRRGYGADDGALSTLDVWDSQLARLGGQLIHARHSVVRELGPLVHDAYARI
FT                   APESRPAHIRYVSTVPFADVVELPSPEEFEAAMLAELGQCRDKEIDRGVSLVGPHRDDL
FT                   DVVLGDYPAKGFASHGETWSMCLSLRLAEFHLLRNDGTDPVLILDDVFAELDTQRREKL
FT                   VSVTAEAEQVLITAAVGDDLPDTLTESAVHRHFVSVADTPEGRISLLDAATGVPHDG"
FT   misc_feature    3548..3670
FT                   /note="HMMPfam hit to PF00470, RecF protein"
FT   misc_feature    3629..3652
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    3890..3952
FT                   /note="ScanRegExp hit to PS00617, RecF protein signature
FT                   1."
FT   misc_feature    4505..4561
FT                   /note="ScanRegExp hit to PS00618, RecF protein signature
FT                   2."
FT   CDS_pept        4725..5276
FT                   /transl_table=11
FT                   /locus_tag="DIP0004"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium paratuberculosis
FT                   hypothetical 17.5 kDa protein TR:Q9L7L4 (EMBL:AF222789)
FT                   (166 aa) fasta scores: E(): 5.6e-18, 45.45% id in 143 aa"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKL4"
FT                   /protein_id="CAE48515.1"
FT                   /translation="MTDNDAVSAAFAHMRQEAKKRTGTVPNLNRPLPKASKSLADNDAT
FT                   PAVPKQRGMATGPDGRRRRRSYSVQRAGSILSDEIKKRGWRKEIAGGWVNSHWDDLVGA
FT                   QIAAHTKVEMFKDKALFITCDSTAWATNLRMMQRIILRSISEQIGPDIIVELKIFGPKA
FT                   PSWRHGPLHVKGRGPRDTYG"
FT   CDS_pept        5379..7436
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="DIP0005"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="Similar to Mycobacterium smegmatis DNA gyrase
FT                   subunit B GyrB SW:GYRB_MYCSM (P48355) (675 aa) fasta
FT                   scores: E(): 1.6e-127, 71.93% id in 684 aa"
FT                   /db_xref="GOA:Q6NKL3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKL3"
FT                   /protein_id="CAE48516.1"
FT                   /translation="MHASVATAEHEYGASSITILEGLEAVRKRPGMYIGSTGERGLHHL
FT                   VWEVVDNSVDEAMAGYATHVDVTLLADGGVEVVDNGRGIPVEMHPSGAPTVQVVMTQLH
FT                   AGGKFDSDSYAVSGGLHGVGISVVNALSTRVEADIKRDGKHWLQNFSMAIPDPLVEGGN
FT                   ARGTGTTIRFWPDAEIFETTTFKFETISRRLQEMAFLNKGLTITLVDKRVTDEELELEA
FT                   IAEEGDTAENVSLDQIDVDADGNIDAPAAPKKREKKKVFFYPDGLKDYVAHLNKSKQVI
FT                   HPTIISFDAKGNDHEVEVAMQWNNSYSQSVHTFANTINTFEGGTHEEGFRAALTSLMNR
FT                   YAREHKLLKEKEANLTGDDCREGLSAVISVRVGDPQFEGQTKTKLGNTEVKGFVQRMVN
FT                   EHIADWLDANPAEAKTIINKAVSSAHARVAARKARDLVRRKSATDLGGLPGKLADCRSK
FT                   DPEKSELYIVEGDSAGGSAKAGRDSLYQAILPLRGKILNVEKARLDKVLKNAEVQAIIT
FT                   ALGTGIHDEFDIKKLRYHKIVLMADADVDGSHIATLLLTLLFRFMPQLIEEGHVYLAQP
FT                   PLYKLKWGKGEPGFAYSDAERDTLLAEGLAQNRKINKDDGIQRYKGLGEMNASELWETT
FT                   LDPKYRVLRRVDITDAQRADEIFSILMGDDVSARRSFITRRAKDVRFLDI"
FT   misc_feature    5412..5444
FT                   /note="FPrintScan hit to PR01159, DNA gyrase subunit B
FT                   signature"
FT   misc_feature    5487..5915
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, phytochrome-like ATPase"
FT                   /note="HMMSmart hit to SM00387, Histidine kinase-like
FT                   ATPases"
FT   misc_feature    5499..5546
FT                   /note="FPrintScan hit to PR00418, DNA topoisomerase II
FT                   family signature"
FT   misc_feature    5499..7412
FT                   /note="HMMSmart hit to SM00433, TopoisomeraseII"
FT   misc_feature    5604..5645
FT                   /note="FPrintScan hit to PR00418, DNA topoisomerase II
FT                   family signature"
FT   misc_feature    5730..5774
FT                   /note="FPrintScan hit to PR00418, DNA topoisomerase II
FT                   family signature"
FT   misc_feature    5928..5975
FT                   /note="FPrintScan hit to PR01159, DNA gyrase subunit B
FT                   signature"
FT   misc_feature    5928..6602
FT                   /note="HMMPfam hit to PF00204, DNA topoisomerase II
FT                   (N-terminal region)"
FT   misc_feature    5973..6014
FT                   /note="FPrintScan hit to PR01159, DNA gyrase subunit B
FT                   signature"
FT   misc_feature    6237..6293
FT                   /note="FPrintScan hit to PR01159, DNA gyrase subunit B
FT                   signature"
FT   misc_feature    6315..6356
FT                   /note="FPrintScan hit to PR00418, DNA topoisomerase II
FT                   family signature"
FT   misc_feature    6447..6497
FT                   /note="FPrintScan hit to PR01159, DNA gyrase subunit B
FT                   signature"
FT   misc_feature    6591..6635
FT                   /note="FPrintScan hit to PR01159, DNA gyrase subunit B
FT                   signature"
FT   misc_feature    6633..6695
FT                   /note="FPrintScan hit to PR01159, DNA gyrase subunit B
FT                   signature"
FT   misc_feature    6771..6815
FT                   /note="FPrintScan hit to PR00418, DNA topoisomerase II
FT                   family signature"
FT   misc_feature    6777..6803
FT                   /note="ScanRegExp hit to PS00177, DNA topoisomerase II
FT                   signature."
FT   misc_feature    6855..7100
FT                   /note="HMMPfam hit to PF01751, Toprim domain"
FT   misc_feature    6921..6950
FT                   /note="FPrintScan hit to PR01159, DNA gyrase subunit B
FT                   signature"
FT   misc_feature    6951..7172
FT                   /note="BlastProDom hit to PD000616, PD000616"
FT   misc_feature    6969..7019
FT                   /note="FPrintScan hit to PR00418, DNA topoisomerase II
FT                   family signature"
FT   misc_feature    7023..7076
FT                   /note="FPrintScan hit to PR00418, DNA topoisomerase II
FT                   family signature"
FT   misc_feature    7083..7121
FT                   /note="FPrintScan hit to PR00418, DNA topoisomerase II
FT                   family signature"
FT   misc_feature    7200..7400
FT                   /note="HMMPfam hit to PF00986, DNA gyrase B subunit,
FT                   carboxyl terminus"
FT   misc_feature    7203..7397
FT                   /note="BlastProDom hit to PD149633, PD149633"
FT   misc_feature    7227..7277
FT                   /note="FPrintScan hit to PR00418, DNA topoisomerase II
FT                   family signature"
FT   misc_feature    7290..7328
FT                   /note="FPrintScan hit to PR01159, DNA gyrase subunit B
FT                   signature"
FT   misc_feature    7338..7388
FT                   /note="FPrintScan hit to PR01159, DNA gyrase subunit B
FT                   signature"
FT   CDS_pept        complement(7503..7940)
FT                   /transl_table=11
FT                   /locus_tag="DIP0006"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKL2"
FT                   /protein_id="CAE48517.1"
FT                   /translation="MSTLAQLLDTKRTALAAELAGFIDRSVSQSSGISGVALKGAVAAA
FT                   KKVRPDIVTKGAERLLPEVVEVLDPYWASFEASDSTHFGEFLEQHKSEVSDKILEVADR
FT                   NAEKVDMPALKKAYGSLRGKAASFIEPNLPGLGQIMQNYMK"
FT   CDS_pept        complement(8201..8473)
FT                   /transl_table=11
FT                   /locus_tag="DIP0007"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKL1"
FT                   /protein_id="CAE48518.1"
FT                   /translation="MRGLTPEQTLMLADAFCAQTSGDLSVRDYAALNAIAAVTTAHIHA
FT                   VVVFPTAHHMVKYVRSLVIQLSPLDDRNTDFADFLVAVLRDLNGL"
FT   CDS_pept        complement(8478..8681)
FT                   /transl_table=11
FT                   /locus_tag="DIP0008"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical 7.1
FT                   kDa protein SC10A5.13 TR:O54104 (EMBL:AL021529) (64 aa)
FT                   fasta scores: E(): 0.18, 52.5% id in 40 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKL0"
FT                   /protein_id="CAE48519.1"
FT                   /translation="MAMTLRLTAEHDRALALLAQAQGCSKQEAATRAIIAAAARMLADE
FT                   EVRTLARQHLPHYAATEHRLGR"
FT   CDS_pept        8792..11362
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="DIP0009"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="Similar to Mycobacterium smegmatis DNA gyrase
FT                   subunit A GyrA SW:GYRA_MYCSM (P48354) (842 aa) fasta
FT                   scores: E(): 0, 73.35% id in 837 aa"
FT                   /db_xref="GOA:Q6NKK9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKK9"
FT                   /protein_id="CAE48520.1"
FT                   /translation="MSDDLLGGDGYDRVHPIDLNEEMETSYIDYAMSVIVGRALPEVRD
FT                   GLKPVHRRILYAMYDSGYRPDRSYVKSARPVSDTMGQFHPHGDSAIYDTLVRLAQDWNM
FT                   RYPMVDGQGNFGSRGNDGPAAMRYTECRLTPLAMEMVRDIRENTVDFSPNYDGKTQEPD
FT                   VLPSRVPNLLMNGSNGIAVGMATNIPPHNLRELGDAIFWLLDNPEADEASALEACMKYV
FT                   KGPDFPTAGQIVGSQGINDAYTTGRGSIRMRGVTSIEEEGNRQIIVITELPYQVNPDNM
FT                   ISNIAEQVRDGKLAGISKIEDESSDRVGMRIVVTLKRDAVPRVVLNNLYKHSQLQTNFG
FT                   ANMLSIVDGVPRTLRLDQMLRHYVTHQIEVIVRRTQYRLDEAEKRAHILRGLVKALDML
FT                   DEVIALIRRSPTVDIARTGLMELLTVDEIQADAILAMQLRRLAALERQKIVDELAEIEL
FT                   EIADYKDILARPERQRAIVRDELAEIVDKYGDDRRTQIIAATGDVTEEDLIARENVVVT
FT                   ITSTGYAKRTKVDAYKSQRRGGKGVRGAELKQDDVVRHFFVSSTHDWILFFTNFGRVYR
FT                   LKAYELPEASRTARGQHVANLLEFQPEERIAQVIQIQSYEDAPYLVLATAQGRVKKSRL
FT                   SDYESNRSGGLIAINLNEGDKLIGAALCDNDDDLLLVSEEGQSIRFNANDDQLRPMGRA
FT                   TAGVKGMRFKGDDQLLAMTVVKPDAFLLVATSGGYGKRTSLDEYSPQGRGGQGVLTFKY
FT                   TPKRGKLIAAVVVDEDDEILAITSAGGVIRTVVNQIRPSSRATMGVRLVNLEDGVELLA
FT                   IDRNVEGEGEEAAEAVATGAVDGPAERGKQTEVDLGIDNADEEA"
FT   misc_feature    8840..10213
FT                   /note="HMMSmart hit to SM00434, DNA Topoisomerase IV"
FT   misc_feature    8903..10258
FT                   /note="HMMPfam hit to PF00521, DNA gyrase/topoisomerase IV,
FT                   subunit A"
FT   misc_feature    9671..9757
FT                   /note="ScanRegExp hit to PS00402, Binding-protein-dependent
FT                   transport systems inner membrane comp. sign."
FT   CDS_pept        11362..11706
FT                   /transl_table=11
FT                   /locus_tag="DIP0010"
FT                   /product="Putative membrane protein"
FT                   /note="Similar in its C-terminal region to Mycobacterium
FT                   leprae hypothetical 32.2 kDa protein MLB1770.07 or ML0007
FT                   TR:O32870 (EMBL:Z70722) (303 aa) fasta scores: E():
FT                   9.9e-08, 36.28% id in 113 aa"
FT                   /db_xref="GOA:Q6NKK8"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKK8"
FT                   /protein_id="CAE48521.1"
FT                   /translation="MATRDVIITRVAPGSAFKTALSLSLIGLISWLICVVILYFGMQAV
FT                   GIWDKINQVIGGVGGDQIVSFGLIISLAALLGTIVAIIATVLAPLTALAYNAFVDLFGG
FT                   VEVTMREELD"
FT   misc_feature    order(11419..11487,11557..11625)
FT                   /note="2 probable transmembrane helices predicted for
FT                   DIP0010 by TMHMM2.0"
FT   tRNA            11818..11891
FT                   /gene="tRNA-Ile"
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:11852..11854,aa:Ile)"
FT                   /note="tRNA Ile anticodon GAT, Cove score 85.68"
FT   tRNA            11904..11976
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:11937..11939,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 75.96"
FT   CDS_pept        complement(12176..12904)
FT                   /transl_table=11
FT                   /locus_tag="DIP0011"
FT                   /product="Putative regulatory protein"
FT                   /note="Similar to Escherichia coli glc operon
FT                   transcriptional activator GlcC or B2980 SW:GLCC_ECOLI
FT                   (P52072) (254 aa) fasta scores: E(): 1.2e-05, 23.5% id in
FT                   234 aa"
FT                   /db_xref="GOA:Q6NKK7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKK7"
FT                   /protein_id="CAE48522.1"
FT                   /translation="MHMSQSTQRAYQEVLDWLEKELRKGSIAIGDKLPGERALAEQFEL
FT                   SRASVREAIRILTSMGLVRTGTGSGPHSGAIVISEPSAGLSWAIRMHLSARSLPLKDLV
FT                   NTCILIESNAAADAATPKISPDSPERSHVLNEAHRLLDSMDDPTLPFHDYHIKDVNFHI
FT                   LITSLAGNLVTETIMESLRYSAIAFVIERLAMRTDWAEVSEKLQREHRNILRAIEERNP
FT                   DKARTLVHDHIADFYELTSH"
FT   misc_feature    complement(12686..12865)
FT                   /note="HMMSmart hit to SM00345, helix_turn_helix gluconate
FT                   operon transcriptional repressor, DNA-binding"
FT   misc_feature    complement(12695..12865)
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family"
FT   misc_feature    complement(12716..12766)
FT                   /note="FPrintScan hit to PR00035, GntR bacterial regulatory
FT                   protein HTH signature"
FT   misc_feature    complement(12734..12808)
FT                   /note="ScanRegExp hit to PS00043, Bacterial regulatory
FT                   proteins, gntR family signature."
FT   misc_feature    complement(12740..12805)
FT                   /note="Predicted helix-turn-helix motif with score 1020
FT                   (+2.66 SD) at aa 34-55, sequence PGERALAEQFELSRASVREAIR"
FT   misc_feature    complement(12764..12808)
FT                   /note="FPrintScan hit to PR00035, GntR bacterial regulatory
FT                   protein HTH signature"
FT   CDS_pept        complement(12992..14662)
FT                   /transl_table=11
FT                   /gene="lldP"
FT                   /gene_synonym="lctP"
FT                   /locus_tag="DIP0012"
FT                   /product="L-lactate permease"
FT                   /note="Similar to Escherichia coli L-lactate permease LldP
FT                   or LctP or B3603 SW:LLDP_ECOLI (P33231) (551 aa) fasta
FT                   scores: E(): 2.4e-68, 40.1% id in 561 aa"
FT                   /db_xref="GOA:Q6NKK6"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKK6"
FT                   /protein_id="CAE48523.1"
FT                   /translation="MDTFTANVSAVGGSTTASAIVALLPLITFFVMLLVVKAKAYVSGL
FT                   TALAVAIIVAIAAFHMPWNFALLSATQGAAFGLFPIVWIVVLALWFYQVTVASGRFQDM
FT                   RAIFDTVGGGDLRIQTILIAFCFGGLLEALAGFGAPVAITATMIMALGLKPLKTATVVL
FT                   IANTAPVAFGAVAIPITTAGTLTGLDSAHIGAVVGHQAPFFAALVPFIIVLIIDGVRGL
FT                   RETWPAALTIGLSFAISQWWSATYFSYELTDVVASLVGLIAAVLLLQVWKPKGLDAVRE
FT                   RLGVEKHEAAGRLTLSRTWMAVFPYVLVVAIFGVAKLWTLGIDIPKALAATDVKIPWPG
FT                   LHGHILNSSGEAIKSTTYNFQWLSSPGTLLLITGIIVAIVYSIFDDKGRYQLPLGRAAM
FT                   ELGLCFYRMRFSALTIVSVLSLAYVMNFSGQTLAIGTAVASLGAAFAFFSPVLGWVGTA
FT                   VTGSDTSANALFSNLQKTAAENIGLDPHLMTAANTSGGVVGKMISPQSLAIAASSVGME
FT                   GKESQIFRSVIWWSIGLLVVLCTMVFLQSNVLAWMLPTP"
FT   misc_feature    complement(order(13016..13081,13301..13366,13382..13447,
FT                   13511..13576,13694..13759,13850..13900,13931..13987,
FT                   14009..14074,14120..14185,14249..14314,14375..14440,
FT                   14462..14527,14558..14623))
FT                   /note="13 probable transmembrane helices predicted for
FT                   DIP0012 by TMHMM2.0"
FT   misc_feature    complement(13028..14614)
FT                   /note="HMMPfam hit to PF02652, L-lactate permease"
FT   misc_feature    complement(13082..13144)
FT                   /note="FPrintScan hit to PR00173, Glutamate-aspartate
FT                   symporter signature"
FT   misc_feature    complement(13526..13585)
FT                   /note="FPrintScan hit to PR00173, Glutamate-aspartate
FT                   symporter signature"
FT   misc_feature    complement(13862..13939)
FT                   /note="FPrintScan hit to PR00173, Glutamate-aspartate
FT                   symporter signature"
FT   misc_feature    complement(13997..14059)
FT                   /note="FPrintScan hit to PR00173, Glutamate-aspartate
FT                   symporter signature"
FT   misc_feature    complement(14549..14662)
FT                   /note="Signal peptide predicted for DIP0012 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.962) with cleavage site
FT                   probability 0.479 between residues 38 and 39"
FT   CDS_pept        15159..15632
FT                   /transl_table=11
FT                   /locus_tag="DIP0013"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="GOA:Q6NKK5"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKK5"
FT                   /protein_id="CAE48524.1"
FT                   /translation="MGAAMGPALAVDAAQEAPTADNSPAVEAPQTPEEGEQSAQTSQDN
FT                   PRYESQIVRAGHSAEAEQVGDVSEDTIFEYSEFDIPEGWFVSVDEDSGKVTVSTPPDAQ
FT                   DGDNYTVKVKAVDLDGNVTWSEVTFTVGDPETDNPEIEPLDADAPEVELPAAE"
FT   CDS_pept        15721..17364
FT                   /transl_table=11
FT                   /locus_tag="DIP0014"
FT                   /product="Putative membrane protein"
FT                   /note="Low similarity to Staphylococcus aureus subsp aureus
FT                   N315 SA0639 protein TR:Q99VT7 (EMBL:AP003131) (543 aa)
FT                   fasta scores: E(): 3e-23, 25.56% id in 485 aa"
FT                   /db_xref="GOA:Q6NKK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKK4"
FT                   /protein_id="CAE48525.1"
FT                   /translation="MIMVRLGVLCMVHGLTSTHMKVRQSKVGGRARWALILSVVLTWFS
FT                   VIGMCMAIIGAGRIIDGGGVSRWIIAGPFVVMVSFALRGWVLAGGQVAEERRVRRQLVE
FT                   RVFQAGEIRTSKFPTGAVVGLATESAEKMMAFRVGFMSQIVASLTSPLLVLVAMGWSSR
FT                   WWLAAVVAAMLPIVPLVVGGFRKMVVRVSHGSQDARKALAADYMDALRALGTLQLLGAS
FT                   ARVAQRLAARGEDNRVAVMQLLRGNQLILFAIDAVFSLAIVAVSAGLALFQVRQGVLTP
FT                   GQGITVIALSILLLEPMDHIGAFFYVGMAGWGAQRGIHGFITSLPTGHAHVPSAQPGCI
FT                   TMHDVSFSHGDSVVLSHAQLEIQRGQRVAIVGRSGAGKTTLLSLIAGMKTPQAGAITRG
FT                   GDCAVVAQHTWLFQGTIADNLRLARPEATEEEMWQALSSAQLADEIRTMPAGLSTLIGE
FT                   FGVGLSGGQAQRLSLARALISGRRIVLFDEPTAHVDLASEAKILDAINNLGRDYTVVMV
FT                   THRDTSLAHMDRIVRVTNGRIEEEEHQHAH"
FT   misc_feature    15811..16614
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region."
FT   misc_feature    order(15817..15885,15913..15981,16132..16200,16210..16269,
FT                   16465..16533,16576..16644)
FT                   /note="6 probable transmembrane helices predicted for
FT                   DIP0014 by TMHMM2.0"
FT   misc_feature    16810..17331
FT                   /note="HMMSmart hit to SM00382, ATPases associated with a
FT                   variety of cellular activities"
FT   misc_feature    16813..17328
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    16819..16896
FT                   /note="ProfileScan hit to PS50101, P-loop nucleotide
FT                   binding motif (does not find all)."
FT   misc_feature    16834..16857
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    17107..17151
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   misc_feature    17107..17319
FT                   /note="ProfileScan hit to PS50100, 2nd half motif for
FT                   nucleotide binding, associated with P-loop."
FT   CDS_pept        17354..19000
FT                   /transl_table=11
FT                   /locus_tag="DIP0015"
FT                   /product="Putative transport system, ATP-binding protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 probable transport ATP-binding protein MsbA or
FT                   B0914 or Z1260 or ECS0997 SWALL:MSBA_ECOLI (SWALL:P27299)
FT                   (582 aa) fasta scores: E(): 7e-30, 26.73% id in 561 aa, and
FT                   to Pasteurella multocida hypothetical protein PM1473
FT                   TR:Q9CKX8 (EMBL:AE006183) (552 aa) fasta scores: E():
FT                   6.1e-33, 27.97% id in 554 aa"
FT                   /db_xref="GOA:Q6NKK3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKK3"
FT                   /protein_id="CAE48526.1"
FT                   /translation="MRTEPTPWHLIRWLLGITRPVLRPLGASTLCRIINQILGIFLYVI
FT                   PAYSLVAGVGSVSSVVAIMVVIALLKALLRYAEHYLGHLVAFKALELIRIRVFRDIYPQ
FT                   APAIMRRTGPDAVGSGDMLTRLTRDIGQIEVFFAHTTAPVISAAVVPLGVVITIFMLSP
FT                   VHGLIAAVIFGVAVVVSLDNSAYRFAIRVSEHRGNITQHITDSVGGVAEIVGYDAQQRR
FT                   QHELRDREEPLQTAVRRRGGIVGTRLGVVAAARICVLTMLLPTTDNMALAVVCMFAVLR
FT                   CWDMINEVADLGNHFSNSLAAARRVWSLAHAGLALNDGPQPLPTATTGATVEWDNVTFT
FT                   YPAETTPALRNVCLTVPAGSWGAILGATGSGKSTLAALLLRYWDPTTGAIRVDGHDIRT
FT                   CPLEQLRSTVSIVTQDITLLNTTVADNLRLAQPNATDAELIDALTVACLDRELTLDTAV
FT                   GEQGANLSGGQRQRLSLAQALLRHGRVLILDEFTAHLNPALAANIRSRLREACPHTTII
FT                   EITHDLTYLDSYQWVAAIDSGSLIDAAQYSR"
FT   misc_feature    17405..18280
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region."
FT   misc_feature    order(17414..17482,17495..17563,17756..17824,17837..17896,
FT                   18080..18148)
FT                   /note="5 probable transmembrane helices predicted for
FT                   DIP0015 by TMHMM2.0"
FT   misc_feature    18425..18961
FT                   /note="HMMSmart hit to SM00382, ATPases associated with a
FT                   variety of cellular activities"
FT   misc_feature    18428..18967
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    18449..18472
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    18746..18790
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   misc_feature    18746..18958
FT                   /note="ProfileScan hit to PS50100, 2nd half motif for
FT                   nucleotide binding, associated with P-loop."
FT   tRNA            19068..19141
FT                   /gene="tRNA-Ile"
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:19102..19104,aa:Ile)"
FT                   /note="tRNA Ile anticodon GAT, Cove score 85.68"
FT   tRNA            19154..19226
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:19187..19189,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 75.96"
FT   CDS_pept        <19447..19767
FT                   /transl_table=11
FT                   /locus_tag="DIP0016"
FT                   /product="Putative membrane protein"
FT                   /note="No database matches. Possible membrane protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKK2"
FT                   /protein_id="CAE48527.1"
FT                   /translation="RNHRWANGRVGADSRNDRFSVVAGVDPAVGRIPMVALVAVMMKAV
FT                   ISTFDLQSVHPRAQLVIVDLSDADRGDSIVRALIVSTTSAVGFNLVGLGAARLGQHLRD
FT                   LP"
FT   misc_feature    order(19504..19572,19666..19734)
FT                   /note="2 probable transmembrane helices predicted for
FT                   DIP0016 by TMHMM2.0"
FT   CDS_pept        19865..20029
FT                   /transl_table=11
FT                   /locus_tag="DIP0017"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No strong consensus RBS usptream. No
FT                   significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKK1"
FT                   /protein_id="CAE48528.1"
FT                   /translation="MRGHRTRLRFAEPEGCHEAFAGHLGKNNSCRRHRDHAYRELADFG
FT                   VKRRANAQG"
FT   tRNA            20221..20293
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:20254..20256,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 75.96"
FT   CDS_pept        20524..20721
FT                   /transl_table=11
FT                   /locus_tag="DIP0018"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No strong consensus RBS usptream. No
FT                   significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKK0"
FT                   /protein_id="CAE48529.1"
FT                   /translation="MEFGAYGVVATEALWVARQCEQDARCSDCFVAANNRSNAGNVVIA
FT                   YECLWDKGVRPFNVALDALV"
FT   CDS_pept        complement(20713..20958)
FT                   /transl_table=11
FT                   /locus_tag="DIP0019"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No strong consensus RBS usptream. No
FT                   significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKJ9"
FT                   /protein_id="CAE48530.1"
FT                   /translation="MIRPRRYGVASRRSLFRRLGILARSAPPSPHYSPHAFIFDEVIHG
FT                   DYAQIVADNSMDSVTQYELWKAICSSLKDENFFELD"
FT   CDS_pept        complement(20955..21185)
FT                   /transl_table=11
FT                   /locus_tag="DIP0020"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No strong consensus RBS usptream. No
FT                   significant database matches"
FT                   /db_xref="GOA:Q6NKJ8"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKJ8"
FT                   /protein_id="CAE48531.1"
FT                   /translation="MNPITHSDTRAWDPTTIMWQVYPLGFAGVPVREPVDPAPRLGTAE
FT                   DWQSLVAACDERGIAVILNSVFSHVADVMRY"
FT   CDS_pept        21381..22379
FT                   /transl_table=11
FT                   /locus_tag="DIP0021"
FT                   /product="Putative solute-binding lipoprotein"
FT                   /note="Similar to Streptomyces coelicolor probable
FT                   solute-binding lipoprotein SC8F11.05 TR:Q9KZH3
FT                   (EMBL:AL353864) (340 aa) fasta scores: E(): 2.8e-63, 54.98%
FT                   id in 331 aa"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKJ7"
FT                   /protein_id="CAE48532.1"
FT                   /translation="MKSIKKTLKAAAAAVAALVTVTACSATGGAPRASDNPNGQAGGVD
FT                   TPRYTVAMITHGAPGDTFWDLVRKGAEDAARKNNIELRYSSDPEAPNQANLVQNAIDSR
FT                   VDGIAVTLPNADAIGPVARKAADKKIPIVALNAGMDAYQKYNISAFFGQEEKVAGTLAG
FT                   ERLAKDGARHALCVIHEQGNSSQEARCAGVKQGMGGNVETLYVNGKDLTSVQSTVQAKL
FT                   SQDKSIDWVMGLQAPVAMTSAEAVKNAGSAAKVATFDTNAQLVDAISSGAIAWAVDQQP
FT                   YMQGYLAVDSIWLAHRNGSTMGGGRPVYTGPSFVDSSNVDAISEAAKAGLR"
FT   misc_feature    21381..21476
FT                   /note="Signal peptide predicted for DIP0021 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.512 between residues 32 and 33"
FT   misc_feature    21522..22349
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar binding domain of the LacI family."
FT   CDS_pept        22376..23407
FT                   /transl_table=11
FT                   /locus_tag="DIP0022"
FT                   /product="Putative ABC transport protein, membrane
FT                   component"
FT                   /note="Similar to Streptomyces coelicolor probable ABC
FT                   transport protein, membrane component SC8F11.06 TR:Q9KZH2
FT                   (EMBL:AL353864) (359 aa) fasta scores: E(): 1.1e-72, 57.66%
FT                   id in 326 aa"
FT                   /db_xref="GOA:Q6NKJ6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKJ6"
FT                   /protein_id="CAE48533.1"
FT                   /translation="MSSVSADDRLRRRTGFSALIRRPELASLLGAIAIFVLFMVLAPSF
FT                   RSLESFSTVLYASSTIGIVAVAVGMLMIGAEFDLSSGVAVTSTALAATMLNYNLHLNSW
FT                   VGAGISLVFALGIGAWNGFLVTRTGIDSFLITLAGFLGLQGLNLAITKWVTGQVATPII
FT                   SDMEGFGSARVVFAGTIHVGSVSIRATVLWWIFFVVIGSWLLFKTRFGNWIFAVGGDAD
FT                   AARASGVPVDRVKIILFMFVGFAAWFVGMHNLFAFDSIQAGQGVGNEFLYIIAAVIGGC
FT                   AMTGGRGTIIGTAIGAVIFGMTNQGIVYAGWNPDWFKFFLGAMLLFAVLTNTSFASLTK
FT                   GRR"
FT   misc_feature    22376..22546
FT                   /note="Signal peptide predicted for DIP0022 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.995) with cleavage site
FT                   probability 0.810 between residues 57 and 58"
FT   misc_feature    order(22448..22507,22526..22594,22682..22750,22769..22828,
FT                   22925..22993,23075..23143,23171..23224,23243..23311,
FT                   23321..23389)
FT                   /note="9 probable transmembrane helices predicted for
FT                   DIP0022 by TMHMM2.0"
FT   misc_feature    22526..23383
FT                   /note="ProfileScan hit to PS50281, Binding-system dependent
FT                   bacterial transporters (araH, livH/limM families);"
FT   CDS_pept        23408..24169
FT                   /transl_table=11
FT                   /locus_tag="DIP0023"
FT                   /product="Putative ABC transport protein, ATP-binding
FT                   protein"
FT                   /note="Similar to Streptomyces coelicolor probable ABC
FT                   transport protein, ATP-binding component SC8F11.07
FT                   TR:Q9KZH1 (EMBL:AL353864) (330 aa) fasta scores: E():
FT                   2.8e-51, 62.15% id in 251 aa"
FT                   /db_xref="GOA:Q6NKJ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKJ5"
FT                   /protein_id="CAE48534.1"
FT                   /translation="MSEIIALRDVTKSYGSFDALRGVSLSISAGEVLCVLGDNGAGKST
FT                   LIKILSGIHKPTSGEMLIDATPTVFNGPRDALNQGIATVHQNLAVVGHMSVWRNFFLGQ
FT                   ELTGFLGRLREDEMRRITQEQLAAMGIDLPDVDVEVESLSGGQRQVVAIARAVYFGARV
FT                   IILDEPTAALGVKQSGMVLRFVAAAREKGIGVVLITHNPHHAYLVGDHFTILNLGNQIL
FT                   DADRSNVTLEELTQHMAGGGELEALSHELRR"
FT   misc_feature    23492..24091
FT                   /note="HMMSmart hit to SM00382, ATPases associated with a
FT                   variety of cellular activities"
FT   misc_feature    23495..24061
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    23501..23578
FT                   /note="ProfileScan hit to PS50101, P-loop nucleotide
FT                   binding motif (does not find all)."
FT   misc_feature    23516..23539
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    23834..23878
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   misc_feature    23834..24049
FT                   /note="ProfileScan hit to PS50100, 2nd half motif for
FT                   nucleotide binding, associated with P-loop."
FT   CDS_pept        complement(24217..24825)
FT                   /transl_table=11
FT                   /locus_tag="DIP0024"
FT                   /product="Putative membrane protein"
FT                   /note="Possible membrane protein. No database matches"
FT                   /db_xref="GOA:Q6NKJ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKJ4"
FT                   /protein_id="CAE48535.1"
FT                   /translation="MNPTTIRGAVVLTKAAYNKYADYRDRKASEAYDALLSAADTAEDV
FT                   RDSAVENVTSLAGQARKRLDAALADAQNTAESTKKDVAKTSKKLSKKARKKARKQAQKA
FT                   GLTKKKRSAGAQAVRCSLYTVVLAALGAAAYFLWDKFSGSGVSDEPPRVEDFGADTVNT
FT                   EESRLVYSTQTPEEGIPERDEELLNSLEEQLKNSEKNDD"
FT   misc_feature    complement(24412..24477)
FT                   /note="1 probable transmembrane helix predicted for DIP0024
FT                   by TMHMM2.0"
FT   misc_feature    complement(24496..24591)
FT                   /note="ProfileScan hit to PS50318, Lysine-rich region."
FT   CDS_pept        24888..25430
FT                   /transl_table=11
FT                   /gene="ppiA"
FT                   /locus_tag="DIP0025"
FT                   /product="probable peptidyl-prolyl cis-trans isomerase A"
FT                   /EC_number="5.2.1.8"
FT                   /note="Similar to Mycobacterium tuberculosis probable
FT                   peptidyl-prolyl cis-trans isomerase A PpiA or Rv0009 or
FT                   MT0011 or MTCY10H4.08 SW:PPIA_MYCTU (P71578) (182 aa) fasta
FT                   scores: E(): 4.7e-52, 78.36% id in 171 aa"
FT                   /db_xref="GOA:Q6NKJ3"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKJ3"
FT                   /protein_id="CAE48536.1"
FT                   /translation="MLMMNGMTLKTATAILHTNRGDVSIELFGNHAPKTVENFVTLANG
FT                   TAEYKTENASGTNEGPFYDGAVFHRVIDGFMIQGGDPTGTGRGGPGYMFADEFHPELQF
FT                   DRPFLLAMANAGPGTNGSQFFITVVPTPHLNNHHTIFGEVTDAASQKVVLDIAQTATDR
FT                   MDRPVEPVVIESVEITE"
FT   misc_feature    24915..25421
FT                   /note="ProfileScan hit to PS50072, Cyclophilin-type
FT                   peptidyl-prolyl cis-trans isomerase profile."
FT   misc_feature    24948..25427
FT                   /note="HMMPfam hit to PF00160, Cyclophilin type
FT                   peptidyl-prolyl cis-trans isomerase"
FT   misc_feature    24966..25013
FT                   /note="FPrintScan hit to PR00153, Cyclophilin
FT                   peptidyl-prolyl cis-trans isomerase signature"
FT   misc_feature    25089..25127
FT                   /note="FPrintScan hit to PR00153, Cyclophilin
FT                   peptidyl-prolyl cis-trans isomerase signature"
FT   misc_feature    25191..25223
FT                   /note="ScanRegExp hit to PS00284, Serpins signature."
FT   misc_feature    25209..25256
FT                   /note="FPrintScan hit to PR00153, Cyclophilin
FT                   peptidyl-prolyl cis-trans isomerase signature"
FT   misc_feature    25254..25292
FT                   /note="FPrintScan hit to PR00153, Cyclophilin
FT                   peptidyl-prolyl cis-trans isomerase signature"
FT   misc_feature    25293..25340
FT                   /note="FPrintScan hit to PR00153, Cyclophilin
FT                   peptidyl-prolyl cis-trans isomerase signature"
FT   CDS_pept        complement(25519..>25752)
FT                   /transl_table=11
FT                   /locus_tag="DIP0026"
FT                   /product="Putative transposase (partial)"
FT                   /note="Similar to Streptococcus mutans transposase
FT                   (fragment) TR:Q9ZHF4 (EMBL:AF065413) (75 aa) fasta scores:
FT                   E(): 3.5e-11, 47.22% id in 72 aa"
FT                   /db_xref="GOA:Q6NKJ2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKJ2"
FT                   /protein_id="CAE48537.1"
FT                   /translation="VQSMSREVNCYDNAVMENFFGHLETKMYYGEHFASVDEFYWAVDD
FT                   YIFWYNNDRLQQRFKGLTPMQYRDQTLKALTT"
FT   misc_feature    complement(25546..25728)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   CDS_pept        25877..26494
FT                   /transl_table=11
FT                   /locus_tag="DIP0027"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Mycobacterium tuberculosis putative
FT                   transmembrane protein Rv0110 or MTV031.04 TR:O53632
FT                   (EMBL:AL021926) (249 aa) fasta scores: E(): 1.4e-13, 34.19%
FT                   id in 193 aa"
FT                   /db_xref="GOA:Q6NKJ1"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKJ1"
FT                   /protein_id="CAE48538.1"
FT                   /translation="MVHTEVMNALKRAYGQAPATAVLCALTILIYLLTVVESRSIEHNL
FT                   SDSWIADHWTLYGPYSHGLGWLRMVGTVFLHSGPTHLALNMFMLFFFGREIEHYLGSGR
FT                   FTLAYIVSGIGASATVLLMDPLAPTVGASGAVYGLMAIFVAMSYRLRRDLTAPLILIAV
FT                   NVGYSLLMDGVSLWGHLGGLLTGCVLGIVLVIAQTTRGNKRG"
FT   misc_feature    order(25913..25981,26084..26152,26171..26239,26249..26317,
FT                   26336..26389,26402..26461)
FT                   /note="6 probable transmembrane helices predicted for
FT                   DIP0027 by TMHMM2.0"
FT   misc_feature    26054..26470
FT                   /note="HMMPfam hit to PF01694, Rhomboid family"
FT   CDS_pept        complement(26672..27025)
FT                   /transl_table=11
FT                   /locus_tag="DIP0028"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKJ0"
FT                   /protein_id="CAE48539.1"
FT                   /translation="MEEIVELHGWKLSPDFIHTLWIKLCTSSPPADLFEILWENSRSHT
FT                   SNTQLFDHHSVNNTHVIIHIVDNCCGIFFTRSALCSQTKSCEILVDNYKNLGITQNSCA
FT                   LYPTKNWGVGPPQ"
FT   CDS_pept        27567..29366
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="DIP0029"
FT                   /product="thiamine biosynthesis protein"
FT                   /note="Similar to Escherichia coli thiamine biosynthesis
FT                   protein ThiC or B3994 SW:THIC_ECOLI (P30136) (631 aa) fasta
FT                   scores: E(): 1.6e-132, 64.01% id in 603 aa"
FT                   /db_xref="GOA:P61424"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61424"
FT                   /protein_id="CAE48540.1"
FT                   /translation="MSAASANSVTNPSAWENSEIHPKHSYSPIVSGDLEVPETEIQLDD
FT                   SPTGPNDPVRIYRTRGPECDPTVGLKPLRAQWIDSREDTEEYAGRERNLADDGRSAQRR
FT                   GAASLEWKGVKPTPRRAKQGKRVTQMHYARQGIITKEMEFVALREHMDPEFVRSEIARG
FT                   RAIIPNNINHPESEPMIIGRKFLTKINANIGNSAVTSSIEEEVSKLRWATRWGADTVMD
FT                   LSTGDDIHTTREWIIRNSPVPIGTVPIYQALEKVNGVAEDLTWEIFRDTVIEQCEQGVD
FT                   YMTIHAGVLLAYIPLTTKRITGIVSRGGSIMAGWCLAHHKESFLYEHFDELCEIFAQYD
FT                   VAFSLGDGLRPGSVADANDAAQFAELKTIGELARRAWEYDVQVMIEGPGHVPLNMVQEN
FT                   NELEQKWAHDAPFYTLGPLVTDIAPGYDHITSAIGAAHIAMGGTAMLCYVTPKEHLGLP
FT                   NRDDVKTGVITYKLAAHAADVAKGHPGARAWDDAMSKARFEFRWHDQFALSLDPDTAIA
FT                   YHDETLPAEPAKTAHFCSMCGPKFCSMRISQDIRDMFADKIADLGIPQVGGDAEAGMAA
FT                   KSEEFVAQGSQLYSEVRDNAAHA"
FT   misc_feature    27945..29219
FT                   /note="BlastProDom hit to PD007048, PD007048"
FT   misc_feature    27948..29219
FT                   /note="HMMPfam hit to PF01964, ThiC family"
FT   CDS_pept        29350..30018
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="DIP0030"
FT                   /product="Putative thiamin-phosphate pyrophosphorylase"
FT                   /note="Similar to Campylobacter jejuni thiamin-phosphate
FT                   pyrophosphorylase ThiE or CJ1081 TR:Q9PNL3 (EMBL:AL139077)
FT                   (210 aa) fasta scores: E(): 3.8e-14, 34.67% id in 199 aa"
FT                   /db_xref="GOA:Q6NKI9"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKI9"
FT                   /protein_id="CAE48541.1"
FT                   /translation="MLPTPRWGRDFDPRCYFVTGTGSVDHIVDVARQAARAGAGLIQVR
FT                   SKPIAARDLYILGREVARAVAEVNPRTRVLIDDRVDVALALMNNGEHIHGVHVGQDDLP
FT                   VRHVRALLGDNAIIGLTTGTLELVRASRQVAEVIDYIGAGPFRPTPTKDSGRAPVGLAG
FT                   YPPLVAESLVPVVAIGDVRPEDAADLAATGVAGVAIVRALMNSQGVATDVKLVLKGFAQ
FT                   "
FT   misc_feature    29383..30012
FT                   /note="HMMPfam hit to PF02581, Thiamine monophosphate
FT                   synthase/TENI"
FT   CDS_pept        30015..31103
FT                   /transl_table=11
FT                   /gene="thiO"
FT                   /locus_tag="DIP0031"
FT                   /product="Putative thiamine biosynthesis oxidoreductase"
FT                   /note="Similar to Rhizobium etli putative thiamine
FT                   biosynthesis oxidoreductase ThiO SW:THIO_RHIET (O34292)
FT                   (327 aa) fasta scores: E(): 5.4e-09, 31.67% id in 341 aa"
FT                   /db_xref="GOA:Q6NKI8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKI8"
FT                   /protein_id="CAE48542.1"
FT                   /translation="MKIAVVGGGIVGLSTAFELSSRGHSVHVFDPNPASGASHFAGGML
FT                   APAAEVQFQQDPLFPLMKRAGKLWPDMVRRVAQRTNLPTGYRTEGTLVVAADRADAEHL
FT                   KQLRATQEAAGMDVRPITTRQARGLEPALGPRLSAAVHIPNDTQVAPRVFLTALLDALD
FT                   DCGVGVIKEKITDLEPLYQQFDVVVLAAGLGAQHLSPIPLALRPVRGDILRVQTEPGAV
FT                   NMVVRGWVNDRPIYIIPRANGEIAIGATSREDERDLPSVEGIYDLLRDAIRVVPGIVDS
FT                   SLIEANVGVRPGTPDDLPYLGWASDRLIISTGYFRHGILLSALGAHVTACLIDGTDPGI
FT                   DLTACAPDRHHNERGTTHGHLH"
FT   misc_feature    30015..31022
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase"
FT   misc_feature    30021..30107
FT                   /note="ProfileScan hit to PS50205, NAD binding site."
FT   CDS_pept        31087..31287
FT                   /transl_table=11
FT                   /locus_tag="DIP0032"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical 6.6
FT                   kDa protein SC6E10.02 TR:Q9S2N5 (EMBL:AL109661) (66 aa)
FT                   fasta scores: E(): 1.1e-06, 36.36% id in 66 aa"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKI7"
FT                   /protein_id="CAE48543.1"
FT                   /translation="MDIYINDIPTAIESPQLTDIISNHCNGIRRGIAVAINQRVIPRSQ
FT                   WDTTTVTAGDHLDILTAVQGG"
FT   CDS_pept        31289..32074
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="DIP0033"
FT                   /product="thiazole biosynthesis protein"
FT                   /note="Similar to Escherichia coli thiazole biosynthesis
FT                   protein ThiG or B3991 SW:THIG_ECOLI (P30139) (256 aa) fasta
FT                   scores: E(): 1.5e-36, 45.85% id in 253 aa, and to
FT                   Streptomyces coelicolor thiazole biosynthesis protein ThiG
FT                   or SC6E10.03 SW:THIG_STRCO (Q9S2N4) (264 aa) fasta scores:
FT                   E(): 9.9e-58, 65.21% id in 253 aa"
FT                   /db_xref="GOA:Q6NKI6"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NKI6"
FT                   /protein_id="CAE48545.1"
FT                   /translation="MLTIADRSFQSHLIMGTGGASSFDTLEKSLIASGTELTTVAMRRH
FT                   AAHTGAHGESVFELMQRLNITPLPNTAGCRTARDAILTAQLAREALDTSWIKVEVIADD
FT                   TTLLPDVLELIDATETLTNDGFTVLAYTSDDPVVAQRLEDAGAAAVMPLGSPIGTGLGI
FT                   LNPHNIELICSRATVPVLLDAGIGTASDATLAMELGCSGVLLASAINRCINPITMATAM
FT                   KHAVEAGRLAREAGRIPRREHAVASSSFEGLASWADEVL"
FT   misc_feature    31814..31921
FT                   /note="ProfileScan hit to PS50264, Proteins binding FMN and
FT                   related compounds (core region profile)."
FT   CDS_pept        32071..33084
FT                   /transl_table=11
FT                   /locus_tag="DIP0034"
FT                   /product="Putative adenylyltransferase"
FT                   /note="Similar to Escherichia coli adenylyltransferase ThiF
FT                   or B3992 SW:THIF_ECOLI (P30138) (251 aa) fasta scores: E():
FT                   1.1e-21, 35.86% id in 237 aa"
FT                   /db_xref="GOA:Q6NKI5"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKI5"
FT                   /protein_id="CAE48547.1"
FT                   /translation="MMLDELERQRVARQLRLPGFGIEQQERLNNGRVLVIGAGGLGSPA
FT                   LQSLAAAGVGSIRLVDNDTVDVSNIQRQILFGVGDVGRSKVHVAAERLRAIQPGIRIDA
FT                   RTERLTAHNAHELAEGCDVILDGSDTFATKFLCGDLAEITGIPLVWGSVLQFEGHMGVF
FT                   TREVGLRDLFPEAPTQGLNCADAGVLGATTAVIANLMATETIKILAGIGTVQPGAVTTY
FT                   NALTSTFRTYTVGRDPLRSAARTLYTWTLPNEYELIDVREPHEIEHTPSGAHITLPQSM
FT                   WNDTTAIQHALDNITTDNVVVVCASGIRSAAFIEQFAHLNPHLTFHNVPSGINELP"
FT   misc_feature    32137..32565
FT                   /note="ProfileScan hit to PS50204, UBA/THIF-type NAD
FT                   binding fold."
FT   misc_feature    32155..32565
FT                   /note="HMMPfam hit to PF00899, ThiF family"
FT   misc_feature    32164..32232
FT                   /note="FPrintScan hit to PR00420, Aromatic-ring hydroxylase
FT                   (flavoprotein monooxygenase) signature"
FT   misc_feature    32167..32256
FT                   /note="ProfileScan hit to PS50205, NAD binding site."
FT   misc_feature    32755..32802
FT                   /note="FPrintScan hit to PR00420, Aromatic-ring hydroxylase
FT                   (flavoprotein monooxygenase) signature"
FT   CDS_pept        33081..33899
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="DIP0035"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="Similar to Escherichia coli phosphomethylpyrimidine
FT                   kinase ThiD or B2103 SW:THID_ECOLI (P76422) (266 aa) fasta
FT                   scores: E(): 5.5e-30, 44.9% id in 265 aa"
FT                   /db_xref="GOA:Q6NKI4"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKI4"
FT                   /protein_id="CAE48548.1"
FT                   /translation="MTPHILTIAGSDPSGGAGIQADLKSIMAAGGYGMAAITALTAQNT
FT                   CGVTAIHTPPTEFLSEQLRAISDDITIHAIKIGMIGSSDAATAIATWLDQLHHTSIVVL
FT                   DPVMVATSGSVLGQRHYFEPLLHHATVITPNLPELAVLANNHGPEQAEHAARSLAEQYD
FT                   CAVLLKGGHRHGTDDLGNTWITASGPQFHAPSPRIHTTDTHGTGCSLSSALATRLAIEP
FT                   PEPALHWATTWLNGAIAHGSDLNVGHGNGPVDHSYQLREYSANCNTINAP"
FT   repeat_region   complement(33865..34120)
FT                   /note="repX"
FT   CDS_pept        34478..37732
FT                   /transl_table=11
FT                   /locus_tag="DIP0036"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar in its N-terminal region to Pasteurella
FT                   multocida hypothetical protein PM1127 TR:Q9CLT2
FT                   (EMBL:AE006153) (1056 aa) fasta scores: E(): 1.4e-15,
FT                   21.94% id in 802 aa"
FT                   /db_xref="GOA:Q6NKI3"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR033114"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR040619"
FT                   /db_xref="InterPro:IPR040796"
FT                   /db_xref="InterPro:IPR041217"
FT                   /db_xref="InterPro:IPR041225"
FT                   /db_xref="InterPro:IPR041383"
FT                   /db_xref="PDB:6JOO"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NKI3"
FT                   /protein_id="CAE48549.1"
FT                   /translation="MKYHVGIDVGTFSVGLAAIEVDDAGMPIKTLSLVSHIHDSGLDPD
FT                   EIKSAVTRLASSGIARRTRRLYRRKRRRLQQLDKFIQRQGWPVIELEDYSDPLYPWKVR
FT                   AELAASYIADEKERGEKLSVALRHIARHRGWRNPYAKVSSLYLPDGPSDAFKAIREEIK
FT                   RASGQPVPETATVGQMVTLCELGTLKLRGEGGVLSARLQQSDYAREIQEICRMQEIGQE
FT                   LYRKIIDVVFAAESPKGSASSRVGKDPLQPGKNRALKASDAFQRYRIAALIGNLRVRVD
FT                   GEKRILSVEEKNLVFDHLVNLTPKKEPEWVTIAEILGIDRGQLIGTATMTDDGERAGAR
FT                   PPTHDTNRSIVNSRIAPLVDWWKTASALEQHAMVKALSNAEVDDFDSPEGAKVQAFFAD
FT                   LDDDVHAKLDSLHLPVGRAAYSEDTLVRLTRRMLSDGVDLYTARLQEFGIEPSWTPPTP
FT                   RIGEPVGNPAVDRVLKTVSRWLESATKTWGAPERVIIEHVREGFVTEKRAREMDGDMRR
FT                   RAARNAKLFQEMQEKLNVQGKPSRADLWRYQSVQRQNCQCAYCGSPITFSNSEMDHIVP
FT                   RAGQGSTNTRENLVAVCHRCNQSKGNTPFAIWAKNTSIEGVSVKEAVERTRHWVTDTGM
FT                   RSTDFKKFTKAVVERFQRATMDEEIDARSMESVAWMANELRSRVAQHFASHGTTVRVYR
FT                   GSLTAEARRASGISGKLKFFDGVGKSRLDRRHHAIDAAVIAFTSDYVAETLAVRSNLKQ
FT                   SQAHRQEAPQWREFTGKDAEHRAAWRVWCQKMEKLSALLTEDLRDDRVVVMSNVRLRLG
FT                   NGSAHKETIGKLSKVKLSSQLSVSDIDKASSEALWCALTREPGFDPKEGLPANPERHIR
FT                   VNGTHVYAGDNIGLFPVSAGSIALRGGYAELGSSFHHARVYKITSGKKPAFAMLRVYTI
FT                   DLLPYRNQDLFSVELKPQTMSMRQAEKKLRDALATGNAEYLGWLVVDDELVVDTSKIAT
FT                   DQVKAVEAELGTIRRWRVDGFFSPSKLRLRPLQMSKEGIKKESAPELSKIIDRPGWLPA
FT                   VNKLFSDGNVTVVRRDSLGRVRLESTAHLPVTWKVQ"
FT   misc_feature    36107..36271
FT                   /note="HMMSmart hit to SM00507, HNH nucleases"
FT   misc_feature    36140..36289
FT                   /note="HMMPfam hit to PF01844, HNH endonuclease"
FT   misc_feature    36464..36529
FT                   /note="Predicted helix-turn-helix motif with score 1063
FT                   (+2.81 SD) at aa 663-684, sequence RSMESVAWMANELRSRVAQHFA"
FT   CDS_pept        37736..38650
FT                   /transl_table=11
FT                   /locus_tag="DIP0037"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Neisseria meningitidis hypothetical
FT                   protein NMA0630 TR:Q9JVY0 (EMBL:AL162753) (304 aa) fasta
FT                   scores: E(): 2.7e-22, 37.5% id in 256 aa, and to
FT                   Pasteurella multocida hypothetical protein PM1126 TR:Q9CLT3
FT                   (EMBL:AE006153) (343 aa) fasta scores: E(): 3.5e-22, 32.04%
FT                   id in 284 aa"
FT                   /db_xref="GOA:Q6NKI2"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019855"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKI2"
FT                   /protein_id="CAE48550.1"
FT                   /translation="MNPGWRVVDLIDFDGKVSYQRGQLAITSDSGELRATLPLAQIAVV
FT                   LIGNKLIISGAVLVKLSEYDIAVLVCDWRRVPVAGSFSWNEHTRIAARQRAQASLSLPR
FT                   QKSAWAQIIKAKILGQARTAAQLGFDATDLKNLARAVRSGDVDNREAMAAKRYWEIISA
FT                   EDDFRRLPGLAATGWNGALDYAYTVLRGHGMRAICSAGLVGTLGVFHHGRGNQFALVDD
FT                   LIEPFRPAIDYAVFSIVSNSQELDKETKRQLVAAVEEPFNSAGQSIPTVFTAFAQQYGR
FT                   YVEGDVEKLVPPIWEGPFDAEER"
FT   CDS_pept        38634..38963
FT                   /transl_table=11
FT                   /locus_tag="DIP0038"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Pasteurella multocida hypothetical
FT                   protein PM1125 TR:Q9CLT4 (EMBL:AE006153) (108 aa) fasta
FT                   scores: E(): 9.3e-07, 42.85% id in 77 aa"
FT                   /db_xref="GOA:Q6NKI1"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKI1"
FT                   /protein_id="CAE48551.1"
FT                   /translation="MPKKGSDPVWCVVMFDLPVKTKTQRKQATAFRQNLLDLGFCMAQL
FT                   SVYVQYLPLAAKLSNLVKLIKEKLPPGGDVRILSVSDIQWSKMIRFSSSAEVSGEEKPD
FT                   QLAIF"
FT   stem_loop       38961..39021
FT                   /note="Score 76: 28/30 (93%) matches, 0 gaps"
FT   CDS_pept        complement(38967..39077)
FT                   /transl_table=11
FT                   /locus_tag="DIP0039"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No strong consensus RBS usptream. No
FT                   significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKI0"
FT                   /protein_id="CAE48552.1"
FT                   /translation="MELFLSVEPHWGSVLKNPDRLQVAQKILFNMVFWAT"
FT   CDS_pept        complement(39311..39592)
FT                   /transl_table=11
FT                   /locus_tag="DIP0040"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to the C-terminal region of Rickettsia
FT                   prowazekii hypothetical protein RP756 SW:Y756_RICPR
FT                   (Q9ZCI4) (105 aa) fasta scores: E(): 3.4, 33.33% id in 51
FT                   aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKH9"
FT                   /protein_id="CAE48553.1"
FT                   /translation="MPILALSAGSRLATVAILTYLLMRNGIPHTNHQTRSFSKTLINFS
FT                   YGSSPLARAGVQFSKTLIDFQQHLARLAPNWGSVLKNPDRLRKKFSNC"
FT   repeat_region   39500..39512
FT                   /note="Possible inverted repeat"
FT   CDS_pept        join(39682..39792,39824..40033,40039..40134,40136..40459,
FT                   40471..40704)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="DIP0041"
FT                   /product="Putative transposase for insertion sequence
FT                   element (pseudogene)"
FT                   /note="Pseudogene. Similar to Corynebacterium diphtheriae
FT                   probable transposase for insertion sequence element
FT                   SW:TRA_CORDI (P35879) (343 aa) fasta scores: E(): 6e-75,
FT                   61.11% id in 342 aa. Note: Also similar to DIP2026 to
FT                   DIP2029 also a pseudogene (274 aa). Presents frameshifts at
FT                   positions: 37, 107, 139 and 247"
FT   misc_feature    39836..39991
FT                   /note="HMMPfam hit to PF00872, Transposase, Mutator family"
FT   misc_feature    40133..40408
FT                   /note="HMMPfam hit to PF00872, Transposase, Mutator family"
FT   misc_feature    40396..40572
FT                   /note="HMMPfam hit to PF00872, Transposase, Mutator family"
FT   repeat_region   40714..40726
FT                   /note="Possible inverted repeat"
FT   CDS_pept        complement(40822..40923)
FT                   /transl_table=11
FT                   /locus_tag="DIP0046"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No strong consensus RBS usptream. No
FT                   significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKH8"
FT                   /protein_id="CAE48555.1"
FT                   /translation="MILTVSAEISYVSATLAQTPAMRLFFDSVPFIL"
FT   CDS_pept        complement(join(41066..42397,42420..42614))
FT                   /transl_table=11
FT                   /locus_tag="DIP0047"
FT                   /product="Putative transposase (pseudogene)"
FT                   /note="Similar to Mycobacterium smegmatis putative
FT                   transposase TR:O70063 (EMBL:AF036759) (503 aa) fasta
FT                   scores: E(): 4.7e-88, 50% id in 498 aa. Presents a
FT                   frameshift at residue 65"
FT                   /protein_id="CAE48556.1"
FT                   /translation="MNMSPSIRRVPTASGATAVQIIWRYRNRKPDIEHVGSAHTDYDLA
FT                   ALMAKAQRLIDGEQISLDLKVSGTGTVDNPVTVSGERAGLLLDAIRGAFQLLGLDAASG
FT                   EDEVFFNLVQARIISLGSKFDSIETLAEVGVTSASYATIKRYLPRYADKDFRDQITHAL
FT                   ATHAAIGPGVMVLYDVTTLYFETDVPDELRKPGFSKERRLEPQITVGMLTDSIGFPLAI
FT                   GAFEGNRAETQTMLPMILRLKDAYHLDDITIVADAGMFSAANKTAIIDAGLDYILGTKE
FT                   REIPEPIKAWLDTVEGRSYTDYDDGHIWTHRHHSDRRRTSGTPQAVTYYQYSYDRARRT
FT                   RRGIGEQLDKAQRAVDGKIPVKRNRYVNLKAPNKQVNHALANKHLTLAGIKGYETSRTD
FT                   LKPQEVIGAYRRLFKIEKSFRMAKSDLKARPIYHRKEDSIHAHLTIVMAAMATGHVLEE
FT                   ASGLSLKRLVRTLKKYRTFTVEIAGQTLHAQTDLPADIRELAEKLPQPSD"
FT   misc_feature    complement(41237..42079)
FT                   /note="HMMPfam hit to PF01609, Transposase (IS4 family)"
FT   CDS_pept        <42736..42969
FT                   /transl_table=11
FT                   /locus_tag="DIP0049"
FT                   /product="Putative transposase (partial)"
FT                   /note="Similar to Corynebacterium jeikeium transposase B
FT                   TnpB TR:AAK67710 (EMBL:AY036070) (302 aa) fasta scores:
FT                   E(): 1.2e-06, 45.45% id in 55 aa, and to Escherichia coli
FT                   O157:H7 EDL933 partial transposase Z1207 TR:AAG55352
FT                   (EMBL:AE005276) (82 aa) fasta scores: E(): 5.2e-05, 38% id
FT                   in 50 aa"
FT                   /db_xref="GOA:Q6NKH7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKH7"
FT                   /protein_id="CAE48557.1"
FT                   /translation="MTMLWLRMSMVPHKNELIYTYTWVDVVDVEIAAFEWVNWWNESRL
FT                   HQSLGYRTPAEVEAEFWEHHPSREIIEIKANA"
FT   misc_feature    42775..42912
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   CDS_pept        43101..43196
FT                   /transl_table=11
FT                   /locus_tag="DIP0050"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKH6"
FT                   /protein_id="CAE48558.1"
FT                   /translation="MGFTMSAKAKTFAKNGLLLAVPVLEVNGDYA"
FT   CDS_pept        43189..43284
FT                   /transl_table=11
FT                   /locus_tag="DIP0051"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKH5"
FT                   /protein_id="CAE48559.1"
FT                   /translation="MHRACLFHCDVMDNLRAEGKRCVYVVHKKND"
FT   CDS_pept        complement(43308..43577)
FT                   /transl_table=11
FT                   /locus_tag="DIP0052"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   10.4 kDa protein Rv0011c or MT0014 or MTCY10H4.11C
FT                   SW:Y011_MYCTU (P71581) (93 aa) fasta scores: E(): 1.5e-09,
FT                   41.48% id in 94 aa"
FT                   /db_xref="GOA:Q6NKH4"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKH4"
FT                   /protein_id="CAE48560.1"
FT                   /translation="MPKSKINHSSTAYTAGSTANRTPVKINSTGTPLWYKIIMFGLILA
FT                   GLLWLIVNYLAGQDISFMTELGPWNYGIGFGLFIIGLLMTMGWR"
FT   misc_feature    complement(order(43314..43379,43410..43475))
FT                   /note="2 probable transmembrane helices predicted for
FT                   DIP0052 by TMHMM2.0"
FT   CDS_pept        complement(43694..45715)
FT                   /transl_table=11
FT                   /gene="pknB"
FT                   /locus_tag="DIP0053"
FT                   /product="probable serine/threonine-protein kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="Similar to Mycobacterium leprae probable
FT                   serine/threonine-protein kinase PknB or ML0016
FT                   SW:PKNB_MYCLE (P54744) (622 aa) fasta scores: E(): 5.7e-58,
FT                   43.26% id in 661 aa"
FT                   /db_xref="GOA:Q6NKH3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKH3"
FT                   /protein_id="CAE48561.1"
FT                   /translation="MTDIVLADRYRLGDVIGTGGMSEVYEATDVLLGRKVAVKMLRADL
FT                   ARDVNFRERFRREAQNSGKLNHPAIVAVYDTGETPRAGLNTPYIVMELVNGRTLRDIVR
FT                   EDGPLTPSQAAHTLIPVCHALQVSHDAGIIHRDIKPANVMITNTGAVKIMDFGIARALD
FT                   DATSAMTQTSAVIGTAQYLSPEQARGKLADARSDVYALGCVLYETLTGKPPFEGETPFA
FT                   VAYQHVQEDPVKPSEYIADLSPTAAINVDAVVLTAMAKHPGDRYQTAQEMCADLERLGR
FT                   NAVTDAARHYVTPTSFATQDPASTTVVPVTQVTELDHAEAGAGIGAGVVPAGAVAGSAA
FT                   VAGSGGAHAAPRSSNRGLRILAAILAVLVLAVGAGFAIDYFGGGPFSQRSTVTIPKLQN
FT                   STQQDAVNQLEKLGLQVNVIEEPNPDIPRGKVIRTNPTDGSNVQRNSTVRLTISSGKEI
FT                   TEVPDLSGKNTADAVKILEAAGLLLDPTVREDSSDTVPKGEIIEVSPAAGSQVSRGSKV
FT                   SITVSTGVETVRVPVITGMKWDQAEGNLTSLGFKPEVVRVDSVEPAGTVVAVPDEGAEV
FT                   PKGSSVTVQISNGAMFTVPEITRQTIDDAVRILHDAGWKGNASRLIQAAKVPTVAVTDQ
FT                   NLIASQLPTPGTALRKDAPIEIRLYEFNLAALVPPAQH"
FT   misc_feature    complement(order(44570..44635,44675..44740))
FT                   /note="2 probable transmembrane helices predicted for
FT                   DIP0053 by TMHMM2.0"
FT   misc_feature    complement(44879..45688)
FT                   /note="HMMSmart hit to SM00220, Serine/Threonine protein
FT                   kinases, catalytic domain"
FT                   /note="ProfileScan hit to PS50011, Protein kinase domain
FT                   profile."
FT   misc_feature    complement(44888..45688)
FT                   /note="HMMSmart hit to SM00219, Tyrosine kinase, catalytic
FT                   domain"
FT   misc_feature    complement(44978..45688)
FT                   /note="HMMPfam hit to PF00069, Protein kinase domain"
FT   misc_feature    complement(45281..45319)
FT                   /note="ScanRegExp hit to PS00108, Serine/Threonine protein
FT                   kinases active-site signature."
FT   misc_feature    complement(45599..45670)
FT                   /note="ScanRegExp hit to PS00107, Protein kinases
FT                   ATP-binding region signature."
FT   CDS_pept        complement(45712..47217)
FT                   /transl_table=11
FT                   /gene="pknA"
FT                   /locus_tag="DIP0054"
FT                   /product="probable serine/threonine-protein kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="Similar to Mycobacterium leprae probable
FT                   serine/threonine-protein kinase PnkA or ML0017
FT                   SW:PKNA_MYCLE (P54743) (437 aa) fasta scores: E(): 4e-37,
FT                   41.99% id in 431 aa"
FT                   /db_xref="GOA:Q6NKH2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKH2"
FT                   /protein_id="CAE48562.1"
FT                   /translation="MTQSQSPDPALQALVGSDYALQWVVGNGGMSTVWLADDLRNQREV
FT                   AIKVLRPEFSDNEEFLSRFRNEALASEHIDSDNVVRTYDYREVTDDMGRTLCFIVMEYV
FT                   RGESLADMLARKGRLEEDLALDVLEQAAHGLSIIHRMGMVHRDIKPGNLLITQNGQVKI
FT                   TDFGIAKAAAAVPLTRTGMVVGTAQYVSPEQAQGRDVTAATDVYSLGVVGYEMLVGQRP
FT                   FTGDSSVSVAIAHINQAPPAMPTSVSAPARELIGIALRKDPAHRYADGNELALAVSATR
FT                   MGQRPPQPKSAPLQHIAPQPAPTESTYALGATAQPTTVIPATGQVPAAPAAAAYPASTV
FT                   IPAGTPRQEPEKQSSGWGAGIVVGALAALLLGTAAWAASQGMFDDLFDKTSQSSESSVP
FT                   PPPVTATVTETPTPQITTVIPEPLPTSSPEPTPSETEHTPDDSHPSSDHQLPSVRPSHN
FT                   GRPSSQAPHAPTQDADQPAESPAPDTLGSLIENLNKLNQGGAQ"
FT   misc_feature    complement(45772..46023)
FT                   /note="ProfileScan hit to PS50099, Proline-rich region."
FT   misc_feature    complement(45778..45855)
FT                   /note="FPrintScan hit to PR01217, Proline rich extensin
FT                   signature"
FT   misc_feature    complement(45892..45942)
FT                   /note="FPrintScan hit to PR01217, Proline rich extensin
FT                   signature"
FT   misc_feature    complement(45949..46014)
FT                   /note="FPrintScan hit to PR01217, Proline rich extensin
FT                   signature"
FT   misc_feature    complement(46309..46347)
FT                   /note="FPrintScan hit to PR01217, Proline rich extensin
FT                   signature"
FT   misc_feature    complement(46372..47163)
FT                   /note="ProfileScan hit to PS50011, Protein kinase domain
FT                   profile."
FT   misc_feature    complement(46384..47163)
FT                   /note="HMMSmart hit to SM00220, Serine/Threonine protein
FT                   kinases, catalytic domain"
FT   misc_feature    complement(46387..47163)
FT                   /note="HMMSmart hit to SM00219, Tyrosine kinase, catalytic
FT                   domain"
FT   misc_feature    complement(46417..47163)
FT                   /note="HMMPfam hit to PF00069, Protein kinase domain"
FT   misc_feature    complement(46753..46791)
FT                   /note="ScanRegExp hit to PS00108, Serine/Threonine protein
FT                   kinases active-site signature."
FT   misc_feature    complement(47074..47145)
FT                   /note="ScanRegExp hit to PS00107, Protein kinases
FT                   ATP-binding region signature."
FT   CDS_pept        complement(47230..48690)
FT                   /transl_table=11
FT                   /gene="pbpA"
FT                   /locus_tag="DIP0055"
FT                   /product="Putative secreted penicillin-binding protein"
FT                   /note="Similar to Mycobacterium leprae putative
FT                   penicillin-binding protein PbpA or ML0018 TR:Q9CDE6
FT                   (EMBL:AL583917) (492 aa) fasta scores: E(): 1.3e-72, 45.9%
FT                   id in 488 aa"
FT                   /db_xref="GOA:Q6NKH1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKH1"
FT                   /protein_id="CAE48563.1"
FT                   /translation="MNRSIRFTSVFALLLILILLVNLTIIQGFSQEKYAHNALNRRGFI
FT                   ELKSQARGQISTGGQVLAESYQDEEGFYQRRYVTNPAIYGPIEGYLSDIYGASGMESNL
FT                   NGVLSGTDSSVSVRRWTDELLGRKHSGANVELTLLPQVQEVAYNQMANAGYEGAVVAIK
FT                   PSTGEILAMASTPSYDPSAIVNPDTAEQTWAALNADPGNPLLNHATQETLPPGSTFKVI
FT                   TTAAGLNAGYGPGSMLTGQDRITLPDGITTLENYAGQTCAGSQNVTLATAFQYSCNTAF
FT                   VQMGIDVGKEKFDEAAHAFGVNDRYDLGVDMAPGTIGDVSDPSARGQSSIGQRDVAMSV
FT                   LHNAVVAATVANGGKRMEPHLVNRIVGQDLKVIKETKPHQINEAVTPEVAATLTDLMRL
FT                   SERHTAGYTGADIASKTGTAEHGEDSRNSNPHAWYIAFGPSANADVAVAVVVKNGGDAG
FT                   QAATGGSVAAPIGRAVIAAAQAALAARG"
FT   misc_feature    complement(47272..48273)
FT                   /note="HMMPfam hit to PF00905, Penicillin binding protein
FT                   transpeptidase domain"
FT   misc_feature    complement(48607..48690)
FT                   /note="Signal peptide predicted for DIP0055 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.438 between residues 28 and 29"
FT   CDS_pept        complement(48687..50036)
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="DIP0056"
FT                   /product="probable cell division protein"
FT                   /note="Similar to Mycobacterium tuberculosis probable cell
FT                   division protein FtsW or Rv0017c or MT0020 or MTCY10H4.17c
FT                   SW:FTSW_MYCTU (P71587) (469 aa) fasta scores: E(): 8.7e-72,
FT                   48.61% id in 434 aa, and to Escherichia coli rod
FT                   shape-determining protein MrdB or RodA or B0634 or Z0780 or
FT                   ECS0672 SW:RODA_ECOLI (P15035) (370 aa) fasta scores: E():
FT                   8.5e-19, 26.57% id in 365 aa"
FT                   /db_xref="GOA:Q6NKH0"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKH0"
FT                   /protein_id="CAE48564.1"
FT                   /translation="MTSLRRITARPVEFGLLVMATLLIAVTLINLNMAQGLSVTSETLW
FT                   VIGGFIGVFTIAHLALCFTAPHADQVMLPVASVLNGLGLVMVYRIDLARDTALASRQVI
FT                   WTLVGILLMIAVLVFIRDHRMLSRYSYVLGLLGLILLALPMVWPTKMNADANIWISIGP
FT                   FSVQPGEFSKILLLIFFAQLLVNKRALFNVAGYRFLGLEFPRLRDLGPILGVWAFAILV
FT                   MAGENDFGPALLLFSTVLGMLYLATNRVSWLIIGAALVAVGGTALYQISSKIQSRVTNF
FT                   INPLDNFNGTGYQLSQSLFGLSSGGVAGAGLGLGHPELIPVAESDFILAAVGEELGFIG
FT                   LAAVLVLFAIFITRGLRTALRARDSYGKLMAAGLSLTLAIQVFVVTAGITALMPMTGLT
FT                   TPFMSQGGSSLMANYILLGLILRISHSTQAAANDVVSMDEQAARGQEAHR"
FT   misc_feature    complement(48750..49832)
FT                   /note="HMMPfam hit to PF01098, Cell cycle protein"
FT   misc_feature    complement(order(48768..48833,48864..48929,48981..49046,
FT                   49092..49157,49221..49286,49332..49397,49479..49544,
FT                   49590..49655,49677..49727,49758..49823,49839..49904,
FT                   49935..50000))
FT                   /note="12 probable transmembrane helices predicted for
FT                   DIP0056 by TMHMM2.0"
FT   CDS_pept        complement(50037..51494)
FT                   /transl_table=11
FT                   /locus_tag="DIP0057"
FT                   /product="Putative phosphoprotein phosphatase"
FT                   /note="Similar to Mycobacterium leprae probable
FT                   phosphoprotein phosphatase Ppp TR:Q50188 (EMBL:Z70722) (509
FT                   aa) fasta scores: E(): 5.8e-46, 43.64% id in 488 aa"
FT                   /db_xref="GOA:Q6NKG9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKG9"
FT                   /protein_id="CAE48565.1"
FT                   /translation="MMLRLNYAAASDRGLVRGNNEDSAYAGPHLIALADGMGGHAAGEV
FT                   ASQLMINHLMRLDADVDDNDMLALLASVADDANRAIAQGVRDVPETDGMGTTLTALMFN
FT                   GADLAMCHVGDSRGYRLRDGALEQITVDDTYVQSLVDKGQLAPEDVSTHPQRSMILKAY
FT                   TGRPVEPTLKMIDIRPGDRFLLCSDGLSDPVTHSTIETTLQQGTPQEAARRLVDLALRS
FT                   GGPDNVTVVVADVVEADGSDKSAAAASLPVTPLTVGALNSGMPEDPRPDTAAGRAAMAI
FT                   AQRQPQVILPDPEPVKEATPSPRRRMVAVISALVVLAVLISAGWWGSSMVKNNYYVTTA
FT                   DSDSAQGALVIENGIDVSLLGKSLHSTYQFACLSPEGDLTFVDSADAEKSCHRFRLSDL
FT                   KESARGQVSTLPDGSYDEVQQQLQRLAEQTLPACITRQAAHPKDKDKKKPAAPSSAAPT
FT                   TTKAASPSSTGSPDDLSTPGETCREVK"
FT   misc_feature    complement(50508..50573)
FT                   /note="1 probable transmembrane helix predicted for DIP0057
FT                   by TMHMM2.0"
FT   misc_feature    complement(50781..51215)
FT                   /note="ProfileScan hit to PS50170, Protein phosphatase 2C,
FT                   box 2."
FT   misc_feature    complement(50790..51464)
FT                   /note="HMMSmart hit to SM00331, Sigma factor PP2C-like
FT                   phosphatases"
FT   misc_feature    complement(50796..51491)
FT                   /note="HMMSmart hit to SM00332, Serine/threonine
FT                   phosphatases, family 2C, catalytic domain"
FT   misc_feature    complement(50811..50990)
FT                   /note="HMMPfam hit to PF00481, Protein phosphatase 2C"
FT   misc_feature    complement(50814..51446)
FT                   /note="BlastProDom hit to PD006823, PD006823"
FT   CDS_pept        complement(51491..51979)
FT                   /transl_table=11
FT                   /locus_tag="DIP0058"
FT                   /product="Putative secreted protein"
FT                   /note="Similar to Mycobacterium leprae hypothetical 17.2
FT                   kDa protein MLB1770.14c or ML0021 TR:Q50189 (EMBL:Z70722)
FT                   (155 aa) fasta scores: E(): 2.3e-13, 35% id in 160 aa"
FT                   /db_xref="GOA:Q6NKG8"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKG8"
FT                   /protein_id="CAE48566.1"
FT                   /translation="MESVIVFLLRIALLVLLWLLILLALYIQRKDAKSAAQTMVAPQAV
FT                   TGLGVSSASSPLKKVSRRGGAPQQIVVVEGPLTGSSMQLDSLTEITLGRSKDCDFVVGD
FT                   DYASARHARLIKRGSEWFAEDLDSRNGTYVGGYRIDQPEKVSAGSDIKIGRTTVRLVA"
FT   misc_feature    complement(51518..51712)
FT                   /note="HMMPfam hit to PF00498, FHA domain"
FT   misc_feature    complement(51563..51712)
FT                   /note="ProfileScan hit to PS50006, Forkhead-associated
FT                   (FHA) domain profile."
FT   misc_feature    complement(51563..51715)
FT                   /note="HMMSmart hit to SM00240, Forkhead associated domain"
FT   misc_feature    complement(51878..51979)
FT                   /note="Signal peptide predicted for DIP0058 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.995) with cleavage site
FT                   probability 0.794 between residues 34 and 35"
FT   CDS_pept        complement(51993..52859)
FT                   /transl_table=11
FT                   /locus_tag="DIP0059"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical 30.8
FT                   kDa protein SCH69.13 TR:Q9XA21 (EMBL:AL079308) (290 aa)
FT                   fasta scores: E(): 3.1e-11, 27.6% id in 297 aa"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKG7"
FT                   /protein_id="CAE48567.1"
FT                   /translation="MSIMGKVAKLDSAMQRGLDNSFAFVFGGKLVPAEIEELLKQEVQD
FT                   NIVRAYEGGVESPNVFRVRVSRKDAQNLAQRYPSLADDFADRLSRYTRNQGWSTEGPVV
FT                   VTIAADSGLRTGQLHASSAFDPVPQEYSHFIGVEDDVAAAAPTNDESNYESESGMNSYD
FT                   ADPRTEYMTAQAPDAIYTEVPVPEPKATPTVSLLLQDGSSRTYLVEEGSNIIGRSNEAH
FT                   FRLPDTGVSRQHAEITWNGRDAILTDLKSTNGTTVNDTPVENWLLEDGDVITVGHSHIE
FT                   VRIVEPN"
FT   misc_feature    complement(52032..52223)
FT                   /note="HMMPfam hit to PF00498, FHA domain"
FT   misc_feature    complement(52074..52223)
FT                   /note="ProfileScan hit to PS50006, Forkhead-associated
FT                   (FHA) domain profile."
FT   misc_feature    complement(52074..52226)
FT                   /note="HMMSmart hit to SM00240, Forkhead associated domain"
FT   misc_feature    complement(52170..52187)
FT                   /note="ScanRegExp hit to PS00343, Gram-positive cocci
FT                   surface proteins 'anchoring' hexapeptide."
FT   tRNA            53080..53163
FT                   /gene="tRNA-Leu"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:53114..53116,aa:Leu)"
FT                   /note="tRNA Leu anticodon CAG, Cove score 57.69"
FT   CDS_pept        complement(join(53337..53534,53536..53667,53667..53720))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="DIP0060"
FT                   /product="IS1628 transposase (pseudogene)"
FT                   /note="Pseudogene. Similar to Corynebacterium glutamicum
FT                   IS1628 transposase TnpB TR:Q9X542 (EMBL:AF121000) (236 aa)
FT                   fasta scores: E(): 9e-47, 86.923% id in 130 aa. Presents
FT                   frameshifts at residues 18 and 62"
FT                   /db_xref="PSEUDO:CAE48568.1"
FT   CDS_pept        complement(53813..56047)
FT                   /transl_table=11
FT                   /locus_tag="DIP0061"
FT                   /product="Putative cation-transporting ATPase"
FT                   /note="Similar to Enterococcus hirae probable copper
FT                   exporting ATPase B CopB SW:COPB_ENTHR (P05425) (745 aa)
FT                   fasta scores: E(): 2.2e-94, 43.228% id in 731 aa, and to
FT                   Mycobacterium tuberculosis probable cation-transporting
FT                   ATPase V CtpV or Rv0969 or MT0997 or MTCY10D7.05c
FT                   SW:CTPV_MYCTU (P77894) (770 aa) fasta scores: E(): 2e-69,
FT                   40.092% id in 651 aa"
FT                   /db_xref="GOA:Q6NKG6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKG6"
FT                   /protein_id="CAE48569.1"
FT                   /translation="MNTPNHSGDHHGDHPAPETDHTYHPDHASHEHHADADTHGHAKPH
FT                   DHPHSALDEDHHVHGHGEHAGHSTAMFRERFWWSLILSIPVVIFSPMVAHLLGYHLPAF
FT                   PGSTWIPPVLGTIIFVYGGTPFLKGGWNELKSRQPGMMLLIAMAITVAFVASWVTTLGL
FT                   GGFELDFWWELALLVTIMLLGHWLEMSALGAASSALDALAALLPDEAEKVIDGTTRTVA
FT                   ISELIVDDVVLVRAGARVPADGTILDGAAEFDEAMITGESRPVFRDTGDKVVAGTVATD
FT                   NTVRIRVEATGGDTALAGIQRMVADAQESSSRAQALADRAAALLFWFALISALITAVVW
FT                   TIIGSPDDAVVRTVTVLVIACPHALGLAIPLVIAISSERAAKSGVLIKDRMALERMRTI
FT                   DVVLFDKTGTLTEGAHAVTGVAAAVGVTEGELLALAAAAEADSEHPVARAIVAAAAAHP
FT                   EASRRQIRATGFSAASGRGVRATVDGAEILVGGPNMLREFNLTTPAELTDTTSAWTGRG
FT                   AGVLHIVRDGQIIGAVAVEDKIRPESRAAVKALQDRGVKVAMITGDAQQVAQAVGQDLG
FT                   IDEVFAEVLPQDKDTKVTQLQDRGLSVAMVGDGVNDAPALTRADVGIAIGAGTDVAMES
FT                   AGVVLASDDPRAVLSMIELSQASYRKMIQNLIWASGYNILAVPLAAGVLASIGFVLSPA
FT                   VGAILMSASTIVVALNAQLLRRIDLDPAHLAPTESKEEHTTPTPASTAVH"
FT   misc_feature    53813..60917
FT                   /note="Anomalous G+C content (63.8%) and dinucleotide
FT                   signature. Putative metal transport system. Present also in
FT                   C.glutamicum"
FT   misc_feature    complement(order(53906..53971,53984..54049,54923..54988,
FT                   55019..55084,55487..55537,55553..55618,55658..55723,
FT                   55754..55819))
FT                   /note="8 probable transmembrane helices predicted for
FT                   DIP0061 by TMHMM2.0"
FT   misc_feature    complement(53969..54013)
FT                   /note="FPrintScan hit to PR00943, Copper-transporting
FT                   ATPase signature"
FT   misc_feature    complement(54062..54139)
FT                   /note="FPrintScan hit to PR00120, H+-transporting ATPase
FT                   (proton pump) signature"
FT   misc_feature    complement(54125..54163)
FT                   /note="FPrintScan hit to PR00119, P-type
FT                   cation-transporting ATPase superfamily signature"
FT   misc_feature    complement(54161..54853)
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase"
FT   misc_feature    complement(54173..54232)
FT                   /note="FPrintScan hit to PR00119, P-type
FT                   cation-transporting ATPase superfamily signature"
FT   misc_feature    complement(54182..54232)
FT                   /note="FPrintScan hit to PR00120, H+-transporting ATPase
FT                   (proton pump) signature"
FT   misc_feature    complement(54248..54301)
FT                   /note="FPrintScan hit to PR00943, Copper-transporting
FT                   ATPase signature"
FT   misc_feature    complement(54266..54316)
FT                   /note="FPrintScan hit to PR00120, H+-transporting ATPase
FT                   (proton pump) signature"
FT   misc_feature    complement(54359..54391)
FT                   /note="FPrintScan hit to PR00119, P-type
FT                   cation-transporting ATPase superfamily signature"
FT   misc_feature    complement(54422..54457)
FT                   /note="FPrintScan hit to PR00119, P-type
FT                   cation-transporting ATPase superfamily signature"
FT   misc_feature    complement(54629..54808)
FT                   /note="ProfileScan hit to PS50310, Alanine-rich region."
FT   misc_feature    complement(54797..54841)
FT                   /note="FPrintScan hit to PR00119, P-type
FT                   cation-transporting ATPase superfamily signature"
FT   misc_feature    complement(54815..54835)
FT                   /note="ScanRegExp hit to PS00154, E1-E2 ATPases
FT                   phosphorylation site."
FT   misc_feature    complement(54845..54892)
FT                   /note="FPrintScan hit to PR00943, Copper-transporting
FT                   ATPase signature"
FT   misc_feature    complement(54863..55522)
FT                   /note="HMMPfam hit to PF00122, E1-E2 ATPase"
FT   misc_feature    complement(55244..55288)
FT                   /note="FPrintScan hit to PR00119, P-type
FT                   cation-transporting ATPase superfamily signature"
FT   misc_feature    complement(55403..55459)
FT                   /note="FPrintScan hit to PR00943, Copper-transporting
FT                   ATPase signature"
FT   misc_feature    complement(55514..55555)
FT                   /note="ScanRegExp hit to PS01039, Bacterial extracellular
FT                   solute-binding proteins, family 3 signature."
FT   misc_feature    complement(55613..55672)
FT                   /note="FPrintScan hit to PR00943, Copper-transporting
FT                   ATPase signature"
FT   misc_feature    complement(55847..56032)
FT                   /note="ProfileScan hit to PS50316, Histidine-rich region."
FT   CDS_pept        complement(56099..56425)
FT                   /transl_table=11
FT                   /locus_tag="DIP0062"
FT                   /product="Putative heavy metal-associated transport
FT                   protein"
FT                   /note="Similar to Deinococcus radiodurans conserved
FT                   hypothetical protein DR2452 TR:Q9RRN6 (EMBL:AE002074) (68
FT                   aa) fasta scores: E(): 0.0038, 43.103% id in 58 aa, and to
FT                   Streptococcus pyogenes putative copper chaperone-copper
FT                   transport operon CopZ or SPY1714 TR:Q99YG6 (EMBL:AE006600)
FT                   (67 aa) fasta scores: E(): 0.0065, 40.000% id in 60 aa, and
FT                   to Pseudomonas syringae Plasmid pPaCu1 copper resistance
FT                   operon ORFH protein TR:Q9KWM7 (EMBL:AB033420) (65 aa) fasta
FT                   scores: E(): 0.025, 40.000% id in 60 aa, and to Candida
FT                   albicans copper-transporting p-type ATPase Ccc2 TR:AAK52331
FT                   (EMBL:AY033084) (1204 aa) fasta scores: E(): 0.03, 28.571%
FT                   id in 84 aa"
FT                   /db_xref="GOA:Q6NKG5"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKG5"
FT                   /protein_id="CAE48570.1"
FT                   /translation="MITSPSRLLPMASHGCSCCGPASHADTASIPAASDSSAGGSSPSY
FT                   QVTGLTCGHCAKSVTQALQALPQVDDVQIDLAAGGVSTVTVTGVVPPEMVRRAIEEAGY
FT                   TVLS"
FT   misc_feature    complement(56102..56299)
FT                   /note="HMMPfam hit to PF00403, Heavy-metal-associated
FT                   domain"
FT   misc_feature    complement(56198..56287)
FT                   /note="ScanRegExp hit to PS01047, Heavy-metal-associated
FT                   domain."
FT   misc_feature    complement(56351..56425)
FT                   /note="Signal peptide predicted for DIP0062 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.861) with cleavage site
FT                   probability 0.476 between residues 25 and 26"
FT   CDS_pept        complement(56540..57667)
FT                   /transl_table=11
FT                   /locus_tag="DIP0063"
FT                   /product="Putative two-component system sensor protein"
FT                   /note="Similar to Escherichia coli sensor protein BaeS or
FT                   B2078 SW:BAES_ECOLI (P30847) (467 aa) fasta scores: E():
FT                   1.8e-28, 33.333% id in 372 aa"
FT                   /db_xref="GOA:Q6NKG4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKG4"
FT                   /protein_id="CAE48571.1"
FT                   /translation="MNPGPGLTFRFLAAQVLVVVISLMVAAAVATMVGPTLFHDHMLMA
FT                   GREDPSLGLFHAEQAYRDANLITLAVALPTALISALLASLWLSRRLRTPLQDLTRAATS
FT                   LAAGNSRIRVPAGGAGPEVATLAHAFNTMADRLEHTEQVRRQMLSDLAHEMGTPLSVLT
FT                   AYLDGLQDGVVDWNNANHTIMADQLTRLTRLMEDIDYVSRAQEHRIDLDLAEEGLGDLL
FT                   HTAAAAAGEAYADKGVDLQVETITDTARVVVDRQRFGQVMSNLLSNALRHTPVGGQVRI
FT                   SVHRQGASTALIHVADDGEGIPPGQLGHIFERFYRGDAARSRDNGGSGIGLTISKALIE
FT                   AHGGTLTATSPGPGRGAVFTLRLPLSPPDSEEAAR"
FT   misc_feature    complement(56567..56911)
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, phytochrome-like ATPase"
FT                   /note="HMMSmart hit to SM00387, Histidine kinase-like
FT                   ATPases"
FT   misc_feature    complement(56567..57220)
FT                   /note="ProfileScan hit to PS50109, Bacterial histidine
FT                   kinase domain."
FT   misc_feature    complement(56576..56617)
FT                   /note="FPrintScan hit to PR00344, Bacterial sensor protein
FT                   C-terminal signature"
FT   misc_feature    complement(56636..56692)
FT                   /note="FPrintScan hit to PR00344, Bacterial sensor protein
FT                   C-terminal signature"
FT   misc_feature    complement(56711..56743)
FT                   /note="FPrintScan hit to PR00344, Bacterial sensor protein
FT                   C-terminal signature"
FT   misc_feature    complement(56753..56797)
FT                   /note="FPrintScan hit to PR00344, Bacterial sensor protein
FT                   C-terminal signature"
FT   misc_feature    complement(57047..57241)
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain"
FT                   /note="HMMSmart hit to SM00388, His Kinase A
FT                   (phosphoacceptor) domain"
FT   misc_feature    complement(57242..57403)
FT                   /note="HMMSmart hit to SM00304, HAMP (Histidine kinases,
FT                   Adenylyl cyclases, Methyl binding proteins, Phosphatases)
FT                   domain"
FT   misc_feature    complement(57251..57463)
FT                   /note="HMMPfam hit to PF00672, HAMP domain"
FT   misc_feature    complement(order(57404..57469,57557..57622))
FT                   /note="2 probable transmembrane helices predicted for
FT                   DIP0063 by TMHMM2.0"
FT   CDS_pept        complement(57664..58386)
FT                   /transl_table=11
FT                   /locus_tag="DIP0064"
FT                   /product="Putative two-component system response regulator"
FT                   /note="Similar to Enterococcus faecalis VicR protein
FT                   TR:Q9REA7 (EMBL:AJ012050) (283 aa) fasta scores: E():
FT                   5.5e-35, 44.978% id in 229 aa, to Bacillus subtilis
FT                   alkaline phosphatase synthesis transcriptional regulatory
FT                   protein PhoP SW:PHOP_BACSU (P13792) (240 aa) fasta scores:
FT                   E(): 3e-34, 42.918% id in 233 aa, and to Bacillus subtilis
FT                   hypothetical sensory transduction protein YycF
FT                   SW:YYCF_BACSU (P37478) (235 aa) fasta scores: E(): 1.8e-33,
FT                   43.478% id in 230 aa"
FT                   /db_xref="GOA:Q6NKG3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKG3"
FT                   /protein_id="CAE48572.1"
FT                   /translation="MADHTPTTATPPGRVLVVDDEQPLAQMVASYLIRAGFDTRQAHTG
FT                   TQAVDEARRFSPDVVVLDLGLPELDGLEVCRRIRTFSDCYILMLTARGSEDDKISGLTL
FT                   GADDYITKPFSIRELVTRVHAVLRRPRTSTTPPQVTTPLIVGDLILDPVAHQVRVEETI
FT                   VELTRTEFELLVALALRPGQALTRHDLVTEVWDTTWVGDERIVDVHIGNLRRKLGTDTR
FT                   GRGFIDTVRGVGYRMGQP"
FT   misc_feature    complement(57685..57903)
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C terminal"
FT   misc_feature    complement(57994..58350)
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain"
FT   misc_feature    complement(58006..58347)
FT                   /note="ProfileScan hit to PS50110, Histidine-receiving
FT                   module in bacterial sensor systems."
FT   misc_feature    complement(58018..58350)
FT                   /note="HMMSmart hit to SM00448, cheY-homologous receiver
FT                   domain"
FT   CDS_pept        58730..59365
FT                   /transl_table=11
FT                   /locus_tag="DIP0066"
FT                   /product="Putative exported protein"
FT                   /note="No database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKG2"
FT                   /protein_id="CAE48573.1"
FT                   /translation="MAPTLRRCLLTVLPRAKEIDVKRAAIAAAALALALTGCSAADPEP
FT                   TADGTVSQDTFLTTHGLADMDAVEIIDHLDRQKVTERPTDLIASVRADELLLSSGDQEV
FT                   VVDLPDNQTYVSIAPYLTSTHDCFYHSLTTCQGELSNEDIQVKITDEATGEVLVDEATT
FT                   TFDNGFIGFWLPDDVTGLIEVSYQGRTGTTEFSTTDDGATCVTDLRLT"
FT   misc_feature    58730..58852
FT                   /note="Signal peptide predicted for DIP0066 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.927) with cleavage site
FT                   probability 0.560 between residues 46 and 47"
FT   CDS_pept        59436..60917
FT                   /transl_table=11
FT                   /locus_tag="DIP0067"
FT                   /product="Putative exported multicopper oxidase"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551
FT                   copper-binding protein, putative MT0869 TR:AAK45112
FT                   (EMBL:AE006975) (504 aa) fasta scores: E(): 9e-68, 43.028%
FT                   id in 502 aa, and to Nicotiana tabacum L-ascorbate oxidase
FT                   precursor Aao SW:ASO_TOBAC (Q40588) (578 aa) fasta scores:
FT                   E(): 2.5e-14, 25.344% id in 509 aa. Note: Contains a
FT                   putative twin-arginine translocation (TAT) system
FT                   recognition motif (RRQFLL) at the N-terminal region"
FT                   /db_xref="GOA:Q6NKG1"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKG1"
FT                   /protein_id="CAE48574.1"
FT                   /translation="MTNAFSRRQFLLGGLVLAGTGAVAACTSDPGPAASAPGSSLRPTP
FT                   TPTALGEPTVRRTLTARPLSLDIGGIEAKTWGYVSDTGDAAIEATAGDVLQVDITNELP
FT                   ESTSIHWHGIALHNAADGVPGMTQDPIEPGESFSYVFEVPHGGTYFYHSHTGLQLDRGL
FT                   HAPLIIRDPQDAEDQDVEWTIVLDDWVDGIQGTPDDELDKLTGMGSGDHNGKKGMGGHG
FT                   HMMHGTPDRVLGGDAGDVMYPHYLINGRIPRAHRTFEARPGDKARLRFINSGGDTIFKV
FT                   ALGGHRMTVTHTDGFPVQPWETESIYLSMGERVDVEVILGDGIFPLTALAVGKDDRAFA
FT                   VIRTAGGQAPHPDVDFPELSSTGLLLSSLKPADRALLPEGTPDREVSIDLGGQMMPYEW
FT                   RILTDGQSSSATVQEGQRLRMVMRNRTMMPHPMHIHGHTWALPGSGGLRKDTVLLRHGE
FT                   TMIADLIADNPGEWAFHCHNAYHMETGMLSSLRYE"
FT   misc_feature    59436..59588
FT                   /note="Signal peptide predicted for DIP0067 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.505 between residues 51 and 52"
FT   misc_feature    59454..59471
FT                   /note="Potential twin-arginine recognition motif RRQFLL"
FT   misc_feature    59562..59954
FT                   /note="HMMPfam hit to PF00394, Multicopper oxidase"
FT   misc_feature    59874..59936
FT                   /note="ScanRegExp hit to PS00079, Multicopper oxidases
FT                   signature 1."
FT   misc_feature    60105..60476
FT                   /note="HMMPfam hit to PF00394, Multicopper oxidase"
FT   misc_feature    60219..60248
FT                   /note="ScanRegExp hit to PS00215, Mitochondrial energy
FT                   transfer proteins signature."
FT   misc_feature    60567..60914
FT                   /note="HMMPfam hit to PF00394, Multicopper oxidase"
FT   misc_feature    60843..60905
FT                   /note="ScanRegExp hit to PS00079, Multicopper oxidases
FT                   signature 1."
FT   misc_feature    60858..60893
FT                   /note="ScanRegExp hit to PS00080, Multicopper oxidases
FT                   signature 2."
FT   CDS_pept        complement(60895..61203)
FT                   /transl_table=11
FT                   /locus_tag="DIP0068"
FT                   /product="Hypothetical protein"
FT                   /note="Weak similarities to Streptomyces coelicolor
FT                   putative DNA polymerase III, epsilon chain SCI8.12
FT                   TR:Q9RJ41 (EMBL:AL132644) (328 aa) fasta scores: E(): 2.7,
FT                   42.22% id in 45 aa, and to Thermotoga maritima DNA
FT                   polymerase III PolC-type PolC or TM0576 SW:DPO3_THEMA
FT                   (Q9ZHF6) (1367 aa) fasta scores: E(): 9.3, 39.58% id in 48
FT                   aa"
FT                   /db_xref="GOA:Q6NKG0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKG0"
FT                   /protein_id="CAE48575.1"
FT                   /translation="MSVWASRLKAMGLLENLLNRYTPRTSGTPVFAVIDTGTTGFNKRY
FT                   DHIIELAAVRADAYFKPVDSWHALLNPDTNAVSTTRGTPPPTSALNPAVGVTRSEAS"
FT   CDS_pept        join(61342..62073,62073..62645)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="tnp1250A"
FT                   /locus_tag="DIP0069"
FT                   /product="transposase (pseudogene)"
FT                   /note="Pseudogene. Similar to Corynebacterium striatum
FT                   transposase Tnp1250A or Tnp1250B TR:Q9ET89 (EMBL:AF024666)
FT                   (416 aa) fasta scores: E(): 1.3e-143, 88.38% id in 396 aa.
FT                   Presents a frameshift at residue 244"
FT                   /db_xref="PSEUDO:CAE48576.1"
FT   misc_feature    61471..62070
FT                   /note="HMMPfam hit to PF00872, Transposase, Mutator family"
FT   misc_feature    62082..62537
FT                   /note="HMMPfam hit to PF00872, Transposase, Mutator family"
FT   misc_feature    62094..62168
FT                   /note="ScanRegExp hit to PS01007, Transposases, Mutator
FT                   family, signature."
FT   CDS_pept        complement(62898..63353)
FT                   /transl_table=11
FT                   /locus_tag="DIP0071"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKF9"
FT                   /protein_id="CAE48577.1"
FT                   /translation="MKLSPHCSLPLTLGGTTDQVASQCYEHEIIDNDFVTELEGFIDIE
FT                   NIEPGDEGRKIICRVENGRCVTVTMAYLDLPITDTFLGLGLNYGPNAKAQFLAGLRHQG
FT                   VEVIAQSEYIILPNDFVTIELGESITWWDRAYWGTDGFLNEAISLQP"
FT   CDS_pept        complement(63350..63850)
FT                   /transl_table=11
FT                   /locus_tag="DIP0072"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKF8"
FT                   /protein_id="CAE48578.1"
FT                   /translation="MLASQTQKLTHRINHDARRSEPSTRFSHIRFRLLRDSMDFSKSPV
FT                   TSIVLNAPVNDYSAILTDFKFFDNPLFSHLSGKLLIGESMRNIKFGAKRDMVTSAEIID
FT                   IVASDSFMGIPLSQRAKTFYHSLLTAGIEAKMDKWGIELANQPVGFSTEKGKIASIHWS
FT                   ASR"
FT   CDS_pept        complement(63823..64218)
FT                   /transl_table=11
FT                   /locus_tag="DIP0073"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Weakly similar to Rhizobium loti MLR2640 protein
FT                   TR:Q98HZ4 (EMBL:AP003000) (140 aa) fasta scores: E(): 4.2,
FT                   27.1% id in 107 aa"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKF7"
FT                   /protein_id="CAE48579.1"
FT                   /translation="MDFLKQPCAPLDFDLSREQIEGMLRSARFIKGSFSTRVVGHLPID
FT                   NSFRQVSVAIENETSSSIEIMTLERGDTFCGIPLKQRKIPFQNSLKSADIDFTYDDSGI
FT                   DLTNAPVSFFIEGGRVASICWHHKHRN"
FT   CDS_pept        complement(64253..64393)
FT                   /transl_table=11
FT                   /locus_tag="DIP0074"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKF6"
FT                   /protein_id="CAE48580.1"
FT                   /translation="MQEGKVEEAFRIEYEFISQTFPGKYGQALDEMMAYTRQQGLISSP
FT                   A"
FT   CDS_pept        64602..66083
FT                   /transl_table=11
FT                   /locus_tag="DIP0075"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="InterPro:IPR041223"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKF5"
FT                   /protein_id="CAE48581.1"
FT                   /translation="MADDPLYLDRTGEWAGLWWLPEIPDEKVPGFLRYDAECGLLLSLI
FT                   GAFEDRVTSNPSPGVTAYHEGTRTWEVIHGVAEQREITLFDTIPISSKRTIGARVESPA
FT                   KQTVTASVAIIGAHVRSEGDPQFAGVEVSVEDLGRWAGSSVFEGLLGAPDGNFDGTGSI
FT                   SVKPVEAQSVLVGGTEYRLVHTHTLPYFDQRKSETVGRMRDTVSIRIVPASPFSLNAAL
FT                   HEASLVQDLISLATHQSAGVIWLRVEVARSESQLPDGRTSPRRRADVLYSPVALGKHDA
FT                   KPVDHHRMFFTCNSLPFEEVLPRWCETHVRLQAATNMILGLRYAPARFVENNLLTAVGA
FT                   AEALHRNLRIGEKPFSKAEFTAMRGAMLDQVPSEHRERFKAAIRNDPTLRDRLHALAAR
FT                   PDEEAIGQLIPDVDYWAKRTTRARNDLAHEGRTPNHSFEELVAIVEVTTAVVILNVLQE
FT                   LGLSAERQREIVLTHPKLRHTVGLSREWLVPSKSD"
FT   misc_feature    64602..64688
FT                   /note="ScanRegExp hit to PS00402, Binding-protein-dependent
FT                   transport systems inner membrane comp. sign."
FT   CDS_pept        66426..66797
FT                   /transl_table=11
FT                   /locus_tag="DIP0076"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKF4"
FT                   /protein_id="CAE48582.1"
FT                   /translation="MYDNTTDTKMQAERQKKSCTTVGGVLAYSVPTGLHRCDSAVTRVE
FT                   EVHMAEMVEIPAALYGRGAVRVVPVDSTVRLDVKIPAALMRKLMIESNRSGVPLTKIVD
FT                   RLLSAAIAQDSEQEEIRPR"
FT   CDS_pept        66921..67721
FT                   /transl_table=11
FT                   /locus_tag="DIP0077"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKF3"
FT                   /protein_id="CAE48583.1"
FT                   /translation="MEEIWLSCHALVFHTTPTQRLCVGWGELAVGRFVKMAAAPAPEMT
FT                   PRLDVSKNATDPDSLTDHGFQYSRHRPVITDHKRFDRLVGFSIKQSNVELAAEAIKQAA
FT                   TVWCLTEKKSDKRDEDSVKFLATYLYKESLYWGKIDPRRALQRATAESWLGSQSFAPTS
FT                   ARTYKAVLHTAGRVLYPAEFPPANRYSNPRAKPVDPASVELIDELYGVAATLPAVHRLR
FT                   LQLILDLTTQSGLRSAEVLDLRGSDVTARILDTGERIALVRVHR"
FT   CDS_pept        67740..68582
FT                   /transl_table=11
FT                   /locus_tag="DIP0078"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKF2"
FT                   /protein_id="CAE48584.1"
FT                   /translation="MPVISPARSKRLLDHAKTVGRGHFFPSPSGGRPYNSSVANVFRYL
FT                   RERGFPSTTVEALRARWLVDLANSPLPAAMVFQLAGNSHYWSLATHHDHLMSMEPKGVA
FT                   ELMLRAKGVGMISMLEHGFVIKADVWSRAQEVIRRGYAAEYIEQINAQYRGAGGRKATA
FT                   VVPSIEAVLTAGLALIMIGKPASIAGIHRLLCELEPDQRLECGFAKDGALLAYPAFANW
FT                   LTRQLEVFDPGADLVARRVLNHVHREQLAARTAEQREASELARARRDELVNLIVAGSR"
FT   CDS_pept        68563..69828
FT                   /transl_table=11
FT                   /locus_tag="DIP0079"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKF1"
FT                   /protein_id="CAE48585.1"
FT                   /translation="MLPAVDDRCSGGYAGDVVADETIIDLAGPSEGLGVRPDKQRAAAY
FT                   AGAYYIRDKTHQLGTGEKMREVTKRGFGIGVTAVSRVGSADDLYSVSPVITAISIDKPS
FT                   PGSTVALGRALQMHQANGFAASVKTKANARLPYLCVDMGYSVRPDFTTVVHDHGFAPVM
FT                   RYPVSRQTVWASEKPEFGSQSPGPVQINSAFYCPAALPLARQRRLVRRLNELLDEQDGF
FT                   EAHDQALQKLLPLLMGTNSRPLKFVSKRKRSPETIPTYQIDLVCPAVQGRVKCPLKPES
FT                   LIIAFDQPEVKPTWSADRYRCCSKSQIRHTYSSEQWKLAQWGMVPGSWEHAIYYEAARS
FT                   LTEQRFSIMKSQHLSGREHLKWSPRREPMISVIIALWIAATNLAIQDSHVAKMPRPSSI
FT                   KKQKRRLERDLGRALMSTPPRT"
FT   CDS_pept        69994..70125
FT                   /transl_table=11
FT                   /locus_tag="DIP0080"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No strong consensus RBS usptream. No
FT                   significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKF0"
FT                   /protein_id="CAE48586.1"
FT                   /translation="MLEGDQMGFRVDFLPGVLLRGSSGLLIFDLGSSFETLVVDLGS"
FT   CDS_pept        70294..70473
FT                   /transl_table=11
FT                   /locus_tag="DIP0081"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No strong consensus RBS usptream. No
FT                   significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKE9"
FT                   /protein_id="CAE48587.1"
FT                   /translation="MARSRNGSTIVGRKSLVPRRRNRLALKHCLTVWVFVRGRNGELCR
FT                   PTKLPDFSGDDVHG"
FT   CDS_pept        70504..70929
FT                   /transl_table=11
FT                   /locus_tag="DIP0082"
FT                   /product="Putative secreted protein"
FT                   /note="Possible secreted protein. No database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKE8"
FT                   /protein_id="CAE48588.1"
FT                   /translation="MRGRKRKVRLSGVMTLTMFLKSAADYFVYFHTHFISTKIRSFFAA
FT                   VATVFSALVFSCPLASAASDAIPEDATSRVVVEPGESFTFTFDDETSNDGVFTRSVNAV
FT                   AFTGTFAAPQAEAGGIISYGLHVRCTGTGFLPLSAKI"
FT   misc_feature    70504..70689
FT                   /note="Signal peptide predicted for DIP0082 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.436 between residues 62 and 63"
FT   CDS_pept        70997..71137
FT                   /transl_table=11
FT                   /locus_tag="DIP0083"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKE7"
FT                   /protein_id="CAE48589.1"
FT                   /translation="MATDLSVEKQSVGQLLPVMITEFLERFLQDRIMALASLEKSIFRA
FT                   M"
FT   CDS_pept        71572..71700
FT                   /transl_table=11
FT                   /locus_tag="DIP0084"
FT                   /product="Putative membrane protein"
FT                   /note="Doubtful CDS. Possible membrane protein. No database
FT                   matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKE6"
FT                   /protein_id="CAE48590.1"
FT                   /translation="MVTLAVVVPVTVFVLRFLMKAMKAMDIMIENNKWDGASSDEK"
FT   misc_feature    71575..71628
FT                   /note="1 probable transmembrane helix predicted for DIP0084
FT                   by TMHMM2.0"
FT   CDS_pept        complement(71845..72360)
FT                   /transl_table=11
FT                   /locus_tag="DIP0085"
FT                   /product="Putative membrane protein"
FT                   /note="Weakly similar to Euhadra herklotsi NADH
FT                   dehydrogenase subunit 1 TR:O21342 (EMBL:Z71695) (296 aa)
FT                   fasta scores: E(): 0.57, 24.16% id in 120 aa"
FT                   /db_xref="GOA:Q6NKE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKE5"
FT                   /protein_id="CAE48591.1"
FT                   /translation="MNSQIKERFYDFAISNGNHYPRWRNPQSTHLLITGYFVSLVLALI
FT                   FELLMFAWIHFIWLFIACMFIAMTCWTILRSTIDLKDMAPEDRLDDYEKAVINQWRQRS
FT                   LSTALSLLFIGGLAAIIASASFIATDSPLSPNLLAIFAGLYMIYTYIFASSLPAVGYAL
FT                   TFNRNPEE"
FT   misc_feature    complement(order(71884..71949,71980..72045,72139..72189,
FT                   72202..72267))
FT                   /note="4 probable transmembrane helices predicted for
FT                   DIP0085 by TMHMM2.0"
FT   CDS_pept        complement(72365..72664)
FT                   /transl_table=11
FT                   /locus_tag="DIP0086"
FT                   /product="Putative regulatory protein"
FT                   /note="Similar to Deinococcus radiodurans transcriptional
FT                   regulator, HTH_3 family DR2259 TR:Q9RS68 (EMBL:AE002058)
FT                   (82 aa) fasta scores: E(): 1.3e-10, 47.67% id in 86 aa"
FT                   /db_xref="GOA:Q6NKE4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKE4"
FT                   /protein_id="CAE48592.1"
FT                   /translation="MTIYYVYTTLYCMSPKKKLERTIYNRIRVLRTERDMSRAQLAELV
FT                   DVNPQTIGALERGDHSPSLDLALRICDVFNLPIEAIFSRIPFTPLTAASLTQGA"
FT   misc_feature    complement(72422..72586)
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix"
FT   misc_feature    complement(72422..72589)
FT                   /note="HMMSmart hit to SM00530, Helix-turn-helix XRE-family
FT                   like proteins, DNA-binding"
FT   misc_feature    complement(72494..72559)
FT                   /note="Predicted helix-turn-helix motif with score 1845
FT                   (+5.47 SD) at aa 36-57, sequence MSRAQLAELVDVNPQTIGALER"
FT   CDS_pept        complement(join(72678..73145,73171..73497))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="DIP0087"
FT                   /product="Putative antibiotic production protein
FT                   (pseudogene)"
FT                   /note="Pseudogene. Similar to Pseudomonas chlororaphis
FT                   phenazine biosynthesis protein PhzF or PhzC SW:PHZF_PSECL
FT                   (Q51520) (278 aa) fasta scores: E(): 1.1e-11, 32.92% id in
FT                   246 aa, and to Pseudomonas fluorescens phenazine
FT                   biosynthesis protein PhzF SW:PHZF_PSEFL (Q51792) (278 aa)
FT                   fasta scores: E(): 1.8e-11, 32.38% id in 247 aa. Presents a
FT                   frameshift at residue 109"
FT                   /db_xref="PSEUDO:CAE48593.1"
FT   CDS_pept        complement(73648..74943)
FT                   /transl_table=11
FT                   /locus_tag="DIP0089"
FT                   /product="Putative membrane protein"
FT                   /note="Weakly similar in its N-terminal region to Bacillus
FT                   subtilis SpaE TR:O52853 (EMBL:U09819) (251 aa) fasta
FT                   scores: E(): 0.0095, 21% id in 200 aa"
FT                   /db_xref="GOA:Q6NKE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKE3"
FT                   /protein_id="CAE48594.1"
FT                   /translation="MWQSMYATGIAAPLTAMFAASAELREHHARMGGRHWRGLSMRSLR
FT                   LARFVAVIACVAVFHVLNFGGTWLLALLDGRTGANRILLLGVLSWVGAIGVAGLAMACA
FT                   RSTNIVITLVVFLVWQLAGTTRPIVEGSVWWAFPFAWPVRLVLPVLQVHQNAVPLEPDA
FT                   ALRHESPWLALLLCLVLAVAGAIIAVVTPRYCIAFRRAHQHVSTAVLREASTRRPADRP
FT                   RNVLPALLPVALTPAVRSCIILCTILILCVAMIYPPSYVHGLFTFAILPIGAGILPALI
FT                   WPTTAPAWNIMRIENPHCTPTLLSIHALCVSAMSAIAALAGLISGSPLSTELTRLTLAI
FT                   PVGCMLTMIALLIVTRFGTTTTIIWAVIWTIISATLGGDVLADTPLWLLAAAAWPEIAH
FT                   GPRWLVAFSIAAITCAALYPLCARTLRTHRSE"
FT   misc_feature    complement(order(73678..73734,73795..73860,73882..73938,
FT                   73969..74034,74098..74163,74176..74268,74374..74430,
FT                   74557..74613,74635..74700,74731..74796))
FT                   /note="10 probable transmembrane helices predicted for
FT                   DIP0089 by TMHMM2.0"
FT   CDS_pept        complement(75080..75781)
FT                   /transl_table=11
FT                   /locus_tag="DIP0090"
FT                   /product="ABC transport system ATP-binding protein"
FT                   /note="Similar to Lactococcus lactis NisF TR:Q48597
FT                   (EMBL:U17255) (225 aa) fasta scores: E(): 1.3e-25, 43.8% id
FT                   in 226 aa, and to Staphylococcus epidermidis putative ABC
FT                   transporter subunit EpiF TR:Q54002 (EMBL:U77778) (231 aa)
FT                   fasta scores: E(): 7.1e-21, 38.15% id in 228 aa"
FT                   /db_xref="GOA:Q6NKE2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKE2"
FT                   /protein_id="CAE48595.1"
FT                   /translation="MSTTIRVNEVSKSFHGQHVLNNVSCDIRPGEVHALLGRNGAGKST
FT                   LFSILLGLIPADSGEVTIDISQVGASIDGPAFYGHLSARSNVRVHSTLLGLPDSEADRV
FT                   LDVVGLSDVGSKKARSFSTGMKARLALAQAILGDPDILILDEPQNGLDPQGIRDLRALL
FT                   RAWAASGKTVLVSSHQLGEVTQLADTVTILAEGTIRYSGPLNQLAPQGQLEQEFFRLTQ
FT                   PGVLEAGDHHE"
FT   misc_feature    complement(75170..75697)
FT                   /note="HMMSmart hit to SM00382, ATPases associated with a
FT                   variety of cellular activities"
FT   misc_feature    complement(75194..75694)
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    complement(75206..75421)
FT                   /note="ProfileScan hit to PS50100, 2nd half motif for
FT                   nucleotide binding, associated with P-loop."
FT   misc_feature    complement(75266..75289)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    complement(75611..75688)
FT                   /note="ProfileScan hit to PS50101, P-loop nucleotide
FT                   binding motif (does not find all)."
FT   misc_feature    complement(75650..75673)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        complement(75820..76479)
FT                   /transl_table=11
FT                   /locus_tag="DIP0091"
FT                   /product="Putative two-component system response regulator"
FT                   /note="Similar to Streptomyces lividans response regulator
FT                   homolog TR:P72471 (EMBL:U63847) (225 aa) fasta scores: E():
FT                   2.7e-29, 42.98% id in 221 aa, and to Streptomyces
FT                   coelicolor putative two-component system regulator
FT                   SCH10.18c TR:Q9X8Q7 (EMBL:AL049754) (228 aa) fasta scores:
FT                   E(): 3e-26, 38.53% id in 218 aa"
FT                   /db_xref="GOA:Q6NKE1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKE1"
FT                   /protein_id="CAE48596.1"
FT                   /translation="MIRIVLADDQPPILKAFSTIIHSRDTMRVVATAANGAEAINACMS
FT                   HNVDVVVMDIRMPVMDGITAARAILARHPRIRIVMLTTFDDPTLVREALTAGVHGFLLK
FT                   DADPEIFLTAIEAIHSGESVLASGVTKQVIDTFRHAYGSDLSPEQRQGLSLITRREMDV
FT                   LLCVAQGLTNAEISADLGIAETTVKTHITALLAKVHARDRVALVLFVHKAGLLLPR"
FT   misc_feature    complement(75826..76023)
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR family"
FT   misc_feature    complement(75850..76023)
FT                   /note="HMMSmart hit to SM00421, helix_turn_helix, Lux
FT                   Regulon"
FT   misc_feature    complement(75862..76014)
FT                   /note="ProfileScan hit to PS50043, Helix-turn-helix domain,
FT                   luxR and related types (substantial overlap with lysR
FT                   type)."
FT   misc_feature    complement(75886..75924)
FT                   /note="FPrintScan hit to PR00038, LuxR bacterial regulatory
FT                   protein HTH signature"
FT   misc_feature    complement(75889..75972)
FT                   /note="ScanRegExp hit to PS00622, Bacterial regulatory
FT                   proteins, luxR family signature."
FT   misc_feature    complement(75922..75972)
FT                   /note="FPrintScan hit to PR00038, LuxR bacterial regulatory
FT                   protein HTH signature"
FT   misc_feature    complement(75970..76014)
FT                   /note="FPrintScan hit to PR00038, LuxR bacterial regulatory
FT                   protein HTH signature"
FT   misc_feature    complement(76111..76476)
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain"
FT   misc_feature    complement(76123..76473)
FT                   /note="ProfileScan hit to PS50110, Histidine-receiving
FT                   module in bacterial sensor systems."
FT   misc_feature    complement(76135..76476)
FT                   /note="HMMSmart hit to SM00448, cheY-homologous receiver
FT                   domain"
FT   CDS_pept        complement(76479..77708)
FT                   /transl_table=11
FT                   /locus_tag="DIP0092"
FT                   /product="Putative two component system sensor kinase"
FT                   /note="Similar to Streptomyces coelicolor putative two
FT                   component sensor kinase SC5F7.35c TR:Q9S2S0 (EMBL:AL096872)
FT                   (416 aa) fasta scores: E(): 2.9e-17, 32.79% id in 308 aa,
FT                   and to Streptomyces coelicolor putative two-component
FT                   system sensor kinase SCH10.17c TR:Q9X8Q6 (EMBL:AL049754)
FT                   (472 aa) fasta scores: E(): 1.1e-11, 33.61% id in 241 aa"
FT                   /db_xref="GOA:Q6NKE0"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKE0"
FT                   /protein_id="CAE48597.1"
FT                   /translation="MPNLIFSYISHLRKRRAPQKDLARTTHHTTTIATMARLGDKILTA
FT                   TATIITAGYLFFATQTPSAHNTAHAAISILFLPFIWHWRSRPKLSSAGFVTLLGAWAAV
FT                   WCHALPENMGITPWAVLAPMAVYAPARYLPQRNWGRIILLLTLAGSFVSPAMWRLDSHL
FT                   LLHYREGMELVLAIGFHWALLGCVYAVGARYFLADQARETAYQSAREEEKLLIARELHD
FT                   VLAHSLTLIKVQAQAGLYGGDQREALEEILNAAATSLEEVRGIVQALRDPTQSGAMQPL
FT                   CQLADLAEIIASFERAGLNISAHLPQHCPPVPTLVQLAGVRIVSEALTNVVKHQGVGST
FT                   VQLSVQVDEQLQITVDSQATAPTGASTSPGSGLLGLNERATALGGRFSAQGTASDFHVC
FT                   ATIPMHQEDH"
FT   misc_feature    complement(order(77121..77186,77232..77297,77319..77369,
FT                   77382..77438,77460..77510,77526..77582))
FT                   /note="6 probable transmembrane helices predicted for
FT                   DIP0092 by TMHMM2.0"
FT   misc_feature    complement(77472..77504)
FT                   /note="ScanRegExp hit to PS00133, Zinc carboxypeptidases,
FT                   zinc-binding region 2 signature."
FT   CDS_pept        complement(77804..78145)
FT                   /transl_table=11
FT                   /locus_tag="DIP0093"
FT                   /product="Putative membrane protein"
FT                   /note="Probable membrane protein. No database matches"
FT                   /db_xref="GOA:Q6NKD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKD9"
FT                   /protein_id="CAE48598.1"
FT                   /translation="MIIPVAVMQCVAVAIVNVINVVVVRNCYVTATWAMLMLMVGVGVM
FT                   LGGFTLIPVAVMFAVQVAVVNIVNMVAVRNCHMATVRAVLVGVVLVNYVGHDVETPLSR
FT                   CEKLFFNKL"
FT   misc_feature    complement(77852..78145)
FT                   /note="ProfileScan hit to PS50326, Valine-rich region."
FT   misc_feature    complement(order(77861..77911,77972..78037,78074..78130))
FT                   /note="3 probable transmembrane helices predicted for
FT                   DIP0093 by TMHMM2.0"
FT   CDS_pept        complement(78214..78330)
FT                   /transl_table=11
FT                   /locus_tag="DIP0094"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No strong consensus RBS usptream. No
FT                   significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKD8"
FT                   /protein_id="CAE48599.1"
FT                   /translation="MYKIPRGDVGIVIQQSPTQHWPLNRVVIFQFLRFLESK"
FT   CDS_pept        complement(78414..79088)
FT                   /transl_table=11
FT                   /gene="opuBB"
FT                   /gene_synonym="proW"
FT                   /locus_tag="DIP0095"
FT                   /product="choline transport system permease protein"
FT                   /note="Similar to Bacillus subtilis choline transport
FT                   system permease protein OpuBB or ProW SW:OPBB_BACSU
FT                   (Q45461) (217 aa) fasta scores: E(): 3e-14, 30.72% id in
FT                   192 aa, and to Mycobacterium tuberculosis putative
FT                   transport system permease Rv3756c or MTV025.104c TR:O69722
FT                   (EMBL:AL022121) (239 aa) fasta scores: E(): 1.9e-28, 48.32%
FT                   id in 209 aa"
FT                   /db_xref="GOA:Q6NKD7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKD7"
FT                   /protein_id="CAE48600.1"
FT                   /translation="MTWFGDLLSYLTTAAHWWGSQGFLARLLEHVGISLAAVAIAALLA
FT                   LPAGVLIGHTGRGAGLVGGVSGAARALPTLGLLTIFGLAFGIGLTAPMLALIILAIPSL
FT                   LAGAYSGVAAVDRATIDAAYAMGFTHRQVISSIELPLSAAVLVGGIRAAVLQVTATATL
FT                   AAYTADVGLGRFIFHGLKTRDYIEMLAASVLVIALALLFDALLGGAQKLISQRTRTATP
FT                   AP"
FT   misc_feature    complement(order(78465..78530,78624..78689,78750..78815,
FT                   78846..78911,78933..78998))
FT                   /note="5 probable transmembrane helices predicted for
FT                   DIP0095 by TMHMM2.0"
FT   misc_feature    complement(78546..78758)
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   CDS_pept        complement(79095..79736)
FT                   /transl_table=11
FT                   /gene="opuBD"
FT                   /gene_synonym="proZ"
FT                   /locus_tag="DIP0096"
FT                   /product="choline transport system permease protein"
FT                   /note="Similar to Bacillus subtilis choline transport
FT                   system permease protein OpuBD or ProZ SW:OPBD_BACSU
FT                   (P39775) (226 aa) fasta scores: E(): 8.5e-13, 29.44% id in
FT                   197 aa, and to Mycobacterium tuberculosis transport system
FT                   permease Rv3757c or MTV025.105c TR:O69723 (EMBL:AL022121)
FT                   (229 aa) fasta scores: E(): 4.7e-25, 39.71% id in 209 aa"
FT                   /db_xref="GOA:Q6NKD6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKD6"
FT                   /protein_id="CAE48601.1"
FT                   /translation="MWLMHAWPEVLDLLRAHVLLSVPAIVISVLVAVPVGLFAARHPRV
FT                   GNTVVQVTSLAYTIPALPMLVIVPFIVAVPLRSQINVIIALCVYGIALIVRTATDAFRS
FT                   VPEEVRTAAVAQGMSPSQIAWKVDMPLAIPVLISGLRVLCVSTVGLVTIGALIGVSSLG
FT                   SLFTDGFQRNITAEVVVGIVAVVLLAVLFDVACLILQRLCTPWTRPGKAR"
FT   misc_feature    complement(order(79140..79205,79266..79331,79452..79502,
FT                   79515..79580,79617..79682))
FT                   /note="5 probable transmembrane helices predicted for
FT                   DIP0096 by TMHMM2.0"
FT   misc_feature    complement(79224..79436)
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   CDS_pept        complement(79727..80557)
FT                   /transl_table=11
FT                   /gene="opuBA"
FT                   /gene_synonym="proV"
FT                   /locus_tag="DIP0097"
FT                   /product="choline transport system ATP-binding protein"
FT                   /note="Similar to Bacillus subtilis choline transport
FT                   ATP-binding protein OpuBA or ProV SW:OPBA_BACSU (Q45460)
FT                   (381 aa) fasta scores: E(): 2.5e-42, 50.58% id in 255 aa,
FT                   and to Mycobacterium tuberculosis putative ABC transporter
FT                   ATP-binding protein Rv3758c or MTV025.106c TR:O69724
FT                   (EMBL:AL022121) (376 aa) fasta scores: E(): 1.3e-42, 53.62%
FT                   id in 248 aa"
FT                   /db_xref="GOA:Q6NKD5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKD5"
FT                   /protein_id="CAE48602.1"
FT                   /translation="MIEFESVSKRYGKRGEKAVADFSLFIPKGKTTVLVGSSGSGKTTL
FT                   LRMINRMVEPTEGRVIVRGKDVAETDPVQLRRSIGYVIQSAGLLPHRTVIQNIALVPTL
FT                   NKEPKAEIERRAKQALADVNLEPSLANRYPGELSGGQQQRVGVARALASDPDILLMDEP
FT                   FGAVDPIVRRSLQKQLIDLQSRLHKTVVMVTHDIDEAFCVGDHIVVLEKGGKIAQQGSP
FT                   AHIFAHPANDFVASFLGSDQENRSLHTELIDGHTVVVDTFGRPLGTLGDGATCG"
FT   misc_feature    complement(79916..80476)
FT                   /note="HMMSmart hit to SM00382, ATPases associated with a
FT                   variety of cellular activities"
FT   misc_feature    complement(79919..80473)
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    complement(79931..80149)
FT                   /note="ProfileScan hit to PS50100, 2nd half motif for
FT                   nucleotide binding, associated with P-loop."
FT   misc_feature    complement(80105..80149)
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   misc_feature    complement(80390..80467)
FT                   /note="ProfileScan hit to PS50101, P-loop nucleotide
FT                   binding motif (does not find all)."
FT   misc_feature    complement(80429..80452)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        complement(80567..81175)
FT                   /transl_table=11
FT                   /locus_tag="DIP0098"
FT                   /product="Putative membrane protein"
FT                   /note="Weakly similar to Mycobacterium tuberculosis
FT                   hypothetical 23.9 kDa protein Rv0444c or MTV037.08C
FT                   TR:O53729 (EMBL:AL021932) (232 aa) fasta scores: E():
FT                   0.004, 25.94% id in 212 aa"
FT                   /db_xref="GOA:Q6NKD4"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKD4"
FT                   /protein_id="CAE48603.1"
FT                   /translation="MSNNFPRDIEDALNVSPAPLTPPPALKLSVMDTIAATPQEQPAQP
FT                   EPEQLATVTPLRRRRPGLVFASMAASVVLLAGAVTAVYQPWQAADPHAQMDSILAASDV
FT                   RQADASAMGATLDIVVSQSMNSGGAMVDGAPAVGHGMGAQVWAVKTDGSMESAGVIGPE
FT                   EHTDVWMPLPGDTHKVMITEEPMAGSTSPRGKVLAEVVV"
FT   misc_feature    complement(80927..80992)
FT                   /note="1 probable transmembrane helix predicted for DIP0098
FT                   by TMHMM2.0"
FT   CDS_pept        complement(81172..81756)
FT                   /transl_table=11
FT                   /locus_tag="DIP0099"
FT                   /product="Putative RNA polymerase sigma factor"
FT                   /note="Similar to Streptomyces coelicolor putative RNA
FT                   polymerase sigma factor SCI11.12c TR:Q9S2A7 (EMBL:AL096849)
FT                   (185 aa) fasta scores: E(): 2.8e-25, 47.36% id in 171 aa,
FT                   and to Bacillus subtilis RNA polymerase sigma factor SigW
FT                   SW:SIGW_BACSU (Q45585) (187 aa) fasta scores: E(): 3.9e-10,
FT                   31.39% id in 172 aa"
FT                   /db_xref="GOA:Q6NKD3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKD3"
FT                   /protein_id="CAE48604.1"
FT                   /translation="MTAVELLVMDPDDLLVAVASGDQAAFAQLYDQLAPYVLGLSTQVI
FT                   HDRAQAEEVTQEVFVEVWRTAPSFDASRGSARSWILRLARSRAIDRVRSDIASKKRDTT
FT                   DFLHSATTWCAAEEEAVESLESQQVRALVDSIGEPHRTAIMLSYFQGLTHSEIAEATGV
FT                   PLGTAKTRLRDGLKKLRQIVHPHLSATGAAR"
FT   misc_feature    complement(81238..81303)
FT                   /note="Predicted helix-turn-helix motif with score 1081
FT                   (+2.87 SD) at aa 152-173, sequence LTHSEIAEATGVPLGTAKTRLR"
FT   misc_feature    complement(81472..81642)
FT                   /note="HMMPfam hit to PF00776, Sigma-70 factor (ECF
FT                   subfamily)"
FT   CDS_pept        complement(81783..82181)
FT                   /transl_table=11
FT                   /locus_tag="DIP0100"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKD2"
FT                   /protein_id="CAE48605.1"
FT                   /translation="MDCSQCEKTFFTQPQSVSHRSSEYPYETHREHSWCQPSSKQVIVK
FT                   HKEYSLMRMTTKAALTMMFAAGAFGLAACGDNGTSEKMTSETSTHMSSEKMTPESDKMM
FT                   ESDKMEHDKMDGKMDHDKMTHESDAMQK"
FT   CDS_pept        82259..83899
FT                   /transl_table=11
FT                   /locus_tag="DIP0101"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Mycobacterium tuberculosis DipZ protein
FT                   Rv2874 or MT2942 or MTCY274.05 SW:DIPZ_MYCTU (Q10801) (695
FT                   aa) fasta scores: E(): 1.6e-43, 43.65% id in 591 aa"
FT                   /db_xref="GOA:Q6NKD1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041017"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKD1"
FT                   /protein_id="CAE48606.1"
FT                   /translation="MFELATIGLIGGIVTGISPCILPVLPVVLAVSVGRRPTHVVAGLA
FT                   LSFATITLLGTVILSSLGLPKDVLRWTGIGLLVIVGLSMMIPKLGELVEEPFSRIPRPT
FT                   FLQQKARDKGGFMIGLALGAVYVPCAGPILAAITVAGATGDIGWPTVVLTVAFAVGASL
FT                   PLLVFALAGNKMGEKIDAIRKHMKLVGAVILALALAMALNIPERVQRAIPDWTAGVQKQ
FT                   ISENDTVRGALSSGGGSLAACRDADPSMLHDCGEAPEFEGLTGWFNTDKPVSTHSGQVT
FT                   LVDFWAYACINCQRAGEHITKLYDAYRDAGLQVVGVHAPEYGFEHELANVKDAAKREGI
FT                   NYPVAQDNDFVTWKKYNNRYWPARYLIDAQGNVRHIHEGEGAYKETEQLVRELLREANP
FT                   QVSLPEPVEKGVEKHDAQLTQRRNPETYLGYERARYFTNSNYGPGERTLEFNAPKVGQY
FT                   TLSGTWEIASDHINPVKDAALSVNIHAATVQTVVSGTGTLEVTYPDGHTKEFKVADGTV
FT                   NVVEQDEPLDGIVTVKPSQGVSFYSLTFG"
FT   misc_feature    82259..82348
FT                   /note="Signal peptide predicted for DIP0101 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.826) with cleavage site
FT                   probability 0.363 between residues 30 and 31"
FT   misc_feature    82280..82864
FT                   /note="HMMPfam hit to PF02683, Cytochrome C biogenesis
FT                   protein transmembrane region"
FT   misc_feature    order(82286..82354,82373..82441,82469..82537,82598..82666,
FT                   82694..82762,82820..82873)
FT                   /note="6 probable transmembrane helices predicted for
FT                   DIP0101 by TMHMM2.0"
FT   misc_feature    83060..83434
FT                   /note="ProfileScan hit to PS50223, Thioredoxin-domain (does
FT                   not find all)."
FT   CDS_pept        complement(83969..84745)
FT                   /transl_table=11
FT                   /gene="tipA"
FT                   /locus_tag="DIP0102"
FT                   /product="transcriptional activator"
FT                   /note="Similar to Streptomyces coelicolor transcriptional
FT                   activator TipA or SCE9.20 SW:TIPA_STRCO (P32184) (253 aa)
FT                   fasta scores: E(): 5.3e-24, 35.85% id in 251 aa"
FT                   /db_xref="GOA:Q6NKD0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKD0"
FT                   /protein_id="CAE48607.1"
FT                   /translation="MVTPMEEHNLRTVGEVADLVGVSVRTLHHWDDIGLVSPQWRSWAD
FT                   YRLYSEEDVAQIYQVLLYRETGMPLKTIRDMLEGNSSPADHLQRQLELLQQRKHRVTSM
FT                   IESVHQLLEDTMNHNEPLSADHTAKVLGREWSKWEKEAEERWGDTEDWAIFQQRAAQMG
FT                   KDDFAARQMVMHKLDQRLAQAFESGMAPDSPDAHALAEEHRACLSQWFPVSHSKHALIA
FT                   QGYTADPRFTAHYDKYAKGLAVWLEKAIQSNAQRHT"
FT   misc_feature    complement(84506..84712)
FT                   /note="HMMSmart hit to SM00422, helix_turn_helix, mercury
FT                   resistance"
FT   misc_feature    complement(84545..84607)
FT                   /note="FPrintScan hit to PR00040, MerR bacterial regulatory
FT                   protein HTH signature"
FT   misc_feature    complement(84599..84706)
FT                   /note="HMMPfam hit to PF00376, Bacterial regulatory
FT                   proteins, merR family"
FT   misc_feature    complement(84638..84679)
FT                   /note="FPrintScan hit to PR00040, MerR bacterial regulatory
FT                   protein HTH signature"
FT   misc_feature    complement(84638..84706)
FT                   /note="ScanRegExp hit to PS00552, Bacterial regulatory
FT                   proteins, merR family signature."
FT   misc_feature    complement(84650..84715)
FT                   /note="Predicted helix-turn-helix motif with score 1580
FT                   (+4.57 SD) at aa 11-32, sequence RTVGEVADLVGVSVRTLHHWDD"
FT   misc_feature    complement(84677..84712)
FT                   /note="FPrintScan hit to PR00040, MerR bacterial regulatory
FT                   protein HTH signature"
FT   CDS_pept        complement(84797..84964)
FT                   /transl_table=11
FT                   /locus_tag="DIP0103"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium leprae hypothetical protein
FT                   ML2114 TR:Q9CBE3 (EMBL:AL583924) (56 aa) fasta scores: E():
FT                   1.7e-05, 52.08% id in 48 aa"
FT                   /db_xref="InterPro:IPR028037"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKC9"
FT                   /protein_id="CAE48608.1"
FT                   /translation="MDILNKAKDLINNNSDKVKEAVDKAGDFIDSKTEGKYADKVDQVQ
FT                   EAVKKKIDEQ"
FT   CDS_pept        complement(84975..86321)
FT                   /transl_table=11
FT                   /locus_tag="DIP0104"
FT                   /product="Putative peptidase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   peptidase SCI52.18c TR:Q9AD91 (EMBL:AL590507) (445 aa)
FT                   fasta scores: E(): 1e-31, 32.04% id in 440 aa"
FT                   /db_xref="GOA:Q6NKC8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKC8"
FT                   /protein_id="CAE48609.1"
FT                   /translation="MSITPIALNVVHMTLYDDTLALLTELIRNACVNDLTPDSGHEERN
FT                   AATLEEFFAGSPVNIQRFEPHPGRVSLVVTVAGSDLAAEPLTFLGHTDVVPVDTQHWSV
FT                   PPFDATIIDGKLYGRGSVDMLFITATMAAVTRHVARTGGNAGTLYFTALADEEARGGLG
FT                   AAWLAQHHPDALSWKNCISETGGSHIPGRDDSDSTIIYVGEKGAAQRRLHVYGDAGHGS
FT                   APYNKDSAIATIGEVARRIAAFEPEVSTDDIWHGFIDAFRFDPTTTAALRDGTGYEHLG
FT                   DLAAFGHAISHLTIAQTVLRAGQAINVLPSHAWLDMDIRTLPGHDDAYVDDLLTQVLGD
FT                   LAPHVTIEHLICEPATISPTDTPLYRTLAEVLHDSFPDTTVIPMIAPGGSDLRFARRMG
FT                   GNGYGFAVHAPDRTLGHVHGQLHSHDEYLHLEDLRLTVAGYQQLVEKFL"
FT   misc_feature    complement(85158..86255)
FT                   /note="HMMPfam hit to PF01546, Peptidase family
FT                   M20/M25/M40"
FT   CDS_pept        86342..87394
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="DIP0105"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="Similar to Corynebacterium glutamicum biotin
FT                   synthase BioB SW:BIOB_CORGL (P46396) (334 aa) fasta scores:
FT                   E(): 2.7e-103, 80.18% id in 328 aa"
FT                   /db_xref="GOA:Q6NKC7"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NKC7"
FT                   /protein_id="CAE48610.1"
FT                   /translation="MIIARIFGHLPIATTWEHHVTDILELARTKVLNNGEGLNKEEVLQ
FT                   VLQLDEARIPELLELAHEVRLKWCGEEVEVEGIISLKTGGCPEDCHFCSQSGLFESPVR
FT                   SAWLDIAGLVEAAKQTQKSGATEFCIVAAVKGPDERLMSQLEEAVAAIKSEVDIEVAAS
FT                   IGILTQEQVDRLKAAGVHRYNHNLETARSYFPNVVTTHSWESRRETLRMVGEAGMEVCS
FT                   GGIIGMGETLEQRAEFACDLAELNPTEVPMNFLDPRPGTPFADYEVLDTTDALRAIGAF
FT                   RLALPKTILRFAGGRELTLGDLGTEQGLLGGINAVIVGNYLTTLGRPMEQDLDMLGKLR
FT                   LPIKALNASV"
FT   misc_feature    86447..87367
FT                   /note="HMMPfam hit to PF01792, Biotin synthase"
FT   CDS_pept        87394..87654
FT                   /transl_table=11
FT                   /locus_tag="DIP0106"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   8.6 kDa protein Rv1590 or MT1625 or MTCY336.14c TR:O06600
FT                   (EMBL:Z95586) (79 aa) fasta scores: E(): 4.1e-11, 67.24% id
FT                   in 58 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKC6"
FT                   /protein_id="CAE48611.1"
FT                   /translation="MATHAQSTELLEALLAGEAPRFQPNTGQELVDDIEIALSPSARAG
FT                   LEAPRFCQICGRRMIVQVRPDGWEATCSRHGSVDSAYLGRR"
FT   repeat_region   87565..87840
FT                   /note="repX"
FT   stem_loop       87688..87749
FT                   /note="Score 50: 18/19 (94%) matches, 0 gaps"
FT   misc_feature    87984..92600
FT                   /note="Anomalous G+C content (56.29%). DtxR-regulated
FT                   operon siderophore-dependent iron uptake system. Not
FT                   present in C.glutamicum"
FT   misc_feature    87987..88006
FT                   /note="DtxR-regulated promoter/operator"
FT   CDS_pept        88041..89228
FT                   /transl_table=11
FT                   /gene="irp6A"
FT                   /locus_tag="DIP0108"
FT                   /product="Ferrisiderophore receptor Irp6A"
FT                   /note="Almost identical to previously sequenced
FT                   Corynebacterium diphtheriae ferrisiderophore receptor Irp6A
FT                   SWALL:Q8VVA8 (EMBL:AY061890) (395 aa) fasta scores: E():
FT                   8.7e-146, 97.46% id in 395 aa"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKC5"
FT                   /protein_id="CAE48612.1"
FT                   /translation="MRLSRKITAVAVAIAASGAALTACSNTSDTATDASATGSSAALTV
FT                   TDVAGRTVEFDKQPERVLLGEGRAMFAASILDKENPGEHIVALGEDLHQGAPSFEAKLF
FT                   EAHPEIKDIPVIGHIAKGNVSVENLLAFNPDVVVMTLDHKKAAEQNGFLAKMDQAGMKY
FT                   VFTDFRQKPLENTTKSVEVLGAVLGEQDKAKEFNEFYTKKRDDIIARAKKLENKPRTLL
FT                   WRAAGLKDCCNTVKNSNLGDLVNAAGGVNIGDTLIDTESGDLTAEKVIAEQPEKIIATG
FT                   GAWAKDPKKPEVLPHVELGYTATDDVAERTLEGLLKTPGFSALEAPKKGDLHAVFHQFY
FT                   DSPYNIFALEQFAQWLHPEEFKDLDAVKDFQEFHKKWMPFEFSGVFFVTDKVEAK"
FT   misc_feature    88281..89057
FT                   /note="HMMPfam hit to PF01497, Periplasmic binding protein"
FT   CDS_pept        89229..90272
FT                   /transl_table=11
FT                   /gene="irp6B"
FT                   /locus_tag="DIP0109"
FT                   /product="Membrane protein permease Irp6B"
FT                   /note="Almost identical to previously sequenced
FT                   Corynebacterium diphtheriae membrane protein permease Irp6B
FT                   SWALL:Q8VVA7 (EMBL:AY061890) (347 aa) fasta scores: E():
FT                   1e-116, 98.27% id in 347 aa and similar to Rhizobium
FT                   meliloti putative iron ABC transporter permease protein
FT                   SMB21430 TR:CAC49658 (EMBL:AL603646) (356 aa) fasta scores:
FT                   E(): 1.6e-55, 50.87% id in 342 aa and to Corynebacterium
FT                   diphtheriae HmuU SWALL:Q9XD88 (EMBL:AF109162) (350 aa)
FT                   fasta scores: E(): 2.1e-36, 40.66% id in 332 aa"
FT                   /db_xref="GOA:Q6NKC4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKC4"
FT                   /protein_id="CAE48613.1"
FT                   /translation="MSNVVEQYHKRSRRKLLAIVILTVLAIAAFVVATVVGPVNLTPAT
FT                   MLKGIIQPDSVDPTTRTVLWNLRLPASVMAVLIGAALSLAGAHMQTILDNPLAEPFTLG
FT                   ISAAAAFGGAASIVLGWVLIPHAQFNLAAVAWASSLVAVVIVAGASVWRGAGAESMILL
FT                   GIALVFLFQALLSLMQYRATTEALQQIVFWTMGSLQRATWTANAIIAVMLAIAIPYTVV
FT                   NAWRLTALRLGDARAAALGINVTRLRVVTLVVASLLAASAVAFAGIIGFIGLVGPHVAR
FT                   ILVGEEQRFFAPASMAAGAFLLATAHAVSITMIPGVALPISIITALVGVPFFVILVFTR
FT                   RRAMWGS"
FT   misc_feature    89229..89351
FT                   /note="Signal peptide predicted for DIP0109 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.560 between residues 41 and 42"
FT   misc_feature    order(89274..89342,89421..89489,89526..89594,89622..89690,
FT                   89709..89777,89835..89903,89982..90050,90093..90161,
FT                   90174..90242)
FT                   /note="9 probable transmembrane helices predicted for
FT                   DIP0109 by TMHMM2.0"
FT   misc_feature    89337..90245
FT                   /note="HMMPfam hit to PF01032, FecCD transport family"
FT   misc_feature    89688..89735
FT                   /note="ScanRegExp hit to PS00012, Phosphopantetheine
FT                   attachment site."
FT   misc_feature    89847..90014
FT                   /note="ProfileScan hit to PS50281, Binding-system dependent
FT                   bacterial transporters (araH, livH/limM families);"
FT   CDS_pept        90274..91032
FT                   /transl_table=11
FT                   /gene="irp6C"
FT                   /locus_tag="DIP0110"
FT                   /product="ATP-binding protein Irp6C"
FT                   /note="Almost identical to previously sequenced
FT                   Corynebacterium diphtheriae ATP-binding protein Irp6C
FT                   SWALL:Q8VVA6 (EMBL:AY061890) (252 aa) fasta scores: E():
FT                   1.4e-79, 99.6% id in 252 aa and similar to Escherichia coli
FT                   iron FecE or B4287 SWALL:FECE_ECOLI (SWALL:P15031) (255 aa)
FT                   fasta scores: E(): 5.7e-19, 37.64% id in 263 aa"
FT                   /db_xref="GOA:Q6NKC3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKC3"
FT                   /protein_id="CAE48614.1"
FT                   /translation="MSLSISDLRVSYGHGPRMRHILNGVSFGPVPLGTVTGLLGPNAAG
FT                   KSTLIKAIAGLKATSGGTRTIMSKGAEVPHHELRNVVGYVPQDLLTSASLTAFESILVS
FT                   ARKGYDPLLSSGAVMERLGITALADRYVSELSGGQRQLVAVAQMLVRQPEVLLLDEPTS
FT                   ALDLRHQVELLKLLRAEVNSRDCLAVVALHDLNLAARYCDHLVVLSGGHVIAEGAPTQV
FT                   LTSDLLEQVYGLRARVLDDAGVPVVCPVED"
FT   misc_feature    90367..90906
FT                   /note="HMMSmart hit to SM00382, ATPases associated with a
FT                   variety of cellular activities"
FT   misc_feature    90370..90906
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    90376..90441
FT                   /note="ProfileScan hit to PS50101, P-loop nucleotide
FT                   binding motif (does not find all)."
FT   misc_feature    90391..90414
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    90676..90720
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   misc_feature    90676..90894
FT                   /note="ProfileScan hit to PS50100, 2nd half motif for
FT                   nucleotide binding, associated with P-loop."
FT   CDS_pept        91122..92600
FT                   /transl_table=11
FT                   /locus_tag="DIP0111"
FT                   /product="Putative lipoprotein"
FT                   /note="Similar to Corynebacterium glutamicum ATCC 13032
FT                   hypothetical protein CGL1283 SWALL:BAB98676 (EMBL:AP005278)
FT                   (581 aa) fasta scores: E(): 1.8e-63, 45.63% id in 504 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKC2"
FT                   /protein_id="CAE48615.1"
FT                   /translation="MRLLKPALVLAIVAGMTLSACGSDSATKDISVAGSELSLDKTALV
FT                   ADSSGVEVSQAFFPDADKVDSVVVAGSTAQHRWEGAQEAIKRGVPLLVDDSSNTEAINA
FT                   EIERLGVKDVVRIGDPAADAQQVAANAAAKKQHTEDVMARQITELSAEHGHLDGGAAVL
FT                   VSKATSAASVATAKASGATVEYLSSGDPRESATLQKDAHAKVVGLGPSFSNQERFHRAV
FT                   DMLQGPEVPGGGHLIFPEHRLVALYGHPSGGALGVMGEQPAPEAVAKVKELTEHYAAID
FT                   PQTTTVPAFEIIATVASADPGPDGNYSNEVTIDELRPWVDEIGKAGGYAVLDLQPGSAN
FT                   FLDQAKQFEELLKLPHVGLALDPEWRINPGEKPMERVGSVEAAEINSTAEWLAGLVRDN
FT                   NLPQKPFVVHQFQWQMIRDREQLNTTAPELAWILHADGHGPARDKFATWEMVQQDLQPE
FT                   FTMAWKNFIDEDTPMFTPEQTMDIYPRPGFVSYQ"
FT   misc_feature    91122..91196
FT                   /note="Signal peptide predicted for DIP0111 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.257 between residues 25 and 26"
FT   misc_feature    91122..91337
FT                   /note="ScanRegExp hit to PS00430, TonB-dependent receptor
FT                   proteins signature 1."
FT   CDS_pept        92618..93025
FT                   /transl_table=11
FT                   /locus_tag="DIP0112"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Bacillus subtilis YdhG protein TR:O05499
FT                   (EMBL:D88802) (135 aa) fasta scores: E(): 2.3e-20, 41.46%
FT                   id in 123 aa"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKC1"
FT                   /protein_id="CAE48616.1"
FT                   /translation="MATRIAEPGEPIIEFFADWLDGISNPTNRAIAERILAWVHEEFPD
FT                   LGYRFAWKQPMFTHHGTFIIGFSPATNHISFAPERAGIVKWEPQLKQRGLSYGKMMVRL
FT                   PWDQPIPFDLLRDVIAFNIDDKRDVTSFWRK"
FT   CDS_pept        93040..94380
FT                   /transl_table=11
FT                   /locus_tag="DIP0113"
FT                   /product="Putative riboflavin biosynthesis protein"
FT                   /note="Similar to Streptomyces griseus
FT                   deoxyribodipyrimidine photolyase Phr SW:PHR_STRGR (P12768)
FT                   (455 aa) fasta scores: E(): 3.5e-36, 36.75% id in 468 aa,
FT                   and to Escherichia coli deoxyribodipyrimidine photolyase
FT                   PhrB or Phr or B0708 SW:PHR_ECOLI (P00914) (472 aa) fasta
FT                   scores: E(): 9.9e-32, 34.01% id in 488 aa"
FT                   /db_xref="GOA:Q6NKC0"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKC0"
FT                   /protein_id="CAE48617.1"
FT                   /translation="MARSVVVWFRDDLRVHDNPALMKAWELVRANPADLHAVYIANEVG
FT                   VRPLGGAVKWWLHHSLLALSEQLAQRGVRLHVLSGDPLTLLPQLVTSCGATAVTMNRRY
FT                   DPAARSIDDAFVADASAHDVEVYDFPCHLLAEPGEITTTTGGSYKVFTPFSRNLRDAIG
FT                   DLPLDTLAAPPKAEQPIDDTETQAAIADLGWDAWWAASISKAWTPGEPAAREALAELDD
FT                   ILPRYLDDRDRPDIDGTSRLSPRLRFGELSVAEVWNHAHTSEGFRRQLMWRDFAWHRLD
FT                   AHPDMATANIRPEFDHFPWDGGDFEAELNAWRHGRTGIALVDAGMRELWATGTMHNRVR
FT                   MVAASLLVKNLGIHWRHGEQWFWDTLVDADPASNPFNWQWVAGSGDDAAPYFRIFNPDT
FT                   QARRFDPDGTYRTRWLPIMSADYPEEAIVDLKESRLRALDAYNACKR"
FT   misc_feature    93052..94287
FT                   /note="HMMPfam hit to PF00875, DNA photolyase"
FT   misc_feature    93466..93516
FT                   /note="FPrintScan hit to PR00147, DNA photolyase signature"
FT   misc_feature    93871..94287
FT                   /note="BlastProDom hit to PD004390, PD004390"
FT   misc_feature    93988..94038
FT                   /note="FPrintScan hit to PR00147, DNA photolyase signature"
FT   misc_feature    94048..94104
FT                   /note="FPrintScan hit to PR00147, DNA photolyase signature"
FT   misc_feature    94165..94209
FT                   /note="FPrintScan hit to PR00147, DNA photolyase signature"
FT   CDS_pept        94403..94822
FT                   /transl_table=11
FT                   /locus_tag="DIP0114"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Staphylococcus aureus subsp aureus N315
FT                   hypothetical protein SA2163 TR:Q99RQ4 (EMBL:AP003137) (143
FT                   aa) fasta scores: E(): 2.4e-15, 39.16% id in 143 aa"
FT                   /db_xref="GOA:Q6NKB9"
FT                   /db_xref="InterPro:IPR021299"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKB9"
FT                   /protein_id="CAE48618.1"
FT                   /translation="MRKLYYASLTYLILGLVAGVFYREWTKVFNAVDRSQLNTLHTHLL
FT                   VLGTFFFLIVLALDKMFHLSGQKKFQQWFIFHNVALAWTTLAMLANGIVATSGGMWGPA
FT                   QSGIAGMGHILLTGGFIWFFSMLNTAIKRSEANQK"
FT   misc_feature    order(94415..94468,94511..94579,94616..94684,94727..94795)
FT                   /note="4 probable transmembrane helices predicted for
FT                   DIP0114 by TMHMM2.0"
FT   CDS_pept        complement(94809..95876)
FT                   /transl_table=11
FT                   /locus_tag="DIP0115"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical 39.2
FT                   kDa protein SCH24.21c TR:Q9X8T5 (EMBL:AL049826) (360 aa)
FT                   fasta scores: E(): 5e-111, 79.49% id in 356 aa"
FT                   /db_xref="GOA:Q6NKB8"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR017815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKB8"
FT                   /protein_id="CAE48619.1"
FT                   /translation="MSAIRVAIAGVGNCASSLVQGVEYYKDASPDQQVPGLMHVQFGDY
FT                   HVGDIEFVAAFDVDRAKVGLDLSEAINASENCTIRICDVPETGVTVQRGPTLDGLGKYY
FT                   RATVEESPAQAVDVVQVLKDERVDVLVSYLPVGSEEADKFYAQCAIDANVAFVNALPVF
FT                   IASDPQWAAKFEEAGVPIVGDDIKSQVGATITHRVLAKLFEDRGVHLDRTMQLNVGGNM
FT                   DFKNMLERERLESKKISKTQAVTSNLDQEIAARDVHIGPSDYVGWLDDRKWAYVRLEGT
FT                   AFGDVPLNLEYKLEVWDSPNSAGIIIDALRAAKIAKDRGIGGPVYPAAAYLMKSPPRQM
FT                   RDEAARAELEQFISG"
FT   misc_feature    complement(94812..95867)
FT                   /note="HMMPfam hit to PF01658, Myo-inositol-1-phosphate
FT                   synthase"
FT   CDS_pept        complement(96123..96881)
FT                   /transl_table=11
FT                   /locus_tag="DIP0116"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Rhizobium loti MLR6622 protein TR:Q988S0
FT                   (EMBL:AP003009) (231 aa) fasta scores: E(): 1.4e-25, 40.99%
FT                   id in 222 aa"
FT                   /db_xref="GOA:Q6NKB7"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKB7"
FT                   /protein_id="CAE48620.1"
FT                   /translation="MTQKNFPPLPGTLSSTGQAIDPVAVSGLNSKLNWLRAGILGANDG
FT                   IVSISALLLGVIATNASTSTVLLSGVAATIAGAVSMALGEFVSVSAQRDNEHKVMEQEY
FT                   NELLHAPGEERAEIAGILENYGMSTATAYRAAIEIGRNDPFRAHLQIEYGIDPHDLTSP
FT                   LHAAVSSAASFLLGALLPLLTVFLIPDLSRVAGAIAVTAVTLLALAITGYVSAHIGGTS
FT                   PVKSVLRLTIGGILGLALTFGAGYAFGAVA"
FT   misc_feature    complement(order(96135..96200,96231..96296,96318..96383,
FT                   96618..96683,96705..96770))
FT                   /note="5 probable transmembrane helices predicted for
FT                   DIP0116 by TMHMM2.0"
FT   CDS_pept        complement(96976..97758)
FT                   /transl_table=11
FT                   /locus_tag="DIP0117"
FT                   /product="Putative lipase"
FT                   /note="Similar to Streptomyces coelicolor putative secreted
FT                   lipase SCI11.24c TR:Q9S295 (EMBL:AL096849) (290 aa) fasta
FT                   scores: E(): 6.8e-20, 33.18% id in 223 aa, and to
FT                   Pseudomonas sp lipase precursor Lip SW:LIP_PSES5 (P25275)
FT                   (364 aa) fasta scores: E(): 5.6e-05, 28.4% id in 176 aa"
FT                   /db_xref="GOA:Q6NKB6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002918"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKB6"
FT                   /protein_id="CAE48621.1"
FT                   /translation="MAVVQHHLPLSARLPARGIFEDDWRDRPSKRHPYPVILIHGTGVT
FT                   KGDWMELGHALRSLGYAVWAPDFGMRSTAAVAESAAQVGAYIDAVLTVTKAKKAIVVGH
FT                   SQGGILARYWMHNLDGANKVSHLISLAVPHHGTSHGGMMSPLGRTPRGTAVIDSLITGF
FT                   FGASGFEMLHDSELIAQLNEHGDTLPYVYYSCIATRSDTIIQPVESCFLHGKLVRNIYA
FT                   QAVSKHAIILHEDMPHDPRVRRLVIAEIERVERLTIPS"
FT   misc_feature    complement(97021..97662)
FT                   /note="HMMPfam hit to PF01674, Lipase (class 2)"
FT   misc_feature    complement(97399..97659)
FT                   /note="ProfileScan hit to PS50187,
FT                   Esterase/lipase/thioesterase active site serine."
FT   CDS_pept        97855..98433
FT                   /transl_table=11
FT                   /locus_tag="DIP0118"
FT                   /product="Putative dehydrogenase"
FT                   /note="Similar to Thermus aquaticus NADH dehydrogenase Nox
FT                   SW:NOX_THETH (Q60049) (205 aa) fasta scores: E(): 3.2e-07,
FT                   34.18% id in 196 aa"
FT                   /db_xref="GOA:Q6NKB5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKB5"
FT                   /protein_id="CAE48622.1"
FT                   /translation="MSLTVAEAIAQRRAVRTYTDQPIPDDILDRVVAQALEAPTAFNAQ
FT                   RADVVVVRDQAVKDALFAASKQAQLRDAPAVLVIVARADAPTDLPELLGPDRAAYANGF
FT                   FARLDAAALRETALKDAMLVAGFALIAAQGEGLATSPTTGWDESQVLEAVGLGGRDDRA
FT                   VGLVIAMGYPAEQPLHPGREASRRVNDHY"
FT   CDS_pept        complement(98438..100177)
FT                   /transl_table=11
FT                   /locus_tag="DIP0119"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Deinococcus radiodurans ATP-dependent DNA
FT                   helicase RecG-related protein DR2199 TR:Q9RSC6
FT                   (EMBL:AE002053) (596 aa) fasta scores: E(): 8.9e-13, 24.04%
FT                   id in 445 aa"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKB4"
FT                   /protein_id="CAE48623.1"
FT                   /translation="MFMEVSLTSLPAHVMNALDAIWEGSIADSLESETLEFKEDPSCAG
FT                   RGKQHGNPQAALIEKLIDEAVCLANGDAGTGHIVVGIKDKIGGPEAFTGTTFDTEKIAK
FT                   KIFDGTRPNLRPEVHEVRYQNNRLIVIYIPEALSLYSRSKGQTSKRVGSHCEPLSEEQR
FT                   RAIAATRAHADYSNGISEFNVDDIAADTIQEVRRLLKTKRAQSGIDTSLPTTTNGLLRE
FT                   LGLIDNYGALKRAGAILLLPAPEGQLSIRHFWRSFPGIDPEVTDYNQPLLIALSSLKRR
FT                   ITENANKEIKRIQFSDGQEIAVSAFPQTAVDEVVTNAIIHRDWRLSRPVVIDQSPQTLK
FT                   VWSPGSLPVGVTPNRLLTTQSIPRNSRLMSAMRMLGLAEESSRGFDRIWAALLGSGRDI
FT                   PDVHTEDTFVEVILHSGNPDESFIKALHELSLSFNPDMLHSVNTLIVLWHLWTSPVISL
FT                   KQARVKTQTSSKEATELMFALESNGLLTQIHNTDEWFLSEKARKTTNYYQSETIPQSSV
FT                   QTWVEEKLSSGSPISAAEIAESIGMPRPEITEILRNLRRAGKAHIDPSGPQRGSGTRWI
FT                   KGT"
FT   misc_feature    complement(98522..98587)
FT                   /note="Predicted helix-turn-helix motif with score 1072
FT                   (+2.84 SD) at aa 531-552, sequence ISAAEIAESIGMPRPEITEILR"
FT   repeat_region   100366..100422
FT                   /note="Possible inverted repeat"
FT   repeat_region   complement(100367..100989)
FT                   /note="repX"
FT   CDS_pept        join(<100495..100545,100547..>100591)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="DIP0120"
FT                   /product="Putative transposon (pseudogene)"
FT                   /note="Pseudogene. Highly similar to the N-terminal region
FT                   of Corynebacterium xerosis and Corynebacterium striatum
FT                   hypothetical 20.7 kDa protein TnpCX TR:Q46485 (EMBL:U21300)
FT                   (190 aa) fasta scores: E(): 0.057, 63.41% id in 41 aa.
FT                   Presents a frameshift at residue 17"
FT   CDS_pept        <100588..100722
FT                   /transl_table=11
FT                   /locus_tag="DIP0121"
FT                   /product="Putative transposon (partial)"
FT                   /note="Similar to parts of Mycobacterium smegmatis TnpA
FT                   protein TR:Q50440 (EMBL:M76495) (413 aa) fasta scores: E():
FT                   0.8, 44.44% id in 36 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKB3"
FT                   /protein_id="CAE48625.1"
FT                   /translation="MSALIDTLVGMKDAVVAEIVQLGRTMNKRRKGILAYIRHTINAL"
FT   repeat_region   100929..100985
FT                   /note="Possible inverted repeat"
FT   CDS_pept        101238..101792
FT                   /transl_table=11
FT                   /locus_tag="DIP0122"
FT                   /product="Putative siderophore binding protein"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   siderophore binding protein SCBAC36F5.26 TR:CAC42862
FT                   (EMBL:AL592292) (178 aa) fasta scores: E(): 6.3e-25, 48.48%
FT                   id in 165 aa"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKB2"
FT                   /protein_id="CAE48626.1"
FT                   /translation="MTGPLILPFNGKVPRVHETAFIAPNATLIGDVTIGPYASVFYGCV
FT                   LRADINSIVVGARTNIQDNSVLHVDRDAACVLGDDVTVGHMALVHGSTVGDGTLVGMHA
FT                   ALLSRSVVGAGSLIAAGAVVLEGQVIPVKSLAAGVPAKVRRELSDEQSAGFIPHAGRYV
FT                   EVAVQHGELGAPLSVEDVRFR"
FT   misc_feature    101292..101345
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats)"
FT   misc_feature    101391..101444
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats)"
FT   misc_feature    101508..101561
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats)"
FT   misc_feature    101562..101615
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats)"
FT   CDS_pept        complement(101789..102787)
FT                   /transl_table=11
FT                   /locus_tag="DIP0123"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   46.1 kDa protein Rv0485 or MT0503 or MTCY20G9.11
FT                   SW:Y485_MYCTU (Q11151) (438 aa) fasta scores: E(): 1.4e-12,
FT                   32.14% id in 224 aa"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKB1"
FT                   /protein_id="CAE48627.1"
FT                   /translation="MPNRRTLRNTPSFTKPTSPAASCLHLIRHLQPVTRATLVNGSGKS
FT                   QPTVTRAVAALMEAHLVRERPDLSIPQGPGRPTIPIELAPSPWVHIGVAVGTRATYIGA
FT                   YNTRGIALREKMIEIRPASTSIDTYIDAITTAITELTTLSELPLASIGISSSGRVSPTG
FT                   LVTAANLGWDRLDIVSALYKRIPVPIAVTSVITAIAGAEQQAQDPNHPSTTLIFYADDS
FT                   TGAALQTPDSITTVPIDTSSEDVALLSEAAVHLVAEHAPNSIVLAGSAFSNPDDARTVG
FT                   KALRSSPTNPNIEIRVFPTHLDNARAAARAVALDHLIEDPLGLAKRILASC"
FT   CDS_pept        103155..104525
FT                   /transl_table=11
FT                   /locus_tag="DIP0124"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative integral
FT                   membrane protein SCBAC19F3.14 TR:CAC44337 (EMBL:AL596102)
FT                   (517 aa) fasta scores: E(): 3.6e-47, 37.96% id in 453 aa"
FT                   /db_xref="GOA:Q6NKB0"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKB0"
FT                   /protein_id="CAE48628.1"
FT                   /translation="MVATYTPSAEKQEASTRALPRHLRRLHFFAGIICAPLIFIASLTG
FT                   LGYAFGPSLDKAVYSEAINVTPSGDELPLERIVDIARATHPDLELAGVRVGNPDQATRV
FT                   MFNDPTLPKSTTQAVFVNQYTGDITGDMPQYGGSAALPIRHWLSLGHRDLWLGEPGRLY
FT                   SETAASWLGVLAVSGVYLWWKRQRKAGRLAAMLRIDGRGRTRNLRWHGAIGTLVAAGMI
FT                   FLTITGLTWSSVAGDNIRSVRTALNWTTPSVSTALGAAAEQTPADPHAEHGGHSGHHAH
FT                   MAALDVSEQAQRVATTAAGELRTPFTVKPPKEDGHAWTAAEDRVAYRLTYDALAVDGSN
FT                   GQVTDRVDFEQWSLPTKLTAWLIELHMGTLLGVPNQIALGLLAIGLLILVVRGYLLWFQ
FT                   RRGTAWVGSAPARSVDGVRGYGALGWIGVAAMVIYGVVAPLFGVTCVAFLICSMLKK"
FT   misc_feature    order(103236..103304,103650..103703,103779..103847,
FT                   104280..104348,104409..104504)
FT                   /note="5 probable transmembrane helices predicted for
FT                   DIP0124 by TMHMM2.0"
FT   stem_loop       104526..104619
FT                   /note="Score 60: 20/20 (100%) matches, 0 gaps"
FT   CDS_pept        104676..105761
FT                   /transl_table=11
FT                   /locus_tag="DIP0125"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to the C-terminal region of Pseudomonas
FT                   aeruginosa hypothetical protein PA4923 SW:YDC3_PSEAE
FT                   (P48636) (195 aa) fasta scores: E(): 3.3e-27, 44.97% id in
FT                   189 aa"
FT                   /db_xref="GOA:Q6NKA9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKA9"
FT                   /protein_id="CAE48629.1"
FT                   /translation="MSFSPELPDFMQGLGVSVHAMTNADVPAHTDSVLRNLNRFEQHFT
FT                   ADDLAVVPLSEYTFFNEGRGDIGIVVQDASGAVVGTMCVQFIKGLAYLNPAVPEMTLRL
FT                   DEAWRGKGIGGWLIEQATEYGRLNGWPGIAVNVEKQSPARRLYARHDFAAQDREVEYGA
FT                   IMLKTLSPKIRSVAVYCGSAVGERPEYAQAARELGTALAQRGITMVYGGGRPGLMGIAA
FT                   DAAIAAGGKVHGVMPHALVDLEQAHPGLSALDITDTMAQRKTRMEELADAFVVLPGGMG
FT                   TMEEMFQVLVRQQLGPYAGPVALMNIEEFWDPFIAALRTMSEEGFISERYIDALVMAKD
FT                   SEELFQGFSSWVNPGLKWLSD"
FT   misc_feature    104883..105134
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family"
FT   CDS_pept        105773..107386
FT                   /transl_table=11
FT                   /locus_tag="DIP0126"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor conserved
FT                   hypothetical protein SCBAC36F5.07 TR:CAC42843
FT                   (EMBL:AL592292) (562 aa) fasta scores: E(): 3.6e-40, 35.62%
FT                   id in 553 aa"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKA8"
FT                   /protein_id="CAE48630.1"
FT                   /translation="MNSPRIPSVLDASCEAYVYDLAAISPTDATAWGISGYDDQLQDFS
FT                   PAYWEKVADQHRKLLNAIPAEDTLDSVDRVTAAVLRDRLGVELDIDAAGDNLAKLNNIE
FT                   SPVQTIRDTFLLMPQDTDEQRDAIAARLTHLPRALAGYKESLQVAAAAGRVAAARQVQC
FT                   VIEQLTELTQPQSMLTQLGVSGAAVEHAQAACGEMAQWLRTELLPKAPAEDAVGRERYQ
FT                   RLSHLFVGDVVDLDDAYLWGQECLREIVDKQEAIAAELYGAGTSVADAMKRLDTEERYT
FT                   IHGVDALQQWMQNQADRVIADLNGTHFAIPEPVRTIEAKIDPAGTGGIFYTPPSDDFTR
FT                   PGRMWWSVPAGQEEFHTWQELTTVFHEAVPGHHLQCGQATCERDNLNLWRRVACWNSGH
FT                   GEGWALYAEQLMAELGYHDDPGTMMGMLDAQRLRAARVVLDIGVHLRKTTPDGGVWDAA
FT                   YAWDFLRANVAMDEKNLAFELDRYLGWPGQAPSYALGQRLWQDLRDSAVAQGMTLPEFH
FT                   SRALALGSIPMSILRREILR"
FT   CDS_pept        107390..107860
FT                   /transl_table=11
FT                   /locus_tag="DIP0127"
FT                   /product="Putative MarR-family regulatory protein"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   regulatory protein SCE50.15 TR:Q9L048 (EMBL:AL163672) (168
FT                   aa) fasta scores: E(): 3.3e-18, 41.89% id in 148 aa"
FT                   /db_xref="GOA:Q6NKA7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKA7"
FT                   /protein_id="CAE48631.1"
FT                   /translation="MISTPPVARNIMRCMSDQLKLDQQICFQLYTGSRLMQRMYRVYFD
FT                   QWGITYSQYLVLLLLWEKDRQTISELSDPLDLDSGTLSPLLRRMEANGFITREHEQSDY
FT                   RKVVVCLTTRGRRLKTKAKKMNDELNDMLGFDDADLAAVTRVLEKINPSAAI"
FT   misc_feature    107513..107809
FT                   /note="HMMSmart hit to SM00347, helix_turn_helix multiple
FT                   antibiotic resistance protein, DNA-binding"
FT   misc_feature    107534..107839
FT                   /note="HMMPfam hit to PF01047, MarR family"
FT   misc_feature    107585..107635
FT                   /note="FPrintScan hit to PR00598, Bacterial regulatory
FT                   protein MarR family signature"
FT   misc_feature    107636..107683
FT                   /note="FPrintScan hit to PR00598, Bacterial regulatory
FT                   protein MarR family signature"
FT   misc_feature    107693..107743
FT                   /note="FPrintScan hit to PR00598, Bacterial regulatory
FT                   protein MarR family signature"
FT   CDS_pept        complement(107838..108890)
FT                   /transl_table=11
FT                   /locus_tag="DIP0128"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Escherichia coli AbrB protein or B0715
FT                   SW:ABRB_ECOLI (P75747) (348 aa) fasta scores: E(): 3.6e-20,
FT                   30.72% id in 345 aa"
FT                   /db_xref="GOA:Q6NKA6"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKA6"
FT                   /protein_id="CAE48632.1"
FT                   /translation="MAWNSSVAAKWLLVVPASAATGYVFSMLHVPAAWILGAIFVSATM
FT                   AIVSGTELPIHKEVFNLGRGFIGILAGLPLATANPALLARYVLPGLMVTFVTLAIGIVG
FT                   GMVLARAQPLLSQETGILSMLAGGASVMPVLAQDLGADFRYVALSQYLRLVAVSMSLPL
FT                   VAHMIAPTGLDHVVTPRDDQPWWALALVCVIAVVGHRLAAVLRIPVPSILGPLLLIVAA
FT                   SAVLPHVDFTPPMVVRIFAFLCIGWMCGGGLSVAALKFFARQVPATMIFIVVLLGGCAL
FT                   TAWPLAATMGVDYFDAYLATSPGGLETVLALASEGGAGPIVVAVQIIRLLCVLLLAGWL
FT                   PQLIRLLRRG"
FT   misc_feature    complement(order(107871..107936,108015..108080,
FT                   108117..108182,108213..108263,108279..108335,
FT                   108381..108437,108564..108629,108645..108710,
FT                   108726..108791,108804..108869))
FT                   /note="10 probable transmembrane helices predicted for
FT                   DIP0128 by TMHMM2.0"
FT   CDS_pept        complement(108895..109479)
FT                   /transl_table=11
FT                   /locus_tag="DIP0129"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKA5"
FT                   /protein_id="CAE48633.1"
FT                   /translation="MGVLSFVRLLRPVSVVRGYTLRSEVTKLVEVSTVRLTTVCQATVT
FT                   TTAIATAVALGVCGCSSAGSVQQAAPETIQPGGYVVALSSDVDLACDFTPAQAQCSPLQ
FT                   FVTTWKNTEGAHEQATTVVMQAEPFAVTATGKQPPVRDQGFARLGKEHRYVVGDPQSGW
FT                   TIDASAPDSIKISRPDGKGVVITQDSYEAVN"
FT   CDS_pept        109478..110248
FT                   /transl_table=11
FT                   /locus_tag="DIP0130"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical 26.0
FT                   kDa protein SC7A8.24c TR:Q9L2D4 (EMBL:AL137187) (260 aa)
FT                   fasta scores: E(): 1e-34, 42.8% id in 257 aa"
FT                   /db_xref="GOA:Q6NKA4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKA4"
FT                   /protein_id="CAE48634.1"
FT                   /translation="MDLGLSGWAILTFGAAAAGWVDAVIGGGGLILIPLIMAVAPGLLP
FT                   ANALATNKFAAVTGTFSAAVTLVRKVGVDTSLALRMIPVAAVGSGLGALMAASISKDVM
FT                   RPIVIILMLIAGLFVALRPDFGQGNSTHKPWGRAVALIAVAAIALYDGIFGPGTGMFLI
FT                   MAFTALLSQDFIRSAALAKVINTATNIGALCVFIAAGHILWKLGIILAIANVAGAQLGA
FT                   RTVLGGGTRLLRAALLTLVVVMSIYLAQQQWFNG"
FT   misc_feature    order(109487..109540,109559..109627,109706..109774,
FT                   109793..109846,109889..109987,110045..110113,
FT                   110171..110224)
FT                   /note="7 probable transmembrane helices predicted for
FT                   DIP0130 by TMHMM2.0"
FT   misc_feature    109556..109837
FT                   /note="HMMPfam hit to PF01925, Domain of unknown function
FT                   DUF81"
FT   misc_feature    109892..110224
FT                   /note="HMMPfam hit to PF01925, Domain of unknown function
FT                   DUF81"
FT   CDS_pept        complement(110238..112583)
FT                   /transl_table=11
FT                   /locus_tag="DIP0131"
FT                   /product="Putative ATP-dependent helicase"
FT                   /note="Similar to Escherichia coli ATP-dependent helicase
FT                   HrpB or B0148 SW:HRPB_ECOLI (P37024) (809 aa) fasta scores:
FT                   E(): 2.6e-40, 35.09% id in 815 aa"
FT                   /db_xref="GOA:Q6NKA3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKA3"
FT                   /protein_id="CAE48635.1"
FT                   /translation="MSFNLSVIGAGLPVAQSTTTLIDALRTHRMAVVQAPPGTGKTTLV
FT                   PPIAHNVTGGRVIVVAPRRVAVRAAAHHLVQLDQSSCDQPSTHRVGYTIRGERSRGDLV
FT                   EFVTPGVLLRRLISNPELDGVSAVVVDEVHERQLDTDLVLGMLVELRELRDDLTVIAMS
FT                   ATVDAPHFAELLSPEHPAPIVETHAEIHPLELHYQPAAERIALSRSYMDHVCTVTQHAV
FT                   AHFTDSALVFLPTIAAVTTAVSTLEQRTSVPVYPLHGQLTSSEQDAALRAGRQRIVVAT
FT                   SIAESSLTVPGVRIVVDAGLSRVPKRDHARDLTGLVTTSTSQAQADQRAGRAGREGPGT
FT                   VYRLYSAAEFQHFPDHVTPEIRSADLTQAALFLAAWGCTDPAQFPLLSAPPKQSWEQAV
FT                   DTLRDIGALNAAGQITELGRTLATLPTDPRLGASLLHCGGGAAPTIAALSLDARGDIPR
FT                   AIAAMSHQQRFTREVARLAGFVPDSECTPGEAIARAWPKNVARRDGDSYLMAGGSRAEL
FT                   GVSSLSGHEWLAVAQASLTHRGSVIRSAAPISEAAAVDIIGVAERTEATLIDGSLRGTR
FT                   IRHAGAITLSTTNVKVEGELAEQALAEGIRTHGLELFTFSDKATELRDRLRHLHEYYGE
FT                   PWPDVDAADPTLWLGPEISALAAGTPAARIDLYPALQRLLPWPEATHLDELAPAVLELP
FT                   NGRRARISYAGDRPVVSTKLQDCFGLLESPIVCGRPLQFHLLSPAGRPLAVTDTLDSFW
FT                   AGPYQQVRSDMRGRYPKHPWPEDPLAIR"
FT   misc_feature    complement(111552..112415)
FT                   /note="ProfileScan hit to PS50136, DNA/RNA helicase domain
FT                   (DEAD/DEAH box)."
FT   misc_feature    complement(111573..111866)
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain"
FT                   /note="HMMSmart hit to SM00490, helicase superfamily
FT                   c-terminal domain"
FT   misc_feature    complement(111990..112556)
FT                   /note="HMMSmart hit to SM00487, DEAD-like helicases
FT                   superfamily, catalytic domain"
FT   misc_feature    complement(112179..112208)
FT                   /note="ScanRegExp hit to PS00690, DEAH-box subfamily
FT                   ATP-dependent helicases signature."
FT   misc_feature    complement(112458..112481)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        complement(112573..113142)
FT                   /transl_table=11
FT                   /locus_tag="DIP0132"
FT                   /product="Putative sugar acetyltransferase"
FT                   /note="Similar to Streptomyces coelicolor putative sugar
FT                   acetyltransferase SCBAC25F8.11c TR:CAC42146 (EMBL:AL592126)
FT                   (193 aa) fasta scores: E(): 2.2e-24, 44.7% id in 170 aa,
FT                   and to Escherichia coli galactoside O-acetyltransferase
FT                   LacA or B0342 SWALL:THGA_ECOLI (SWALL:P07464) (203 aa)
FT                   fasta scores: E(): 2.3e-21, 36.51% id in 178 aa"
FT                   /db_xref="GOA:Q6NKA2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKA2"
FT                   /protein_id="CAE48636.1"
FT                   /translation="MADQRAQRWHIPVSPEITQAMARTAELVFDYNATHPAHTEELSRL
FT                   RRLILSPASKDCTIRQPLTIEYGVNTTIGKDTFINYGVTILDTAEVTIGSQVLIGPNCQ
FT                   LITVTHPVDNADMRTAGWEIAHPIVVGKQAWLGAGVIVLPGVTIGERAVIGAGSVVTHD
FT                   IPDDTIAYGNPARVIRTTNPHTTYEL"
FT   misc_feature    complement(112651..112737)
FT                   /note="ScanRegExp hit to PS00101, Hexapeptide-repeat
FT                   containing-transferases signature."
FT   misc_feature    complement(112657..112710)
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats)"
FT   misc_feature    complement(112711..112764)
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats)"
FT   misc_feature    complement(112822..112875)
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats)"
FT   misc_feature    complement(112882..112935)
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats)"
FT   CDS_pept        113144..113884
FT                   /transl_table=11
FT                   /locus_tag="DIP0133"
FT                   /product="Putative DNA repair protein"
FT                   /note="Similar to Escherichia coli alkylated DNA repair
FT                   protein Alkb or AidD or B2212 SW:ALKB_ECOLI (P05050) (216
FT                   aa) fasta scores: E(): 1.4e-12, 35.02% id in 237 aa"
FT                   /db_xref="GOA:Q6NKA1"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKA1"
FT                   /protein_id="CAE48637.1"
FT                   /translation="MAGVCGSKLMMARLVGMPDLFSDSGWGSGELPRALRPGLVHLPRW
FT                   MGLDQQFAVVQQCREIARSVAGTPLAMHRQQWASGTMSAYLMSLGLHWEYRTYQYVSQW
FT                   GGVAVPPIPVEFSALAHEVLRAAAGVDDSLAAWVDSYRIDAALVNYYPPGAGMGMHQDA
FT                   FEDSRAPVVSLSIGDSAVFRAGNGVNRQRPWQDVVLGSGDAVVFGGPSRDMFHSVVRLH
FT                   AGTAPTRCGVSQGRINLTFRQVKL"
FT   CDS_pept        113937..114524
FT                   /transl_table=11
FT                   /locus_tag="DIP0134"
FT                   /product="Putative DNA-repair protein"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551
FT                   DNA-3-methyladenine glycosidase I MT1248 TR:AAK45505
FT                   (EMBL:AE007001) (204 aa) fasta scores: E(): 8.3e-35, 52.71%
FT                   id in 184 aa, and to Escherichia coli DNA-3-methyladenine
FT                   glycosylase I Tag or B3549 SW:3MG1_ECOLI (P05100) (187 aa)
FT                   fasta scores: E(): 1.5e-25, 44.88% id in 176 aa"
FT                   /db_xref="GOA:Q6NKA0"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NKA0"
FT                   /protein_id="CAE48638.1"
FT                   /translation="MNGMDLISCDDGRVRPAWAVGDALLRHYYDYEWGAPVHSESGLFE
FT                   RLALEGFQSGLSWRTVLQKRAAFREVFWGFDADRVACMTEADVQALLVDARLIRNRRKI
FT                   MAVVNNARAVIDLREHGGLDEVLWSFAPAQHTPPLTVADIPSQTVESRAMAKELKRCGF
FT                   QFVGPTTCYATMQAVGMVDDRPRGASPLLVES"
FT   CDS_pept        114529..115257
FT                   /transl_table=11
FT                   /locus_tag="DIP0135"
FT                   /product="Putative oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="Similar to Mycobacterium tuberculosis putative
FT                   oxidoreductase Rv0484c or MT0502 or MTCY20G9.10c
FT                   SW:Y484_MYCTU (Q11150) (251 aa) fasta scores: E(): 1.2e-45,
FT                   57.32% id in 232 aa"
FT                   /db_xref="GOA:Q6NK99"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK99"
FT                   /protein_id="CAE48639.1"
FT                   /translation="MSNQHVVNEKKIAVVTGASSGIGEAAARALAADGWHVIVAARRKH
FT                   LLDVLAADIAGTAIELDVTSDESVAAFAAQIPRCDLLVNNAGGALGLDPIAQANLEDWQ
FT                   WMYNTNVLGTLRVTRALLDALSSSNGLIINISSIAGIAPYAGGAGYNAAKFGVSAMDKV
FT                   MRIEFQERGIRVAEINPGRVHTDFSLVRFKGDQQAANAVYEGKVNLTAGDIAETIRWVA
FT                   SLPTHVNIDRLVITPQDQVI"
FT   misc_feature    114553..115248
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase"
FT   misc_feature    114562..114615
FT                   /note="FPrintScan hit to PR00081, Glucose/ribitol
FT                   dehydrogenase family signature"
FT   misc_feature    114577..114630
FT                   /note="FPrintScan hit to PR01397,
FT                   2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase signature"
FT   misc_feature    114757..114792
FT                   /note="FPrintScan hit to PR00081, Glucose/ribitol
FT                   dehydrogenase family signature"
FT                   /note="FPrintScan hit to PR00080, Short-chain
FT                   dehydrogenase/reductase (SDR) superfamily signature"
FT   misc_feature    114829..114891
FT                   /note="FPrintScan hit to PR01397,
FT                   2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase signature"
FT   misc_feature    114898..114948
FT                   /note="FPrintScan hit to PR00081, Glucose/ribitol
FT                   dehydrogenase family signature"
FT   misc_feature    114916..114942
FT                   /note="FPrintScan hit to PR00080, Short-chain
FT                   dehydrogenase/reductase (SDR) superfamily signature"
FT   misc_feature    114937..115023
FT                   /note="ScanRegExp hit to PS00061, Short-chain
FT                   dehydrogenases/reductases family signature."
FT   misc_feature    114976..115035
FT                   /note="FPrintScan hit to PR00081, Glucose/ribitol
FT                   dehydrogenase family signature"
FT                   /note="FPrintScan hit to PR00080, Short-chain
FT                   dehydrogenase/reductase (SDR) superfamily signature"
FT   misc_feature    115021..115092
FT                   /note="FPrintScan hit to PR01397,
FT                   2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase signature"
FT   misc_feature    115039..115092
FT                   /note="FPrintScan hit to PR00081, Glucose/ribitol
FT                   dehydrogenase family signature"
FT   CDS_pept        115518..116276
FT                   /transl_table=11
FT                   /locus_tag="DIP0136"
FT                   /product="Putative lipoprotein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK98"
FT                   /protein_id="CAE48640.1"
FT                   /translation="MRTPHRQGHTRWTKLPLVFAVGTLSVAMLAACGSDTATDTTDGSA
FT                   GPSSPAAASATPTTADALSGRIVGAEDAPEGLTHEDFYAMFGSTEETPKDTINPPECEP
FT                   LIFDSHTMFNWGSRARGTTAVSMYNSADGHQTAFIKIEEDAAEPVPDAGACATVTTENT
FT                   STLGTSRTTYAIAPKELPIEGADTVVAVDQNLQGLTLDDADMSGARAGERTTVVIAQAH
FT                   GHTITAVGTGDIPDQAITDLVNKQIHKLAS"
FT   misc_feature    115518..115682
FT                   /note="Signal peptide predicted for DIP0136 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.378 between residues 55 and 56"
FT   CDS_pept        complement(116460..116687)
FT                   /transl_table=11
FT                   /locus_tag="DIP0137"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to a region of Corynebacterium glutamicum
FT                   Ycg4K TR:Q9EUM3 (EMBL:AF164956) (256 aa) fasta scores: E():
FT                   9.2e-09, 75.61% id in 41 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK97"
FT                   /protein_id="CAE48641.1"
FT                   /translation="MGQARGWARKESQRRGNEHARRNAPLSHDDVIVQLTLGIWSEGRT
FT                   ADAFAQRSITPRKPLGNQHPRTTQRPSDST"
FT   CDS_pept        complement(116920..117045)
FT                   /transl_table=11
FT                   /locus_tag="DIP0138"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK96"
FT                   /protein_id="CAE48642.1"
FT                   /translation="MDSEKETQENDEQGRFHLPPAISLEREDVVKFNQAPDRPRS"
FT   CDS_pept        complement(117050..117379)
FT                   /transl_table=11
FT                   /locus_tag="DIP0139"
FT                   /product="Putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="GOA:Q6NK95"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK95"
FT                   /protein_id="CAE48643.1"
FT                   /translation="MIFVSIPKNGDGNSCWYGLALIFGVIAAILGAIALFFRSKGQELK
FT                   LSSLEAQLVGKTEIEAMRALTESKRITLSQGRAQIQGISKFVIWGFVSLVVSLMCTVAY
FT                   SLVGG"
FT   misc_feature    complement(order(117056..117121,117269..117334))
FT                   /note="2 probable transmembrane helices predicted for
FT                   DIP0139 by TMHMM2.0"
FT   CDS_pept        complement(117622..>117900)
FT                   /transl_table=11
FT                   /locus_tag="DIP0140"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No strong consensus RBS usptream. No
FT                   significant database matches"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK94"
FT                   /protein_id="CAE48644.1"
FT                   /translation="WLCRDLVSMGPEEGEVSGKNVHQSWDSERQQWKVGREGASRASGY
FT                   RDTESEARKWSQKLAKDSGSEWIKHRKDDGRIHQRNSYGDDPFPPRG"
FT   CDS_pept        118089..118232
FT                   /transl_table=11
FT                   /locus_tag="DIP0141"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK93"
FT                   /protein_id="CAE48645.1"
FT                   /translation="MILCRHIKKSRGGSNNCQPALDENTEKVGVALPKTERYPQGFGVD
FT                   LR"
FT   repeat_region   118305..118330
FT                   /note="Possible inverted repeat"
FT   CDS_pept        118306..118980
FT                   /transl_table=11
FT                   /locus_tag="DIP0142"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK92"
FT                   /protein_id="CAE48646.1"
FT                   /translation="MGSEGRCNTFIRKRLLMASTLGPFHSLIDADKHRLTELITAGSSV
FT                   HAAVRLLNANYRHCLNYAHHNTLITPRRQSTVVPQQRAAFLTQINNENTSIRRAAIDTE
FT                   LSLSVAYRLARGTGQHTRRSRYQQRVDSTNLRLEYLRLRLACLSQRDAATAVGIGRRAA
FT                   YDFDHGVSHTGSPRRRFIPNGPHAKAYNTCMTTLAARHDVIEEGRLSAPALPTRIDPYK
FT                   TH"
FT   CDS_pept        join(118976..119083,119091..119708,119716..119988)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="DIP0143"
FT                   /product="Putative transposase (pseudogene)"
FT                   /note="Pseudogene. Similar to Mycobacterium tuberculosis
FT                   CDC1551 IS1603, transposase MT3281 TR:AAK47622
FT                   (EMBL:AE007140) (344 aa) fasta scores: E(): 2.1e-42, 40.65%
FT                   id in 337 aa. Presents frameshifts at residues 36 and 242"
FT                   /db_xref="PSEUDO:CAE48647.1"
FT   misc_feature    119100..119708
FT                   /note="BlastProDom hit to PD002997, PD002997"
FT   misc_feature    119493..119711
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    119716..119961
FT                   /note="BlastProDom hit to PD002997, PD002997"
FT   misc_feature    119725..119952
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   119997..120022
FT                   /note="Possible inverted repeat"
FT   CDS_pept        complement(120068..120265)
FT                   /transl_table=11
FT                   /locus_tag="DIP0145"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No strong consensus RBS usptream. No
FT                   significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK91"
FT                   /protein_id="CAE48648.1"
FT                   /translation="MVRVSLFLLATPVHQDRVNFRTEIKKAITTVTKFWPDAGITADLK
FT                   GVTIQRGQPSITIEPKKELG"
FT   CDS_pept        120487..120867
FT                   /transl_table=11
FT                   /locus_tag="DIP0146"
FT                   /product="Putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="GOA:Q6NK90"
FT                   /db_xref="InterPro:IPR025962"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK90"
FT                   /protein_id="CAE48649.1"
FT                   /translation="MPIAAALSASVGLILLSVLCLTLPKVAMSGNIQRNSAIGIRTKET
FT                   KKSDSAWLEGHRKATPILQATGIITLGITAILLVSSFFQAFPPLLPVVSGILAYGVLFA
FT                   GFIAGAVVANKAAKNVNIQKGI"
FT   misc_feature    120487..120573
FT                   /note="Signal peptide predicted for DIP0146 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.536 between residues 29 and 30"
FT   misc_feature    order(120499..120567,120679..120747,120760..120828)
FT                   /note="3 probable transmembrane helices predicted for
FT                   DIP0146 by TMHMM2.0"
FT   CDS_pept        120867..120974
FT                   /transl_table=11
FT                   /locus_tag="DIP0147"
FT                   /product="Putative lipoprotein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="InterPro:IPR021096"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK89"
FT                   /protein_id="CAE48650.1"
FT                   /translation="MRKLSKVAIAVAITVSAACSGIAYAQTSHADQVTQ"
FT   misc_feature    120867..120941
FT                   /note="Signal peptide predicted for DIP0147 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.979 between residues 25 and 26"
FT   misc_feature    120885..120944
FT                   /note="1 probable transmembrane helix predicted for DIP0147
FT                   by TMHMM2.0"
FT   CDS_pept        join(121083..121232,121238..121303)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="DIP0148"
FT                   /product="Conserved hypothetical protein (pseudogene)"
FT                   /note="Pseudogene. Similar to the plasmid borne
FT                   Corynebacterium striatum YtpG TR:Q9FB50 (EMBL:AF024666) (76
FT                   aa) fasta scores: E(): 3.2e-09, 78.46% id in 65 aa.
FT                   Presents a frameshift at residue 50"
FT                   /db_xref="PSEUDO:CAE48651.1"
FT   CDS_pept        121423..121722
FT                   /transl_table=11
FT                   /locus_tag="DIP0149"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Bacillus subtilis hypothetical 7.9 kDa
FT                   protein in dnaN-recF intergenic region YaaA SW:YAAA_BACSU
FT                   (P05650) (71 aa) fasta scores: E(): 2.5e-05, 44.92% id in
FT                   69 aa"
FT                   /db_xref="GOA:Q6NK88"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK88"
FT                   /protein_id="CAE48652.1"
FT                   /translation="MCMQAQDVTIRDQEIKLGQFIKLANLVETGGAAKEVIAEGRVTVN
FT                   GAVDTRRGKTLRDGDVVCIGTACARVVAGAADDDDYFDEKTANDDFDPEVWRNM"
FT   misc_feature    121465..121608
FT                   /note="HMMPfam hit to PF01479, S4 domain"
FT   CDS_pept        121722..122546
FT                   /transl_table=11
FT                   /locus_tag="DIP0150"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551
FT                   conserved hypothetical protein MT0934.1 TR:AAK45182
FT                   (EMBL:AE006980) (257 aa) fasta scores: E(): 3.3e-32, 41.96%
FT                   id in 255 aa"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK87"
FT                   /protein_id="CAE48653.1"
FT                   /translation="MPAFQAEPGMPYWIDLTTSDLRKSTYFYSHVLGWEIEEFGADYHL
FT                   ARVQGLPVAGFIKRPENHQQPDTWVTYFMTDNIAADCAEVEKLGGRVLAVPMEVRLGQM
FT                   ALVVDNAGGLFGLIQPAGEDAFIAAGEPGTPVWHELTATTNYTKAVEFYPALFGWATAT
FT                   MDTDGSFGYTTAQVDGGAIAGIFNAEGQFPPQVPSFWQSYLGVAEVDAAVAATVEYGGS
FT                   VIREPWDTEFGRMAIIADSTGATVTLCEAPEPVEEGNESDSLEGIDLSQFGL"
FT   misc_feature    122145..122492
FT                   /note="HMMPfam hit to PF00903, Glyoxalase/Bleomycin
FT                   resistance protein/Dioxygenase superfamily"
FT   CDS_pept        122552..122857
FT                   /transl_table=11
FT                   /locus_tag="DIP0151"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor conserved
FT                   hypothetical protein SC10F4.36c TR:Q9F3M5 (EMBL:AL450350)
FT                   (94 aa) fasta scores: E(): 8.6e-07, 38.2% id in 89 aa, and
FT                   to Mycobacterium tuberculosis hypothetical 11.0 kDa protein
FT                   Rv3204 or MTCY07D11.22c TR:O05862 (EMBL:Z95120) (101 aa)
FT                   fasta scores: E(): 0.00013, 40% id in 95 aa"
FT                   /db_xref="GOA:Q6NK86"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK86"
FT                   /protein_id="CAE48654.1"
FT                   /translation="MGTDCSQHVPLSDLTERVLADVDTIPSGAVTTYGDIARRVGCGAR
FT                   HVGSIMRRYGALTAWWRVVRADGTLAVADRAIEHWDRENIAHNGKRVDLSQCYYQP"
FT   misc_feature    122582..122824
FT                   /note="HMMPfam hit to PF01035, 6-O-methylguanine DNA
FT                   methyltransferase, DNA binding domain"
FT   misc_feature    122642..122707
FT                   /note="Predicted helix-turn-helix motif with score 1011
FT                   (+2.63 SD) at aa 31-52, sequence TTYGDIARRVGCGARHVGSIMR"
FT   CDS_pept        complement(122867..123787)
FT                   /transl_table=11
FT                   /locus_tag="DIP0152"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="GOA:Q6NK85"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK85"
FT                   /protein_id="CAE48655.1"
FT                   /translation="MTDTSNISPEERREREEFLIGGHDRILTPEQQLEQLSTYIAAHYE
FT                   APAKNPPWSDNPSDKDAIDTFDARLPDRITHACMLMLGSALDHTMPGVAFIDGVTTQDV
FT                   PELGGQIIRPANPNGAWAISLHPGGWWKGSGVALDNAWRPEVAAVANLSDVTFLDLDYP
FT                   LVPEHTLEQVIATVTTAAQWVRDNQQPTAMFAWGYSSGGALTTLTHSLWDAQALTFPHL
FT                   DLTGLPPEVVGGISFPDAAQFPPTLMQVASNDAIAGHYPWAEEPKQVRVLEYVSEHRVS
FT                   TPEVARQRVRDVAEFFAHQAAQHSA"
FT   CDS_pept        123927..124553
FT                   /transl_table=11
FT                   /locus_tag="DIP0153"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK84"
FT                   /protein_id="CAE48656.1"
FT                   /translation="MSGISIIENAVLKPTKREVAEQWLGYFEHIGSYRFVDPDGQVGIE
FT                   SLIGFDLDRRLVQMPVTYRSAEFDAEHTLTTMDHSVLGTRYVSNAMGDPVAVREYIRVI
FT                   LEADNGAQRSDGKVSVLDVRGSGNREEKLTLGEVRILEATRQRAVGYVRIDGTLRGFVL
FT                   RVPHLLVPENSPRLGHNISPMRLNGSVVMSPKTVLIAAELSWHDI"
FT   CDS_pept        complement(124561..126570)
FT                   /transl_table=11
FT                   /locus_tag="DIP0154"
FT                   /product="Putative endopeptidase"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551
FT                   endopeptidase, peptidase family M13 MT0208 TR:AAK44429
FT                   (EMBL:AE006930) (663 aa) fasta scores: E(): 2.9e-89, 46.97%
FT                   id in 662 aa"
FT                   /db_xref="GOA:Q6NK83"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK83"
FT                   /protein_id="CAE48657.1"
FT                   /translation="MRLPPMLDNLTRMARMNDNQHRFALSDLYRFVNGPWLDSHVIPED
FT                   RGVDGIFHGLRDRAEEDVHTIVMDSADSLAGKLYASFMDTEGIESAGVAALDKDLTLID
FT                   VATVPEFVQALGALDRVGVGGPVGFWVAKDSAGDKSVAYIMQSGITLPDEAYYREESHA
FT                   QTREAYQKHVEKMLGFLAPEQLGTTPIDAATRILALETDIAAAHWDVVQRRDAVKTFNP
FT                   TEMAELPPQVAALLRAAGLPEHRVISMMPSYFEALESLLTPQRLDDWKLLTTWRILHSR
FT                   AGVLTPEISRADFEFFGTTLSGATQQRDRWKRALGLAESFVGEEIGALYVERHFPESSK
FT                   KDMLSLVSYLIEAYRERISGLSWMTPETRERALDKLDKFNAKIGYPDSWRSYAGLEFSA
FT                   KGTDLLDNVRAGSAFAHDYELNKIGRLADRNEWVTTPQTVNAFYNPVVNDITFPAAILR
FT                   APFYSPDADAAENFGAIGAVIGHEIGHGFDDQGSQYDGHGNLQSWWTDEDRAAFSALTD
FT                   RLVEQFEGLVPSVLADNNPSGAGVNGRFTLGENIGDLGGLGIAVIAYRRYLADHGLDFD
FT                   STPLAAFHAEDADPELEKTQFTGLQRLFLAWARVWRTAIRPELAAQYLAIDPHSPAEFR
FT                   CNVIAGNVAEFYQAFDVAEDSPMWIAPEKRVTIW"
FT   misc_feature    complement(124573..125253)
FT                   /note="HMMPfam hit to PF01431, Peptidase family M13"
FT   misc_feature    complement(124891..124926)
FT                   /note="FPrintScan hit to PR00786, Neprilysin
FT                   metalloprotease (M13) family signature"
FT   misc_feature    complement(125110..125139)
FT                   /note="ScanRegExp hit to PS00142, Neutral zinc
FT                   metallopeptidases, zinc-binding region signature."
FT   misc_feature    complement(125110..125160)
FT                   /note="FPrintScan hit to PR00786, Neprilysin
FT                   metalloprotease (M13) family signature"
FT   misc_feature    complement(125185..125223)
FT                   /note="FPrintScan hit to PR00786, Neprilysin
FT                   metalloprotease (M13) family signature"
FT   misc_feature    complement(125239..125277)
FT                   /note="FPrintScan hit to PR00786, Neprilysin
FT                   metalloprotease (M13) family signature"
FT   CDS_pept        126599..127231
FT                   /transl_table=11
FT                   /locus_tag="DIP0155"
FT                   /product="Putative secreted protein"
FT                   /note="No significant database matches. Possible secreted
FT                   protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK82"
FT                   /protein_id="CAE48658.1"
FT                   /translation="MSHYQFRPAVTAKTWSLLALGVITALVLPALLNMVTPDVDTKTVN
FT                   VSLGSEQEKWEMPMFKNDSSRLQCEESMSDLLTPTWDCDGATLTSMVVWGSQDQDTTLR
FT                   RMMRLNSMIDPGDEVPILHKGGVRIISSPEMPNQVGLSLERPADDVEHTGTLFVLVDGP
FT                   EFDSYAELVFNNLRAEEARIAGGEHEPMTLEELTKGFDKAHKGDAHT"
FT   misc_feature    126599..126715
FT                   /note="Signal peptide predicted for DIP0155 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.974) with cleavage site
FT                   probability 0.622 between residues 39 and 40"
FT   CDS_pept        127228..128148
FT                   /transl_table=11
FT                   /locus_tag="DIP0156"
FT                   /product="Putative membrane protein"
FT                   /note="No significant database matches. Possible membrane
FT                   protein"
FT                   /db_xref="GOA:Q6NK81"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK81"
FT                   /protein_id="CAE48659.1"
FT                   /translation="MSTQRAQPASISWVLWTLIGISIPVIAFFTFANFFASPIAAFLGV
FT                   LFGLVYFAVGTALFFFSPMWPTAGWKWYFACIGWGAGASFCIVMLSAAPFTDLTDKLGW
FT                   EAVSASFAGAYPEEIAKSLGVLLILFTFSKLTRPWHGFVTGAMIGLGFEVFENISYGVL
FT                   GAMSDPNTDITGALYSWWIRSIAGPGLHVAFTAIAGYGIGLAVFRYGWDTLQRFLVGLC
FT                   ALGVAFCLHFTWNLQFDSYAKQIANFIIVALILYPLMVWLWLRCHRQAKNDLGVVRMKR
FT                   PITTIAELQRRKLATTSEESQPHAS"
FT   misc_feature    order(127264..127332,127342..127410,127447..127515,
FT                   127558..127626,127645..127713,127771..127839,
FT                   127876..127932,127960..128019)
FT                   /note="8 probable transmembrane helices predicted for
FT                   DIP0156 by TMHMM2.0"
FT   CDS_pept        128138..129046
FT                   /transl_table=11
FT                   /locus_tag="DIP0157"
FT                   /product="Putative secreted protein"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551 amino
FT                   acid ABC transporter, amino acid-binding protein, putative
FT                   MT3866 TR:AAK48230 (EMBL:AE007181) (343 aa) fasta scores:
FT                   E(): 2.6e-26, 35.69% id in 311 aa"
FT                   /db_xref="GOA:Q6NK80"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK80"
FT                   /protein_id="CAE48660.1"
FT                   /translation="MRLNIRRIIAATVTAGALALSSCGSIESIEGGSHHNSDTIVVGSQ
FT                   DYYSNEIIAEIYSQALEAKGYTVDRQFRIGQREVYVDEIESGRIDVFPEYTGPLLQHWK
FT                   PDTEAREKTEVYQQLKEALPEHLVALDQSAATDQDSYVVTEEFAKKHHVNSIADLAEAA
FT                   KKQPLTLGANSEAQDRPNGPKGLEKTYGVSVGFTPIEDSGGPLTVKALRDNSIQLAIIY
FT                   SADPSISTNHLTNLEDPKGQFLASHVVTIAHDDVPLGAATVLNKVNATLTTEQLRELNA
FT                   RSVNEQLPSSVIAKDWIKQHL"
FT   misc_feature    128138..128221
FT                   /note="Signal peptide predicted for DIP0157 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.326 between residues 28 and 29"
FT   CDS_pept        complement(129067..129504)
FT                   /transl_table=11
FT                   /locus_tag="DIP0158"
FT                   /product="Putative secreted protein"
FT                   /note="No significant database matches. Possible secreted
FT                   protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK79"
FT                   /protein_id="CAE48661.1"
FT                   /translation="MRKLTMVGITAAVVGASVIAGISGMTSRNSDHITAASLISASSEV
FT                   RSAPADGTISEPGTYRVGNQDIRVTTTEPVILVLCGPEVASISASGPLGLSLDEDVRLG
FT                   SLQTTGDVTLVGRGDLYIAETLSAAHVSTQTGQLVTHGVPR"
FT   misc_feature    complement(129421..129504)
FT                   /note="Signal peptide predicted for DIP0158 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.457 between residues 28 and 29"
FT   stem_loop       complement(129618..129713)
FT   CDS_pept        complement(129730..133155)
FT                   /transl_table=11
FT                   /locus_tag="DIP0159"
FT                   /product="Putative transferase"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551
FT                   arabinosyl transferase MT3902 TR:AAK48268 (EMBL:AE007183)
FT                   (1098 aa) fasta scores: E(): 1.3e-49, 38.11% id in 1149 aa"
FT                   /db_xref="GOA:Q6NK78"
FT                   /db_xref="InterPro:IPR007680"
FT                   /db_xref="InterPro:IPR027451"
FT                   /db_xref="InterPro:IPR032731"
FT                   /db_xref="InterPro:IPR040920"
FT                   /db_xref="InterPro:IPR042486"
FT                   /db_xref="PDB:3BYW"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK78"
FT                   /protein_id="CAE48662.1"
FT                   /translation="MTKPMNTNITGIKWAAILSGVIGFVLFIITPLMPVNQVQSSVSWP
FT                   QNGSLNSVSAPLMSYTPISFDAKIPVASVDKLRKDQDLILGTLPANSEDAGARGLFVRA
FT                   NDDGLQITSHGELVLDLSKRELAQLPADATIAISATEDETTAGIEGDDSTTETVERDVR
FT                   PIIMGIYTELESNAAADLLNAGLNAHVEINSRFTSSPTLAKYASMWLGGLMLLISLISL
FT                   GMLDRRDGATDIRFLNKGFFRPRPLDAIVGAILLVWYFIGANTSDDGFILTMARASSAS
FT                   DYMANYYRWFGVPESPFGAPYYDLLGLMSKVSTASIWMRLPSLISAIVIWLVLSREVLP
FT                   RLGEKIAQRRVAQWTTAFVFLSFWLAYNNGLRPEPIIAAGTLLTWLSFEVAIATQRLLP
FT                   AAIGTMLAAFTLACGPTGLMAVTAVLAGLSYLIRIVYRRLPYLNTGASKRSIAVSVMAM
FT                   VAPFMAAGTAVFIAVFGDQTLRNVLESIHVRGDKGPALSWYNELVRYQVLMMQTVDGSF
FT                   ARRVGVFFTFVAAALVGATILRQGKVPGTNKGPVMRLMLVMVGTLFFMMFTPTKWTHHF
FT                   GVWAGIAAALAGVGAVALSHIALRSPRARILLTGGILFVFAFALAGPNGWWYTSSYSIP
FT                   WWDKTIQFHGIEASTVMLLLSLVVMAAGVLVSFRKDVAEEQAEARGEDPAMVNRPFRKQ
FT                   HFEGLAAAPIAILSIFAVAFSLASLSKGFIDQYPNYSVGLGNLRSLKGDTCNLANDVLV
FT                   ETNTNESFLTPLTGTLGDSLTNDDVRGFDPNRISPWAFTPENRPEALGAANSTGDGSDT
FT                   AAADSDASNTAAGADSDGSAAKADAASDNQEEAAKKKETHRADQGVNGSHSRLPFNLDY
FT                   RTVPVLGSWTDGKQEIAEATSSWFKLPKANDNTPLVVVSAAGSIKHKDVNGIVENGQKI
FT                   VLEYGRSNTGGSLGKAEKLGELDLLDSGIDSTWRNLRIPLSDIPDDADVIRIHAKDTSL
FT                   DPDEWIAFTPPRVPTMDTLANQFPASTPGLLDWAVPLQFPCQRTFNHYAGVAEIPEYRI
FT                   SADAKGKQSGMNFQDFAGGGVTGIAETINSSYELPSYSKNDWVRDWGSIKMYKLRTNSK
FT                   GEAPDVATVDTETITRSGLWYPGRMNIDTKVTKN"
FT   misc_feature    complement(order(131002..131067,131161..131226,
FT                   131272..131337,131359..131424,131455..131505,
FT                   131542..131607,131737..131802,131866..131931,
FT                   131962..132027,132139..132204,132367..132417,
FT                   132481..132537,133051..133116))
FT                   /note="13 probable transmembrane helices predicted for
FT                   DIP0159 by TMHMM2.0"
FT   misc_feature    complement(133036..133155)
FT                   /note="Signal peptide predicted for DIP0159 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.802 between residues 40 and 41"
FT   CDS_pept        complement(133148..135232)
FT                   /transl_table=11
FT                   /locus_tag="DIP0160"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   69.5 kDa protein CY13D12.26 Rv3792 or MTCY13D12.26
FT                   TR:P72058 (EMBL:Z80343) (643 aa) fasta scores: E():
FT                   3.7e-53, 34.5% id in 652 aa"
FT                   /db_xref="GOA:Q6NK77"
FT                   /db_xref="InterPro:IPR020959"
FT                   /db_xref="InterPro:IPR020963"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK77"
FT                   /protein_id="CAE48663.1"
FT                   /translation="MSRPCAKLLSMTESAPSKHASPSGGSSQVRAQRNTTQGEASDSEL
FT                   TSVVMYAPDQLSAKATLIAIVATIFGSSICTLGLWYLLKVVKLPPFGGSQVTKAGATVG
FT                   IFLTLLVTCIFVLWWMADDKRGTTRPRWRTWITYAVTHMAPAGLVMAAIGVPLSPSRLY
FT                   LEGITVDQGFRTQFLTRLTATQGLPDMNYADLPAYYPGAWFWLGARFAQLIGYPGWAIY
FT                   QPWALLSIAVTGCVLVPVWQRLVGSLPVATAIALVTTAIALTLCAFEPYACVIAMGIPA
FT                   ALVMGRRALSGQKLATVGVVVYLGASASTYTLYTAVIALSLVTVSGLFFAFVLRSWRPI
FT                   RQIIVIGVSSMAIASIVWGPYLWLRFTGHYEGTAAASHFLPPEGTVVPLPMFATSFVGV
FT                   LCFIGLIYLIMRVMDPDVCAMGVGLAVMYLWVIASMSVALSGTTLLGFRLDSVITIILG
FT                   TAGVLGLAELRLVAVHRFYPVQFSTSLSTRINVICVVVLALAGIQYAQAIPDRNAHAIE
FT                   LAYTNTDGDGHRADFLPPDATQYYAEVDRVIQEKTGKPAADTVVLTDEFNFLTYYPYLG
FT                   FQAFTSHYANPLGEFEKRNAVIENWASQSWDSLKDPQDFDRAVSNVPWRSPDAFVLRAD
FT                   STGSSDSKDGWNFNLAIDIFPSNPNVWFKGVRFNPEVFQGENSPWTVTQVGPFVVVTHD
FT                   "
FT   misc_feature    complement(order(133709..133774,133814..133879,
FT                   133910..133966,134006..134071,134132..134197,
FT                   134234..134299,134429..134494,134510..134575,
FT                   134765..134830,134870..134935,134981..135046))
FT                   /note="11 probable transmembrane helices predicted for
FT                   DIP0160 by TMHMM2.0"
FT   misc_feature    complement(133796..133846)
FT                   /note="ScanRegExp hit to PS00237, G-protein coupled
FT                   receptors family 1 signature."
FT   CDS_pept        complement(135343..136104)
FT                   /transl_table=11
FT                   /locus_tag="DIP0161"
FT                   /product="Putative oxidoreductase"
FT                   /note="Similar to Mycobacterium leprae putative
FT                   oxidoreductase ML0108 TR:Q9CDA5 (EMBL:AL583917) (254 aa)
FT                   fasta scores: E(): 5.6e-50, 57.14% id in 252 aa"
FT                   /db_xref="GOA:Q6NK76"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK76"
FT                   /protein_id="CAE48664.1"
FT                   /translation="MLNAVGQAQNILLLGGTSEIGLSIVAEFLAKGPAHVTLAARQDSP
FT                   RIDAAVAQMKAAGASEVDVIDFDATDFDKHAEVIDLAWAQGDVDLAIVAFGTLGDQEQL
FT                   WQDQKAAVTSAQTNYTAPVSVGVLLGEKFKEQGHGTIVALSSVAGQRVRRSNFVYGASK
FT                   AGMDGFYVNLGEALRPSGANVVVVRPGQVRTKMSADAGEAPLTVNKEDVAKATFDAVLN
FT                   RKSAIFVHPLFEYVSLAFKFIPQAIFRKLPF"
FT   misc_feature    complement(135364..136086)
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase"
FT   misc_feature    complement(135514..135567)
FT                   /note="FPrintScan hit to PR00081, Glucose/ribitol
FT                   dehydrogenase family signature"
FT   misc_feature    complement(135523..135564)
FT                   /note="FPrintScan hit to PR01167, Insect alcohol
FT                   dehydrogenase family signature"
FT   misc_feature    complement(135571..135630)
FT                   /note="FPrintScan hit to PR00081, Glucose/ribitol
FT                   dehydrogenase family signature"
FT   misc_feature    complement(135577..135633)
FT                   /note="FPrintScan hit to PR01167, Insect alcohol
FT                   dehydrogenase family signature"
FT   misc_feature    complement(135583..135669)
FT                   /note="ScanRegExp hit to PS00061, Short-chain
FT                   dehydrogenases/reductases family signature."
FT   misc_feature    complement(135649..135693)
FT                   /note="FPrintScan hit to PR01167, Insect alcohol
FT                   dehydrogenase family signature"
FT   misc_feature    complement(135658..135708)
FT                   /note="FPrintScan hit to PR00081, Glucose/ribitol
FT                   dehydrogenase family signature"
FT   misc_feature    complement(135814..135849)
FT                   /note="FPrintScan hit to PR00081, Glucose/ribitol
FT                   dehydrogenase family signature"
FT   misc_feature    complement(136024..136077)
FT                   /note="FPrintScan hit to PR00081, Glucose/ribitol
FT                   dehydrogenase family signature"
FT   misc_feature    complement(136045..136080)
FT                   /note="FPrintScan hit to PR01167, Insect alcohol
FT                   dehydrogenase family signature"
FT   CDS_pept        complement(136124..137590)
FT                   /transl_table=11
FT                   /locus_tag="DIP0162"
FT                   /product="Putative oxidoreductase, FAD-binding"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551
FT                   oxidoreductase, FAD-binding MT3898 TR:AAK48263
FT                   (EMBL:AE007183) (463 aa) fasta scores: E(): 4.2e-118,
FT                   67.57% id in 478 aa"
FT                   /db_xref="GOA:Q6NK75"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK75"
FT                   /protein_id="CAE48665.1"
FT                   /translation="MTTDKGTSSTAASNGASGALYTEAKKLTGWGRTAPTTAEVLSTPD
FT                   LDVIVDAVRQVAEQNDSKPAHLKRGVIARGMGRSYGDPAQNSGGLVVDMQALNKIHSID
FT                   PESAIVDVDGGVTLDQLMKAALPYGLWVPVLPGTRQVTIGGAIGPDIHGKNHHSAGSFG
FT                   DHVASMELLVADGRILHLEPEGSADDPTGELFWATVGGMGLTGIIVRARIRMTKTETAY
FT                   FIADGDLTANLDETIEFHSDGSEHNYTYSSAWFDAISPEPKLGRAAISRGSLATLAQLE
FT                   EIAPKLAKDPLKFNAPQLVTVPDIFPSFTMNKLSMIAIGELWWLKSGTYKNKVQNLTQF
FT                   YQPLDLIGEWNRGYGSKGFLQYQFVVPREAVEPFKDIVKDIQKSGHYSALNVFKLFGEG
FT                   NKAPLSYPMPGWNVCVDFPIKPGLGAFLDDLDKRVMEFGGRLYLAKESRTSAENFHKMY
FT                   PGMEGWLKTRNAIDPTGVFASDMSRRLELH"
FT   misc_feature    complement(136979..137527)
FT                   /note="HMMPfam hit to PF01565, FAD binding domain"
FT   CDS_pept        complement(137707..137955)
FT                   /transl_table=11
FT                   /locus_tag="DIP0163"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK74"
FT                   /protein_id="CAE48666.1"
FT                   /translation="MFGFLRKSQPVPQPQEATSDTIATQHTSAPLSNDMMLLMAEEIPM
FT                   LDSNSRVRVYEILEQYDGPTICSQEELPREIREMMDL"
FT   CDS_pept        137984..138418
FT                   /transl_table=11
FT                   /locus_tag="DIP0164"
FT                   /product="Putative membrane protein"
FT                   /note="No significant database matches. Possible membrane
FT                   protein"
FT                   /db_xref="GOA:Q6NK73"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK73"
FT                   /protein_id="CAE48667.1"
FT                   /translation="MSWGFASVCPMTNQARICRLSAALSVGLITALPDYVANKAVRWLL
FT                   NSLIAGAGVGVVAYVNKQDEDPTNDLDVVARELIDDSQFGPAATWGLFLAVVVLLFVQR
FT                   IDAKLTAVVTGWLRRRGVRAPHTVLGVLAAALTYAEVSKS"
FT   misc_feature    order(138026..138094,138113..138166,138230..138289)
FT                   /note="3 probable transmembrane helices predicted for
FT                   DIP0164 by TMHMM2.0"
FT   CDS_pept        138415..138963
FT                   /transl_table=11
FT                   /locus_tag="DIP0165"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK72"
FT                   /protein_id="CAE48668.1"
FT                   /translation="MISVIDVLSGLADNPTVVMWHVHTSPDYPTSLMSGAWVLGPAESH
FT                   GVDSLGSLLTNTWALPLTPAAAALVPAGIPVISLDDVRAAVEAGLGEIKSVIASAKQDN
FT                   PKLVAPRFNALPTISPDDFRAAYHGEPQAETAWSAASAVAAWMQTWLDIEQQRRSRAYL
FT                   KDALGSSARSLPLHLLPTR"
FT   CDS_pept        138975..139394
FT                   /transl_table=11
FT                   /locus_tag="DIP0166"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   13.4 kDa protein Rv3789 or MT3897 or MTCY13D12.23
FT                   SW:Y1I9_MYCTU (P72055) (121 aa) fasta scores: E(): 4.2e-17,
FT                   48.78% id in 123 aa"
FT                   /db_xref="GOA:Q6NK71"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK71"
FT                   /protein_id="CAE48669.1"
FT                   /translation="MTTTNSAAPQSVTSQGIRFIISGGISAVVDLGLTYICQILFGFSA
FT                   AGGRTIGFIFGTLTAYLINRRWTFQAEASTKRFIQVAVLYTITYFVNVGGHALLFGLFT
FT                   SSGLGDRVALVIAFVISQGVATVINFFVQRWFIFK"
FT   misc_feature    order(139032..139100,139110..139178,139215..139283,
FT                   139311..139370)
FT                   /note="4 probable transmembrane helices predicted for
FT                   DIP0166 by TMHMM2.0"
FT   stem_loop       139418..139511
FT                   /note="Score 57: 19/19 (100%) matches, 0 gaps"
FT   CDS_pept        139604..140383
FT                   /transl_table=11
FT                   /locus_tag="DIP0167"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches. Note: Also similar
FT                   to DIP2059 (271 aa) E(): 1e-38; 44.747% identity in 257 aa
FT                   overlap"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK70"
FT                   /protein_id="CAE48670.1"
FT                   /translation="MTHGLYWQGDVNVDELAAALCRRGFVLTGVTELELLARQPLTLPL
FT                   HVVANRRVKSTEYVVIHRSSVRKYARVADVLIELPVYAMRWLGRRQAIRLAEIAYAGRE
FT                   GRARLERHAQGAVPVRVREIVQASVIGADSPPERDLVRALRSAGVECESNVRVGDYRWD
FT                   IRICGSAVLIEVDGYAYHNAENRETFRLDRWKANDATLRGYLVLRYSAVCVRESLDVIV
FT                   DQVVQAVQCAPKQLRDVDEARCWHRGAWKWMPGLAWL"
FT   CDS_pept        complement(140517..141434)
FT                   /transl_table=11
FT                   /locus_tag="DIP0168"
FT                   /product="Putative glycosyl transferase"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551
FT                   glycosyl transferase MT3891 TR:AAK48256 (EMBL:AE007182)
FT                   (304 aa) fasta scores: E(): 1.8e-71, 62.17% id in 304 aa"
FT                   /db_xref="GOA:Q6NK69"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK69"
FT                   /protein_id="CAE48671.1"
FT                   /translation="MPLSTSDNIAAVIVTHKRVELLRASLEVVAAQTHPVKWIIVVDNG
FT                   CEDAVRDLLHSVAGDRGIYLPSHTNLGGAGGFAYGFLTALALGADAIWCADDDGRPEGP
FT                   QVLATLIDAAVTHQLDEVSPVVCNMDDPNRLAFPLRRGLEWRRYRSELIDPNNPSDTLL
FT                   PGIASLFNGALISAAAMERIGVPDLRLFIRGDEVEYHRRLVRSGLNFGTCLTTAYLHPD
FT                   GSDEFKPILGGRMHTQYPASDAKRYFTYRNRGYLMNQPGMRRLLPQEYARFAWFFLIQR
FT                   RDPRGFLEWFKLHQLGRSEKFERP"
FT   misc_feature    complement(140898..141407)
FT                   /note="HMMPfam hit to PF00535, Glycosyl transferase"
FT   misc_feature    complement(141105..141413)
FT                   /note="ProfileScan hit to PS50167, General
FT                   Glycosyltransferase domain."
FT   CDS_pept        141608..142573
FT                   /transl_table=11
FT                   /locus_tag="DIP0169"
FT                   /product="Putative secreted protein"
FT                   /note="Similar to Treponema pallidum periplasmic
FT                   zinc-binding protein TroA or TroMP1 or TP0163
FT                   SWALL:TROA_TREPA (SWALL:P96116) (308 aa) fasta scores: E():
FT                   4.2e-29, 35.27% id in 292 aa, and to Streptococcus
FT                   pneumoniae manganese ABC transporter substrate-binding
FT                   lipoprotein precursor PsaA or SP1650 SWALL:P72538
FT                   (EMBL:U53509) (309 aa) fasta scores: E(): 1.6e-19, 28.47%
FT                   id in 309 aa, and to Streptococcus gordonii challis
FT                   coagregation-mediating adhesin precursor ScaA SW:ADHS_STRGC
FT                   () (310 aa) fasta scores: E(): 1.9e-20, 30.15% id in 315
FT                   aa. Note: Also similar to the downstream DIP0173 (333 aa)
FT                   E(): 6.5e-38;56.061% identity in 330 aa overlap. Contains a
FT                   putative twin-arginine translocation (TAT) system
FT                   recognition motif (RRGFIR) at the N-terminal region"
FT                   /db_xref="GOA:Q6NK68"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK68"
FT                   /protein_id="CAE48672.1"
FT                   /translation="MSRRGFIRTAAASVAALALTGSLVACSTDSASTSATTSAANKALT
FT                   VFATTGYIGDAVKNIAPDADVTIMVGPGGDPHTYQPTTQDISKIESSDVVLWSGLHMEA
FT                   KMLDQLKAQGDRQAAVAEAIPEDKRLDWPEPGDNGEKLYDPHVWNSTENWKYVVDAIAK
FT                   KLSEVDKDNAATYKDNAEKYKKEIDETAAYVKEQIDQIPEQKRILITGHDAFSYFGKQF
FT                   GVEIHATDFVTSESEMSPAELAELGKFIAEKKIPTIFQDNLANPQAINSLKETVKAKGW
FT                   NVEISDKELYADSLGESAPTDTYLGVLKYNADAIREALAK"
FT   misc_feature    141608..150356
FT                   /note="Anomalous G+C content (57.26%) and GC deviation.
FT                   Putative metal transport system"
FT   misc_feature    141614..141631
FT                   /note="Potential twin-arginine recognition motif RRGFIR"
FT   misc_feature    141743..142567
FT                   /note="HMMPfam hit to PF01297, Periplasmic solute binding
FT                   protein family"
FT   misc_feature    141806..141862
FT                   /note="FPrintScan hit to PR00691, Adhesin B signature"
FT   misc_feature    141824..141865
FT                   /note="FPrintScan hit to PR00690, Adhesin family signature"
FT   misc_feature    141863..141916
FT                   /note="FPrintScan hit to PR00690, Adhesin family signature"
FT   misc_feature    141863..141922
FT                   /note="FPrintScan hit to PR00691, Adhesin B signature"
FT   misc_feature    142034..142093
FT                   /note="FPrintScan hit to PR00691, Adhesin B signature"
FT   misc_feature    142208..142261
FT                   /note="FPrintScan hit to PR00691, Adhesin B signature"
FT   misc_feature    142208..142273
FT                   /note="FPrintScan hit to PR00690, Adhesin family signature"
FT   misc_feature    142367..142423
FT                   /note="FPrintScan hit to PR00690, Adhesin family signature"
FT   misc_feature    142499..142555
FT                   /note="FPrintScan hit to PR00691, Adhesin B signature"
FT   CDS_pept        142673..143407
FT                   /transl_table=11
FT                   /locus_tag="DIP0170"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Bacillus subtilis probable metal
FT                   transport system ATP-binding protein YtgB SW:YTGB_BACSU
FT                   (O34338) (250 aa) fasta scores: E(): 5.3e-33, 45.61% id in
FT                   228 aa, and to Streptococcus gordonii challis hypothetical
FT                   ABC transporter ATP-binding protein in ScaA 5'region
FT                   SW:YSC1_STRGC (P42360) (251 aa) fasta scores: E(): 4.6e-30,
FT                   40.26% id in 231 aa"
FT                   /db_xref="GOA:Q6NK67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK67"
FT                   /protein_id="CAE48673.1"
FT                   /translation="MSVPLHALPPALVMRNVSARYGSTVAVERASVVVPAGTVMGFIGP
FT                   NGAGKSSLIKAAIDLIDRDGEVEFFGESLAACRNRVGYMPQSADVDWDYPITVRQVVQM
FT                   GLFPRVGWFKRLSGEHKELVDASLARVGIADLAKRHISELSGGQRRRVFVARILAQQPD
FT                   IYLLDEPFAGVDAASEKVIRGVLHELRDAGKSVVIVHHDLSTVEELCDHVTIINREVLA
FT                   SGPVSEVFTRETVNKAFGLGLL"
FT   misc_feature    142778..143392
FT                   /note="HMMSmart hit to SM00382, ATPases associated with a
FT                   variety of cellular activities"
FT   misc_feature    142781..143329
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    142787..142864
FT                   /note="ProfileScan hit to PS50101, P-loop nucleotide
FT                   binding motif (does not find all)."
FT   misc_feature    142802..142825
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    143102..143146
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   misc_feature    143102..143317
FT                   /note="ProfileScan hit to PS50100, 2nd half motif for
FT                   nucleotide binding, associated with P-loop."
FT   CDS_pept        143404..144303
FT                   /transl_table=11
FT                   /locus_tag="DIP0171"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Bacillus subtilis probable metal
FT                   transport system membrane protein YtgC SW:YTGC_BACSU
FT                   (O35024) (435 aa) fasta scores: E(): 3.1e-22, 33.91% id in
FT                   286 aa, and to Treponema pallidum zinc transport system
FT                   membrane protein TroC or TP0165 SW:TROC_TREPA (P96118) (298
FT                   aa) fasta scores: E(): 1.5e-21, 35.69% id in 297 aa"
FT                   /db_xref="GOA:Q6NK66"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK66"
FT                   /protein_id="CAE48675.1"
FT                   /translation="MSLIEFLSEFSFRRVVLGTMLIGLCSGAMGTFLYLRRQSMMSDVI
FT                   GHSATPGVMGSFLLFSTVPVLAGSQLLAQWGIDARSMPVITVGALITGLASALLADKVA
FT                   ATTRIGIDATMAVMLSLFLGGGLILLQIIQSGRYKGKGGIDELMFGNAATLTNLDVRTL
FT                   AVVSVVILGVIVALWRPFTLLVFDPVLARMSGMPRWINGVLFVIITLGMVIGVKAVGLI
FT                   LMIAFAVFPPAAARQWSRTALQMVVASALIGGASAVLGTYISISVGKVPTGPVIVLVLA
FT                   AIVLVSMVLSPRRSGVSA"
FT   misc_feature    143428..144276
FT                   /note="HMMPfam hit to PF00950, ABC 3 transport family"
FT   misc_feature    order(143446..143514,143533..143601,143644..143703,
FT                   143740..143808,143893..143961,143998..144093,
FT                   144136..144204,144223..144276)
FT                   /note="8 probable transmembrane helices predicted for
FT                   DIP0171 by TMHMM2.0"
FT   CDS_pept        144300..145151
FT                   /transl_table=11
FT                   /locus_tag="DIP0172"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Treponema pallidum zinc transport system
FT                   membrane protein Trod or TP0166 SW:TROD_TREPA (P96119) (367
FT                   aa) fasta scores: E(): 3.4e-27, 35.97% id in 278 aa, and to
FT                   Bacillus subtilis YtgD TR:O34500 (EMBL:AF008220) (295 aa)
FT                   fasta scores: E(): 2.8e-25, 35.92% id in 270 aa"
FT                   /db_xref="GOA:Q6NK65"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK65"
FT                   /protein_id="CAE48676.1"
FT                   /translation="MTFAVSVSLLALVVALTAAIPGVVLVLRRQAMLSDALSHAVLPGI
FT                   AVGALWTTNPNSPILLIGATLSGVLVMALTEWVRGRKRVTEDSATGLIFPAFFAIGVIL
FT                   ISTKFNRSSISEHTVLVGDLNISAMQHLVVGTIDFGPKSAWIIGAVGLLTLALLLVAKR
FT                   PLAISTFDPVFARTVGIRTRLINYLVMTMVSLTIVVVFDAAGAVLAVALMIVPAATALM
FT                   IASSEGAMLLVTLVVAAVSSQAGFWVAYRLDAATSPTMAFVDGLIFLAVWGIIRARRRL
FT                   RC"
FT   misc_feature    144300..144392
FT                   /note="Signal peptide predicted for DIP0172 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.990) with cleavage site
FT                   probability 0.427 between residues 31 and 32"
FT   misc_feature    144306..145124
FT                   /note="HMMPfam hit to PF00950, ABC 3 transport family"
FT   misc_feature    order(144312..144380,144474..144533,144567..144620,
FT                   144729..144782,144849..144902,144912..144971,
FT                   144990..145049,145059..145127)
FT                   /note="8 probable transmembrane helices predicted for
FT                   DIP0172 by TMHMM2.0"
FT   CDS_pept        145272..146273
FT                   /transl_table=11
FT                   /locus_tag="DIP0173"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Neisseria meningitidis putative
FT                   periplasmic binding protein NMA0789 SWALL:Q9JVL4
FT                   (EMBL:AL162754) (308 aa) fasta scores: E(): 2.7e-24, 31.71%
FT                   id in 309 aa, and to Treponema pallidum periplasmic
FT                   zinc-binding protein TroA or TroMP1 or TP0163
FT                   SWALL:TROA_TREPA (SWALL:P96116) (308 aa) fasta scores: E():
FT                   2.5e-16, 33.12% id in 317 aa, and to Streptococcus pyogenes
FT                   zinc-binding protein precursor AdcA or SPY0714 SWALL:Q9A0L9
FT                   (EMBL:AE006523) (515 aa) fasta scores: E(): 2.5e-16, 28.85%
FT                   id in 298 aa Note: Also similar to the upstream DIP0169,
FT                   (321 aa) E(): 4.5e-38; 56.798% identity in 331 aa overlap"
FT                   /db_xref="GOA:Q6NK64"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK64"
FT                   /protein_id="CAE48677.1"
FT                   /translation="MAATGLVAAAGCSTTDSGTSASGTSSAAKSDTLKIFATTSYIGDA
FT                   VKNIAPDADLTVMVGPGGDPHTYQPSTADLEAMQNADAVIWSGLGMEANMIDQLRGLGD
FT                   KQIAVAEQLPESQLLPWVEEDEHDHDHGDAHEHGHEGEDAHGHHHESQWDPHVWNSTDN
FT                   WKLVVDQIVKKLSAADSANADTYKANGEKYNKQIDEAKAYVQAKIDTIPQDQRTLVSGH
FT                   DAFRYFGKQFGLEVKATDFVTSDAERSANELEDLATFIVEHHVPVIFQDASANPQAVKS
FT                   LEENVAKKGGKVKVVDKELYSDSLGADAPADTYIGALKYNADTIAEAFSSTR"
FT   misc_feature    145272..146261
FT                   /note="HMMPfam hit to PF01297, Periplasmic solute binding
FT                   protein family"
FT   misc_feature    145365..145421
FT                   /note="FPrintScan hit to PR00690, Adhesin family signature"
FT   misc_feature    145365..145430
FT                   /note="FPrintScan hit to PR00691, Adhesin B signature"
FT   misc_feature    145455..145496
FT                   /note="FPrintScan hit to PR00690, Adhesin family signature"
FT   misc_feature    145494..145547
FT                   /note="FPrintScan hit to PR00690, Adhesin family signature"
FT   misc_feature    145650..145739
FT                   /note="ProfileScan hit to PS50316, Histidine-rich region."
FT   misc_feature    146193..146249
FT                   /note="FPrintScan hit to PR00691, Adhesin B signature"
FT   misc_feature    complement(146333..148033)
FT                   /note="Putative O-antigen export system"
FT   CDS_pept        complement(146339..147118)
FT                   /transl_table=11
FT                   /locus_tag="DIP0174"
FT                   /product="Putative ABC transport system, ATP-binding
FT                   protein"
FT                   /note="Similar to Mycobacterium leprae putative ABC
FT                   transporter ATP-binding component ML0114 SWALL:Q9CDA0
FT                   (EMBL:AL583917) (272 aa) fasta scores: E(): 2.3e-60, 74.4%
FT                   id in 254 aa, and to Xylella fastidiosa ABC transporter
FT                   ATP-binding protein XF2568 SWALL:Q9PAF0 (EMBL:AE004064)
FT                   (246 aa) fasta scores: E(): 1.4e-34, 45.93% id in 246 aa"
FT                   /db_xref="GOA:Q6NK63"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK63"
FT                   /protein_id="CAE48678.1"
FT                   /translation="MVSIDTYNACVDFPIFDAKSRSMKKAFLGAAGGAIGRNKDNTVVV
FT                   EALRDVNLHLREGDRIGLVGHNGAGKSTLLRLLSGIYEPTRGSAHVRGRVAPVFDLGVG
FT                   MDPEISGYENIVIRGLFLGQTRKQMKQKMDEIADFTELGDYLSMPLRTYSTGMRIRLAL
FT                   GVVTSIEPEILLLDEGIGAVDAAFMAKARERLSDLVKRSGILVFASHSNDFLVQLCDSA
FT                   LWVDHGTIRQAGPVADIVEAYEGKEAADHIRRLQARM"
FT   misc_feature    complement(146426..146950)
FT                   /note="HMMSmart hit to SM00382, ATPases associated with a
FT                   variety of cellular activities"
FT   misc_feature    complement(146435..146947)
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    complement(146447..146662)
FT                   /note="ProfileScan hit to PS50100, 2nd half motif for
FT                   nucleotide binding, associated with P-loop."
FT   misc_feature    complement(146864..146941)
FT                   /note="ProfileScan hit to PS50101, P-loop nucleotide
FT                   binding motif (does not find all)."
FT   misc_feature    complement(146903..146926)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        complement(147137..147997)
FT                   /transl_table=11
FT                   /locus_tag="DIP0175"
FT                   /product="Putative ABC transport system, permease protein"
FT                   /note="Similar to Mycobacterium leprae putative ABC
FT                   transporter component ML0112 SWALL:Q9CDA2 (EMBL:AL583917)
FT                   (276 aa) fasta scores: E(): 1.2e-60, 55.23% id in 277 aa,
FT                   and to Xylella fastidiosa ABC transporter permease protein
FT                   XF2567 SWALL:Q9PAF1 (EMBL:AE004064) (267 aa) fasta scores:
FT                   E(): 5.2e-37, 36.5% id in 263 aa"
FT                   /db_xref="GOA:Q6NK62"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK62"
FT                   /protein_id="CAE48679.1"
FT                   /translation="MVARITNTDTTADEPSQSKTLAAAWADLVRGFSQRELWLQLGWQD
FT                   IKQRYRRSVLGPLWITIATGVMALALGLLYSVLFKIPVAQFLPHVTVGLIMWNFIAGCI
FT                   KEGSEVFIANEGLIKQLPSALSVHVYRLVWKQTLFLMHNMVIWVILMAIFPRPLGWDIL
FT                   LGIPALALLIANGVWVTMFFGIVATRYRDFSPLLEALTQLLFYVTPIVWTTETLYSQGG
FT                   AVSERAKLAMLNPLYHYMEVIRAPLIGAPIHPLNWIVVGCCTVIGLFIAMLAMRQWRFR
FT                   VSYWV"
FT   misc_feature    complement(147149..147916)
FT                   /note="HMMPfam hit to PF01061, ABC-2 type transporter"
FT   misc_feature    complement(order(147176..147241,147362..147418,
FT                   147440..147505,147518..147583,147689..147754,
FT                   147767..147832))
FT                   /note="6 probable transmembrane helices predicted for
FT                   DIP0175 by TMHMM2.0"
FT   CDS_pept        148133..149326
FT                   /transl_table=11
FT                   /locus_tag="DIP0176"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium leprae hypothetical protein
FT                   ML0117 TR:Q9CD97 (EMBL:AL583917) (398 aa) fasta scores:
FT                   E(): 8.1e-38, 35.73% id in 417 aa"
FT                   /db_xref="GOA:Q6NK61"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK61"
FT                   /protein_id="CAE48680.1"
FT                   /translation="MAFDVARVRGAYTSITGGWTYMNAQQQAQIPERVAAAVARGFRNS
FT                   PIVEDVEPAFGSHARERHAGLFASDGYERSARVAIADLTGTSADAVILGPNLEVLFSQF
FT                   AAAVWPLVRRGSSVVMAHGCSPAMTVGAKTRWAQPDLGTGEIPAWQFGSLVDGSTRLVA
FT                   LRAADPQVGTINPIREISEYVHGASRAWLLVDASSLAGHRPITMEALGADIVALDCSAF
FT                   GGPQVAALAFRDATMFPRLDADLLNSSVAPGLAAGVSAAVDHIADLDESVRGTRRNRLV
FT                   DSIESAGLYLGRLGTYLADSLDSLPKTHVFGVTGEAAAGSDADRIPHVTFCIDGVPADL
FT                   IYHRLLSNRIVGALSASSPLLDAMGAEDTHGTISLALAPFNTTHDVDQLMRVVASFA"
FT   CDS_pept        complement(149323..150270)
FT                   /transl_table=11
FT                   /locus_tag="DIP0177"
FT                   /product="Putative quinone oxidoreductase"
FT                   /note="Similar to Streptomyces coelicolor putative quinone
FT                   oxidoreductase SCGD3.24c TR:Q9XA55 (EMBL:AL096822) (326 aa)
FT                   fasta scores: E(): 1.4e-57, 53.87% id in 323 aa"
FT                   /db_xref="GOA:Q6NK60"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK60"
FT                   /protein_id="CAE48681.1"
FT                   /translation="MRAIYVQDDATLAVHDAPTPTLQPGEVLVQVKAAGVNRADLLQAA
FT                   GHYPPPPGESEIIGLECAGVIVDAGTTSRNVGDKVACLLAGGGYAEYVAVPEGQLMPIP
FT                   EGYSFAEAAAVVEVAATVWSNIGMLTGLKPEHMFLIHGGAGGIGTFAIQLAKHVGATVA
FT                   VTAGSKEKLETCRELGADILINYREEDFAEVLKNKCDRILDIMGAKYLDQNVRALAMDG
FT                   HQVTIGMQGGVKGELNIGRLLSKRGTISATALRARDREDKARIVASTVENVWPLLADGT
FT                   IRHHIHATLPLEQAQRAHEMLKNGEVTGKLVLEV"
FT   misc_feature    complement(149326..150240)
FT                   /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenases"
FT   tRNA            150357..150441
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:150391..150393,aa:Ser)"
FT                   /note="tRNA Ser anticodon TGA, Cove score 51.94"
FT   stem_loop       150507..150590
FT                   /note="Score 72: 28/31 (90%) matches, 0 gaps"
FT   CDS_pept        complement(150627..151661)
FT                   /transl_table=11
FT                   /locus_tag="DIP0178"
FT                   /product="Putative aminotransferase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   histidinol-phophate aminotransferase SCD78.11 TR:Q9ZBY8
FT                   (EMBL:AL034355) (359 aa) fasta scores: E(): 6.9e-55, 49.85%
FT                   id in 345 aa, and to Streptomyces tendae NikT protein
FT                   TR:Q9F2E4 (EMBL:AJ250581) (440 aa) fasta scores: E():
FT                   1.1e-42, 42.9% id in 324 aa"
FT                   /db_xref="GOA:P61004"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61004"
FT                   /protein_id="CAE48682.1"
FT                   /translation="MIRKDLSQIPTYVPGKRNDHALKLSSNEVTHRPLPSAAQAMAEAA
FT                   AGANRYPDMGVTELRGALSEHLGVPAEQIAVGCGSSALCQQLVQITCTPGDEVVFPWRS
FT                   FEAYPIFVQVVGATPVAVPLTSDGFNDLDAMAAAITPKTKLVFVCNPNNPSGTVVRREA
FT                   FLEFMAKVPADVVVALDEAYTEYVRDEDTIFATEILSEFPNLVGLRTFSKAFGLAGVRV
FT                   GYAFGPHELIDALNKVALPFGVNAVGQAGALASLNNLDELMEHTEEVVAVRDRVADHIG
FT                   AAHSQANFVWIPAESRSETPFEIAEKLAAHDVLVRAFPEGVRITVTNEEESDRLLAAWD
FT                   ASFA"
FT   misc_feature    complement(150633..151469)
FT                   /note="HMMPfam hit to PF00155, Aminotransferase class I and
FT                   II"
FT   misc_feature    complement(150978..151052)
FT                   /note="FPrintScan hit to PR00753,
FT                   1-aminocyclopropane-1-carboxylate synthase signature"
FT   misc_feature    complement(151005..151034)
FT                   /note="ScanRegExp hit to PS00599, Aminotransferases
FT                   class-II pyridoxal-phosphate attachment site."
FT   misc_feature    complement(151170..151244)
FT                   /note="FPrintScan hit to PR00753,
FT                   1-aminocyclopropane-1-carboxylate synthase signature"
FT   tRNA            151769..151857
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:151803..151805,aa:Ser)"
FT                   /note="tRNA Ser anticodon GCT, Cove score 42.39"
FT   tRNA            151905..151977
FT                   /gene="tRNA-Arg"
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:151938..151940,aa:Arg)"
FT                   /note="tRNA Arg anticodon ACG, Cove score 77.20"
FT   CDS_pept        152426..154000
FT                   /transl_table=11
FT                   /locus_tag="DIP0179"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Staphylococcus aureus subsp aureus Mu50
FT                   hypothetical 57.2 kDa protein SAV1916 TR:BAB58078
FT                   (EMBL:AP003363) (520 aa) fasta scores: E(): 3.6e-71, 41.38%
FT                   id in 505 aa, and to Helicobacter pylori sodium-dependent
FT                   transporter HP0214 TR:O25003 (EMBL:AE000541) (552 aa) fasta
FT                   scores: E(): 9.3e-34, 50.45% id in 555 aa"
FT                   /db_xref="GOA:Q6NK59"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK59"
FT                   /protein_id="CAE48683.1"
FT                   /translation="MSTPITHESSSHALAEDAEVHGKNENRRQFTGLFAGLILAVLIYL
FT                   VFPESSVDMVQGVDPDGEYSYNALRITAAIAVLMGAWWMTEAIPLAATALVPLVAFPVL
FT                   QVIPFAKISAPYASPTIFLFMGGFILALGMQRWNLHRRLALSVVLLVGTKPKQLIAGFM
FT                   LATGFLSMWVSNTATAVVMLPIGVSVLQLTAESVGGMKAQKKFATALMLAIAYSASIGS
FT                   LGTIIGTPPNALMVAYMAENHDIHIGFGTWMLVGVPLAIVYMAIAWLVLVSVFKPEVDS
FT                   IPGGREMIKSELAKMGSMKFGEAATAVIFTGAALSWVFVPLLIDVFQWKVEIADAAIGL
FT                   IASMLLFMIPADRKTGVRLTDWKTANELPWDVLLLFGGGLALSKMFSDSGLSLWIGEIA
FT                   KGLVSLPLILLIAAIAALVLLLTEFTSNTATAATFLPIMAGVAVGIGLNANGDQNILLL
FT                   TIPVALSATCAFMLPVATPPNAIAYGSGHVRIGDMVKGGVWLNLIGVVLVTLATYFLAI
FT                   PVFNIVL"
FT   misc_feature    order(152513..152569,152627..152680,152684..152752,
FT                   152765..152824,152915..152983,153041..153109,
FT                   153170..153238,153335..153403,153422..153481,
FT                   153539..153607,153626..153694,153707..153766,
FT                   153785..153853,153917..153985)
FT                   /note="14 probable transmembrane helices predicted for
FT                   DIP0179 by TMHMM2.0"
FT   misc_feature    152672..153979
FT                   /note="HMMPfam hit to PF00939, Sodium:sulfate symporter
FT                   transmembrane region"
FT   tRNA            154077..154149
FT                   /gene="tRNA-Arg"
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:154110..154112,aa:Arg)"
FT                   /note="tRNA Arg anticodon ACG, Cove score 77.20"
FT   misc_feature    154153..190718
FT                   /note="Corynephage"
FT   CDS_pept        154365..154994
FT                   /transl_table=11
FT                   /locus_tag="DIP0180"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="InterPro:IPR022104"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK58"
FT                   /protein_id="CAE48684.1"
FT                   /translation="MGELDTADRLLEKSKEAFALAVELYNRPTLKYHAESCSIFLCNAW
FT                   ELMLKSYIIRKYGIDEIYYDDGDKTIALTDCLKKVFTNDKDPLRINMAELIRFRNTNTH
FT                   FITDEYEIFYGPFLQMSVNNYADKLFELHGQSVSDLIPENHLTLAVKRGAIEPEVIRAK
FT                   YEPHVAKKLLSLSKQAADAAGDGNSGRVAAIYETNFRLVKRQGMRI"
FT   CDS_pept        155099..155371
FT                   /transl_table=11
FT                   /locus_tag="DIP0181"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK57"
FT                   /protein_id="CAE48685.1"
FT                   /translation="MNKRLKKAKVQIQFRDSKKNKFTSHDFQLFIKAYAMKGDPRFSHD
FT                   RKASNEVNPSWTYSQQAIKHIADELIKDPEKCLDRLKFAVSKKNN"
FT   CDS_pept        complement(155600..156826)
FT                   /transl_table=11
FT                   /locus_tag="DIP0182"
FT                   /product="Putative phage integrase"
FT                   /note="Similar to Mycobacterium phage MS6 Integrase Int
FT                   TR:O55248 (EMBL:AF030986) (372 aa) fasta scores: E():
FT                   1.5e-09, 26.48% id in 370 aa"
FT                   /db_xref="GOA:Q6NK56"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK56"
FT                   /protein_id="CAE48686.1"
FT                   /translation="MATVRDLWTKRNPNTTSKTKRIRSARWGVGKRWQAVWIENGREAT
FT                   KTFETRDEAELWAARAEVGKADGTWITKDKVDITLSDLWEPWIASKGNISDKTKRDYLS
FT                   YWNVHIRPQWGQTPCAHIQRSVINAWIPTLSTMKGVPASQPPRPLSESAMRKVGLIIHG
FT                   ILDLAVELGVIHQNPIRTGDLPKQKKSERRYLKITEVDELIRQAPTEQAKLLLRVLIMT
FT                   GLRPGEAKGLKVKDLDPVRGRLMIRRDVDDLGHEDSTKTRNHRDVPIGGEILLLLDRYA
FT                   QGKDPDSWLIPDERGKVWTTSRWRVVWKNLCIWTGIGDLDTYELRHTAASIAIAAGADV
FT                   KTVQLMLGHSSAAMTLDIYAHLWEEGLDAIPGAMEAHMESERKRAEEASTVHEASEAER
FT                   RRAQFKVIG"
FT   misc_feature    complement(155720..156307)
FT                   /note="HMMPfam hit to PF00589, Phage integrase family"
FT   CDS_pept        complement(156926..157948)
FT                   /transl_table=11
FT                   /locus_tag="DIP0183"
FT                   /product="Putative transcriptional regulator"
FT                   /note="Similar to Streptococcus pneumoniae transcriptional
FT                   regulator SP1809 TR:AAK75882 (EMBL:AE007473) (383 aa) fasta
FT                   scores: E(): 8.2e-14, 29.35% id in 310 aa"
FT                   /db_xref="GOA:Q6NK55"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK55"
FT                   /protein_id="CAE48687.1"
FT                   /translation="MPTLSSNLKHLRLLLGRSQGEFAEQLGIAQSTLSSVERENRPPST
FT                   KLINTARFQTGVSAEYFEASIHFYAAPDLLFRSAREGRANADKIAAAFSIAEHYLRERY
FT                   PDVTSDLPTIPIADLEGELSLRMLEEFASQTRDHFGIDQDSMIPNLTTVLNNHGILVTS
FT                   LPDYVVEGTNFDGVSTPTDSTLRIIALNQQRSGDRYRFSLAHELAHLILHANTLRSDKS
FT                   QMEKEANIFAASFLMPRALLTPVITPELTLKDYAELKAQWGYSIQAIVRRAHELELIDY
FT                   KRYRSLRMQIAGRGWNINEPVDVLLENVYIDPIDLLSNNIKKHQSTNEGLATVTSLHKQ
FT                   "
FT   misc_feature    complement(157316..157345)
FT                   /note="ScanRegExp hit to PS00142, Neutral zinc
FT                   metallopeptidases, zinc-binding region signature."
FT   misc_feature    complement(157763..157927)
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix"
FT   misc_feature    complement(157763..157930)
FT                   /note="HMMSmart hit to SM00530, Helix-turn-helix XRE-family
FT                   like proteins, DNA-binding"
FT   misc_feature    complement(157835..157900)
FT                   /note="Predicted helix-turn-helix motif with score 2114
FT                   (+6.39 SD) at aa 17-38, sequence RSQGEFAEQLGIAQSTLSSVER"
FT   CDS_pept        complement(157960..158523)
FT                   /transl_table=11
FT                   /locus_tag="DIP0184"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK54"
FT                   /protein_id="CAE48688.1"
FT                   /translation="MAHTTGENLFTMKRVLRNLEADHDALREALADGRRMRDLLPYGDY
FT                   INRYRNLTRDPMVVAIHKQFHESGLGGLTIDESMFPLSLRFEDDDVTLVFRRPEGFRHG
FT                   TNEESSQRPLIERRSRIVLFWKYAEPGTDALKRISLQMFDNEGPLEEATMLSEKIPLLT
FT                   KPESLTTAMFIPTHADEPRFVFGS"
FT   CDS_pept        complement(158618..159025)
FT                   /transl_table=11
FT                   /locus_tag="DIP0185"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK53"
FT                   /protein_id="CAE48689.1"
FT                   /translation="MSPVEAALETLAHTMGITVIETSKLGSTLNACFHPPTQTIFIKIG
FT                   LDPVTRRCAIAHELGHAHYGHNCSTPGAERQADEWAAQQLLDVGDVEAVGLECEGSAAA
FT                   MAAELGVTPHLLVLWMGMYERGRIQPEKRAC"
FT   CDS_pept        complement(159035..159196)
FT                   /transl_table=11
FT                   /locus_tag="DIP0186"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK52"
FT                   /protein_id="CAE48690.1"
FT                   /translation="MDTRRKAKRGNNSPTAPPHVTEPDYDAILDGINAGTEPIAAQKAT
FT                   DPLEENYT"
FT   CDS_pept        159639..159881
FT                   /transl_table=11
FT                   /locus_tag="DIP0187"
FT                   /product="Putative transcriptional regulator"
FT                   /note="Similar to Pyrococcus abyssi repressor protein,
FT                   putative PAB7155 TR:Q9V101 (EMBL:AJ248284) (73 aa) fasta
FT                   scores: E(): 0.002, 36.06% id in 61 aa"
FT                   /db_xref="GOA:Q6NK51"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK51"
FT                   /protein_id="CAE48691.1"
FT                   /translation="MNMANVKIKIRDGLIDRLRNMSGITSDEAFARTIGTSRSTLVDVK
FT                   TGEREPSLAFAIGIAQAFGLGLSEIVTWETETTAA"
FT   misc_feature    159678..159848
FT                   /note="HMMSmart hit to SM00530, Helix-turn-helix XRE-family
FT                   like proteins, DNA-binding"
FT   misc_feature    159681..159848
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix"
FT   CDS_pept        complement(160120..160446)
FT                   /transl_table=11
FT                   /locus_tag="DIP0188"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK50"
FT                   /protein_id="CAE48692.1"
FT                   /translation="MSKVVLVYGGQRYTLATSDVASVHFRITERLNHSAHYRDRLDRRP
FT                   FGQEQGSLQDFPGGPLLEQFDPFEVFELADGGEVWVACYDGVDLALETEQRTKDFFEPY
FT                   RDQR"
FT   CDS_pept        160470..160961
FT                   /transl_table=11
FT                   /locus_tag="DIP0189"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK49"
FT                   /protein_id="CAE48693.1"
FT                   /translation="MQSLFRLRVKGTPLVELRVVPFEKDRFTIVHADVKDPVTVHAVTI
FT                   EEIHNLMTLLFRQTLRNLGVSRIGKDELDVVIRLDPQARETGRPKVKRYTALVEGIHSV
FT                   GDPGERPVRHLVFVTVDIQRESFIAHTKRVIRRIKHDSRFHRKMKHLSERRKRDGIKTI
FT                   "
FT   CDS_pept        160942..161760
FT                   /transl_table=11
FT                   /locus_tag="DIP0190"
FT                   /product="Putative anti-repressor protein"
FT                   /note="Similar to Staphylococcus aureus prophage phiPV83
FT                   antirepressor TR:Q9MBT0 (EMBL:AB044554) (265 aa) fasta
FT                   scores: E(): 1.5e-32, 42.8% id in 257 aa"
FT                   /db_xref="GOA:Q6NK48"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK48"
FT                   /protein_id="CAE48694.1"
FT                   /translation="MELKPFNFRGHNVRVLVAENGEPLWVGRDVCAVLEIKNSRDALSR
FT                   IDPEGVGIADTLTPGGIQKLKVVNESGLYELLFQSRVPQAKEFRRWVTGEVLPEIRRHG
FT                   MYATTATVEQMLADPTTAIKLLEQIKQERDQRRALEVQAAIDKPKVMFADAVAEANTDI
FT                   LVRDLAKILRGNGIEVGGNRLFAWLRKHKYLMDGPSHIKHTPTQKAMELGLFKIKETVV
FT                   TRSDGRSSITVTPKVTGKGQRYFVERFLDGRFDINDIKTNKNRPVAAGRK"
FT   misc_feature    160942..161235
FT                   /note="HMMPfam hit to PF02498, BRO family, N-terminus"
FT   CDS_pept        161977..162219
FT                   /transl_table=11
FT                   /locus_tag="DIP0191"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK47"
FT                   /protein_id="CAE48695.1"
FT                   /translation="MTMRTYKNPYPDSEDAVEIRFDHCREDIAKAAQEYWREMTEAELD
FT                   DLQEEIMRALAVSEWQNIWLTSAAFITVLAYHFHD"
FT   CDS_pept        162231..162455
FT                   /transl_table=11
FT                   /locus_tag="DIP0192"
FT                   /product="Putative exported protein"
FT                   /note="No significant database matches. Possible exported
FT                   protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK46"
FT                   /protein_id="CAE48696.1"
FT                   /translation="MILLVLINIVFSMLLLFNLTDANRKIEDATKRLDMLNEDVDVQSV
FT                   KILDLYGIAQIPPMPDEEAASRIFTEVRR"
FT   misc_feature    162231..162302
FT                   /note="Signal peptide predicted for DIP0192 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.644) with cleavage site
FT                   probability 0.635 between residues 24 and 25"
FT   CDS_pept        162452..162598
FT                   /transl_table=11
FT                   /locus_tag="DIP0193"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK45"
FT                   /protein_id="CAE48697.1"
FT                   /translation="MNRTALEELHQALISEAEAMRTGEYFLGAGIVDAYAHQLREAIDS
FT                   HDE"
FT   CDS_pept        162606..162875
FT                   /transl_table=11
FT                   /locus_tag="DIP0194"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK44"
FT                   /protein_id="CAE48698.1"
FT                   /translation="MCKHCGAAVLFVKDDRWHVFDAKPSEEGEWRIRSRWAANVAAEKT
FT                   TVTRLTESKLRRARLMGEPLFRPHFQTCPANPRAKILQEKRRHG"
FT   CDS_pept        162868..163017
FT                   /transl_table=11
FT                   /locus_tag="DIP0195"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK43"
FT                   /protein_id="CAE48699.1"
FT                   /translation="MDDASIADEWWENLPERRKIQIHHWIVSPRQITIQELPGQIALIE
FT                   GTEQ"
FT   CDS_pept        163014..163457
FT                   /transl_table=11
FT                   /locus_tag="DIP0196"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK42"
FT                   /protein_id="CAE48700.1"
FT                   /translation="MTKTQLVCDKNQLNWGLKAAKAIAGKSPYDVVQMRVSPDRDYLYI
FT                   CAVNAEATLVAKVELLVANISSEEDEIITIDKAKIPALILATAETGKKSEDSRPMAGIC
FT                   IRGKEVDFTDENGAGRGVDLTTIHRNDSAEIGDPVRTIIRVKQ"
FT   misc_feature    163071..163094
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        163482..163715
FT                   /transl_table=11
FT                   /locus_tag="DIP0197"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK41"
FT                   /protein_id="CAE48701.1"
FT                   /translation="MTPSPAQITELARATRYLGGNPTLSMRSYMHEGTESHRLVAEATF
FT                   WTLSVLNVPEALLETEKDKANIVDAAPIGGIS"
FT   CDS_pept        163814..164122
FT                   /transl_table=11
FT                   /locus_tag="DIP0197A"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK40"
FT                   /protein_id="CAE48702.1"
FT                   /translation="MLERHKIARKKCMTCTLLAECEKMLSDFEKEELRVDGVVAGRYCD
FT                   VSHRNGSSIDVLRHCKHCNVRLIPQGGPRGKEPSGARKHRGEGLCAVCYPLFSRKQR"
FT   CDS_pept        164151..165359
FT                   /transl_table=11
FT                   /locus_tag="DIP0198"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK39"
FT                   /protein_id="CAE48703.1"
FT                   /translation="MAWSRVGDNIATHPLMSRLLTSCEFDHSLKNEAFGALVQLTTVSA
FT                   AHLTDYIIEYGLMAQIAPGREKQLIDVLVDAGMLFRDEVDGRKVLRIVDDNELLHNRSR
FT                   DEVEIDRRRAADKRNPALIPAVRYRDGDQCRWCGRTVDWRDRKGGRAATIDSLNEHRES
FT                   TVDTLVVACKSCNSKRGAGEELQLLPTPTREKVHYTDHTIDWINRSEWAQHEGIHLEPR
FT                   QTHLDIGQQITTPAAPSEQQQVGQAAAPLEAAARAHRAAPDVEAPFVSDPLDEAPDWVK
FT                   QSLVNDHGQAAAPLMAAAPREHDHAPAAPSEQQQVGQAAAPLEAAARAHRAAPDVEAPP
FT                   QHHVDNETVKPSTDLEQITDRWGDGSRSLGTGRDGNGQVGTARRRRRRRRGGRGTGRNK
FT                   AHG"
FT   misc_feature    164889..165149
FT                   /note="ProfileScan hit to PS50310, Alanine-rich region."
FT   misc_feature    165297..165341
FT                   /note="ProfileScan hit to PS50323, Arginine-rich region."
FT   CDS_pept        165352..165966
FT                   /transl_table=11
FT                   /locus_tag="DIP0199"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK38"
FT                   /protein_id="CAE48704.1"
FT                   /translation="MDSWKLHSLGKALYELEKLGPLLDDLLLPSQCGYSEGRGGSGQGS
FT                   RPPLRIPILDVKWETERLLSYWSARLAVRLQLVPPRARSVAISAAWLQRHLIEIEPDPE
FT                   FDQAAEQIIEQARIIDAMFTEDATPDEDMEGTCREIASACRRLGYEISKTTVHRWAREE
FT                   TISSKTMEDGRVIVSLQEVIGKLTACDNEEVVDSGTPNIVS"
FT   CDS_pept        166018..166335
FT                   /transl_table=11
FT                   /locus_tag="DIP0200"
FT                   /product="Putative phage protein"
FT                   /note="No significant database matches"
FT                   /db_xref="GOA:Q6NK37"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK37"
FT                   /protein_id="CAE48705.1"
FT                   /translation="MHQRCNTRGGQDMGFDSRAAKKLKAMFKQQCRDAGAVCWLCGQPI
FT                   NYDAPPNSRDSFEPDHFYPQATHPELAEDPENLRPSHCSCNRSRKDGVPAPSLGSLSEQ
FT                   W"
FT   misc_feature    166093..166278
FT                   /note="HMMSmart hit to SM00507, HNH nucleases"
FT   CDS_pept        join(166479..166829,166831..168423)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="DIP0201"
FT                   /product="Putative phage terminase (pseudogene)"
FT                   /note="Pseudogene. Similar to Bacteriophage BFK20
FT                   hypothetical 75.6 kDa protein TR:Q9MBK4 (EMBL:AJ278322)
FT                   (679 aa) fasta scores: E(): 6e-79, 40.76% id in 677 aa.
FT                   Presents a frameshift at residue 117"
FT                   /db_xref="PSEUDO:CAE48706.1"
FT   misc_feature    168319..168405
FT                   /note="ProfileScan hit to PS50312, Aspartic acid-rich
FT                   region."
FT   CDS_pept        168436..169686
FT                   /transl_table=11
FT                   /locus_tag="DIP0203"
FT                   /product="Putative phage protein"
FT                   /note="C-terminal region similar to Bacteriophage BFK20
FT                   putative portal protein TR:Q9MBK2 (EMBL:AJ278322) (215 aa)
FT                   fasta scores: E(): 1e-40, 56.45% id in 209 aa, and
FT                   N-terminal region to Bacteriophage BFK20 hypothetical 24.1
FT                   kDa protein TR:Q9MBK3 (EMBL:AJ278322) (213 aa) fasta
FT                   scores: E(): 3.8e-29, 41.79% id in 201 aa. Note: It seems
FT                   these two bacterophage proteins have been fused into
FT                   DIP0203"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK36"
FT                   /protein_id="CAE48707.1"
FT                   /translation="MGFLQRIGLLPQVTTTPTQHELLAPLLDTYIGVVTEMPTEELFAE
FT                   QPHLRTVTTFIARAISSTSLHVYRRDSDGGRHRVRDSDLAKLMRRSSKTELMQDMLNGS
FT                   ILDLCLYDEFIWVAMEDSDSGEWELHRIPPTWIKQRKHSDPWTLEWMGIIDAKTGQQIK
FT                   IPAERIIHVHGYNPTSTSRGLTPVVALRETLKEQLESAAYRGQLWRNGPRLGGVITRPK
FT                   DAKWDSTSRKRFKAAWQSQYSGRGSGAGGTPILEDGMQFVPAHLKAQDEQVVEMTKLSL
FT                   QTVASIYHVNPVMVGLLDNANYSNVREFRRSLYGDSLGPIIKQVEGVINEFLRPMIDDD
FT                   DAVYVEFNLDEKLRASFEEKAAVTSTAVGGPWMTRNEARAMNNLPAIDGGEDLITPLNV
FT                   TTENSESNNDVGLEEES"
FT   CDS_pept        169683..170726
FT                   /transl_table=11
FT                   /locus_tag="DIP0204"
FT                   /product="Putative phage prohead protease"
FT                   /note="C-terminal region similar to Bacteriophage BFK20
FT                   putative prohead protease TR:Q9MBK0 (EMBL:AJ278322) (204
FT                   aa) fasta scores: E(): 1.1e-35, 66.46% id in 164 aa, and
FT                   N-terminal region to Bacteriophage BFK20 hypothetical 18.4
FT                   kDa protein TR:Q9MBK1 (EMBL:AJ278322) (176 aa) fasta
FT                   scores: E(): 6.2e-14, 51.06% id in 94 aa. Note: It seems
FT                   these two bacterophage proteins have been fused into
FT                   DIP0204"
FT                   /db_xref="GOA:Q6NK35"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK35"
FT                   /protein_id="CAE48708.1"
FT                   /translation="MTIHVVIGPPCSGKSSFVEANAPAGIGRFDFDNIAGTVAGQDVKN
FT                   ASPNPVANAVLAMRRGLMGWLLDVELDPPEFWLINAQPSPALIAALSARGATFHLCDPG
FT                   MEECLARAARDGRPQSVEDRIRQWYDNPPELPTKGGHEVKTKSYDVSIDETQTEGTITA
FT                   YASVFGNVDSYGDVVIPGAFEETLGEWQKSGNTIPLLYGHDFKDPFSNIGGVTSAVEDA
FT                   HGLKITAQLDLDNPKARQVYNLLKAKRLSQMSFAFDVVEGSWGEREQQEVYELKKVKLY
FT                   EVSVVPIGANQETSIIDVKAVVAEELANMLDSRQLTKSISNKPPKQGAFALSALDAHLS
FT                   ILEKENR"
FT   misc_feature    169704..169727
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        170723..171973
FT                   /transl_table=11
FT                   /locus_tag="DIP0205"
FT                   /product="Putative phage capsid protein"
FT                   /note="Similar to Bacteriophage BFK20 putative major capsid
FT                   protein TR:Q9MBJ9 (EMBL:AJ278322) (428 aa) fasta scores:
FT                   E(): 5e-66, 47.14% id in 420 aa"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="PDB:2R9I"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK34"
FT                   /protein_id="CAE48709.1"
FT                   /translation="MNLKDLLAHRENLMDSAKRARSAITDDMDPADAAQAVENVKSIIS
FT                   EIESTDEAIAARRGVSDVTQKLKGLTITERGTENDSAASRSLGEHFVKAAGDRLKNQAA
FT                   GAHIEYSVPEYQVKEDAHSSPKDLVEGWGTFYQRGIINQRRERLVAADLMGAATVTAST
FT                   VKYIVEKANRIASGAPATVAEGTKKPYVKYADFDVVTESLSKVAALAKFTDEMIEDYDF
FT                   VASWINNNLVYDLSVVEEKQLINGDGRGSNIKGLLNREGIQTHKSAKQADWFNDLFKAK
FT                   NKVSQATNLEADGIMINPVNYEALRLTKDGNGQYIAGGPFQGQYGNGNILIDPPLWGIK
FT                   TVVSNAVPAGTAIVGAFRQGATVLRKGGVRVDSANTNADDFENNLVTLRAEERLGLMVP
FT                   LPAAFVKVTLEETTEEL"
FT   CDS_pept        171973..172173
FT                   /transl_table=11
FT                   /locus_tag="DIP0206"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK33"
FT                   /protein_id="CAE48710.1"
FT                   /translation="MRREYEATTPYGQKLTLEMSEDYKNAHWPDAVLLEDTWPAASSFE
FT                   AAETKRKTPTRNRAQKPEADK"
FT   CDS_pept        172195..172677
FT                   /transl_table=11
FT                   /locus_tag="DIP0207"
FT                   /product="Putative phage protein"
FT                   /note="Similar to Bacteriophage BFK20 hypothetical 19.9 kDa
FT                   protein TR:Q9MBJ8 (EMBL:AJ278322) (180 aa) fasta scores:
FT                   E(): 3.6e-16, 38.46% id in 156 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK32"
FT                   /protein_id="CAE48711.1"
FT                   /translation="MNAITPTPGIDKEAFDRAANAVRRLCGWHIFPIIEETITLDSPGD
FT                   SLLVLPTKHLVEIINVTIDGTTYPLSDFRSSPDGLLVKRHGRFPRGIAMVTVTMKHGYE
FT                   KPTEILGVINDMARRANESNLTQLNVGGISVGATNSATPQSSEWRIVDELRLGPLP"
FT   misc_feature    172195..172350
FT                   /note="ScanRegExp hit to PS00430, TonB-dependent receptor
FT                   proteins signature 1."
FT   CDS_pept        172674..173036
FT                   /transl_table=11
FT                   /locus_tag="DIP0208"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK31"
FT                   /protein_id="CAE48712.1"
FT                   /translation="MSIIFNQRIEIIRAGEKRSVYSSDVMEDWDNPVVLPVEVPVSIQP
FT                   VSSTESDATANRSYVTSRFRLFSPPGIDIPQLKAKDRVRIGLLVLDVVGDPARWPHPLK
FT                   PATVHHVEADLEVHRG"
FT   CDS_pept        173002..173295
FT                   /transl_table=11
FT                   /locus_tag="DIP0208A"
FT                   /product="Putative phage protein"
FT                   /note="Similar to Bacteriophage BFK20 hypothetical 10.2 kDa
FT                   protein TR:Q9MBJ7 (EMBL:AJ278322) (94 aa) fasta scores:
FT                   E(): 2.5e-07, 44.57% id in 83 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK30"
FT                   /protein_id="CAE48713.1"
FT                   /translation="MWKQIWRCIVGKYDKQFQQLNRNPKIAQALKNRAEKTRAAAQRIS
FT                   DAEGGTAHYRVVSGVRPGGRAYAYVVSDNRDEEFGTEKTKRIGALRRAARGG"
FT   CDS_pept        173285..173662
FT                   /transl_table=11
FT                   /locus_tag="DIP0209"
FT                   /product="Putative phage protein"
FT                   /note="Similar to Bacteriophage BFK20 hypothetical 13.7 kDa
FT                   protein TR:Q9MBJ6 (EMBL:AJ278322) (126 aa) fasta scores:
FT                   E(): 1.5e-11, 37.06% id in 116 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK29"
FT                   /protein_id="CAE48714.1"
FT                   /translation="MVDEKAVIISKLSKLGFPVYSELPHDFEEKHLPVLWVQHVGPAAR
FT                   RQAINSRGIDYVDLDIDLFVSLDMWHTGAAMELAQTIRTHMHRFREGMLKVLDTGRPEP
FT                   RPDFNSTIRRCGLTITVAVPA"
FT   CDS_pept        173691..174638
FT                   /transl_table=11
FT                   /locus_tag="DIP0210"
FT                   /product="Putative phage protein"
FT                   /note="N-terminal region similar to Bacteriophage BFK20
FT                   hypothetical 13.9 kDa protein TR:Q9MBJ5 (EMBL:AJ278322)
FT                   (125 aa) fasta scores: E(): 1.3e-21, 50% id in 116 aa, and
FT                   C-terminal region to Bacteriophage BFK20 hypothetical 14.9
FT                   kDa protein TR:Q9MBJ4 (EMBL:AJ278322) (145 aa) fasta
FT                   scores: E(): 3e-10, 37.85% id in 140 aa. Note: It seems
FT                   these two bacterophage proteins have been fused into
FT                   DIP0210"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK28"
FT                   /protein_id="CAE48715.1"
FT                   /translation="MTDFDIDTSAANYADELALLGVTGAMSYAPKGTQMPETIAPLNPP
FT                   FVDFGWLSDGGITESQNEERNDWTPFQSTNPIRGQVTKQDFQFKTVVWSISGLANAMYY
FT                   GVPESDMRFDQETGVTTFEQGKELPPDFKFGLVVDIVDGGKARRHCMPNVSVVERGDIV
FT                   YSKDDLVGYEMTFRASYDPVAGYAVRRMFKEGWKPGHAGTTLADENKDASLGDWSNTLD
FT                   ESEVRKQSKTVTLPKGATGGTFTVSINGKASAAINHDATGTAMKLVLNKVDGGESAKVT
FT                   GRAGGPYTITGVEGEITADGTNLTGSDTQDISIN"
FT   CDS_pept        174736..175113
FT                   /transl_table=11
FT                   /locus_tag="DIP0211"
FT                   /product="Putative phage protein"
FT                   /note="Similar to Bacteriophage BFK20 hypothetical 15.7 kDa
FT                   protein TR:Q9MBJ3 (EMBL:AJ278322) (138 aa) fasta scores:
FT                   E(): 3.2e-08, 37.09% id in 124 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK27"
FT                   /protein_id="CAE48716.1"
FT                   /translation="MTIDLNAMLAKRAEVLGEGNKFDVKLGNKTFYFVAPELASSEWND
FT                   RHQAFLEDIRDGLMTSATAREEFLGLALEDQAEEFAEAADNIGVDPFIIAQMAFQEHAE
FT                   YVGKTQSQKSLNRTQRRAKQR"
FT   CDS_pept        175275..175484
FT                   /transl_table=11
FT                   /locus_tag="DIP0211A"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK26"
FT                   /protein_id="CAE48717.1"
FT                   /translation="MMWEISNLIRITNFLLERSQAKNPNHVKAPKLKLYPWSPDQDIKH
FT                   YGKVDEEDQVDAVNFLLGLSPPPQ"
FT   CDS_pept        175497..181139
FT                   /transl_table=11
FT                   /locus_tag="DIP0212"
FT                   /product="immunity-specific protein Beta241"
FT                   /note="C-terminal region identical to Corynephage beta
FT                   immunity-specific protein Beta241 TR:Q37919 (EMBL:L04258)
FT                   (241 aa) fasta scores: E(): 3.1e-64, 100% id in 241 aa, and
FT                   whole length similar to Staphylococcus aureus subspaureus
FT                   Mu50 phi pvl ORF15 and 16 homologue SAV1955 TR:BAB58117
FT                   (EMBL:AP003364) (1509 aa) fasta scores: E(): 2.9e-19,
FT                   23.76% id in 1073 aa"
FT                   /db_xref="GOA:Q6NK25"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK25"
FT                   /protein_id="CAE48718.1"
FT                   /translation="MDSDATYVPILASFDGFFKSIDKNAEKAGQQAATTFAESMERNLQ
FT                   RAERAAEKAGTVFERAHNRAADAAAKTQIAELKLLEVKEKQGAKASEVAAAEAKVEKAR
FT                   RDQEAADKAVAKAAKSLASAQDDVAKATQQAGDAMEVNAEKAGLFSKMTGGLGDKLGAL
FT                   PALAAGAVAGFAGFVAIKETLLDVGSAFDSAYDTIRIGTGASGEAFAGLQQSMRNVAAN
FT                   NIGIGDDMEAVGTALADINTRLGLTGAPLEKMTAQMLQLQHMGVDADINAVSQALNGFG
FT                   IEADAMPAALDSLFQVSQATGLTITELSNSAVKAGPQLRQFGFSMADSAALVGQLDKAG
FT                   VNADGVLSKMSKALTTFAAEGKDAPKALNETITSIEQLVKAGNSQGAINLAEGIFGAKG
FT                   AEQFVDAVQTGTLSVEDFMSATGATNDTISGLAAETASFKEHWHQFKMQAMLAIEPVAT
FT                   AVFNMLTPAILNLKDGFTSAIEFVENTLVPGFKKIPDVLAVTAQWLDDNRNKLIALAVA
FT                   VSPIVVPFLVGLAAKWTAAGVAATVSAAKQAQAWVLTKIEAAQASAANIAALWTTGAGW
FT                   IKAGAQAILGAGQIAGAWLLTKAQSGVSIVASIAAVGIGWVTTGIQALAGAAQVAAAWV
FT                   IGLGPIAWVTAAIAAVGAGLVWFFTQTETGKQAWQSFTSALQAGWDLFSSALRTGWEML
FT                   KTAVFDAWTVRVETLKSVWEATTGAIGAGWEWLKGALYSGWMWISGNVIEGFKAGLSGL
FT                   RDFFSSVVNGIKSTWATLRSALAKPVNFMINTVYNGGILKAWNVIAGLLPGLKQGNPLA
FT                   GIPEHATGGRIAGPGTGTSDDVLMWGSNGEHMLTAKEVQRAGGHNAIYFMRDLIASRTP
FT                   FTWDGGRFIAEHRKSVNDYGSEVKRRGIGNVDDNGLFSMLPKFKDGGAIRPMWELQLEN
FT                   GHKAAKSRNGNPYTWGYEDCSGYMSAIADAILHGGRGRRAWATGSFPGGQPWAPGLGKG
FT                   FSVGVHDNPGGPGGGHTAGTLTGVGPYSTVNVESGGSHGTVAYGGPAIGADHAQFNGVR
FT                   PGRFHLAIGADGAFETAGSGGVSPQAQRSMIAKAFGGVISTVMDPIAAKLPSPPPAWQT
FT                   IPRGAYDSGKDALVKGVDNAVNSIEDSLATVYRGISKIPNLLKEKGPRGIEKKAKIYDR
FT                   GGILGHGEIAINHGAPERILPPALTASFDKFTTVVPQVADRFGIIADKLLGTKIRETPT
FT                   APGSLNAQVDMEKLNDQLSGLHSMADKVVPVLETVNAMGIEGLKGLTHITGAWKEYVSV
FT                   ENSVAKAAEDSKAANEALATARKELADLEREIAKKGPNAKGQAEDSKKLAEARKKVSDA
FT                   ESKAVDSSSALEKALGDVAVGQIKLALSVVSAIAEIGKAIAGAFTAVYEGQSRGWSLVS
FT                   QMAEEVEKGRQKLSEMRIENANLTIQQIKAINDLRIAQWDTHRAALNGALGIAQAQAEL
FT                   DKRRREGIMLGASGIDAMARAMDRYRKTGIFAIEEVTWYTEEQKRKIKAAEWKVHEARI
FT                   QSAIDQLDAQGKVELAGLAAAEATLKQHTAVRLLELSAQKLSAQAASFYGVTAQGATAL
FT                   ERMNQGKALQGKGAGSIFGGILKGLGGAAGGAAAGFALGGPVGALLGGIAGLLFGGAGQ
FT                   VMNGIAEIKQGRMQESTYKKYAEEELKKLPPEVQKEIHSAGVMGGIASFFGGNGAMIAS
FT                   TPFEAMKIKNQFATWDYEKKLQSMEHDSSIQKQLLATQRAQIEQRLAAQKAALEAERDA
FT                   AGYHAAAGEADNEGVRQAYDALAQDSARRARDLAETAQRGKSQLDEIVGRLKDLADRSA
FT                   ANIINQGINQTVVVKLEKTGRLHTDQDIAKALEETLNAVKGLEARVEMVEAARAPSALE
FT                   AAHSQL"
FT   misc_feature    175569..176033
FT                   /note="ProfileScan hit to PS50310, Alanine-rich region."
FT   misc_feature    order(177027..177086,177216..177284,177312..177380,
FT                   177399..177467)
FT                   /note="4 probable transmembrane helices predicted for
FT                   DIP0212 by TMHMM2.0"
FT   misc_feature    177084..177455
FT                   /note="ProfileScan hit to PS50310, Alanine-rich region."
FT   misc_feature    177252..177287
FT                   /note="ScanRegExp hit to PS00213, Lipocalin signature."
FT   misc_feature    178386..178703
FT                   /note="ProfileScan hit to PS50315, Glycine-rich region."
FT   misc_feature    180249..180422
FT                   /note="ProfileScan hit to PS50315, Glycine-rich region."
FT   CDS_pept        181149..181901
FT                   /transl_table=11
FT                   /gene="beta201"
FT                   /locus_tag="DIP0213"
FT                   /product="immunity-specific protein Beta201"
FT                   /note="Similar to the previously sequenced Corynephage beta
FT                   immunity-specific protein Beta201 TR:Q37920 (EMBL:L04258)
FT                   (201 aa) fasta scores: E(): 3.9e-64, 85.64% id in 202 aa.
FT                   Note: there is a frameshift in the already sequenced data
FT                   in from residue 167"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK24"
FT                   /protein_id="CAE48719.1"
FT                   /translation="MQVMFYSPSGQKLFGENGSPAFLLKGGITDLKGAIEARTTVIPEV
FT                   PGQVFDGVTIKPFTFGVTMVVYPTKEMPMEKAMRKTRQIFSAFDYSTCRIDGTGIPVGL
FT                   KVRLDSIISAPSQDTAKEIAEEITITLAADEGIFWADRKEASGKIDIVNYGDCDLWPEY
FT                   RWQKTTTITLPSGAKINLPETPTPRVLRTTRHQVSITDLDGKPDRELLKKLGTVWPEGV
FT                   PRKETKTYEITQNGYIMWRIGYLDPWGL"
FT   CDS_pept        181902..182762
FT                   /transl_table=11
FT                   /gene="beta286"
FT                   /locus_tag="DIP0214"
FT                   /product="immunity-specific protein Beta286"
FT                   /note="Almost identical to previously sequenced Corynephage
FT                   beta immunity-specific protein Beta286 TR:Q37921
FT                   (EMBL:L04258) (286 aa) fasta scores: E(): 1.1e-115, 99.65%
FT                   id in 286 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK23"
FT                   /protein_id="CAE48720.1"
FT                   /translation="MDVSQWEQFAKHRSAVIRDYGMWIGLMDNNMEPIVDMPAPVSIDA
FT                   PITRMTPSSCKAVFKTRVDGHIHPMVDYLIAENLAKVDEQGQLIAAAQDAVFLAIEVAQ
FT                   GIRNVYKGVFTVALGDQESPTLLEFNGVCEIQWTLGALPCPSAPYSWTGKWVDLNQDWA
FT                   GKWSKTRTMADIKVAEVADGFTLSGAADTTIGKLISQSLQAINTMLKSKGRSLPIAVKP
FT                   VTSNPTSPQLVIRPTDRFIWDEISDLALAAGVTVKCKTWWPSDPPVPGLDLKEPIVVIE
FT                   ITQEE"
FT   CDS_pept        182762..183877
FT                   /transl_table=11
FT                   /gene="beta371"
FT                   /locus_tag="DIP0215"
FT                   /product="immunity-specific protein Beta371"
FT                   /note="Almost identical to previously sequenced Corynephage
FT                   beta immunity-specific protein Beta371 beta371 TR:Q37922
FT                   (EMBL:L04258) (371 aa) fasta scores: E(): 9.9e-126, 89.75%
FT                   id in 371 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK22"
FT                   /protein_id="CAE48721.1"
FT                   /translation="MDPVIKLVAHAQEMSMTIPRRQACMVYGKLNVTLKKGDVQEERDK
FT                   RVTDGYVHIPEDMPQGRFDFGFTREDADVNIGTGQSTYELALDTAARRITGQVLFEQDI
FT                   IAPGFGDWRPLIDFSCGDLVGVRIWGKELVLPVTSITRETTGWRAHVGGQLINDRRKII
FT                   SENRKILADIESERRERMNEIGAISSVASAASVAAKDADAKAETADGKAEDALEKWRRQ
FT                   KDQLDKVQSDLIEKNTQWNRIQDRGLNELAAQQEAMKRYVDLSRPSSVTVSTWDPVWAG
FT                   PVQVSYPSRNQVELYLKHSPYIIGASVLGIARVNALSGYSFSFTADMTAGQTFTPQVGG
FT                   FESFNQVSVTVHPIVNFAAILSEERRKRGLQ"
FT   CDS_pept        183877..185304
FT                   /transl_table=11
FT                   /locus_tag="DIP0216"
FT                   /product="Putative phage tail fiber protein"
FT                   /note="Low similarity to N-terminal region of Bacteriophage
FT                   lambda side tail fiber protein Stf SW:STF_LAMBD (P03764)
FT                   (774 aa) fasta scores: E(): 0.0021, 24.28% id in 383 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK21"
FT                   /protein_id="CAE48722.1"
FT                   /translation="MPKLKGSLKNITDKPSTIREVLLRATHTRTNGKTITTSEPVRVKV
FT                   SESGDFTETLAPGAAVLVLVGADFMARESIPLLVAEGMTTIAEAMEAARDFTPDVHDRL
FT                   AELAAETQKNLEEARGVKAEADSATARMREAAQALKDSVDGSIAEATVGIKKSGSELLA
FT                   SMQALQSKAASSESEAKESAQGAEASRSAALASASSASSSAGEAAESLAGLRAKIEEWK
FT                   PHGEQLAQWQPQFEWLKENAASGFTKIAELMQDAAAGVRGELSGLVEQAKTAQTTAGQH
FT                   SLKAQAAAKDAESVANRVVDAAIAKLKGNAPAMLDTLEELAERVISGGTLETEILQKLS
FT                   KMADSDTVKKIVARLDGLTIAGVQGLSAALADKAAARHKHGTSDINGLDTELAGFKGAL
FT                   AEKAPRQHGHTLQEISGLSGAILNVRNELSQKASQQYVNSVETEAKRQYGRIKDISVVN
FT                   SLPASPDAGTIYLVKER"
FT   misc_feature    184135..184815
FT                   /note="ProfileScan hit to PS50310, Alanine-rich region."
FT   CDS_pept        185304..185978
FT                   /transl_table=11
FT                   /locus_tag="DIP0217"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK20"
FT                   /protein_id="CAE48723.1"
FT                   /translation="MIFYGSSKIKEVFYGDTRIKEVYAGADLVWKRITDTVKFANGGAV
FT                   DFRKAAPEGFKGYLYSDTIRADKDGFYDFHTTGPSGRLCLDDGHGEFAIIPLTRGNDGV
FT                   RVFVRHTDMITFRFNEKNIPITITAKPSTVNDPRRTVVLNYSSTDQIEDSGWGTAIPSA
FT                   RGRGVNLKPGRYWLTSSKSVYINDNWVRAPGGWVDFHSSARSNIRLYYRDVRAYLVPGQ
FT                   KL"
FT   CDS_pept        186059..187498
FT                   /transl_table=11
FT                   /locus_tag="DIP0218"
FT                   /product="Putative phage protein"
FT                   /note="C-terminal region similar to C-terminal region of
FT                   Mycobacteriophage TM4 GP29 TR:Q9ZX49 (EMBL:AF068845) (547
FT                   aa) fasta scores: E(): 3.7e-35, 49.14% id in 234 aa"
FT                   /db_xref="GOA:Q6NK19"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR015020"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK19"
FT                   /protein_id="CAE48724.1"
FT                   /translation="MNTVIDFSAGVPPAVEVKAAGHIGVMRYISPPRLSWMTAKPATRP
FT                   QIDRCRSAGVDVGFVWQYGGADNPDTMRGRTGGHADATSAQAKLIELGCPHHPVFFAVD
FT                   FDISLDQWNATAVHYFKAACEVLGRDRVGIYGHSRVISWAVEDQVIADLGGGKHLAWQT
FT                   PAWSMGERATEAVLYQGAANVKGPAGINIDVNEVLHHEWGQHPVGETRLEKSQEMELAM
FT                   KPNPNHRGDPLFLPDVLKAFGVKVQEWDGWRDRGHGDFTVIQGVFAHHTGTDKDIPGYI
FT                   ADHPELGLCSQIHLNRDGTAVIVGAGIAYHAGRGSYPGWPTDNANQVAIGIEAASSGTS
FT                   PWPPAQLDAYYRTCAAILWYLGKPATPQTLLGHKEYSGAAQGKWDPGGIDMNDFRRNVQ
FT                   HYIDNPPFLAADAAHITKEEDPMIQSLINPAKKFAQSTLISIVDATCWQILVLAKAIAK
FT                   KQGLDPDQILADAITADREGK"
FT   CDS_pept        187501..187824
FT                   /transl_table=11
FT                   /locus_tag="DIP0219"
FT                   /product="Putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="GOA:Q6NK18"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK18"
FT                   /protein_id="CAE48725.1"
FT                   /translation="MANTDIQIAVTRALESQSWWLRRKDSLTSGAGLVLHFANLIVALL
FT                   GDANPWVNVVVALVIGVAQLIIHAGTKGAITPSMVARIDNAAPTPPVFDLDQARDQLAA
FT                   PSE"
FT   misc_feature    order(187579..187638,187651..187710)
FT                   /note="2 probable transmembrane helices predicted for
FT                   DIP0219 by TMHMM2.0"
FT   CDS_pept        187830..188294
FT                   /transl_table=11
FT                   /locus_tag="DIP0220"
FT                   /product="Putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="GOA:Q6NK17"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK17"
FT                   /protein_id="CAE48726.1"
FT                   /translation="MPIEHLPPRVQPTARRVRAFLMTDSTALLLLAVVQAAMGLYYLPG
FT                   VLGDPLRWQRPVESIMPIIAWAWVHLAVGGLCAVAAVTDRWHVDIVALALATGLNLSWA
FT                   FSLLAASVEHNQSVLWLVGVLILAMTVSLMWAVWRGKRGDIPFAKEGGAA"
FT   misc_feature    order(187905..187973,188016..188078,188097..188165,
FT                   188175..188243)
FT                   /note="4 probable transmembrane helices predicted for
FT                   DIP0220 by TMHMM2.0"
FT   CDS_pept        188291..188629
FT                   /transl_table=11
FT                   /locus_tag="DIP0221"
FT                   /product="Putative secreted protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK16"
FT                   /protein_id="CAE48727.1"
FT                   /translation="MSVVAAFLSGVGALVTALGGVLIGVVKARSDTHTAKGSRMDVLEA
FT                   RIDKMQADLDDERARRRGVEVDNHRLRMALVTAVKHLEQLIRWADGGAKPPRPDDIDLD
FT                   EIKSLLKA"
FT   misc_feature    188291..188374
FT                   /note="Signal peptide predicted for DIP0221 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.930 between residues 28 and 29"
FT   misc_feature    188928..188946
FT                   /note="tox promoter, DtxR-regulated"
FT   CDS_pept        188979..190661
FT                   /transl_table=11
FT                   /gene="tox"
FT                   /locus_tag="DIP0222"
FT                   /product="Diphtheria toxin precursor"
FT                   /EC_number="2.4.2.36"
FT                   /note="Identical to previously sequenced Corynephage beta
FT                   diphtheria toxin precursor SW:DTX_CORBE (P00588) (567 aa)
FT                   fasta scores: E(): 6.2e-216, 100% id in 560 aa, and to
FT                   Corynephage omega diphtheria toxin precursor SW:DTX_COROM
FT                   (P00587) (560 aa) fasta scores: E(): 1.1e-215, 99.82% id in
FT                   560 aa. Note: The start codon for DIP0222 is 7 residues
FT                   downstream of the one in Corynephage beta"
FT                   /db_xref="GOA:Q6NK15"
FT                   /db_xref="InterPro:IPR000512"
FT                   /db_xref="InterPro:IPR022404"
FT                   /db_xref="InterPro:IPR022405"
FT                   /db_xref="InterPro:IPR022406"
FT                   /db_xref="InterPro:IPR036799"
FT                   /db_xref="InterPro:IPR036801"
FT                   /db_xref="PDB:5I82"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK15"
FT                   /protein_id="CAE48728.1"
FT                   /translation="MSRKLFASILIGALLGIGAPPSAHAGADDVVDSSKSFVMENFSSY
FT                   HGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNENPLSGKAGG
FT                   VVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSL
FT                   PFAEGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRRSVGS
FT                   SLSCINLDWDVIRDKTKTKIESLKEHGPIKNKMSESPNKTVSEEKAKQYLEEFHQTALE
FT                   HPELSELKTVTGTNPVFAGANYAAWAVNVAQVIDSETADNLEKTTAALSILPGIGSVMG
FT                   IADGAVHHNTEEIVAQSIALSSLMVAQAIPLVGELVDIGFAAYNFVESIINLFQVVHNS
FT                   YNRPAYSPGHKTQPFLHDGYAVSWNTVEDSIIRTGFQGESGHDIKITAENTPLPIAGVL
FT                   LPTIPGKLDVNKSKTHISVNGRKIRMRCRAIDGDVTFCRPKSPVYVGNGVHANLHVAFH
FT                   RSSSEKIHSNEISSDSIGVLGYQKTVDHTKVNSKLSLFFEIKS"
FT   misc_feature    188979..189053
FT                   /note="Signal peptide predicted for DIP0222 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.839 between residues 25 and 26"
FT   misc_feature    188979..190658
FT                   /note="BlastProDom hit to PD025441, PD025441"
FT   misc_feature    189054..189614
FT                   /note="HMMPfam hit to PF02763, Diphtheria toxin, C domain"
FT   misc_feature    189087..189143
FT                   /note="FPrintScan hit to PR00769, Diphtheria toxin
FT                   signature"
FT   misc_feature    189162..189230
FT                   /note="FPrintScan hit to PR00769, Diphtheria toxin
FT                   signature"
FT   misc_feature    189276..189344
FT                   /note="FPrintScan hit to PR00769, Diphtheria toxin
FT                   signature"
FT   misc_feature    189390..189452
FT                   /note="FPrintScan hit to PR00769, Diphtheria toxin
FT                   signature"
FT   misc_feature    189453..189521
FT                   /note="FPrintScan hit to PR00769, Diphtheria toxin
FT                   signature"
FT   misc_feature    189549..189617
FT                   /note="FPrintScan hit to PR00769, Diphtheria toxin
FT                   signature"
FT   misc_feature    189651..190190
FT                   /note="HMMPfam hit to PF02764, Diphtheria toxin, T domain"
FT   misc_feature    189867..189926
FT                   /note="FPrintScan hit to PR00769, Diphtheria toxin
FT                   signature"
FT   misc_feature    189954..190022
FT                   /note="FPrintScan hit to PR00769, Diphtheria toxin
FT                   signature"
FT   misc_feature    190035..190106
FT                   /note="FPrintScan hit to PR00769, Diphtheria toxin
FT                   signature"
FT   misc_feature    190149..190211
FT                   /note="FPrintScan hit to PR00769, Diphtheria toxin
FT                   signature"
FT   misc_feature    190194..190655
FT                   /note="HMMPfam hit to PF01324, Diphtheria toxin, R domain"
FT   tRNA            190709..190788
FT                   /gene="tRNA-Arg"
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:190749..190751,aa:Arg)"
FT                   /note="tRNA Arg anticodon ACG, Cove score 23.44"
FT   misc_feature    190792..208253
FT                   /note="Anomalous G+C content (56.92%) and G/C deviation.
FT                   Putative pathogenicity island. Not present in C.glutamicum"
FT   CDS_pept        190816..190992
FT                   /transl_table=11
FT                   /locus_tag="DIP0223"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK14"
FT                   /protein_id="CAE48729.1"
FT                   /translation="MGWGFFACLVRAGAPFPARPFSRLLELKNTKTAGSENLLKVPPLG
FT                   FRVLEFEFADFGG"
FT   CDS_pept        191070..191210
FT                   /transl_table=11
FT                   /locus_tag="DIP0224"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK13"
FT                   /protein_id="CAE48730.1"
FT                   /translation="MPKLFGRFGISAGWRYKKWFNLARTTHLPSKVSHPEEFLAQLVWM
FT                   R"
FT   CDS_pept        191220..192626
FT                   /transl_table=11
FT                   /locus_tag="DIP0225"
FT                   /product="Putative secreted polysaccharide deacetylase"
FT                   /note="N-terminal region similar to Mycobacterium
FT                   tuberculosis CDC1551 polysaccharide deacetylase, putative
FT                   MT1128 TR:AAK45386 (EMBL:AE006993) (291 aa) fasta scores:
FT                   E(): 2.1e-22, 42.43% id in 205 aa"
FT                   /db_xref="GOA:Q6NK12"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK12"
FT                   /protein_id="CAE48731.1"
FT                   /translation="MNSVHFRRHTSRTRRISIFLAACLLATGCITGCTISTPNTPVSES
FT                   DSSTSSSQSSQDVELTVDAASGMVSTNSPQLPIHVQWPVLEGHEKLSEAIAVWAEGEAR
FT                   EFIGEYGPREVNPSELNGSGEQVRDGDVVAMRLTLEEFGGANAASMSRMFFSSGDRVWQ
FT                   GPDVIAQDRRVDAARAVLDQLGDRVASGVSADEVAGIPNLFGDVLVEGDVVHVRLPQAS
FT                   VLASSEGIVEVDIPAEGLLSQNGKRLLPPAPVPPPMPQLPQVQSRGAEPVDCSVLKCVA
FT                   LTFDDGPGPYTSQILDTLDSHGVKATFFEIATAIPRFPEVVRRQVASGMEVGSHTVTHR
FT                   QLPLLPLAEQQQEADGASDRLAEAGAPRPVMMRPPYGAWNQDTKRLGYSLILWNVDSED
FT                   WKNRDAQVTTNNIMAQVRPGSIVLMHDIHPSTAEALPGIIDRLKEQGYTLVTVSQLLGQ
FT                   TVPGEVYYGR"
FT   misc_feature    191220..191354
FT                   /note="Signal peptide predicted for DIP0225 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.633 between residues 45 and 46"
FT   misc_feature    192045..192467
FT                   /note="HMMPfam hit to PF01522, Polysaccharide deacetylase"
FT   CDS_pept        complement(192614..193987)
FT                   /transl_table=11
FT                   /locus_tag="DIP0226"
FT                   /product="Putative GntR-family regulator"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   GntR-family regulator SC5G8.04 TR:Q9KZB0 (EMBL:AL353872)
FT                   (462 aa) fasta scores: E(): 8.4e-38, 36.46% id in 458 aa"
FT                   /db_xref="GOA:Q6NK11"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK11"
FT                   /protein_id="CAE48732.1"
FT                   /translation="MRPDLVTNLPITLNRTSTDPIPTQIADHIRTLVGRGLLKPGDHVP
FT                   STRALSTQLDISRGSAVTAYEQLLAEGFLIAARGSGTCINPDLTPTPPPAHSPTPPPEP
FT                   PAIDLTPGLPDTTTLANSSWRAAWRIACTQPPAHTPPQGLLHLREQVADHLRRMRAVVA
FT                   SPDHIIITAGAREGFSLILHALGQDLRVGVESPGYPSLRRVPEALGSTTVPLPTDNDGL
FT                   ITHDLPDLDAILVTPSHQYPHGGSLPAYRRTQLTTWANRTAGLIIEDDFDSELRHIGQP
FT                   LPALFALAPQRTALLGTFSSVISPQVSCGYIVAPPHLVPHLIELRTIFGNTASGITQEA
FT                   LAQYLSTGALRRRTQNLRRTYRRRRDTVISTLGSIPGTTLSPIVGGLHAVLTCTRPEAD
FT                   ILQRCRQRGIIVEGLSNYWSQHPDSDLSNGIVIGFGSHDDTTLTEALHHLAWAVNYRP"
FT   misc_feature    complement(192665..192694)
FT                   /note="ScanRegExp hit to PS00758, ArgE / dapE / ACY1 / CPG2
FT                   / yscS family signature 1."
FT   misc_feature    complement(193646..193732)
FT                   /note="ProfileScan hit to PS50099, Proline-rich region."
FT   misc_feature    complement(193736..193915)
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family"
FT                   /note="HMMSmart hit to SM00345, helix_turn_helix gluconate
FT                   operon transcriptional repressor, DNA-binding"
FT   misc_feature    complement(193766..193816)
FT                   /note="FPrintScan hit to PR00035, GntR bacterial regulatory
FT                   protein HTH signature"
FT   misc_feature    complement(193784..193858)
FT                   /note="ScanRegExp hit to PS00043, Bacterial regulatory
FT                   proteins, gntR family signature."
FT   misc_feature    complement(193814..193858)
FT                   /note="FPrintScan hit to PR00035, GntR bacterial regulatory
FT                   protein HTH signature"
FT   CDS_pept        194078..194971
FT                   /transl_table=11
FT                   /locus_tag="DIP0227"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Corynebacterium glutamicum pyridoxine
FT                   biosynthesis enzyme CGL0788 SWALL:Q8NS91 (EMBL:AP005276)
FT                   (317 aa) fasta scores: E(): 1e-93, 91.21% id in 296 aa, and
FT                   to Mycobacterium tuberculosis hypothetical 31.4 kDa protein
FT                   Rv2606c or MT2681 or MTCY1A10.27 SW:YQ06_MYCTU (O06208)
FT                   (299 aa) fasta scores: E(): 2.5e-82, 80.41% id in 291 aa"
FT                   /db_xref="GOA:P60800"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60800"
FT                   /protein_id="CAE48733.1"
FT                   /translation="MTQETFTATTRVKRGLADMLKGGVIMDVVTPEQARIAEDAGASAV
FT                   MALERVPADIRAQGGVARMSDPDLIEGIVNAVSIPVMAKARIGHFVEAQILESLGVDFI
FT                   DESEVLSPADYVNHIDKWNFDVPFVCGATNLGEALRRITEGAAMIRSKGEAGTGDVSEA
FT                   VKHLRTIRGEINRLRSMDEDQLYVAAKEIQAPYDLVREVAATGKLPVTLFVAGGVATPA
FT                   DAALVMQMGAEGVFVGSGIFKSGNPAARAAAIVKATTMYDDPAAIAEVSRGLGEAMVGI
FT                   NVADVPAPHRLAERGW"
FT   misc_feature    194102..194722
FT                   /note="BlastProDom hit to PD004958, PD004958"
FT                   /note="HMMPfam hit to PF01680, SOR/SNZ family"
FT   misc_feature    194699..194806
FT                   /note="ProfileScan hit to PS50264, Proteins binding FMN and
FT                   related compounds (core region profile)."
FT   CDS_pept        194965..195522
FT                   /transl_table=11
FT                   /locus_tag="DIP0228"
FT                   /product="Putative amidotransferase"
FT                   /note="Similar to Streptomyces coelicolor hypothetical 21.5
FT                   kDa protein SCl2.12c TR:Q9L287 (EMBL:AL137778) (202 aa)
FT                   fasta scores: E(): 2.5e-29, 49.45% id in 182 aa, and to
FT                   Mycobacterium tuberculosis CDC1551 amidotransferase,
FT                   putative MT2679 TR:AAK46995 (EMBL:AE007101) (198 aa) fasta
FT                   scores: E(): 1.5e-26, 47.54% id in 183 aa"
FT                   /db_xref="GOA:Q6NK10"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NK10"
FT                   /protein_id="CAE48734.1"
FT                   /translation="MVIGVLTLQGGFAEHIAILESLGVEHRRVRVPNDLLGLDGLIIPG
FT                   GESTVMDKLARAFDLAEPLRAAINNGLPVFATCAGLIYLGTVENPAKGQQTLGCLDVVV
FT                   RRNAFGRQVDSFDAVVDVEGIDANVAFIRAPEVISCGAGVTVTARVGDHVVGVRQGKIH
FT                   AYAFHPESAGEVRLHQAWLASI"
FT   misc_feature    194977..195516
FT                   /note="HMMPfam hit to PF01174, SNO glutamine
FT                   amidotransferase family"
FT   CDS_pept        complement(195519..195686)
FT                   /transl_table=11
FT                   /locus_tag="DIP0229"
FT                   /product="Putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="GOA:Q6NK09"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK09"
FT                   /protein_id="CAE48735.1"
FT                   /translation="MDRSEEKVFEESTVVWQWWMWAIVAAAALVLILLAWWLRKNSRKA
FT                   QRSNLTQRSN"
FT   misc_feature    complement(195576..195632)
FT                   /note="1 probable transmembrane helix predicted for DIP0229
FT                   by TMHMM2.0"
FT   CDS_pept        complement(join(196003..196275,196395..196721,
FT                   196723..196977))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="DIP0230"
FT                   /product="IS element transposase (pseudogene)"
FT                   /note="Pseudogene. Similar to Shigella flexneri putative
FT                   transposase for IS110 S0128 TR:Q9AFS5 (EMBL:AF348706) (398
FT                   aa) fasta scores: E(): 5.4e-25, 34.75% id in 328 aa.
FT                   Presents frameshifts at residues 85 and 194 and lacks stop
FT                   codon"
FT   misc_feature    complement(196006..196233)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02371, Transposase
FT                   IS116/IS110/IS902 family"
FT   misc_feature    complement(196873..196950)
FT                   /note="ScanRegExp hit to PS00217, Sugar transport proteins
FT                   signature 2."
FT   CDS_pept        complement(197202..197330)
FT                   /transl_table=11
FT                   /locus_tag="DIP0232"
FT                   /product="Putative exported protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK08"
FT                   /protein_id="CAE48737.1"
FT                   /translation="MPGALINIMSSSSSQASTTRRLTATAAVTLATAPAFAAPVTL"
FT   misc_feature    complement(197226..197330)
FT                   /note="Signal peptide predicted for DIP0232 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.638) with cleavage site
FT                   probability 0.563 between residues 35 and 36"
FT   CDS_pept        complement(197338..198327)
FT                   /transl_table=11
FT                   /locus_tag="DIP0233"
FT                   /product="Putative fimbrial associated sortase-like
FT                   protein"
FT                   /note="Similar to Actinomyces naeslundii putative fimbrial
FT                   associated protein TR:O05996 (EMBL:U85709) (280 aa) fasta
FT                   scores: E(): 4.5e-16, 40.000% id in 215 aa, and to
FT                   Staphylococcus aureus sortase SrtA TR:Q9S446
FT                   (EMBL:AF162687) (206 aa) fasta scores: E(): 1.2, 26.923% id
FT                   in 156 aa. Note: Also similar to DIP0236 (312 aa) E():
FT                   5.7e-25; 45.342% identity in 322 aa overlap, DIP2224,
FT                   DIP2012 and DIP2225"
FT                   /db_xref="GOA:Q6NK07"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK07"
FT                   /protein_id="CAE48738.1"
FT                   /translation="MTDQPPTPNTADATPPRQDKKLNTNAIIAVVLILAGLGVLLYPVL
FT                   ATQWNNYQQSRAAEAYSQLEKGVPPEVLNKAWEEAQQYNANLGDIDPGDAWTSSDDESS
FT                   SAYQRYLNYLSALNETEAMGRIVLPSIKSDLPIFHGTSDRVLARGVGHLYGTDLPVGAP
FT                   GELGEDGVIPPAPPEGRLSALSAHTGLQNATLWDNLIQIKKGDPVYVAAAGEKLKYEVR
FT                   NIEVVTPDKTSLLRRTSNKDQVTLITCTPYGINTHRLIITAERVPMDPQGESAFDGQGT
FT                   TWQWWMWAILAAAAIIVLLLIRWWWKNFRKQEGEEGPTTSGAGGTTES"
FT   misc_feature    complement(order(197410..197475,198181..198246))
FT                   /note="2 probable transmembrane helices predicted for
FT                   DIP0233 by TMHMM2.0"
FT   CDS_pept        198371..198847
FT                   /transl_table=11
FT                   /locus_tag="DIP0234"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK06"
FT                   /protein_id="CAE48739.1"
FT                   /translation="MWRVGVYSSLRGYKRLNFCCEMLIAAYPKVGECAREGLMDKEVCI
FT                   NAAKGRFLGLRLPELFGGSDMRLNRSCRRRNMKLAAWCMLIQCDSRGGNHAAEVREIGD
FT                   ITKIAICQQCDFECAGPSANFKVTRLQGLRTLKAANRSESLNVEGCYALQSLLM"
FT   CDS_pept        198862..200334
FT                   /transl_table=11
FT                   /locus_tag="DIP0235"
FT                   /product="Putative fimbrial subunit"
FT                   /note="Similar to Actinomyces viscosus type-1 fimbrial
FT                   major subunit precursor FimP TR:Q9X4D1 (EMBL:AF106034) (535
FT                   aa) fasta scores: E(): 6.9e-16, 31.5% id in 530 aa. Note:
FT                   Contains a potential sortase anchor site (LTMPG) upstream
FT                   of the C-terminal region transmembrane domain"
FT                   /db_xref="GOA:Q6NK05"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="PDB:4HSQ"
FT                   /db_xref="PDB:4HSS"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK05"
FT                   /protein_id="CAE48740.1"
FT                   /translation="MKKNSLTIRSVTFAAVAGLSLGISAPGAVAIAEEGTQVQQTQRAN
FT                   IDFERKGSLTLHKKKGAESEKRATGKEMDDVAGEPLNGVTFKITKLNFDLQNGDWAKFP
FT                   KTAADAKGHETSTTKEVETSGNGTAVFDNLDLGIYLVEETKAPDGIVTGAPFIVSIPMV
FT                   NEASDAWNYNVVAYPKNTETKTEKTVKDADQNIQDAYTYTIKADAPTWGKDKKLTAFRF
FT                   EDELDKRLDFQKVTEVKAGDTVLGTSDYTVNDPATDGNKLVVTLTDEGLKKVKSGDKMS
FT                   LTFEVKRKEVGNTTELKNRADVIFNNPNTDKEVKNKTNEVVTYHGKLKVVKKDGKEAGK
FT                   VLKGAEFELYQCTSAAVLGKGPLTVDGVKKWTTGDDGTFTIDGLHVTDFEDGKEAAPAT
FT                   KKFCLKETKAPAGYALPDPNVTEIEFTRAKISEKDKFEGDDEVTLVSEIKNIKQGTPKL
FT                   PMTGGAGVGILAAIGAAIVAAGAWFARRGAKN"
FT   misc_feature    198862..198957
FT                   /note="Signal peptide predicted for DIP0235 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.832 between residues 32 and 33"
FT   misc_feature    200233..200247
FT                   /note="potential sortase anchor site LPMTG"
FT   misc_feature    200233..200250
FT                   /note="ScanRegExp hit to PS00343, Gram-positive cocci
FT                   surface proteins 'anchoring' hexapeptide."
FT   misc_feature    200245..200313
FT                   /note="1 probable transmembrane helix predicted for DIP0235
FT                   by TMHMM2.0"
FT   CDS_pept        200435..201373
FT                   /transl_table=11
FT                   /locus_tag="DIP0236"
FT                   /product="Putative fimbrial associated sortase-like
FT                   protein"
FT                   /note="Similar to Actinomyces naeslundii putative fimbrial
FT                   associated protein TR:O68213 (EMBL:AF019629) (365 aa) fasta
FT                   scores: E(): 1.2e-31, 42.802% id in 257 aa, and to
FT                   Staphylococcus aureus sortase SrtA TR:Q9S446
FT                   (EMBL:AF162687) (206 aa) fasta scores: E(): 0.094, 27.559%
FT                   id in 127 aa. Note: Also similar to DIP0233 (329 aa) E():
FT                   5.2e-25; 45.031% identity in 322 aa overlap. Note: Also
FT                   similar to DIP2012, DIP2224 and DIP2225"
FT                   /db_xref="GOA:Q6NK04"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK04"
FT                   /protein_id="CAE48741.1"
FT                   /translation="MDHTLSTDVEPEKEPRRANSAKTSPVLAAVLVILGVLVMLYPVTS
FT                   TLWNNHLATKAAQEYAKLEKNAPQEVKNTQWERAHEYNENRTTGPIFDPWLARFDENNS
FT                   DYQEYLDQLDANDAMARLIFPKIKADLPIFHGTDNDTLQKGLGHLFGSDLPVGGKGMHS
FT                   VITGHTGLANSTMFDHLNKAEKGDTFYVQVSGEKLKYVVDQIKVVLPTETEDLRPEQGK
FT                   DYITLITCTPYGINTHRLMVRGHQVPLAPEDHEVFDKNHGAGWQWWMYTLLAAAAVVLL
FT                   LLLRWLLKNKRDGESQETTEMMNDEGAGADD"
FT   misc_feature    order(200510..200578,201230..201298)
FT                   /note="2 probable transmembrane helices predicted for
FT                   DIP0236 by TMHMM2.0"
FT   CDS_pept        201366..202157
FT                   /transl_table=11
FT                   /locus_tag="DIP0237"
FT                   /product="Putative surface anchored protein"
FT                   /note="No significant database matches. Note: Contains a
FT                   potential sortase anchor site (LALTG) upstream of the
FT                   C-terminal region transmembrane domain"
FT                   /db_xref="GOA:Q6NK03"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK03"
FT                   /protein_id="CAE48742.1"
FT                   /translation="MTSHARAVRTSRRLVAAIALSAGLLGGAYGAVGVADAAKVAGLSD
FT                   QPGVSRDYGTDTLSITLSPGNGDPVNPATGKVAGVTIKLQRLQGIDPENAADQAKVRNT
FT                   SADKIAGWPTDRTIKAVTNEAGQVRFQGLEKGIYLVTSQAPAGAAAGEYREISPFLVAV
FT                   PFHTVADNPRPVEGVIVAKTNSTVPPTTPPWTPPTTPSTPPPGHTPPLRETPGSGDEKE
FT                   REQGDLALTGVQIIGLVLAAVALMGAGLLMLLITKKRKQEG"
FT   misc_feature    201366..201476
FT                   /note="Signal peptide predicted for DIP0237 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.607 between residues 37 and 38"
FT   misc_feature    201927..202010
FT                   /note="ProfileScan hit to PS50099, Proline-rich region."
FT   misc_feature    202047..202061
FT                   /note="potential sortase anchor site LALTG"
FT   misc_feature    202062..202130
FT                   /note="probable transmembrane helix predicted for DIP0237
FT                   by TMHMM2.0"
FT   CDS_pept        202163..205282
FT                   /transl_table=11
FT                   /locus_tag="DIP0238"
FT                   /product="Putative surface-anchored fimbrial subunit"
FT                   /note="weak similarity to Actimomyces fimbrial associated
FT                   protein. Note: Contains a potential sortase anchor site
FT                   (LPKTG) upstream of the C-terminal region transmembrane
FT                   domain"
FT                   /db_xref="GOA:Q6NK02"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK02"
FT                   /protein_id="CAE48743.1"
FT                   /translation="MKTKFMGVAAALTAALALVFGVAAPGALPSLPVATAQAQDRSFTV
FT                   TSQQRYEQKGTRFIPNYKIPADQLSGGTITLGAGTVVTLESSIRFYLAPNDADFTVYYT
FT                   GTDGNWYETKATYKKVSVKKYEVTLPEITIGGAAEIEFKGVHRGPPNTVISAKFDVVGG
FT                   TTQPEPEPDPAPEPQPAPEPEPGTSVNPAAPTAVDPATAPSCVEKGYINIPDTKGVDYF
FT                   IGGELKHAGQHFYEGQKASVKVTAKPQNGYQFAAGAKTEWSFDFSGEVKDCSDSSEDPK
FT                   PAAVEGRHFDAIGHEFAVEADPVDPTKPNAFTAKVTAESHMKYATVRIETDATFLDPQK
FT                   YNLTLDQIEPGVTLQKRNVNIGNGFITMDVVPVKDGKPVDSAVVPKDAVFTFTNNLSEN
FT                   KNLKIALDVYGANKSTPKPPDIISPPDGAQWVHGRVPNPPMPKRCGLRIAVVADLSTSL
FT                   KYADSNGFDESKKAANALIDSLAGTPAELGIYNFAGGAPRNPAGSTYGQNPPYISLQSD
FT                   DGVSRAKSIVSNWNGNGSTNWEAGLKQVAAGNYDVVYFITDGMPTYSSKAPQLGLGGEF
FT                   VQESALNQAIDAANELKAAGTRVVPIMVDLTVGGKNAQHTTVTQDLVLKNVRFWKRGTS
FT                   NSEPGLYFQFTNKYVDAASYVGDDTTANFEIAYKNGGFKVWERTSRGRNIDVTRDQSKW
FT                   TYGPREVKTMGEDISGTGDTIRVEQYSQLAAQMKKIGEELALRCNGVVKVKKRIVDENG
FT                   RAIEDGVPGWEFTLSAGGQDIIDPGNGDRVRKSLKATSSANEDRGTASWNIMSEQEQQL
FT                   TLVETQQPGFNLYKRNDKNAVCTETRDGVMKPIEVTNDGEFGFKVKMRAKDKKLSSVSC
FT                   VVDNYKQPETPPGKLTFKKAQYNGDKIEEIPGLGGATFEIYPSKGDQPDYSAEALYTIK
FT                   PGQESIEVKTTGTFFLVETKAPKGLNLLAQPVKFEISVDETTKKYKISVGSTSSGQVQA
FT                   KGEGDKMILTVADTTAGELPKTGGYGVGLVGLIGVALAGAGFLLGRRKTA"
FT   misc_feature    202163..202276
FT                   /note="Signal peptide predicted for DIP0238 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.912 between residues 38 and 39"
FT   misc_feature    202661..202771
FT                   /note="ProfileScan hit to PS50099, Proline-rich region."
FT   misc_feature    204530..204574
FT                   /note="ScanRegExp hit to PS00678, Trp-Asp (WD) repeats
FT                   signature."
FT   misc_feature    205184..205198
FT                   /note="potential sortase anchor site LPKTG"
FT   misc_feature    205184..205201
FT                   /note="ScanRegExp hit to PS00343, Gram-positive cocci
FT                   surface proteins 'anchoring' hexapeptide."
FT   misc_feature    205196..205264
FT                   /note="probable transmembrane helix predicted for DIP0238
FT                   by TMHMM2.0"
FT   stem_loop       205348..205392
FT   CDS_pept        complement(join(205490..205561,205575..205949))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="DIP0239"
FT                   /product="Putative surface-anchored protein (pseudogene)"
FT                   /note="Pseudogene. No database matches. Note: Contains a
FT                   potential sortase anchor site (LPSTG). Presents a
FT                   frameshift at residue 125"
FT                   /db_xref="PSEUDO:CAE48744.1"
FT   misc_feature    complement(205505..205519)
FT                   /note="potential sortase anchor site LPSTG"
FT   misc_feature    complement(205581..205646)
FT                   /note="1 probable transmembrane helix predicted for DIP0239
FT                   by TMHMM2.0"
FT   CDS_pept        complement(205903..206310)
FT                   /transl_table=11
FT                   /locus_tag="DIP0240"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK01"
FT                   /protein_id="CAE48745.1"
FT                   /translation="MSRRSLRCRRRPLQLGAVEPALVGEKRTLSARYEVSAGFPEGAKV
FT                   IFRANGVRVGTAQTDAEGNASVEYVFDQAGLQKITAEVREREVDGRIFSKAEAEAEPFE
FT                   VLSAGEVETGTRLTLEDDSVDLDATPLPDPR"
FT   CDS_pept        complement(206336..206485)
FT                   /transl_table=11
FT                   /locus_tag="DIP0241"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NK00"
FT                   /protein_id="CAE48746.1"
FT                   /translation="MIRGVFFNGDEEIGHAKTSNGVAELQTIVPDEAATLQLSAVVEDF
FT                   ENDT"
FT   CDS_pept        complement(206740..207051)
FT                   /transl_table=11
FT                   /locus_tag="DIP0242"
FT                   /product="Putative IS element transposase"
FT                   /note="Similar to Burkholderia cepacia insertion element
FT                   IS401 hypothetical 12.4 kDa protein SW:YISX_BURCE (Q51647)
FT                   (107 aa) fasta scores: E(): 1.6e-06, 36.78% id in 87 aa"
FT                   /db_xref="GOA:Q6NJZ9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJZ9"
FT                   /protein_id="CAE48747.1"
FT                   /translation="MVRTYSPAFREAAVRMMISHREEYKCSRWAAAVAISEKIGASPNS
FT                   IYAWFKKSTFETIESDDFDLAYYKERIERLESEIQRLQKTIKFLRTTIIILSNSLHFG"
FT   CDS_pept        complement(207298..207492)
FT                   /transl_table=11
FT                   /locus_tag="DIP0243"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJZ8"
FT                   /protein_id="CAE48748.1"
FT                   /translation="MLPPVVPTSLAAENTRTQSCAIATSNVEYKKYVKAYSFMCISYKD
FT                   DDVVVEVTFFEISYWYFSG"
FT   CDS_pept        complement(207638..208117)
FT                   /transl_table=11
FT                   /locus_tag="DIP0244"
FT                   /product="Putative exported protein"
FT                   /note="No significant database matches. Possible secreted
FT                   protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJZ7"
FT                   /protein_id="CAE48749.1"
FT                   /translation="MRMKVTYNYNIQCCLTAAAKAFALFLFAIPPASAQPSGITSIIRW
FT                   PVGTSDNFSSATRYRNSAWAVQQHLAGSDYLTVQLGDRQATFTRSAARLLLLGALMLGE
FT                   ATHFEPAIGTAIDHAISQGRPYNFTLSDEELIRNWGTPQRLETAHKPRPNRGTIP"
FT   misc_feature    complement(208016..208117)
FT                   /note="Signal peptide predicted for DIP0244 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.996 between residues 34 and 35"
FT   CDS_pept        complement(208253..209263)
FT                   /transl_table=11
FT                   /locus_tag="DIP0245"
FT                   /product="Putative prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551
FT                   prephenate dehydrogenase MT3861 TR:AAK48225 (EMBL:AE007181)
FT                   (323 aa) fasta scores: E(): 5.5e-49, 52.31% id in 281 aa,
FT                   and to Bacillus subtilis prephenate dehydrogenase TyrA
FT                   SW:TYRA_BACSU (P20692) (372 aa) fasta scores: E(): 2.7e-15,
FT                   31.9% id in 279 aa"
FT                   /db_xref="GOA:Q6NJZ6"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJZ6"
FT                   /protein_id="CAE48750.1"
FT                   /translation="MTINEVSRPVCVLGLGLIGGSLLRALRHKGVPAFGFNRSPSAARI
FT                   ATKEGFDVSSSLIQTLERAEAENALIVLATPMPAIASLLDALQEHAPSCGFTDVVSVKE
FT                   AVYDLVKSRGLQSRYVGGHPMAGTANSGWEASYPELFVRAPWVVTYDFAPEADAEWVGL
FT                   WTDVVNMAGTVGAEVIPARVEAHDAAVARISHLPHVFAEALAIVGDNGGALALSLAAGS
FT                   FRDSTRVAGSAPSLVRAMCETNAQALLGALDEALTLLNDARAHLTEAHPNLEELIDAGY
FT                   RSRVRFEARSGGNASESVGPTKISNRPVFRFHPGSDGWIAQLKQAEGLGARIEIF"
FT   misc_feature    complement(208412..209230)
FT                   /note="HMMPfam hit to PF02153, Prephenate dehydrogenase"
FT   CDS_pept        209301..209753
FT                   /transl_table=11
FT                   /locus_tag="DIP0246"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   17.9 kDa protein Rv3753c or MTV025.10c TR:O69720
FT                   (EMBL:AL022121) (166 aa) fasta scores: E(): 1e-20, 45.57%
FT                   id in 147 aa"
FT                   /note="Conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJZ5"
FT                   /protein_id="CAE48751.1"
FT                   /translation="MKSNFAVTVARVNATWQVRAFNDDYSSLKRSIDAVRTLGAEGAAF
FT                   AMLSIEDDYFVLVRPTPQGVKLLISDATAATEDDFAADILDELDADQPDPEDTPYAEGD
FT                   FDILADLGLSEQIMSIITDETDWWASEQLQRIAEELGFDDELEQAL"
FT   misc_feature    209774..210082
FT                   /note="HMMPfam hit to PF00383, Cytidine and deoxycytidylate
FT                   deaminase zinc-binding region"
FT   CDS_pept        209792..210235
FT                   /transl_table=11
FT                   /locus_tag="DIP0247"
FT                   /product="Putative cytosine deaminase"
FT                   /EC_number="3.5.4.12"
FT                   /note="Similar to Bifidobacterium longum cytosine deaminase
FT                   TR:Q9F9W7 (EMBL:AF160969) (143 aa) fasta scores: E():
FT                   1.2e-28, 53.47% id in 144 aa, and to Mycobacterium
FT                   tuberculosis CDC1551 cytidine and deoxycytidylate deaminase
FT                   family protein MT3859 TR:AAK48223 (EMBL:AE007181) (152 aa)
FT                   fasta scores: E(): 6.9e-28, 53.47% id in 144 aa"
FT                   /db_xref="GOA:Q6NJZ4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJZ4"
FT                   /protein_id="CAE48752.1"
FT                   /translation="MMREAITLAHTTPPADIPVGAIIYGPDGTILGRGTNRRETDHNPL
FT                   GHAEIMAITQACTQRGDGWRLTDCTLAVTLEPCTMCAGALVGSRIGHIIFGAYEPKTGA
FT                   CGSAFDVVRDPAVLHTVQVRGGILEAECAELMTNFFGGLRTEA"
FT   misc_feature    209930..210046
FT                   /note="ScanRegExp hit to PS00903, Cytidine and
FT                   deoxycytidylate deaminases zinc-binding region signature."
FT   tRNA            210284..210371
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:210318..210320,aa:Ser)"
FT                   /note="tRNA Ser anticodon CGA, Cove score 55.08"
FT   stem_loop       210438..210539
FT                   /note="Score 58: 22/24 (91%) matches, 0 gaps"
FT   CDS_pept        210640..211152
FT                   /transl_table=11
FT                   /locus_tag="DIP0248"
FT                   /product="Putative excisionase"
FT                   /note="Similar to Arthrobacter spTM1 putative excisionase
FT                   TR:Q9LCU5 (EMBL:AF042490) (174 aa) fasta scores: E():
FT                   4.4e-21, 41.07% id in 168 aa"
FT                   /db_xref="GOA:Q6NJZ3"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJZ3"
FT                   /protein_id="CAE48753.1"
FT                   /translation="MSLSERTYFPPAEEGELSKVESFLAVYKDRHGTEARPQFFLSGSN
FT                   EGEQIPLPKELYEILVRTVEALASGKAVTIHPNDPLVTTQQAAELLGVSRPTVVKLIED
FT                   GKLEATKVTRHRRIKLEDVLRYQERQTIEQLDFLASTTSDAPALTESEYVSVRKMLANK
FT                   RKESRIG"
FT   misc_feature    210883..210948
FT                   /note="Predicted helix-turn-helix motif with score 1896
FT                   (+5.64 SD) at aa 82-103, sequence VTTQQAAELLGVSRPTVVKLIE"
FT   CDS_pept        211399..211599
FT                   /transl_table=11
FT                   /locus_tag="DIP0249"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJZ2"
FT                   /protein_id="CAE48754.1"
FT                   /translation="MSSLCQNFLAFAAFPQVGNIRNGLIWHELLIPPAEPREPREPAEP
FT                   PKPANPNQGLHWKTISRSLVV"
FT   CDS_pept        211613..213949
FT                   /transl_table=11
FT                   /locus_tag="DIP0250"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative membrane
FT                   transport protein sce87.17C TR:Q9RKC1 (EMBL:AL132674) (745
FT                   aa) fasta scores: E(): 2.9e-36, 42.48% id in 798 aa"
FT                   /db_xref="GOA:Q6NJZ1"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJZ1"
FT                   /protein_id="CAE48755.1"
FT                   /translation="MAAFLYRVGAWSFRAKWFVIVTWLVVLAAVGGAAAAFQAGFNDLF
FT                   TINNTPAKTATEIYLENFPEQRNPLKSTGVNIVFKAPEGHTLAEPENKAAMDSVVQAIQ
FT                   DNLEGLTNTQRFGNPVELNPKLQQGVIDLMTQRGVPEENARADAANLSLITPDETIGYT
FT                   TFDIDVPMPADVSDAQRQAITDAMNLGREKGLTVEAGGAGFGDPIVIEETSEIIGVAIA
FT                   AIILIFTFGSLVAAGLPLLIAVIGVGIGSLSITLATAWVSLNNVTPVLAVMLGLAVGID
FT                   YSLFIMFRYRRELLHLDKEQAAGMAVGTAGSAVVFAGLTVIIALVALAVANIPFLTYMG
FT                   LAAAFTVFIAVLIALTMVPALLGALGDKAFAVRLRRKRRTSPARTLGRKWGELVHRAPG
FT                   VVIAVSVVTLGALTLPALQLHLSLPSDTQASYSSTQRKQAEIMAEGFGPGINSPFLVVA
FT                   DAHSVDENAEILEPLIRAQNPAPGERKQAAANAAYQYIIQKYSVTPDVKHVQIVGLSKD
FT                   GLAAQLLLTPESSPEDDVTKQLIDALLIKQDEVNNATGIRSGITGLIPVQQDVTNRLAG
FT                   VMPLYLGIVVGLAVLLLMIVFRSIWVPVVAGVGFLLSVGAAFGVTVLFWQEGLWGLVDT
FT                   PSPIIAFMPIFLIGVCFGLAMDYQVFLVSAMRERFVHGRIDATSRYNAIEESIVEGFAS
FT                   SVRVVTAAALIMIAVFVAFIGQPIPFIKIFGFALGAGVLFDAFFIRMAFVPAAMFLLGR
FT                   QTWYMPHWLDKVLPRLDVEGTSLER"
FT   misc_feature    211613..211720
FT                   /note="Signal peptide predicted for DIP0250 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.939) with cleavage site
FT                   probability 0.419 between residues 36 and 37"
FT   misc_feature    order(211661..211729,212258..212326,212330..212398,
FT                   212408..212476,212537..212605,212642..212710,
FT                   212801..212869,213332..213400,213419..213487,
FT                   213530..213598,213704..213772,213800..213868)
FT                   /note="12 probable transmembrane helices predicted for
FT                   DIP0250 by TMHMM2.0"
FT   misc_feature    212246..212317
FT                   /note="FPrintScan hit to PR00702, Acriflavin resistance
FT                   protein family signature"
FT   misc_feature    212309..212704
FT                   /note="ProfileScan hit to PS50156, Sterol-sensing domain
FT                   (SSD) profile."
FT   misc_feature    212405..212479
FT                   /note="FPrintScan hit to PR00702, Acriflavin resistance
FT                   protein family signature"
FT   misc_feature    212627..212698
FT                   /note="FPrintScan hit to PR00702, Acriflavin resistance
FT                   protein family signature"
FT   repeat_region   214119..214410
FT                   /note="repX"
FT   CDS_pept        214616..215908
FT                   /transl_table=11
FT                   /locus_tag="DIP0251"
FT                   /product="Putative tRNA-ribosyltransferase"
FT                   /note="Similar to Archaeoglobus fulgidus putative queuine
FT                   tRNA-ribosyltransferase Tgt or AF1485 SW:TGT_ARCFU (O28787)
FT                   (403 aa) fasta scores: E(): 8.6e-40, 40.78% id in 407 aa,
FT                   and to Escherichia coli queuine tRNA-ribosyltransferase Tgt
FT                   or B0406 or Z0505 or ECS0457 SW:TGT_ECOLI (P19675) (375 aa)
FT                   fasta scores: E(): 4.5e-13, 37.68% id in 406 aa"
FT                   /db_xref="GOA:Q6NJZ0"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJZ0"
FT                   /protein_id="CAE48756.1"
FT                   /translation="MTDTTFELRTELDDAPGRHGRTGVIHTPHGDINTPAFIPVATKAT
FT                   VKTLTPQQIRDTGAQAILSNAYHLYLQPGPDIVDEAGGVSKFENWHGPTYTDSGGFQVM
FT                   SLGVGFKKVLAMDTAGLVEGDIRAPKKDRYAQVDEDGVDFRSVIDGSRHRFTPEVSMQI
FT                   QHRLGADIIFAFDELTTLVDTRQYQESSVERTHRWARRCLIEHDRLTREREGKPLQSLW
FT                   GVVQGAQYEDLRRQAVRGLLDLDKEAEDNGRRGFGGFGIGGALEKENLGTIVGWVCDEI
FT                   PQHKPRHLLGISEPDDLFTAIEAGADTFDCVAPTRLGRRGGVYTLDGRVNLTAARFKRD
FT                   FRQVDEEFGGPIAEYSRAYIHHLFKAKEFLGGTLCTMHNVAFMIQLVDNIRSAINNGDF
FT                   EAYRDEFLGRYYASKGGPAAAGRSGGMIYGV"
FT   misc_feature    215087..215839
FT                   /note="HMMPfam hit to PF01702, Queuine
FT                   tRNA-ribosyltransferase"
FT   CDS_pept        215918..216811
FT                   /transl_table=11
FT                   /locus_tag="DIP0252"
FT                   /product="Putative glutamyl-tRNA synthetase"
FT                   /note="Similar to Escherichia coli glutamyl-tRNA synthetase
FT                   GltX or B2400 SW:SYE_ECOLI (P04805) (471 aa) fasta scores:
FT                   E(): 1.6e-25, 35.38% id in 260 aa"
FT                   /db_xref="GOA:Q6NJY9"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NJY9"
FT                   /protein_id="CAE48757.1"
FT                   /translation="MGTFQGAGRYAPSPSGDLHFGNVRTAVLAWLFARHTGRRFLIRVE
FT                   DVDTQRSSLESAARQLEDLHALGMDWDAAPTYQHNNFDRYEQALRNLPHYECYCSRKDI
FT                   QEASRAPHTIPGQYPGTCRNLTEVQREERRQALAKQGRVPALRLRADVPTWHVRDYYAG
FT                   DVLGDVDDMILRRGGQQPDWAYNLAVVVDDAADGIDQVVRGNDLLTSAPRQAYLAHLLG
FT                   VPAPTYVHVPLVLNAAGQRLAKRDGAVTMREMPDILPRVAESLGLSARTLPGMLEEFDP
FT                   DRFSQQPWIFAIHKEV"
FT   misc_feature    215942..215980
FT                   /note="FPrintScan hit to PR00987, Glutamyl-tRNA synthetase
FT                   signature"
FT   misc_feature    215942..216172
FT                   /note="HMMPfam hit to PF00749, tRNA synthetases class I (E
FT                   and Q)"
FT   misc_feature    215984..216019
FT                   /note="FPrintScan hit to PR00987, Glutamyl-tRNA synthetase
FT                   signature"
FT   misc_feature    216029..216070
FT                   /note="FPrintScan hit to PR00987, Glutamyl-tRNA synthetase
FT                   signature"
FT   misc_feature    216464..216496
FT                   /note="FPrintScan hit to PR00987, Glutamyl-tRNA synthetase
FT                   signature"
FT   misc_feature    216470..216667
FT                   /note="HMMPfam hit to PF00749, tRNA synthetases class I (E
FT                   and Q)"
FT   misc_feature    216512..216538
FT                   /note="FPrintScan hit to PR00987, Glutamyl-tRNA synthetase
FT                   signature"
FT   CDS_pept        216891..218279
FT                   /transl_table=11
FT                   /gene="gntP"
FT                   /locus_tag="DIP0253"
FT                   /product="gluconate permease"
FT                   /note="Similar to Corynebacterium glutamicum gluconate
FT                   permease GntP TR:Q9AL75 (EMBL:AJ296014) (463 aa) fasta
FT                   scores: E(): 2.9e-113, 69.34% id in 460 aa, and to Bacillus
FT                   subtilis gluconate permease GntP SW:GNTP_BACSU (P12012)
FT                   (448 aa) fasta scores: E(): 4.8e-53, 38.58% id in 451 aa"
FT                   /db_xref="GOA:Q6NJY8"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJY8"
FT                   /protein_id="CAE48758.1"
FT                   /translation="MEDWVPTLSAGPLLGIAAAAIALILVLVIVFKLHAFLTLIIVSAA
FT                   TGLAAGIPLEGIVPTMTKGFGSTLASVALLVGLGAMLGRLVETSGGAKSLAETLVARFG
FT                   EQRAPFALGVASLLMGFPIFFDAGLIVMLPVIFAVARRLNGPVLAYGIPAAGAFSVMHI
FT                   YLPPHPGPISAAEFYSADIGLVMLLGLIIAIPTWLISGLWLGKTLGRRYPLPVPDILAG
FT                   GPQATDVKNPATPGLIVSLLLLPMLLIFGNTSMGLATSAGWVDKSSSLVRALQFVGSTP
FT                   IALLISTLVALYFLGIRRGQPKADLEKLLDGALGPICSVVLITGAGGMFGGVLRTSGIG
FT                   DALADSMSDLGVPVVLGCWLVAAILRLAQGSATVALTTAAALMAPAVAAGGYSEFQIAL
FT                   MVLASAAGSVFAGHVNDSGFWLVGRLMGMDVATTLRTWTLNQALVGAVGFVFVLVFYGV
FT                   SFAF"
FT   misc_feature    216891..217022
FT                   /note="Signal peptide predicted for DIP0253 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.635) with cleavage site
FT                   probability 0.357 between residues 44 and 45"
FT   misc_feature    order(216915..216983,216993..217061,217080..217148,
FT                   217242..217310,217323..217391,217434..217502,
FT                   217599..217667,217710..217778,217815..217883,
FT                   217926..217985,218004..218063,218091..218159,
FT                   218196..218264)
FT                   /note="13 probable transmembrane helices predicted for
FT                   DIP0253 by TMHMM2.0"
FT   misc_feature    216921..218264
FT                   /note="HMMPfam hit to PF02447, GntP family permease"
FT   CDS_pept        complement(218276..218779)
FT                   /transl_table=11
FT                   /locus_tag="DIP0254"
FT                   /product="Putative transferase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   gluconokinase SCI52.21 TR:Q9AD88 (EMBL:AL590507) (175 aa)
FT                   fasta scores: E(): 4.2e-33, 60.39% id in 154 aa, and to
FT                   Escherichia coli thermosensitive gluconokinase IdnK or GntV
FT                   or B4268 SW:IDNK_ECOLI (P39208) (187 aa) fasta scores: E():
FT                   3e-20, 44.15% id in 154 aa"
FT                   /db_xref="GOA:Q6NJY7"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJY7"
FT                   /protein_id="CAE48759.1"
FT                   /translation="MSTAVKVVVMGVSGSGKTTVGTLLAERLGVEYRDGDDLHSQANIE
FT                   KMASSIPLNDDDRWPWLAQVGEWLAAQLAGGVIGCSALKRSYRDVLRRECPEVVFVHVY
FT                   GSREVLLERMNHREGHFMPASLLDSQFATLQPLENDEVGHVFDVTDSPAQIADAAARWL
FT                   SERS"
FT   misc_feature    complement(218726..218749)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        complement(218871..219080)
FT                   /transl_table=11
FT                   /locus_tag="DIP0255"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No strong consensus RBS usptream. No
FT                   significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJY6"
FT                   /protein_id="CAE48760.1"
FT                   /translation="MDALRLLGCCGFRAHFRLLELTNTKTAGRDFRAEMPSLGFRVLEF
FT                   EKADTSRQVRTNLTPQRSPTKHIL"
FT   misc_feature    complement(218934..218990)
FT                   /note="ScanRegExp hit to PS00179, Aminoacyl-transfer RNA
FT                   synthetases class-II signature 1."
FT   stem_loop       complement(218937..219032)
FT                   /note="Score 69: 35/44 (79%) matches, 0 gaps"
FT   tRNA            complement(219137..219222)
FT                   /gene="tRNA-Ser"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:219186..219188,aa:Ser)"
FT                   /note="tRNA Ser anticodon GGA, Cove score 51.87"
FT   CDS_pept        219238..219384
FT                   /transl_table=11
FT                   /locus_tag="DIP0256"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No strong consensus RBS usptream. No
FT                   significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJY5"
FT                   /protein_id="CAE48761.1"
FT                   /translation="MPCYFANNTHASVDQANPQEDGEWVVVELLRGGGSVRLGAGLRMA
FT                   RIP"
FT   CDS_pept        219574..220833
FT                   /transl_table=11
FT                   /locus_tag="DIP0257"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551
FT                   conserved hypothetical protein MT3825 TR:AAK48194
FT                   (EMBL:AE007179) (435 aa) fasta scores: E(): 5.2e-94, 55.95%
FT                   id in 420 aa"
FT                   /db_xref="GOA:Q6NJY4"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024551"
FT                   /db_xref="PDB:3D6K"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJY4"
FT                   /protein_id="CAE48762.1"
FT                   /translation="MSLKDYDAARLAQVREEVTAKYAELKAKNLSLDLTRGKPSAEQLD
FT                   LSNDLLSLPGGDFRTKDGVDCRNYGGLLGIADIRELWAEALGLPADLVVAQDGSSLNIM
FT                   FDLISWSYTWGNNDSSRPWSAEEKVKWLCPVPGYDRHFTITEHFGFEMINVPMTDEGPD
FT                   MGVVRELVKDPQVKGMWTVPVFGNPTGVTFSEQTCRELAEMSTAAPDFRIVWDNAYALH
FT                   TLSDEFPIVHNVIEFAQAAGNPNRFWFMSSTSKITHAGSGVSFFASSKENIEWYASHAN
FT                   VRGIGPNKLNQLAHAQFFGDVAGLKAHMLKHAASLAPKFERVLEILDSRLSEYGVAKWT
FT                   SPTGGYFISVDVVPGTASRVVELAKEAGIALTGAGSSFPLHNDPNNENIRLAPSLPPVA
FT                   ELEVAMDGFATCVLMAALEV"
FT   CDS_pept        220837..221388
FT                   /transl_table=11
FT                   /locus_tag="DIP0258"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJY3"
FT                   /protein_id="CAE48763.1"
FT                   /translation="MNFDETAVWLDGVFPGELTIHSAPAESFRVGTADLGDDMLATTLD
FT                   FARVDTGLEAGGRDVRSEIFTVAHAGVGTEKFVELLRTLGTLLYDASGSLPAQPGQLVP
FT                   AVGIEPFDGTDITVRHGLFVVPYVWGGEVPQCDEPDRLTVMLQLVMLTQEEFDYAVTYG
FT                   IPELQSEIARSGIDLLDWSR"
FT   CDS_pept        221399..223522
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /gene_synonym="dnaZX"
FT                   /locus_tag="DIP0259"
FT                   /product="DNA polymerase III subunit gamma/tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="Similar to Mycobacterium tuberculosis DNA polymerase
FT                   III subunit gamma/tau DnaX or DnaZX or Rv3721c or MT3824 or
FT                   MTV025.069c SW:DP3X_MYCTU (O69688) (578 aa) fasta scores:
FT                   E(): 7.5e-72, 53.57% id in 573 aa, and to Bacillus subtilis
FT                   DNA polymerase III subunit gamma/tau DnaX or DnaH
FT                   SW:DP3X_BACSU (P09122) (563 aa) fasta scores: E(): 1.5e-29,
FT                   31.22% id in 570 aa"
FT                   /db_xref="GOA:Q6NJY2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJY2"
FT                   /protein_id="CAE48764.1"
FT                   /translation="MALYRKYRPASFAEVVGQEQVTQPLSVALDSGRINHAYLFSGPRG
FT                   CGKTSSARIMARSLNCVEGPTSTPCGKCNSCISLAPNGPGNLDVTELDAASNRSVDDMR
FT                   ELRDRAMYAPAESRYRIFIIDEAHMITRDGANALLKIVEEPPAHLIFIFATTEPEKILP
FT                   TIRSRTHHYPFRLLTPQSMRGLLERTVASEHVAVEDSVYPLVIRAGGGSPRDTLSILDQ
FT                   LIAGAGPDGLDYNLARMLLGATDDTLIDTTIDALAGNDNAALFQVVDDAIEAGLDPRRF
FT                   ATDLLDRFRDLMVLQSVPDALTLGLVDAPTDRGDILRDQATHLPAGEAARLAALVNDGL
FT                   RGLKGATSPRLLLEILCAKMLLPSAQPAATATAPAAAAPAPAPTEIPAKYERRSVRLAR
FT                   EAAARKNAEAPAPEPAPEPKPEPKPEPRDGFATIQEKWATISDVIFKANSVAGILLSQA
FT                   TLLGLRDDSTLVIGHNTGALAHRINDPQHAGSIVTAIKQETDLDVTIECVVGTDPKAAG
FT                   FSEPENKKVWNPEPKPEPKPEPKPEPKPEPEPAPASDNVWGAPAPLGGGQPATPPPPPV
FT                   ERFSPAKATAPQPPAAPQPVQEAPKPRWQQAAERGMRKMEERAKRPSFSDGVPLPPEPE
FT                   EPDVPPDLYGYPADEGIPEPQTPQATSNYVVDHDEEEEMVREAAQGVGNRDHRDAMTVA
FT                   VDILSEELGARQL"
FT   misc_feature    221498..221929
FT                   /note="HMMSmart hit to SM00382, ATPases associated with a
FT                   variety of cellular activities"
FT   misc_feature    221507..222085
FT                   /note="HMMPfam hit to PF00004, ATPase family associated
FT                   with various cellular activities (AAA)"
FT   misc_feature    221522..221545
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    221843..222082
FT                   /note="ProfileScan hit to PS50150, Replication factor C
FT                   conserved domain."
FT   misc_feature    222491..222643
FT                   /note="ProfileScan hit to PS50310, Alanine-rich region."
FT   misc_feature    222626..222664
FT                   /note="FPrintScan hit to PR01217, Proline rich extensin
FT                   signature"
FT   repeat_region   222632..222679
FT                   /note="4x PEP(A/K/R)"
FT   misc_feature    222947..223012
FT                   /note="FPrintScan hit to PR01217, Proline rich extensin
FT                   signature"
FT   repeat_region   222983..223030
FT                   /note="4x PEPK"
FT   misc_feature    222983..223372
FT                   /note="ProfileScan hit to PS50099, Proline-rich region."
FT   misc_feature    223019..223069
FT                   /note="FPrintScan hit to PR01217, Proline rich extensin
FT                   signature"
FT   misc_feature    223106..223183
FT                   /note="FPrintScan hit to PR01217, Proline rich extensin
FT                   signature"
FT   CDS_pept        223595..223915
FT                   /transl_table=11
FT                   /locus_tag="DIP0260"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium tuberculosis protein
FT                   Rv3716c or MT3819 or MTV025.064c SW:Y1B6_MYCTU (O69683)
FT                   (133 aa) fasta scores: E(): 2.7e-14, 54.16% id in 96 aa"
FT                   /db_xref="GOA:Q6NJY1"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NJY1"
FT                   /protein_id="CAE48765.1"
FT                   /translation="MTQPDMSQILAQAQQMQAKLQEAQREILATTVTGTAGNGLVSIDM
FT                   QGNGMVSSVTIDPKVVDADDVETLQDLLVGAFAEAHEKLGTLAEQKMGPLSQGFDGLGG
FT                   MF"
FT   misc_feature    223601..223885
FT                   /note="HMMPfam hit to PF02575, Uncharacterized BCR, YbaB
FT                   family COG0718"
FT   CDS_pept        223919..224575
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="DIP0261"
FT                   /product="recombination protein"
FT                   /note="Similar to Mycobacterium tuberculosis recombination
FT                   protein RecR or Rv3715c or MT3818 or MTV025.063C
FT                   SW:RECR_MYCTU (O69682) (203 aa) fasta scores: E(): 1.1e-33,
FT                   62.38% id in 218 aa, and to Streptomyces coelicolor
FT                   recombination protein RecR or SC66T3.29c SW:RECR_STRCO ()
FT                   (199 aa) fasta scores: E(): 5.7e-28, 55.04% id in 218 aa"
FT                   /db_xref="GOA:Q6NJY0"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NJY0"
FT                   /protein_id="CAE48766.1"
FT                   /translation="MFEGPLQDLIDEFSRLPGVGPKSAQRIAFHLLHVEPADITRLQDA
FT                   LGAIRDGVTFCRICCNISREEVCRICADSSRDRSTICVVEEPKDIQVIERTGEYTGRYH
FT                   VLGGSLDPLANIGPRELNISQLLQRIGGVLPDRELADSTPETPLYDASPEVREVILATD
FT                   PNTEGEATASYLARLLRDFPDLVVSRLASGMPLGGDLEFVDELTLSRALSGRLTL"
FT   misc_feature    224027..224152
FT                   /note="HMMPfam hit to PF02132, RecR protein"
FT   misc_feature    224084..224149
FT                   /note="ScanRegExp hit to PS01300, RecR protein signature."
FT   misc_feature    224153..224470
FT                   /note="HMMSmart hit to SM00493, No definition"
FT   misc_feature    224153..224497
FT                   /note="HMMPfam hit to PF01751, Toprim domain"
FT   CDS_pept        complement(224581..225333)
FT                   /transl_table=11
FT                   /locus_tag="DIP0262"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551
FT                   cobyric acid synthase MT3816 TR:AAK48185 (EMBL:AE007178)
FT                   (231 aa) fasta scores: E(): 1.3e-31, 58.13% id in 246 aa,
FT                   and to Streptomyces coelicolor hypothetical 26.2 kDa
FT                   protein 2SCG58.13 TR:Q9FCA0 (EMBL:AL391017) (242 aa) fasta
FT                   scores: E(): 6.6e-20, 42.85% id in 252 aa"
FT                   /db_xref="GOA:Q6NJX9"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJX9"
FT                   /protein_id="CAE48767.1"
FT                   /translation="MSELTIGLILPDVLGTYGDDGNALVLRQRARLRGISAEIHTVRLG
FT                   EAVPEGLDLYCLGGGEDTAQILAAEHLNNDRGLRRAADSGRPILGICAGLQVLGRSFRA
FT                   SGKIVEGVGLIDATTASLAKRTIGELQSTPTAAGFTAELTEPLTGFENHMGATILGPDA
FT                   QPLGAVTRGVGNTDLHGITTASVSDEQVSYEGAVQGNVVCTYMHGPALARNPQLADLLL
FT                   AKAMGIALADLAPLDLPVVDQLRKERLA"
FT   misc_feature    complement(224584..225315)
FT                   /note="HMMPfam hit to PF01656, Cobyrinic acid a,c-diamide
FT                   synthase"
FT   CDS_pept        complement(225335..226597)
FT                   /transl_table=11
FT                   /locus_tag="DIP0263"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   43.4 kDa protein Rv3712 or MTV025.060 TR:O69679
FT                   (EMBL:AL022121) (413 aa) fasta scores: E(): 2.3e-86, 59.95%
FT                   id in 412 aa, and to Streptomyces coelicolor putative
FT                   ligase 2SCG58.12 TR:Q9FCA1 (EMBL:AL391017) (412 aa) fasta
FT                   scores: E(): 4.3e-59, 43.03% id in 409 aa"
FT                   /db_xref="GOA:Q6NJX8"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJX8"
FT                   /protein_id="CAE48768.1"
FT                   /translation="MSFNLRTRLAIGAAAVATTASRATGRGSGGMIGGLIAEKIDPNIM
FT                   QSLAKTRPTALVTGTNGKSTTTRMLASAVRAQHTVATNEGGDNMDAGIISALMAGQSAS
FT                   HVVLEVDELHVPSAADRLHPQCLILLNLTRDQLDRVGEINKIERALRDCVTAHPDMTVI
FT                   ANCDDVLVTSVAYDAPNVVWVSAGAGWTGDSVSCPRTGSHIVRQDDHWYATKPLPNGET
FT                   FQRPTPAWTITPDGILTPGHAEPVPLSLALPGNANRGNATQAIAAAVTCFNVPLDDAVR
FT                   AVETVDDVAGRYSTITLGEHQIHLLLAKNPAGWQEALSMVDRTAEGLVIAVNGQVADGE
FT                   DLSWLWDVKFEELEELSVKAAGERGTDLSVRLTYASVDHELVRDPLAAIKACPAGRVEV
FT                   LANYTAFRDLKRAITAATKEA"
FT   misc_feature    complement(226193..226429)
FT                   /note="HMMPfam hit to PF01225, Mur ligase family, catalytic
FT                   domain"
FT   CDS_pept        complement(226618..227739)
FT                   /transl_table=11
FT                   /locus_tag="DIP0264"
FT                   /product="Putative helicase"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551 DNA
FT                   polymerase III, epsilon subunit MT3814 TR:AAK48182
FT                   (EMBL:AE007178) (329 aa) fasta scores: E(): 1.3e-07, 25.37%
FT                   id in 335 aa, and to Bacillus subtilis probable
FT                   ATP-dependent helicase DinG homolog SW:DING_BACSU (P54394)
FT                   (931 aa) fasta scores: E(): 0.48, 24.07% id in 108 aa"
FT                   /db_xref="GOA:Q6NJX7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJX7"
FT                   /protein_id="CAE48769.1"
FT                   /translation="MNVSLPTRPPARLFPMTNKDQEERDKARAQRAAEQAAARKAEIEK
FT                   APYVALSVQASGIHPSTSRLVTIDAVTFTEQGEEVDHFFAVLNPESNPGPFHLHGLSPE
FT                   QIQEGKRYSQILKALDRLIDGRTLLVHNAELVWGFIVSESKRAMSNAARANRSRSRQRN
FT                   RRRQRVGHIPKPVTIVDTLATARRLGLTFADIRIRNVATQLGLEAPDARASVARAQADT
FT                   AQLTREDTLLVARMFFVEHAQGAVSSTSPADLRADRFGLQRSNVRVDAMEVPRVWENPG
FT                   VYTKERGLVQGMEVVVAPEITMDPDRIIQAIVRTELAYNEKITRASSLVVCNKREDLTG
FT                   KAMHGDRKGIPLMTDEEFLRAVEHVKPGKPAET"
FT   CDS_pept        complement(227743..228507)
FT                   /transl_table=11
FT                   /locus_tag="DIP0265"
FT                   /product="Putative nitroreductase"
FT                   /note="Similar to Escherichia coli oxygen-insensitive NADPH
FT                   nitroreductase NfsA or MdaA or Mda18 or B0851 SW:NFSA_ECOLI
FT                   (P17117) (240 aa) fasta scores: E(): 2e-23, 36.32% id in
FT                   223 aa"
FT                   /db_xref="GOA:Q6NJX6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJX6"
FT                   /protein_id="CAE48770.1"
FT                   /translation="MKASMNETIRTQLNHRTIREFSTEQVSEEIMEQLFAVAGRTATSL
FT                   GMQSTSIIRVTDPQLRVRLAEIGAQEYVGRAPIYLLFIVDCHRNAGILQELGADPAGAA
FT                   TARNFVQGFTDACLTAQNVCIAAESMGLGVNFLGNVHNDAAAVIELLQLPELTFPVVGM
FT                   TLGWPNQEPQLKPRMATPLRTMENGYHAPDSWLEALSDYDQEMTTYYDLRDANRRVDSF
FT                   TRQVLAKNPAAGADSDKRNHTFAIARDQGFNL"
FT   misc_feature    complement(227983..228489)
FT                   /note="HMMPfam hit to PF00881, Nitroreductase family"
FT   CDS_pept        complement(228555..230372)
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="DIP0266"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="Similar to Corynebacterium glutamicum
FT                   2-isopropylmalate synthase LeuA SW:LEU1_CORGL (P42455) (616
FT                   aa) fasta scores: E(): 2.5e-205, 83.27% id in 604 aa"
FT                   /db_xref="GOA:Q6NJX5"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJX5"
FT                   /protein_id="CAE48771.1"
FT                   /translation="MTSPDTFISAPAAIVTPRGDKAPGQAPWNTQRNSSMAVNRYQPFH
FT                   VEVENIDLPDRTWPQKRITKAPQWCAVDLRDGNQALIDPMSPERKRRMFNLLVNMGYKE
FT                   IEVGFPSASQTDFDFVREIIENNMIPNDVTIQVLVQAREHLIRRTFEACEGAKNVIVHF
FT                   YNSTSILQRDVVFRKDKAAIKKLATDAAELIKSIAVDYPDTNWRWEYSPESYTGTELTY
FT                   AKEVVDAVVAVMDPTPENPIIINLPSTVEMITPNVYADGIEWMHRNLNRRDSIILSLHP
FT                   HNDRGTGVAAAELGYLAGADRIEGCLFGNGERTGNVCLVTLGLNMFTQGVDPQIDFSDI
FT                   DQIRRTVEYCNQLRVPERHPYGGDLVFTAFSGSHQDAVNKGLDAMASRVHPGATHTEVS
FT                   WDELRGETWEVPYLPIDPKDVGRNYEAVIRVNSQSGKGGVAYIMKTDHGLALPRPMQVE
FT                   FSSIVQEVTDAEGGEVNSKNMWDIFAREYLDSTSPVEQVSMSVNAAETENDEARIHARL
FT                   IVNGSETTIEGHGNGPIAAYANALESLGIDVEVQEYEQHARTAGDDAEAAAYILAEVNG
FT                   KKFWGVGIAGSITYASLKAITSAVNRALS"
FT   misc_feature    complement(229284..230156)
FT                   /note="HMMPfam hit to PF00682, HMGL-like"
FT   misc_feature    complement(229503..229544)
FT                   /note="ScanRegExp hit to PS00816, Alpha-isopropylmalate and
FT                   homocitrate synthases signature 2."
FT   misc_feature    complement(230103..230153)
FT                   /note="ScanRegExp hit to PS00815, Alpha-isopropylmalate and
FT                   homocitrate synthases signature 1."
FT   CDS_pept        230521..231552
FT                   /transl_table=11
FT                   /locus_tag="DIP0267"
FT                   /product="Putative regulatory protein"
FT                   /note="Similar to Bacillus subtilis deoxyribonucleoside
FT                   regulator DeoR SW:DEOR_BACSU (P39140) (313 aa) fasta
FT                   scores: E(): 6.6e-43, 42.9% id in 303 aa"
FT                   /db_xref="GOA:Q6NJX4"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJX4"
FT                   /protein_id="CAE48772.1"
FT                   /translation="MNPVSCARYPTMWNMLWGVSWLGVEWGKNVHMIDARDCLALDAAK
FT                   LYYVTGLGQAQVAKELGISRPTVSKLLSHARDKGFVTISLNDPREVAGGYVEKLCARYG
FT                   LADVRVVQSPAMGRGLTGELGNAGAALLEEVVKDGMTVGVSWGDTMLAVSEHLRTLPLV
FT                   DVKVVQLKGGHSHTARNTNDMVTLTRFSRALNAEMMMLPLPVILDSKEAKELVVKDRHI
FT                   ASMLNLGAHCDVAVFTVGAVKSESLLLNLGYLSPSEQARLMEHAVGDVCSRFYDAQGEV
FT                   ADPDIDARTVGISLADLKKRPVRVLVAGGLEKAPAIEAALRTGVATHVVIDHATAQRVV
FT                   EMA"
FT   misc_feature    230674..230739
FT                   /note="Predicted helix-turn-helix motif with score 2347
FT                   (+7.18 SD) at aa 52-73, sequence LGQAQVAKELGISRPTVSKLLS"
FT   CDS_pept        231758..232858
FT                   /transl_table=11
FT                   /locus_tag="DIP0268"
FT                   /product="Conserved hypothetical protein"
FT                   /note="C-terminal region similar to C-terminal region of
FT                   Mycobacterium tuberculosis hypothetical 58.9 kDa protein
FT                   Rv2100 precursor or MT2160 or MTCY49.40 SW:YL00_MYCTU
FT                   (Q10709) (550 aa) fasta scores: E(): 7.5e-09, 35.11% id in
FT                   131 aa"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJX3"
FT                   /protein_id="CAE48773.1"
FT                   /translation="MNTTGETTQPFYSHCDMNDPLCRAERLRIQFDYYRWHSLQPDDND
FT                   DVDTYTADIATRIGKTQRYVCDHLDAIYYLTQLPQLHTVYQQLWHLDDTRLITITRIIS
FT                   ALPTTYYDAIDTHLTRWLTPTQPAQTIPSTRAITRFLRKTITHLGFHLDNTRKPEQYVY
FT                   IYDAGHGLAGIDALIHAGVAELLETTLRSIKKTHSCDDSTALQLLLEDKTSVVINLYDT
FT                   GTGITYTPQGTALPQVPEHLVIRVLGDADVAVSTGYRFTEAMRRFIQGRDGVCRFPGCG
FT                   VPAQWCDIDHVEEYDLGGVTGAVNAQCLCRHHHNVKTSRRVDCEIGAGGVVTWQIGDRR
FT                   VVTTPEGVLAGQTFRQRREKKIKKAA"
FT   misc_feature    232544..232702
FT                   /note="HMMSmart hit to SM00507, HNH nucleases"
FT   misc_feature    232580..232720
FT                   /note="HMMPfam hit to PF01844, HNH endonuclease"
FT   repeat_region   complement(232940..232968)
FT                   /note="Possible inverted repeat"
FT   repeat_region   complement(232940..234244)
FT                   /note="repX"
FT   CDS_pept        complement(join(232956..233060,233065..233118,
FT                   233181..233387,233387..233554,233569..233826))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="DIP0269"
FT                   /product="Putative transposase (pseudogene)"
FT                   /note="Pseudogene. Similar to Corynebacterium glutamicum
FT                   DNA, transposable element IS31831 TR:Q45144 (EMBL:D17429)
FT                   (436 aa) fasta scores: E(): 1.8e-14, 39.2% id in 403 aa,
FT                   and to Mycobacterium smegmatis TnpA protein TR:Q50440
FT                   (EMBL:M76495) (413 aa) fasta scores: E(): 5.4e-07, 35.42%
FT                   id in 223 aa. Presents internal in-frame stop codons,
FT                   multiple frameshifts at residues 86, 141, 209 and 227 and
FT                   lacks final stop codon"
FT   repeat_region   complement(233952..233980)
FT                   /note="Possible inverted repeat"
FT   CDS_pept        234348..235064
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /gene_synonym="punB"
FT                   /locus_tag="DIP0271"
FT                   /product="purine nucleoside phosphorylase II"
FT                   /EC_number="2.4.2.1"
FT                   /note="Similar to Bacillus stearothermophilus purine
FT                   nucleoside phosphorylase II DeoD or PunB SW:DEOD_BACST
FT                   (P77835) (234 aa) fasta scores: E(): 8.6e-40, 49.56% id in
FT                   230 aa, and to Staphylococcus aureus purine nucleoside
FT                   phosphorylase Pnp or SA0131 TR:Q99X79 (EMBL:AP003129) (235
FT                   aa) fasta scores: E(): 1.3e-60, 69.52% id in 233 aa"
FT                   /db_xref="GOA:Q6NJX2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJX2"
FT                   /protein_id="CAE48775.1"
FT                   /translation="MAEKSTPHINPKGVDIAETVLLPGDPLRAKFIADTYLEDVVQFNS
FT                   VRNMLGFTGTYQGTPVSVMGSGMGMPSIGIYSYELINFFDARNVIRVGSIGAMQKDIDL
FT                   YEIIVAASASTDSNFLEQYNLPGTYAPTASWTLLRAFMDEADRKGKKVHVGNILSSDVF
FT                   YNADNTVNERWARMGVLGVEMESAALYSIAAYAGANALGVFTVSDNLFTGARTTAEERE
FT                   SAFTDMMELALPLARA"
FT   misc_feature    234399..235055
FT                   /note="HMMPfam hit to PF01048, Phosphorylase family"
FT   misc_feature    234540..234587
FT                   /note="ScanRegExp hit to PS01232, Purine and other
FT                   phosphorylases family 1 signature."
FT   misc_feature    234768..234794
FT                   /note="ScanRegExp hit to PS00039, DEAD-box subfamily
FT                   ATP-dependent helicases signature."
FT   CDS_pept        235061..236425
FT                   /transl_table=11
FT                   /locus_tag="DIP0272"
FT                   /product="Putative antibiotic resistance protein (membrane
FT                   protein)"
FT                   /note="Similar to Staphylococcus aureus SA0132 protein
FT                   TR:Q99X78 (EMBL:AP003129) (450 aa) fasta scores: E():
FT                   3.5e-67, 46.1% id in 436 aa, and to Bacillus subtilis
FT                   tetracycline resistance protein TetB or Tet SW:TCRB_BACSU
FT                   (P23054) (458 aa) fasta scores: E(): 1.3e-23, 26.3% id in
FT                   403 aa"
FT                   /db_xref="GOA:Q6NJX1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJX1"
FT                   /protein_id="CAE48776.1"
FT                   /translation="MTTHNATLKPTDPKAAVPVLLFSFVFCLIVDNGFKTMTGPMAEGL
FT                   GIDPNTASLQASLAGVIIGIGAVVYAALADAISIRKLMLIGIGLVVVGSVIGFVFSGSW
FT                   PLVLAGRLIQTGGLAAAETLYVIYVTKHLAAEDQKTYLGFSTAAFQSGLLVGALTSGAI
FT                   STYIGWRVMFLVPLILIVAVPFILKTVPEEEASSSHLDVVGLFLIAIFATSVIQYMQAF
FT                   KLFWLAFMLVSIVIFVWYVRNAKNPVVNPEFFKNGRYVWAILLVLIVYSTQLGYIVLLP
FT                   FAAKEFHGLDQAQASYLMIPGYICAVLIGIFSGKIGKLMTSRRTIFTALGMIIVALVVG
FT                   ALAIQVHVAVAIASIILFASGFALLYAPLVNTALANILPEKSGVAIGFYNLTINIGVPL
FT                   GIAYTFKLMNLSIGTNAVIWILAAIAVVGAVMYFIADRALFSREKAAGIDSVANH"
FT   misc_feature    235124..236380
FT                   /note="HMMPfam hit to PF00083, Sugar (and other)
FT                   transporter"
FT   misc_feature    order(235211..235279,235313..235381,235394..235447,
FT                   235481..235549,235559..235627,235664..235717,
FT                   235730..235783,235841..235909,235937..235996,
FT                   236033..236092,236102..236170,236207..236275,
FT                   236303..236362)
FT                   /note="13 probable transmembrane helices predicted for
FT                   DIP0272 by TMHMM2.0"
FT   misc_feature    235295..235363
FT                   /note="FPrintScan hit to PR01036, Tetracycline resistance
FT                   protein TetB signature"
FT   misc_feature    235391..235453
FT                   /note="FPrintScan hit to PR01036, Tetracycline resistance
FT                   protein TetB signature"
FT   misc_feature    235556..235630
FT                   /note="FPrintScan hit to PR01036, Tetracycline resistance
FT                   protein TetB signature"
FT   misc_feature    235733..235789
FT                   /note="FPrintScan hit to PR01036, Tetracycline resistance
FT                   protein TetB signature"
FT   misc_feature    235835..235912
FT                   /note="FPrintScan hit to PR01036, Tetracycline resistance
FT                   protein TetB signature"
FT   misc_feature    235940..236014
FT                   /note="FPrintScan hit to PR01036, Tetracycline resistance
FT                   protein TetB signature"
FT   CDS_pept        236460..237116
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="DIP0273"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="Similar to Mycobacterium tuberculosis
FT                   deoxyribose-phosphate aldolase DeoC or Rv0478 or MT0496 or
FT                   MTCY20G9.04 SW:DEOC_MYCTU (Q11138) (224 aa) fasta scores:
FT                   E(): 2.4e-37, 57.07% id in 219 aa, and to Bacillus subtilis
FT                   deoxyribose-phosphate aldolase DeoC or Dra SW:DEOC_BACSU
FT                   (P39121) (211 aa) fasta scores: E(): 3.2e-25, 46.53% id in
FT                   202 aa"
FT                   /db_xref="GOA:Q6NJX0"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NJX0"
FT                   /protein_id="CAE48777.1"
FT                   /translation="MTTRNDVAQMIDHTLLKPEATTDDFKALIADAVRLGTYSVCVSPS
FT                   ALPVEVPENLHVATVVGFPSGAVKPEIKAAEAARTVADGAEEVDMVINIALAKEGKFDE
FT                   LEAEIKAVRDAVPAPGILKVILETAALTDDEIVAACKASENAGADFVKTSTGFHPAGGA
FT                   SVHAVEIMHATVGGRLGIKASGGIRTAKDALAMIEAGATRLGLSASAAILEELGE"
FT   misc_feature    236472..237101
FT                   /note="HMMPfam hit to PF01791, Deoxyribose-phosphate
FT                   aldolase"
FT   misc_feature    236988..237095
FT                   /note="ProfileScan hit to PS50264, Proteins binding FMN and
FT                   related compounds (core region profile)."
FT   CDS_pept        237124..238776
FT                   /transl_table=11
FT                   /locus_tag="DIP0274"
FT                   /product="Putative mutase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   phosphomannomutase SCK13.08c TR:Q9AD82 (EMBL:AL512667) (549
FT                   aa) fasta scores: E(): 7.9e-86, 46.75% id in 554 aa"
FT                   /db_xref="GOA:Q6NJW9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJW9"
FT                   /protein_id="CAE48778.1"
FT                   /translation="MSYAELERTAREWADHDPDPRTKETIEGWLKTHDEESLQQAFNGP
FT                   LTFGTAGLRARVGAGESQLSLAVILRTTYGLVDWVKTQLGADATPTIVIGCDARHGSLE
FT                   FHQAAAEVVSAAGGRALLLPAKNPTPLTAFSVKKFGADAGIMVTASHNPPADNGYKVYL
FT                   GGRIAQGPAEGVQLISPADKEISEAIAAAPYADEIPRTTDNIEHVDPREDYLTRALTLA
FT                   DKKSDILIALTAMHGVGAALGEKVLTAAGFNVSLVPEQAEPDPDFPTVSFPNPEEKGAL
FT                   DLAKAHANTIGADVIIAYDPDADRCAVATPDANAEGGWRQLSGDETGAVLGAYRASVAK
FT                   PGSMANSIVSGRLLSKIAEAAGRTHATTLTGFKWIARTPELVFGYEEAIGFCCDPEAVA
FT                   DKDGVSASVVVASLVSALKAEGRTLDDALDDLAREHGLYQTAPLTFRVDDLSIIARAMS
FT                   TLRAQPPTELAGATVTEVTDLNDPTLPWGATDGMMFITDHNDRIICRPSGTEPKLKCYL
FT                   EVVMPVTGDTIPRAEAAQRLDAIATALRTHLGM"
FT   misc_feature    237247..237687
FT                   /note="HMMPfam hit to PF02878,
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I"
FT   misc_feature    237550..237594
FT                   /note="FPrintScan hit to PR00509,
FT                   Phosphoglucomutase/phosphomannomutase family signature"
FT   misc_feature    237553..237582
FT                   /note="ScanRegExp hit to PS00710, Phosphoglucomutase and
FT                   phosphomannomutase phosphoserine signature."
FT   misc_feature    237757..238068
FT                   /note="HMMPfam hit to PF02879,
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II"
FT   misc_feature    237802..237861
FT                   /note="FPrintScan hit to PR00509,
FT                   Phosphoglucomutase/phosphomannomutase family signature"
FT   misc_feature    238000..238047
FT                   /note="FPrintScan hit to PR00509,
FT                   Phosphoglucomutase/phosphomannomutase family signature"
FT   misc_feature    238090..238416
FT                   /note="HMMPfam hit to PF02880,
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain III"
FT   misc_feature    238489..238740
FT                   /note="HMMPfam hit to PF00408,
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain"
FT   CDS_pept        238823..239860
FT                   /transl_table=11
FT                   /locus_tag="DIP0275"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative integral
FT                   membrane protein 2SCI34.05 TR:Q9EWX4 (EMBL:AL445403) (396
FT                   aa) fasta scores: E(): 1.3e-08, 28.77% id in 358 aa"
FT                   /db_xref="GOA:Q6NJW8"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJW8"
FT                   /protein_id="CAE48779.1"
FT                   /translation="MNKVLTALALVAATTALRLGAFAIAGATAGIPNAITTAALKWDAD
FT                   QYLTIARDGYLANPETSVAFFPGLPMAMRMLSVITHLPLEASGLIIVTIATAALALAVM
FT                   RLAELMGIATPSGRIVATLVVLLAPMSGTFTMVYTEAPFMALSFWAIVAMMQERWRQAT
FT                   LLVALAGLVRLTGIDLVATFAIVLLLASKRHLPLAVIAPLPTASYLAWASWVTRDAGGY
FT                   FGIQEKGWGSGFDGGISTINWIVHSLHEPIRLGYILSSASMVIAVIALVVAYPRLPLAP
FT                   WLFSLFIGLNVLLSGGIMHSRPRLLLPMVLLALPFIRTWPAVILWSLGGLAISAYMIVV
FT                   FPWAI"
FT   misc_feature    238823..238891
FT                   /note="Signal peptide predicted for DIP0275 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.346 between residues 23 and 24"
FT   misc_feature    order(238832..238900,239066..239134,239177..239278,
FT                   239312..239380,239408..239467,239576..239644,
FT                   239657..239725,239786..239854)
FT                   /note="8 probable transmembrane helices predicted for
FT                   DIP0275 by TMHMM2.0"
FT   CDS_pept        complement(239862..240698)
FT                   /transl_table=11
FT                   /locus_tag="DIP0276"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Corynebacterium glutamicum hypothetical
FT                   29.6 kDa protein in leuA-lysC intergenic region
FT                   SW:YLEU_CORGL (P42459) (270 aa) fasta scores: E(): 4.6e-47,
FT                   58.18% id in 220 aa"
FT                   /db_xref="GOA:Q6NJW7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJW7"
FT                   /protein_id="CAE48780.1"
FT                   /translation="MYSNFLAMAFALASALTIAWGTVVRHRIAEETDGSPLLEAVTRFR
FT                   WWVGSLTALLGYALQVVALGFGTLLVVQPILVLSLMFTLPLSARYDGRRPSRDEMGWAG
FT                   ALTVAVAVLVVLGKPAAGDPQPPMDRWLISLGIGAVILLTLWFVSGSLALNTRALVLGA
FT                   ITGGVYGYVAVLSKATVDIMTHGGITTLVFSWQGYSLLFGAILGTVIQQYAFNAGPLKN
FT                   SLPAMTIVEPIVAFALGYAVLGEQFQVYGLNWAFMAAALVTMVVSTFALSWRGVGS"
FT   misc_feature    complement(order(239871..239936,239967..240032,
FT                   240069..240125,240171..240221,240237..240302,
FT                   240348..240398,240435..240488,240501..240566,
FT                   240627..240683))
FT                   /note="9 probable transmembrane helices predicted for
FT                   DIP0276 by TMHMM2.0"
FT   misc_feature    complement(240618..240698)
FT                   /note="Signal peptide predicted for DIP0276 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.979) with cleavage site
FT                   probability 0.323 between residues 27 and 28"
FT   CDS_pept        240889..242154
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /gene_synonym="ask"
FT                   /locus_tag="DIP0277"
FT                   /product="aspartokinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="Similar to Corynebacterium flavum aspartokinase LysC
FT                   or Ask SW:AK_CORFL (P41398) (421 aa) fasta scores: E():
FT                   1.8e-135, 87.64% id in 421 aa"
FT                   /db_xref="GOA:Q6NJW6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJW6"
FT                   /protein_id="CAE48781.1"
FT                   /translation="MALVVQKYGGSSLESAERIRRVAERIVATKKQGHDVVVVCSAMGD
FT                   TTDELLDLAAQVNPVPPAREMDMLLTAGERISNALVAMAIESFGAKAQSFTGSQAGVIT
FT                   TERHGNARIVDVTPGRVREALDEGKICLVAGFQGVNRESKDVTTLGRGGSDTTAVALAA
FT                   ALNADVCEIYSDVDGVYTADPRIVPNAQKLEKLCFEEMLELAASGSKILVLRSVEYARA
FT                   FGVPLRVRSSYSNDPGTLVAGSMEDIPVEEAVLTGVATDNSEAKITVLGIPDSPGSASA
FT                   VFRALADAEINIDTVLQNISSLEDNRTDITFTCPRADGPHAMELLRNLQAKNDWQNVLY
FT                   DDQIGKVSLVGAGMKSHPGVTAEFCEALRDAGVNIELISTSEIRISVLIRESDVDVAAR
FT                   AIHEKFELGGETEAIVYAGTGR"
FT   misc_feature    240892..241581
FT                   /note="HMMPfam hit to PF00696, Amino acid kinase family"
FT   misc_feature    240901..240927
FT                   /note="ScanRegExp hit to PS00324, Aspartokinase signature."
FT   misc_feature    240985..241029
FT                   /note="FPrintScan hit to PR00474, Glutamate 5-kinase family
FT                   signature"
FT   misc_feature    241345..241428
FT                   /note="FPrintScan hit to PR00474, Glutamate 5-kinase family
FT                   signature"
FT   misc_feature    241684..241911
FT                   /note="HMMPfam hit to PF01842, ACT domain"
FT   misc_feature    241930..242127
FT                   /note="HMMPfam hit to PF01842, ACT domain"
FT   CDS_pept        242501..245743
FT                   /transl_table=11
FT                   /locus_tag="DIP0278"
FT                   /product="Putative surface-anchored membrane protein"
FT                   /note="Low similarity to Staphylococcus aureus Ser-Asp rich
FT                   fibrinogen-binding, bone sialoprotein-binding protein SdrE
FT                   or SAV0563 TR:BAB56725 (EMBL:AP003359) (1141 aa) fasta
FT                   scores: E(): 1.9e-05, 21.85% id in 668 aa. Note: Contains a
FT                   potential sortase anchor site (LARTG) upstream of the
FT                   C-terminal region transmembrane domain"
FT                   /db_xref="GOA:Q6NJW5"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJW5"
FT                   /protein_id="CAE48782.1"
FT                   /translation="MVDSRFYEPLGFRRSPIRRLITLLMVVVVCVGLVVSPRVPSAGAA
FT                   ECKGEISNVQWKNDTNIKDGVFVGSYGQGADVQFDWKVDPGAKAGDQFTLKLPNELSRL
FT                   GNKDLTLTAPSGEEVAKGTWDDVAKTWTFTLTDYANSHGDISGSAFFTVQWDRSVAQSN
FT                   TQYPLTFSGCKGAGTLNGKTPEEGVGGTAQATSKTGLYDSKTDSARWNIYVETADTDIY
FT                   TPVVVKDIGNTQLLFRCSDVKVFDRTPYPHTKIRDTPIDPNRWKCEEKDGGIIVSMVPD
FT                   EHGRYLTAGQSLTIGFETPINDDTSRFITNKAIVEISPNKIENVEYSVDRGDAGGVGQG
FT                   FQGKIKIQKEVVGETAPVQGNKFDFEYKCGETTQNISVAAGQTSDIFTQRSSSTCSITE
FT                   KNVAEGVTVDFEVIDEETGKPAYVVPIDNGVTVKFNKNSSTTLNVKVTNTYPNKPEAKK
FT                   GKFVIKKTVNGLDAGQKDKAFKFNYTCKAPDGDAYTEPQLAEVTAGRTWQSGNYPEGTI
FT                   CTIEEDLESAKVPGYSLISAQPKGDVTIKAEGTEGSPVEFAATNSYTKDLGSFSVQKKI
FT                   EASAEAMPLLKDQEFGFKYTCGADKGEFKLKNGETKKVERIATGTKCTVEESDAKVPNG
FT                   FMWTGKIEGTDLDPNDFTIVKDKTLAFTATNTYKQQYGGFTLSKNVTGDATNLEELQKR
FT                   SYTFNYTCTAPTGTVLKDKVEITEETPKAIGNIPAASTCKVTEVEAPAKDTDWTVDLSV
FT                   NGTWVGETAEFKVPAEGEPSISILAKNNYRQHKGSFTIEKIVDASEGIVTPKEFTFTWQ
FT                   CGEDKGAETVRVTNGKGRVEIDRAFPVGTKCSVKELEAEAEDARLITSWENQEFTIDKD
FT                   KQHVIVSATNTYRYAESKVKIVKKLEGPAKDKAKDKTFTFDYSCVVNNEAIEGSVNITG
FT                   EGATEIPESFPAGTKCTITERDASISGTTWTHRIAEDGQITIQSPAKVYQVGVTNAYSK
FT                   PGFPWFIPLIPLVIIPFLPLFPHPTPAPQPAPQPTPQKPSEQQPSPKAPEKKPQKEKKV
FT                   LARTGANVWMFIVIAVLLVLLGAFLRRRGNNS"
FT   misc_feature    242501..242632
FT                   /note="Signal peptide predicted for DIP0278 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.918 between residues 44 and 45"
FT   misc_feature    243026..243049
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    245468..245626
FT                   /note="ProfileScan hit to PS50099, Proline-rich region."
FT   misc_feature    245645..245659
FT                   /note="potential sortase anchor site LARTG"
FT   misc_feature    245666..245719
FT                   /note="1 probable transmembrane helix predicted for DIP0278
FT                   by TMHMM2.0"
FT   CDS_pept        246016..247047
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="DIP0279"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="Similar to Corynebacterium flavum
FT                   aspartate-semialdehyde dehydrogenase Asd SW:DHAS_CORFL
FT                   (P41400) (344 aa) fasta scores: E(): 3.3e-100, 79.3% id in
FT                   343 aa"
FT                   /db_xref="GOA:Q6NJW4"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJW4"
FT                   /protein_id="CAE48783.1"
FT                   /translation="MTTVAVVGATGQVGRVMRSILEERDFPLDTIRFFASARSAGTTLP
FT                   YKGQEIEVEDLALQIEESLAGIDIALFSAGGSTSKQYAPLFAAAGATVVDNSSAWRKDD
FT                   EVPLIVSEVNPDAKNDVVKGIIANPNCTTMAIMPVVKALHDAAGVTKLHVSSYQAVSGS
FT                   GLAGVETLIKQVAEIGDRAVELVHDGSLLAPEDMGPYVAPIAFNALPFAGNLVEDGTEE
FT                   TDEEQKLRNESRKILGLPDLKVAGTCVRVPVFTGHTMVVHAEFNNAITPEQAREVLGNA
FT                   AGVDVVDVPTPLAAAGVDNSLVGRIRQDQTVDDNKGLVFVVSGDNLRKGAALNAIQIAE
FT                   LLV"
FT   misc_feature    246016..246396
FT                   /note="HMMPfam hit to PF01118, Semialdehyde dehydrogenase,
FT                   NAD binding domain"
FT   misc_feature    246421..247002
FT                   /note="HMMPfam hit to PF02774, Semialdehyde dehydrogenase,
FT                   dimerisation domain"
FT   misc_feature    246745..246789
FT                   /note="ScanRegExp hit to PS01103, Aspartate-semialdehyde
FT                   dehydrogenase signature."
FT   CDS_pept        complement(247054..247620)
FT                   /transl_table=11
FT                   /gene="sigC"
FT                   /locus_tag="DIP0280"
FT                   /product="Putative RNA polymerase sigma factor"
FT                   /note="Similar to Mycobacterium tuberculosis probable RNA
FT                   polymerase sigma-C factor SigC or Rv2069 or MT2129 or
FT                   MTCY49.08 SW:RPSC_MYCTU (Q10679) (185 aa) fasta scores:
FT                   E(): 6.1e-30, 52.24% id in 178 aa"
FT                   /db_xref="GOA:Q6NJW3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJW3"
FT                   /protein_id="CAE48784.1"
FT                   /translation="MNMKPSERDDDYVTALALKAGRGDRAALTAFIRATQTDVWRLLAH
FT                   LGGTDIADDLTQETYLRVMSALPRFAARSSARTWLLSLARRVWVDNIRHDMARPRKSAA
FT                   EVEQCDGTTSSLWAEWVDVRMLIDALPAERREALILTQVLGFSYEEAAKIADVRIGTIR
FT                   SRVARARADIVAAAATETDTNEAAG"
FT   misc_feature    complement(247120..247185)
FT                   /note="Predicted helix-turn-helix motif with score 1077
FT                   (+2.86 SD) at aa 150-171, sequence FSYEEAAKIADVRIGTIRSRVA"
FT   misc_feature    complement(247336..247500)
FT                   /note="HMMPfam hit to PF00776, Sigma-70 factor (ECF
FT                   subfamily)"
FT   CDS_pept        247748..249286
FT                   /transl_table=11
FT                   /gene="cat"
FT                   /locus_tag="DIP0281"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="Similar to Onchocerca volvulus endobacterium
FT                   catalase Cat SW:CATA_ONCVE (Q27710) (482 aa) fasta scores:
FT                   E(): 8e-92, 52.24% id in 490 aa"
FT                   /db_xref="GOA:Q6NJW2"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJW2"
FT                   /protein_id="CAE48785.1"
FT                   /translation="MTSPVDPILNKGERTEAAPHTTRAGGQPVASENISITAGPQGANV
FT                   LNDLHLIEKLAHFNRERVPERNPHAKGHGAFGELHITEDVSQYTKAKLFQKGTVTPMAV
FT                   RFSTVAGEKGSPDTWRDVHGFALRFYTQDGNYDIVGNNTPTFFLRDAMKFPDFIHSQKR
FT                   LGSSGLRDADMQWDFWTRTPESAHQVTYLMGDRGTPKTSRHQDGFGSHTYQWINEDGQP
FT                   VWVKYHFKTRQGWETFTDAEAQEMAGKNADYQREDLYNAIERGDFPIWDVKVQIMPFDE
FT                   AETYRWNPFDLTKTWSQKDYPLIDVGYFVLNRNPQNFFAQIEQLALDPANLVPGVGLSP
FT                   DRMLMARAFAYADAQRYRIGPNYQQLPINQPVVPVNTYQHEGPMAYHFNPADAPVHTPN
FT                   RFGKGAGYLDDGQTSSSGATYGQAQDLYVNPDPHGTDLTRAAYVKHADDDDFMQAGILY
FT                   REVYDDAAKERFVDNVTNAMAGVSPETEERVYWYWTQVDENLGAKIREAFAAKK"
FT   misc_feature    247811..248962
FT                   /note="HMMPfam hit to PF00199, Catalase"
FT   misc_feature    247811..249262
FT                   /note="BlastProDom hit to PD000510, PD000510"
FT   misc_feature    247850..247921
FT                   /note="FPrintScan hit to PR00067, Catalase signature"
FT   misc_feature    248036..248092
FT                   /note="FPrintScan hit to PR00067, Catalase signature"
FT   misc_feature    248099..248152
FT                   /note="FPrintScan hit to PR00067, Catalase signature"
FT   misc_feature    248156..248212
FT                   /note="FPrintScan hit to PR00067, Catalase signature"
FT   misc_feature    248651..248734
FT                   /note="FPrintScan hit to PR00067, Catalase signature"
FT   misc_feature    248747..248827
FT                   /note="FPrintScan hit to PR00067, Catalase signature"
FT   misc_feature    248786..248812
FT                   /note="ScanRegExp hit to PS00437, Catalase proximal
FT                   heme-ligand signature."
FT   CDS_pept        complement(249276..250334)
FT                   /transl_table=11
FT                   /locus_tag="DIP0282"
FT                   /product="Putative ABC transport system ATP-binding
FT                   protein"
FT                   /note="Similar to Vibrio cholerae iron (III) ABC
FT                   transporter, ATP-binding protein VC0610 TR:Q9KUB3
FT                   (EMBL:AE004146) (343 aa) fasta scores: E(): 7e-18, 34.743%
FT                   id in 331 aa, and to Archaeoglobus fulgidus branched-chain
FT                   amino acid ABC transporter, ATP-binding protein AF0221
FT                   TR:O30018 (EMBL:AE001090) (224 aa) fasta scores: E():
FT                   9.2e-17, 34.562% id in 217 aa"
FT                   /db_xref="GOA:Q6NJW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJW1"
FT                   /protein_id="CAE48786.1"
FT                   /translation="MALIHIQGLSVTSRGARLLDDVSLEADPGELIVVLGRSGAGKSTL
FT                   LRALAGLIPAQGVVEVDGESLAGRPPHQRPIAMMMDQPSLFPHMTVEDNIRFAGDAGAH
FT                   VAMLSLGIDHLALRYPHQLSTGQQQKVALARALIKQPKLMFFDEPLAHVDTYSSEQLKS
FT                   QILRTHRRLGCTTFYVTHDINEAFSIADRIIFLSHGRIVQDASPQDMREQPACLDIARH
FT                   LGASIFVPTTGTVSHSSFGTATAAITALGTSMEVEAHPDLRSGDAMVMVGYPTSATATP
FT                   TGQQARHLMGATGQVIRNIYMGDHHEVAIETTRGRIVLHCSPDDELAFAALGDEVLIHC
FT                   DPEKMWVLPATS"
FT   misc_feature    249276..255947
FT                   /note="Anomalous G+C content (55.53%), G/C deviation and
FT                   dinucleotide signature. Putative pathogencity island. Not
FT                   present in C.glutamicum"
FT   misc_feature    complement(249735..250253)
FT                   /note="HMMSmart hit to SM00382, ATPases associated with a
FT                   variety of cellular activities"
FT   misc_feature    complement(249738..250250)
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    complement(249750..249968)
FT                   /note="ProfileScan hit to PS50100, 2nd half motif for
FT                   nucleotide binding, associated with P-loop."
FT   misc_feature    complement(250167..250244)
FT                   /note="ProfileScan hit to PS50101, P-loop nucleotide
FT                   binding motif (does not find all)."
FT   misc_feature    complement(250206..250229)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        complement(250325..251878)
FT                   /transl_table=11
FT                   /locus_tag="DIP0283"
FT                   /product="Putative transport system permease (iron)"
FT                   /note="Similar to Treponema hyodysenteriae putative
FT                   permease ShiD TR:O54371 (EMBL:U75349) (277 aa) fasta
FT                   scores: E(): 0.0013, 21.739% id in 184 aa, and to
FT                   Escherichia coli O157:H7 EDL933 putative transport system
FT                   permease protein YabK TR:AAG54371 (EMBL:AE005183) (536 aa)
FT                   fasta scores: E(): 0.019, 21.995% id in 441 aa"
FT                   /db_xref="GOA:Q6NJW0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJW0"
FT                   /protein_id="CAE48787.1"
FT                   /translation="MRTGLWIFSVVAIAAVAVGIPYAMLLKAAGTGTAAVAPIILSSTI
FT                   ALCATLLAVGIGTVGALAAAQFSRTVVLLLDVILLFQLTIPHFVIGAGWKTIMGRTGIH
FT                   LCSQCNFSGLGPLLFTFTVAFTPLAYFVQRTALRSVSSREVDAARVAGLHGWALFRAVY
FT                   QPRLVLFAPALAVFIFSAALSDPVTPNVMAPRASLAATRVWFQGDQAGTALALTLPVAG
FT                   AVVVAGLVYARLLRSNPALVELLHFAGNSSGQPHRAVGAQVRAPQAVLCFLGAVAGLFV
FT                   LVAAFRGFVHGSETPMGNAVVNTVGLAFLVLLCSLLLSAVALGARRSCGLRWGWLGRRG
FT                   IDAVFALLALSPGAAIGCGLQIALNHPGVYGPWASLSLVLLACLPSSLAMTYFLMVYIG
FT                   PLMSRSEYMVSLLQGVGPLRAVASIVLPRSTNVVILGFLMVFSNASVLAVPLLWVSSPD
FT                   TPLLMLRLFTLLDAANYPAALYISMTVSLFIVSLAGAIVVSINGVGLAAFARKQVASWR
FT                   "
FT   misc_feature    complement(order(250352..250417,250517..250582,
FT                   250679..250744,250790..250846,250910..250975,
FT                   251006..251071,251186..251251,251312..251377,
FT                   251483..251539,251600..251665,251705..251770,
FT                   251801..251857))
FT                   /note="12 probable transmembrane helices predicted for
FT                   DIP0283 by TMHMM2.0"
FT   misc_feature    complement(251777..251878)
FT                   /note="Signal peptide predicted for DIP0283 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.426 between residues 34 and 35"
FT   CDS_pept        complement(251875..252876)
FT                   /transl_table=11
FT                   /locus_tag="DIP0284"
FT                   /product="Putative ABC-transport system iron-binding
FT                   secreted protein"
FT                   /note="Similar to Escherichia coli O157:H7 putative
FT                   periplasmic-iron-binding protein ECS0415 TR:BAB33838
FT                   (EMBL:AP002551) (343 aa) fasta scores: E(): 5.5e-19,
FT                   27.139% id in 339 aa, and to Actinobacillus
FT                   pleuropneumoniae AfuA protein TR:Q57512 (EMBL:U05042) (346
FT                   aa) fasta scores: E(): 4.2e-16, 26.280% id in 293 aa, and
FT                   to Serratia marcescens iron(III)-binding periplasmic
FT                   protein precursor SfuA SW:SFUA_SERMA (P21408) (338 aa)
FT                   fasta scores: E(): 0.00026, 20.000% id in 290 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJV9"
FT                   /protein_id="CAE48788.1"
FT                   /translation="MLSKWLRLLAVCVVAMVSVATVYRTLFPAKTAVTIMCSNDVTVCE
FT                   QWKRDIARELGLNVRYVSLPTQEALRRLRTGSHEFDVWVGGPSENYRLAARLGLLQAVD
FT                   LPAADAIPGSFKDPQNQWFGVYASVLSVCSDRDALAELGVPVPRTWSDLMRPELRGWVS
FT                   APSPVSSGTGYAMLLSMQAAGLSQDEIAAIVGNVDRFTRSGNAPSDVVAHGEAAVAISY
FT                   EPYCQNKTTRYGRDVEISYPAEGTSFEIASGGVVAQGHNKSAAYEVMNWLLSPSGQTSA
FT                   RRVGLPQIPTSDLVVGNISTRLKDSHGIVAVDPAVADSERDRWMSWFSEQRA"
FT   misc_feature    complement(251884..252771)
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding protein"
FT   misc_feature    complement(252676..252741)
FT                   /note="Predicted helix-turn-helix motif with score 1105
FT                   (+2.95 SD) at aa 46-67, sequence QWKRDIARELGLNVRYVSLPTQ"
FT   misc_feature    complement(252790..252876)
FT                   /note="Signal peptide predicted for DIP0284 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.981) with cleavage site
FT                   probability 0.522 between residues 29 and 30"
FT   misc_feature    complement(252796..252861)
FT                   /note="1 probable transmembrane helix predicted for DIP0284
FT                   by TMHMM2.0"
FT   CDS_pept        complement(252957..254327)
FT                   /transl_table=11
FT                   /locus_tag="DIP0285"
FT                   /product="Putative glycerol-3-phosphate transporter"
FT                   /note="Similar to Bacillus subtilis glycerol-3-phosphate
FT                   transporter GlpT SW:GLPT_BACSU (P37948) (444 aa) fasta
FT                   scores: E(): 1.4e-74, 45.434% id in 438 aa, and to
FT                   Escherichia coli glycerol-3-phosphate transporter GlpT or
FT                   B2240 SW:GLPT_ECOLI (P08194) (452 aa) fasta scores: E():
FT                   4.2e-74, 44.295% id in 447 aa"
FT                   /db_xref="GOA:Q6NJV8"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJV8"
FT                   /protein_id="CAE48789.1"
FT                   /translation="MFAWLQAPGPAAPLSAEQVDRTYPRMRLQVFMGIFLGYAGFYLIR
FT                   NNISAIAPLLIDESGAIDKPAIGIIGNAVLVSYGLSKFFSAMVSDRSNARYFLPLGLAL
FT                   SALMNLVVAFVPWVSASVGVFATVMFLNGWFQGMGYPPCGRIVVQWFSTSERGWKGSLW
FT                   NTSHNLGAFGLPVLVGIGLSMTGENWRAAYWLPALVALVVALVAFLLIRDNPQSVGLPP
FT                   IDDYRNDPAKVAEDTGEKISTKDLVFKHILHSRIIMLLAIANVFVYALRYGVLHWITTY
FT                   LSEQHHMSIGSGLIGFAAFELAGFIGTVLCGWLSDNVFKGNRSAAISLFTLGAGLSIAA
FT                   YWLAPVGTPFWLMVIFVAFIGGFIYGPVGLIGLQALDLSPRNVAGTAAGFTGLFGYLLG
FT                   ATLASTGVGFLVKFAGWNVTFIVFLVFTVLILVIFQVIWREEKKLMQERALKLEQGV"
FT   misc_feature    complement(order(253014..253079,253095..253160,
FT                   253200..253265,253296..253361,253383..253448,
FT                   253494..253559,253695..253751,253782..253847,
FT                   253911..253961,253974..254039,254061..254126,
FT                   254172..254237))
FT                   /note="12 probable transmembrane helices predicted for
FT                   DIP0285 by TMHMM2.0"
FT   misc_feature    complement(253014..254255)
FT                   /note="HMMPfam hit to PF00083, Sugar (and other)
FT                   transporter"
FT   CDS_pept        complement(254456..255157)
FT                   /transl_table=11
FT                   /locus_tag="DIP0286"
FT                   /product="two-component regulatory protein"
FT                   /note="Similar to Klebsiella pneumoniae phosphate regulon
FT                   transcriptional regulatory protein PhoB SW:PHOB_KLEPN
FT                   (P45605) (229 aa) fasta scores: E(): 1.7e-25, 40.708% id in
FT                   226 aa, to Shigella dysenteriae phosphate regulon
FT                   transcriptional regulatory protein PhoB SW:PHOB_SHIDY
FT                   (P45606) (229 aa) fasta scores: E(): 6.5e-25, 40.265% id in
FT                   226 aa, and to Escherichia coli phosphate regulon
FT                   transcriptional regulatory protein PhoB or B0399 or Z0497
FT                   or ECS0449 SW:PHOB_ECOLI (P08402) (229 aa) fasta scores:
FT                   E(): 6.5e-25, 40.265% id in 226 aa"
FT                   /db_xref="GOA:Q6NJV7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJV7"
FT                   /protein_id="CAE48790.1"
FT                   /translation="MHRLRVLVVDDEPQMVQIISYALELEGWEVLSASSAQRGWQLLNE
FT                   YRCDLVILDVMLPDASGYALCERIRAAGDVAGTPVIMLTALGDTDNRVEGLEAGADDYV
FT                   AKPFSPKELVLRAQAVVRRSGGVVQPELREIIVGEVSVNPATHAVVIGGRRVDTTATEG
FT                   KLLQALVSHPNEVVSVKRLLNEVWDTTATQGGRNMVKSTAYRLRKKLENAGLPADSILA
FT                   VRGQGYVFQYE"
FT   misc_feature    complement(254477..254698)
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C terminal"
FT   misc_feature    complement(254783..255148)
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain"
FT   misc_feature    complement(254795..255145)
FT                   /note="ProfileScan hit to PS50110, Histidine-receiving
FT                   module in bacterial sensor systems."
FT   misc_feature    complement(254807..255148)
FT                   /note="HMMSmart hit to SM00448, cheY-homologous receiver
FT                   domain"
FT   CDS_pept        complement(255150..255947)
FT                   /transl_table=11
FT                   /locus_tag="DIP0287"
FT                   /product="two-component sensor protein"
FT                   /note="Similar to Escherichia coli sensor protein RcsC or
FT                   B2218 SW:RCSC_ECOLI (P14376) (933 aa) fasta scores: E():
FT                   5.5e-10, 26.339% id in 224 aa, and to Pseudomonas syringae
FT                   sensor protein GacS or LemA SW:GACS_PSESY (P48027) (907 aa)
FT                   fasta scores: E(): 2e-09, 27.530% id in 247 aa"
FT                   /db_xref="GOA:Q6NJV6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJV6"
FT                   /protein_id="CAE48791.1"
FT                   /translation="MFAALVLTACGSACAASLVTAAVVRRRGCDQGSTITDEQILAHEI
FT                   RTPLSLIKGAAELLGQESDPHKCERLVATIGANSTRAIEVAESFLLQAKLNSGSVKLQV
FT                   SPCDVRGLVRSTAQELRAMSEVPIVVDDPGDPLVIDGDAQLLRHALWNVLNNAARYAGS
FT                   DSDIVVGVEESATGVIVTVADYGPGMTSRQRRDMFVPFAQFGQAHAQGHTQTQSTAAVP
FT                   SGAGLGMAITQKIVQLHRGSVLVDSIADHGTSVLITLPRTYYA"
FT   misc_feature    complement(255159..255527)
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, phytochrome-like ATPase"
FT                   /note="HMMSmart hit to SM00387, Histidine kinase-like
FT                   ATPases"
FT   misc_feature    complement(255159..255830)
FT                   /note="ProfileScan hit to PS50109, Bacterial histidine
FT                   kinase domain."
FT   misc_feature    complement(255168..255209)
FT                   /note="FPrintScan hit to PR00344, Bacterial sensor protein
FT                   C-terminal signature"
FT   misc_feature    complement(255225..255281)
FT                   /note="FPrintScan hit to PR00344, Bacterial sensor protein
FT                   C-terminal signature"
FT   misc_feature    complement(255372..255416)
FT                   /note="FPrintScan hit to PR00344, Bacterial sensor protein
FT                   C-terminal signature"
FT   misc_feature    complement(255654..255848)
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain"
FT                   /note="HMMSmart hit to SM00388, His Kinase A
FT                   (phosphoacceptor) domain"
FT   misc_feature    complement(255681..255728)
FT                   /note="ScanRegExp hit to PS00012, Phosphopantetheine
FT                   attachment site."
FT   misc_feature    complement(255876..255941)
FT                   /note="1 probable transmembrane helix predicted for DIP0287
FT                   by TMHMM2.0"
FT   misc_feature    complement(255885..255947)
FT                   /note="Signal peptide predicted for DIP0287 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.668 between residues 21 and 22"
FT   stem_loop       complement(255997..256076)
FT   CDS_pept        complement(256103..256405)
FT                   /transl_table=11
FT                   /locus_tag="DIP0288"
FT                   /product="Putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="GOA:Q6NJV5"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJV5"
FT                   /protein_id="CAE48792.1"
FT                   /translation="MLYDSIASVLIIIAGLLFVVSATALWHAPDALTRANLLGPATSVA
FT                   LPLIVIATLLHDIGAGSFEINHLVRAIVAIVALWVVLAVASFVMGRALHEVSQES"
FT   misc_feature    complement(order(256136..256201,256238..256294,
FT                   256325..256390))
FT                   /note="3 probable transmembrane helices predicted for
FT                   DIP0288 by TMHMM2.0"
FT   misc_feature    complement(256340..256405)
FT                   /note="Signal peptide predicted for DIP0288 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.954) with cleavage site
FT                   probability 0.552 between residues 22 and 23"
FT   CDS_pept        complement(256405..256671)
FT                   /transl_table=11
FT                   /locus_tag="DIP0289"
FT                   /product="Putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="GOA:Q6NJV4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJV4"
FT                   /protein_id="CAE48793.1"
FT                   /translation="MLEISIYIGLALTAASLLSAIVLMLKTKDELTRAVISDMCFYGMI
FT                   AFYLIWSLRNPTSIAYEVVLLAGLVGGALPTMSVARIISKGRR"
FT   misc_feature    complement(order(256432..256497,256513..256578,
FT                   256594..256659))
FT                   /note="3 probable transmembrane helices predicted for
FT                   DIP0289 by TMHMM2.0"
FT   CDS_pept        complement(256671..257048)
FT                   /transl_table=11
FT                   /locus_tag="DIP0290"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Vibrio cholerae hypothetical protein
FT                   VCA0154 TR:Q9KN12 (EMBL:AE004356) (158 aa) fasta scores:
FT                   E(): 0.0029, 30.588% id in 85 aa"
FT                   /db_xref="GOA:Q6NJV3"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJV3"
FT                   /protein_id="CAE48794.1"
FT                   /translation="MHAPLYVVWLIGQIFVATGVLIKDMFHGYKSMEPCVVYYPLRVTK
FT                   EWQITALAASITITPGTMSIGLREDGTLLVHAVYGHNPADVLADIATMEEHLAPSVKDI
FT                   PHKVANVRIEHPAHLAIRKEQ"
FT   misc_feature    complement(256743..257027)
FT                   /note="HMMPfam hit to PF01899, Protein of unknown function
FT                   DUF68"
FT   misc_feature    complement(256983..257033)
FT                   /note="1 probable transmembrane helix predicted for DIP0290
FT                   by TMHMM2.0"
FT   CDS_pept        complement(257051..258574)
FT                   /transl_table=11
FT                   /locus_tag="DIP0291"
FT                   /product="Putative Na+/H+ antiporter subunit"
FT                   /note="Similar to Staphylococcus aureus Na+/H+-antiporter
FT                   subunit MnhD or SA0810 TR:Q9ZNG3 (EMBL:AB015981) (498 aa)
FT                   fasta scores: E(): 2.4e-35, 29.482% id in 502 aa"
FT                   /db_xref="GOA:Q6NJV2"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJV2"
FT                   /protein_id="CAE48795.1"
FT                   /translation="MDFVLPLFVGLPLLTVALTVMAPWRVVRDGFAVVVPVLTGLAGAW
FT                   LFAYTATHGTIAHSIGLYVGGVAIPFVADQFSAIMIVTTSIVAFASNWFAVAVGETRAR
FT                   FYAPLSLMLLTGVMGALLTADLFNFFVFIEVMLLPSYGLMAMTGTWARLSAGRTFVLVN
FT                   LATSTILVMAVSVLYGTVGAVNIAALAGAARGNGPVSVVMGIVVIALIVKAGVFPVHTW
FT                   LPRSYPATSASVMGLFSGLHTKVAVYMLFRIYVVIFDLEQRWIWLITVICILSMLVGAF
FT                   AGLAENSMRRVLAYQMVNGMPFILVMLAFTSGNEQAALAAGIFYALHHMITVGSLILSA
FT                   GAIEETYGTDLLSKLTGIARRDPWVAAVFVVGAFSVVGFPPFSGLWGKVFIVVGVAHQA
FT                   TWQAWLVIAVIVIASFGAFLSMLRLWREVFWGAVMNRERVPEAMRVPWHRLAPAAVLAV
FT                   TSLAMFVFAGPLVGATRAAAGDLLDVPAYTQAVLGDNPIGLATDLQGGK"
FT   misc_feature    complement(order(257174..257239,257300..257365,
FT                   257426..257482,257546..257611,257642..257698,
FT                   257720..257785,257801..257866,257906..257971,
FT                   258032..258097,258113..258178,258194..258259,
FT                   258281..258346,258407..258472,258494..258559))
FT                   /note="14 probable transmembrane helices predicted for
FT                   DIP0291 by TMHMM2.0"
FT   misc_feature    complement(257324..258208)
FT                   /note="HMMPfam hit to PF00361,
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains"
FT   misc_feature    complement(257387..257467)
FT                   /note="FPrintScan hit to PR01437, NADH-ubiquinone
FT                   oxidoreductase subunit 4 signature"
FT   misc_feature    complement(258026..258100)
FT                   /note="FPrintScan hit to PR01437, NADH-ubiquinone
FT                   oxidoreductase subunit 4 signature"
FT   misc_feature    complement(258131..258190)
FT                   /note="FPrintScan hit to PR01437, NADH-ubiquinone
FT                   oxidoreductase subunit 4 signature"
FT   CDS_pept        complement(258574..258999)
FT                   /transl_table=11
FT                   /locus_tag="DIP0292"
FT                   /product="Putative Na+/H+ antiporter subunit"
FT                   /note="Similar to Staphylococcus aureus Na+/H+-antiporter
FT                   subunit MnhC or SA0811 TR:Q9ZNG4 (EMBL:AB015981) (113 aa)
FT                   fasta scores: E(): 6.5e-08, 38.889% id in 90 aa"
FT                   /db_xref="GOA:Q6NJV1"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJV1"
FT                   /protein_id="CAE48796.1"
FT                   /translation="MILSLSIAVLAAAGTYMVLQRGMLRIVIGMTLISHAVNLIILNAG
FT                   VPRWRGEAFPSLTDISESSDPVPQAFVLTAIVIAMATTTYMLTLSGLGRSDDTLAEEVA
FT                   DETSPLQTLGRSTTNAEAVEDLEHAAKRAATRQEETH"
FT   misc_feature    complement(258682..258999)
FT                   /note="HMMPfam hit to PF01898, Protein of unknown function
FT                   DUF67"
FT   misc_feature    complement(258730..258960)
FT                   /note="BlastProDom hit to PD006097, PD006097"
FT   misc_feature    complement(order(258733..258798,258862..258927,
FT                   258943..258993))
FT                   /note="3 probable transmembrane helices predicted for
FT                   DIP0292 by TMHMM2.0"
FT   CDS_pept        complement(259003..261915)
FT                   /transl_table=11
FT                   /locus_tag="DIP0293"
FT                   /product="Putative Na+/H+ antiporter subunit"
FT                   /note="Similar to Pseudomonas aeruginosa probable NADH
FT                   dehydrogenase PA1054 TR:Q9I4S0 (EMBL:AE004537) (933 aa)
FT                   fasta scores: E(): 3e-85, 34.395% id in 942 aa, and to
FT                   Rhizobium meliloti pH adaptation potassium efflux system
FT                   transmembrane protein TR:CAC47489 (EMBL:AL591792) (999 aa)
FT                   fasta scores: E(): 5.9e-61, 31.818% id in 968 aa, and to
FT                   Staphylococcus aureus Na+/H+ antiporter subunit MnhA
FT                   TR:Q9ZNG6 (EMBL:AB015981) (801 aa) fasta scores: E():
FT                   6.5e-33, 31.750% id in 800 aa"
FT                   /db_xref="GOA:Q6NJV0"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJV0"
FT                   /protein_id="CAE48797.1"
FT                   /translation="MTLIIVLALAACAVALAPVTVRICDRKAGWPLAALFVVAAVLLCK
FT                   ELPGIIAGTPLTLEYTWVPDFVGDGVDVSFALRADALSSFFALLALGIGSVVFAYSASY
FT                   LHNNAGNTSFYTIMTAFMASILLLVFANDAVLLFIAWELVSLASFMLIARSGGKGGELG
FT                   SQRTLILTFIGGLTLLVAMAIASNQAGSTNIDAIIHAGFWAEKPALTGVVAVLVAVSAF
FT                   TKSAQFPFHFWLPEAMAAATPVSAFLHAAAVVKAGIYVLLRFSAVFSDVAVWNWLLIVV
FT                   GMFTAVMASFFAIQKTDMKKLTAYSTVSHLGWIVATIGVGTPFALAAAVVHTLAHALFK
FT                   SSLFMLVGVVDHQAGTRDLTRLGSSWRQLPFTFGAMAIAAASMAAVPPLFGFVSKEGML
FT                   EAFLHAPIGNAGVVVLMVAAGVGALFTFTYSVRLVVDGFIDGSREMSDCKEAPVSLWLP
FT                   AALPGVLSIPAALFVSRLDAPVSAAVSEVADDPHTHLAVWHGVTIPFVISMLVLVFGVL
FT                   GLVKRQWIWDSLADRKLAPRSGNELLNLSVRGIAAFGRCVGSMADSLSPTRHLAYVFML
FT                   LVVLGGTVTVKGVASGGIDGVPLAPRIDGADRWADALPLAIIVLAAALLLRTKRRLTAV
FT                   IMIGVVGVGVTVQMLMLGSPDVALTQFMVEALTVVIMMMVIRQQPDNFHPSKGRRKAFA
FT                   AVMAVAVGVVTFLMCWFVLGRRERPELAIWYLNNGPEITGGDNVVNTILVEFRAFDTMG
FT                   ELSVLGMAAVVIAAVVTSMPRYPFAHGTHPAPFGLSHVNSIPLRQLLRVLIPILGILSF
FT                   AIFMRGHNSPGGGFIAALVAGGALMLSYLSHARDQHIFTFKTPIYLTSIGIILALVSGF
FT                   LGLTHGSFLYALHGHWAGEHWTTAMIFDLGVYLAVLGMLSMAINALGSYLRPGMDYDRL
FT                   NFTRDESPLVSPAKVEAQADDDLDWPETKSSAQASQPKEA"
FT   misc_feature    complement(order(259165..259230,259291..259347,
FT                   259387..259437,259468..259518,259582..259647,
FT                   259774..259839,259888..259944,259960..260016,
FT                   260038..260088,260134..260199,260365..260430,
FT                   260491..260556,260617..260682,260743..260808,
FT                   260923..260988,261034..261099,261139..261204,
FT                   261250..261315,261355..261411,261493..261558,
FT                   261598..261663,261760..261825,261847..261903))
FT                   /note="23 probable transmembrane helices predicted for
FT                   DIP0293 by TMHMM2.0"
FT   misc_feature    complement(260602..260661)
FT                   /note="FPrintScan hit to PR01434, NADH-ubiquinone
FT                   oxidoreductase chain 5 signature"
FT   misc_feature    complement(260647..261525)
FT                   /note="HMMPfam hit to PF00361,
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains"
FT   misc_feature    complement(260707..260787)
FT                   /note="FPrintScan hit to PR01437, NADH-ubiquinone
FT                   oxidoreductase subunit 4 signature"
FT   misc_feature    complement(260884..260943)
FT                   /note="FPrintScan hit to PR01437, NADH-ubiquinone
FT                   oxidoreductase subunit 4 signature"
FT   misc_feature    complement(260950..260988)
FT                   /note="FPrintScan hit to PR01434, NADH-ubiquinone
FT                   oxidoreductase chain 5 signature"
FT   misc_feature    complement(261112..261192)
FT                   /note="FPrintScan hit to PR01434, NADH-ubiquinone
FT                   oxidoreductase chain 5 signature"
FT   misc_feature    complement(261127..261201)
FT                   /note="FPrintScan hit to PR01437, NADH-ubiquinone
FT                   oxidoreductase subunit 4 signature"
FT   misc_feature    complement(261193..261258)
FT                   /note="FPrintScan hit to PR01434, NADH-ubiquinone
FT                   oxidoreductase chain 5 signature"
FT   misc_feature    complement(261343..261417)
FT                   /note="FPrintScan hit to PR01437, NADH-ubiquinone
FT                   oxidoreductase subunit 4 signature"
FT   misc_feature    complement(261448..261507)
FT                   /note="FPrintScan hit to PR01437, NADH-ubiquinone
FT                   oxidoreductase subunit 4 signature"
FT   misc_feature    complement(261532..261594)
FT                   /note="FPrintScan hit to PR01434, NADH-ubiquinone
FT                   oxidoreductase chain 5 signature"
FT   misc_feature    complement(261556..261705)
FT                   /note="HMMPfam hit to PF00662, NADH-Ubiquinone
FT                   oxidoreductase (complex I), chain 5 N-terminus"
FT   misc_feature    complement(261601..261678)
FT                   /note="FPrintScan hit to PR01434, NADH-ubiquinone
FT                   oxidoreductase chain 5 signature"
FT   misc_feature    complement(261853..261915)
FT                   /note="Signal peptide predicted for DIP0293 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.834) with cleavage site
FT                   probability 0.531 between residues 21 and 22"
FT   CDS_pept        262085..263482
FT                   /transl_table=11
FT                   /locus_tag="DIP0294"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Deinococcus radiodurans conserved
FT                   hypothetical protein DR0075 TR:Q9RY75 (EMBL:AE001870) (1467
FT                   aa) fasta scores: E(): 3e-06, 27.568% id in 370 aa"
FT                   /db_xref="GOA:Q6NJU9"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJU9"
FT                   /protein_id="CAE48798.1"
FT                   /translation="MSRKIVRRALAGALFFVPLIAGTVYATTQDVDPAATWSAAQETQQ
FT                   GAPAVQEDPSLVDIRRAAGEAGSQASLLKNGTTQLVDGTTALNNGAAQLGDGTKAAQNG
FT                   AAQLADGMVKLQAATGQMGNGATEIANGIDQAVGQFQNVEVIRGQLLTAINLAMSDPKL
FT                   ADVKPDLEDFKRQVETFKVDDNITSQMDKLRDGSRELANQLAVPGYSFHDGIYSATKGS
FT                   KDLSAGLNDLSGGVDQALTGVRDLDNGAKKIDAMAKENQTRVGNIQRALPITKAGTPEA
FT                   QEQGVTRTLAPLYAFLIAAGLMLAATAYLRDRIWGTIAFITLTLLGGGLVYLLGTEITA
FT                   GVAAAAAGVSALAVAGAALLGTLLTSIFGERTGRGLSALVTIAQVAVVGFVWNSAANSA
FT                   LSSAAKALVNFMPLHYPTLALSSIGNAGDTTTTALGVGVTAACAVCAAAGVMILRKKEE
FT                   QTLPTAE"
FT   misc_feature    order(262952..263011,263024..263092,263120..263188,
FT                   263207..263260,263375..263443)
FT                   /note="5 probable transmembrane helices predicted for
FT                   DIP0294 by TMHMM2.0"
FT   CDS_pept        complement(263559..264449)
FT                   /transl_table=11
FT                   /locus_tag="DIP0295"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJU8"
FT                   /protein_id="CAE48799.1"
FT                   /translation="MNVWGDKIRVIDTLRMSHTEYAQWITNQQHKHFNIHAELWADSEE
FT                   WEALNPWTRDWARILAVGKRARTGVICGRSAVRLWRLGILGYEEPVVVVLPGTKTAPRN
FT                   TKRWIHYRSARIPSNKITEHKGIRFTTMERSIGDLCRWGTFAEGLVAVESYLRQEDAQP
FT                   FLLEQELEEFGRIPGVRKFRRVLQVADSKSESVAESWAKAQLIEAKITFEQQVQINNRR
FT                   ADFLVGRVVIEIDGDIKFHDDESRAVLKERKRDRELQNAGYVVAHFDWESLNSGTFIPS
FT                   LLRLLEFTNTKTQGR"
FT   stem_loop       complement(264632..264673)
FT                   /note="Score 56: 19/20 (95%) matches, 0 gaps"
FT   tRNA            complement(264680..264753)
FT                   /gene="tRNA-Pro"
FT                   /product="transfer RNA-Pro"
FT                   /anticodon="(pos:264717..264719,aa:Pro)"
FT                   /note="tRNA Pro anticodon CGG, Cove score 67.50"
FT   CDS_pept        complement(264827..265741)
FT                   /transl_table=11
FT                   /locus_tag="DIP0296"
FT                   /product="Putative secreted protein"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551
FT                   conserved hypothetical protein MT3785 TR:AAK48152
FT                   (EMBL:AE007176) (319 aa) fasta scores: E(): 1.6e-59, 54.08%
FT                   id in 294 aa"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJU7"
FT                   /protein_id="CAE48800.1"
FT                   /translation="MIWVRLLKTLLGLTAATAATGAATLAWGYRECSNFELKTIDLPIL
FT                   EPGILRGNPHFSILHISDLHMVPTQTTKQRWVAQLDKLNPDLVVNTGDNLSDAKAVPAV
FT                   MQALSPLLKRPGVFVFGTNDYFAPRMVNPFVYLLGKKRTPSRVELPWKGMRAAFIEHGW
FT                   RDANQQRHEFKVDFLRLAITGVDDPHHDLDNYDDIAGAPNPDADLSIALTHSPEPRVLK
FT                   KFEQDGYMLSLSGHTHGGQICLPGSRALVTNCGIDRPRVQGLHRFGSMWMHVSNGLGTS
FT                   KFAPVRIFCKPSATLIRVTERTL"
FT   misc_feature    complement(265013..265576)
FT                   /note="ProfileScan hit to PS50185, Metallo-phosphoesterase
FT                   motif."
FT   misc_feature    complement(265676..265741)
FT                   /note="Signal peptide predicted for DIP0296 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.958) with cleavage site
FT                   probability 0.347 between residues 22 and 23"
FT   CDS_pept        265769..266233
FT                   /transl_table=11
FT                   /locus_tag="DIP0297"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551
FT                   conserved hypothetical protein MT3790 TR:AAK48157
FT                   (EMBL:AE007176) (154 aa) fasta scores: E(): 2e-23, 57.14%
FT                   id in 154 aa"
FT                   /db_xref="GOA:Q6NJU6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJU6"
FT                   /protein_id="CAE48801.1"
FT                   /translation="MSELKNKIRADLTTAMKAREKERTGTLRMLLAAIQTEETSGSKHE
FT                   LTDEDVLKVIAREIKKRRESAEVYAEAGRSELADAETNEANILAEYQPQQLDDDELAAL
FT                   VAEAVAQVKAELGEGVSMKQMGQVMKLATAQAAGRADGKRLSTAVRAALA"
FT   misc_feature    265787..266227
FT                   /note="HMMPfam hit to PF02637, GatB/Yqey domain"
FT   CDS_pept        complement(266238..268622)
FT                   /transl_table=11
FT                   /locus_tag="DIP0298"
FT                   /product="Putative penicillin-binding secreted protein"
FT                   /note="Similar to Mycobacterium leprae Pbp1 Pon1
FT                   SWALL:P72351 (EMBL:S82044) (821 aa) fasta scores: E():
FT                   4.9e-130, 48.08% id in 757 aa, and to Mycobacterium
FT                   tuberculosis CDC1551 penicillin-binding protein 1 MT3784
FT                   TR:AAK48151 (EMBL:AE007176) (810 aa) fasta scores: E():
FT                   4.8e-134, 48.75% id in 761 aa"
FT                   /db_xref="GOA:Q6NJU5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJU5"
FT                   /protein_id="CAE48802.1"
FT                   /translation="MWNSLKDIVLATVAGGVVCALALTPVAAIAGVAVDRTNDTMQSNL
FT                   QDLTDGSAPGVSTILDNRNNPIAWVYKQRRFEIPSEAIPQSMKDAIVSIEDRRFYEHKG
FT                   VDIQGNLRAIVTNIFAGGVAQGASTIDQQYVKNFLLLVKSDNPEEQAAATETSIPRKLR
FT                   EMRMASTIDSTLSKDDILTRYLNLVHLGNGAFGVEAAARTYFGKGAPELSLAQSAMFAG
FT                   IVQSSSYLDPYTNPDAVMDRRNVVLDTMAANGYATPEDVAAAKAEPLGVLEQPQGLPNG
FT                   CITAGDNGFFCDYVLKYLSEKGLSTDQLTQGSYTINTTLDPDVQQAAHAAAAGQVNSHT
FT                   FGVANVMNIVEPGKDSRKILAMTSSRDYGLDLDAGQTVLPQPTSLVGNGAGSVFKIFTA
FT                   AVALQQGYGLDTQLQVPPRYEAKGMGDGGAEGCGAGTYCVENSGSYAPQMSLRDALAFS
FT                   PNTPFVQMIEKVGVKDVVDTSVKLGLRSYANPGTFNKDNSIADYVKEHNLGSYTLGPTA
FT                   VNPLELSNVAASLASDGMWCEPSPITTVTDAKGNEVFLDRPACEQAIDPEIAQALSAGL
FT                   SQDTIKGTGAQAAKSLGFSAPTAAKTGTTESHSSAAFLGFNSNFAAASYIYNDGTTVTP
FT                   LCTSPVVQCGEGTLFGGDEPARTWFTAAQSSGLAASGNLPSYDPKFNRGVSGSFGTSYV
FT                   GREGESVRKELSAKGYKVTMTSAPGDGIPKGSVVNVIAPVPLKPGGTIELFISDGTRPR
FT                   TTPPSTTRRPNPTEEVVPGTGVSQNDLDDLAHQLQQLLPGF"
FT   misc_feature    complement(266640..267659)
FT                   /note="HMMPfam hit to PF00905, Penicillin binding protein
FT                   transpeptidase domain"
FT   misc_feature    complement(267912..268451)
FT                   /note="BlastProDom hit to PD001895, PD001895"
FT   misc_feature    complement(267912..268454)
FT                   /note="HMMPfam hit to PF00912, Transglycosylase"
FT   misc_feature    complement(268539..268622)
FT                   /note="Signal peptide predicted for DIP0298 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.619 between residues 28 and 29"
FT   CDS_pept        268821..269168
FT                   /transl_table=11
FT                   /locus_tag="DIP0299"
FT                   /product="Putative regulatory protein"
FT                   /note="Similar to Mycobacterium tuberculosis putative
FT                   regulatory protein Rv681c or MTV025.029c TR:O69649
FT                   (EMBL:AL022121) (100 aa) fasta scores: E(): 4.9e-22, 65.06%
FT                   id in 83 aa, and to Mycobacterium tuberculosis CDC1551
FT                   WhiB-related protein MT3783 TR:AAK48150 (EMBL:AE007176)
FT                   (118 aa) fasta scores: E(): 5.6e-22, 65.06% id in 83 aa"
FT                   /db_xref="GOA:Q6NJU4"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJU4"
FT                   /protein_id="CAE48803.1"
FT                   /translation="MTASLMNTGKKNPFRDTQQGEYGNGDRNDWVMQASCRNGDPDALF
FT                   VRGAEQRRAAAICRQCPVMIQCRADALDNKVEFGVWGGLTERQRRAILRKNPHVDSWEQ
FT                   FFAQGGELLGM"
FT   misc_feature    268908..269096
FT                   /note="HMMPfam hit to PF02467, Transcription factor WhiB"
FT   CDS_pept        269209..269364
FT                   /transl_table=11
FT                   /locus_tag="DIP0300"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical 6.1
FT                   kDa protein SCH17.10c TR:Q9XA37 (EMBL:AL079353) (53 aa)
FT                   fasta scores: E(): 5.4e-16, 85.71% id in 49 aa, and to
FT                   Mycobacterium tuberculosis CDC1551 conserved hypothetical
FT                   protein MT3780 TR:AAK48147 (EMBL:AE007175) (53 aa) fasta
FT                   scores: E(): 5.9e-14, 77.08% id in 48 aa"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJU3"
FT                   /protein_id="CAE48804.1"
FT                   /translation="MTKWEYSTVPLLTHATKQILDTWGEDGWELVSVVPGPNPENVVAY
FT                   MKRPVE"
FT   CDS_pept        269366..269830
FT                   /transl_table=11
FT                   /locus_tag="DIP0301"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551
FT                   conserved hypothetical protein MT3779 TR:AAK48146
FT                   (EMBL:AE007175) (151 aa) fasta scores: E(): 1.3e-30, 63.75%
FT                   id in 149 aa, and to Streptomyces coelicolor hypothetical
FT                   15.7 kDa protein SCH17.09c TR:Q9XA38 (EMBL:AL079353) (155
FT                   aa) fasta scores: E(): 2.5e-29, 62.25% id in 151 aa"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJU2"
FT                   /protein_id="CAE48805.1"
FT                   /translation="MGASISEKLAELNIMLPSVAAPVAAYVPAVKVGNQVWTSGQLPFI
FT                   DGQLPATGKVGATVTAEQAASYARTAALNALAAVDALVGIDNVTRILKVTGFVASATDF
FT                   GGQPAVVNGASNLIGEIFGEAGAHARSAVGVAELPLDAPVELEIIVEVAN"
FT   misc_feature    269417..269821
FT                   /note="HMMPfam hit to PF01042, YjgF family"
FT   CDS_pept        269881..270705
FT                   /transl_table=11
FT                   /locus_tag="DIP0302"
FT                   /product="Putative hydrolase"
FT                   /note="Similar to Mycobacterium tuberculosis putative
FT                   hydrolase Rv3677c or MTV025.025c TR:O69645 (EMBL:AL022121)
FT                   (264 aa) fasta scores: E(): 1.1e-18, 40.89% id in 269 aa"
FT                   /db_xref="GOA:Q6NJU1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJU1"
FT                   /protein_id="CAE48806.1"
FT                   /translation="MLKAMEHPAYSQLRPVTPSAGVVLCPNPGYSSLEGTNSWVVRAEG
FT                   DRCSIVIDPGPADEGHLNVLHGKAETVGLVLLTHRHHDHADGAERFRQLTGAAIRAQQA
FT                   PYCHGGDVLRDGEIIAIDGVTPQLEVVFTPGHTSDSVCFFVWSGVPHESNLEGIITGDT
FT                   IAGRHTTMISETDGDLGQYLNTLALLEKRGKGIALLPGHGPDGDDVASFAHWYIERRMQ
FT                   RLEQIKEAIAQRGADVPIKELIDAVYDDVDPVLRGAAEQSTRVALRYLAQQQ"
FT   misc_feature    269971..270486
FT                   /note="HMMPfam hit to PF00753, Metallo-beta-lactamase
FT                   superfamily"
FT   CDS_pept        complement(270766..271449)
FT                   /transl_table=11
FT                   /locus_tag="DIP0303"
FT                   /product="Putative transcription regulator"
FT                   /note="Similar to Corynebacterium glutamicum probable
FT                   transcription regulator TR:AAK58838 (EMBL:AF293334) (227
FT                   aa) fasta scores: E(): 8e-79, 91.18% id in 227 aa, and to
FT                   Escherichia coli catabolite gene activator Crp or Cap or
FT                   Csm or B3357 or Z4718 or ECS4208 SW:CRP_ECOLI (P03020) (210
FT                   aa) fasta scores: E(): 4.6e-15, 33.68% id in 190 aa"
FT                   /db_xref="GOA:Q6NJU0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJU0"
FT                   /protein_id="CAE48807.1"
FT                   /translation="MEGVQDILSRAGIFQGVDPIAVNNLIEDLESVRFPRGATIFEEGE
FT                   PGDRLYIITSGKVKLARHSMDGRENLLTVMGPSDMFGELSIFDPGPRTSSAVCVTEVHA
FT                   ATMNSEMLRQWIAEHPEISEQLLRVLARRLRRTNNSLADLIFTDVPGRVAKTLLQLANR
FT                   FGTQEGGALRVNHDLTQEEIAQLVGASRETVNKALATFAHRNWIRLEGKSVLIVDTEHL
FT                   AKRAR"
FT   misc_feature    complement(270796..270942)
FT                   /note="HMMSmart hit to SM00419, helix_turn_helix, cAMP
FT                   Regulatory protein, DNA-binding"
FT   misc_feature    complement(270829..270921)
FT                   /note="HMMPfam hit to PF00325, Bacterial regulatory
FT                   proteins, crp family"
FT   misc_feature    complement(270853..270918)
FT                   /note="Predicted helix-turn-helix motif with score 1990
FT                   (+5.96 SD) at aa 178-199, sequence LTQEEIAQLVGASRETVNKALA"
FT   misc_feature    complement(271048..271413)
FT                   /note="HMMSmart hit to SM00100, Cyclic
FT                   nucleotide-monophosphate binding domain"
FT   misc_feature    complement(271051..271413)
FT                   /note="ProfileScan hit to PS50042, cAMP/cGMP binding
FT                   motif."
FT   misc_feature    complement(271087..271368)
FT                   /note="HMMPfam hit to PF00027, Cyclic nucleotide-binding
FT                   domain"
FT   misc_feature    complement(271144..271179)
FT                   /note="FPrintScan hit to PR00103, cAMP-dependent protein
FT                   kinase signature"
FT   misc_feature    complement(271186..271215)
FT                   /note="FPrintScan hit to PR00103, cAMP-dependent protein
FT                   kinase signature"
FT   misc_feature    complement(271261..271305)
FT                   /note="FPrintScan hit to PR00103, cAMP-dependent protein
FT                   kinase signature"
FT   misc_feature    complement(271306..271350)
FT                   /note="FPrintScan hit to PR00103, cAMP-dependent protein
FT                   kinase signature"
FT   CDS_pept        271954..272709
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="DIP0304"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="Similar to Mycobacterium tuberculosis endonuclease
FT                   III Nth or Rv3674c or MT3775 or MTV025.022c SW:END3_MYCTU
FT                   (O69642) (245 aa) fasta scores: E(): 2.2e-59, 62.04% id in
FT                   245 aa, and to Bacillus subtilis probable endonuclease III
FT                   Nth or JooB SW:END3_BACSU (P39788) (219 aa) fasta scores:
FT                   E(): 1.4e-28, 41.96% id in 193 aa"
FT                   /db_xref="GOA:Q6NJT9"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJT9"
FT                   /protein_id="CAE48808.1"
FT                   /translation="MSRPDLAQQPTALAVKRRARAINRELAKAYPDAHCELDFNNPLEL
FT                   TVATVLSAQCTDVRVNQITPALFAKYPTAEAYASANEAELQEMIRPTGFYKAKAAHLIG
FT                   MGQKLVTDFSGEIPRDLESLVSLPGVGRKTAHVVRGNAFDIPGLTVDTHFGRLVRRLGL
FT                   TTQTNPVKVEHEIADLIEKKEWTMFSHRIIFHGRRVCHSRTAACGACFLAPRCPSYGEA
FT                   GPTDPLRAETLVTGDNREHLLQMAGIGNA"
FT   misc_feature    272080..272544
FT                   /note="HMMPfam hit to PF00730, HhH-GPD superfamily base
FT                   excision DNA repair protein"
FT   misc_feature    272104..272547
FT                   /note="HMMSmart hit to SM00478, endonuclease III"
FT   misc_feature    272548..272610
FT                   /note="HMMSmart hit to SM00525, No definition"
FT   CDS_pept        272702..273262
FT                   /transl_table=11
FT                   /locus_tag="DIP0305"
FT                   /product="Putative secreted protein"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551
FT                   thioredoxin-related protein MT3774 TR:AAK48141
FT                   (EMBL:AE007175) (227 aa) fasta scores: E(): 7.6e-13, 32.84%
FT                   id in 204 aa"
FT                   /db_xref="GOA:Q6NJT8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJT8"
FT                   /protein_id="CAE48809.1"
FT                   /translation="MRKTIVVSALVFVAVFAALISMIVGNNNEPTPENLQEETQNVASR
FT                   PDCEVSTVAGVQLDCLGGNAHMSDGNPKITVVNVWAWWCEPCRAELPLFDTLAQRHPEL
FT                   RVIGVHADTNAANGAALLNDLGVSLPSLQDNHNAFAGTLGLPNVVPITVIMNADGSKEA
FT                   VMPRAFSTYEELETAVMAKVHKG"
FT   misc_feature    272702..272782
FT                   /note="Signal peptide predicted for DIP0305 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.174 between residues 27 and 28"
FT   misc_feature    272846..273244
FT                   /note="ProfileScan hit to PS50223, Thioredoxin-domain (does
FT                   not find all)."
FT   misc_feature    272927..272983
FT                   /note="ScanRegExp hit to PS00194, Thioredoxin family active
FT                   site."
FT   CDS_pept        273265..274002
FT                   /transl_table=11
FT                   /locus_tag="DIP0306"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical 26.5
FT                   kDa protein SCH17.02c TR:Q9XA45 (EMBL:AL079353) (247 aa)
FT                   fasta scores: E(): 1.9e-26, 40.08% id in 227 aa"
FT                   /db_xref="GOA:Q6NJT7"
FT                   /db_xref="InterPro:IPR000059"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJT7"
FT                   /protein_id="CAE48810.1"
FT                   /translation="MDFPQPDAPGHNIDLRPEFAPRWLSPLVSDVANGVICDRLRRVLA
FT                   PPQRTETTKQAAVLMLLAGDPLAHTVPNDATVLLTHRSPTMRSHSGQIAFPGGRMDPTD
FT                   HNVVDCALREAWEETGVDRMNVTPLVTFPMLHIRATGYPVHPVLGYWHRPSRVGVVSPN
FT                   EADAVAAIPIAELADPSNRLTVEFDRWSGPAFRINDFIIWGFTGGLLDAMLYQAGWEQP
FT                   WDSHKHYDLYDTLARSRNNERLT"
FT   misc_feature    273421..273846
FT                   /note="HMMPfam hit to PF00293, MutT-like domain"
FT   misc_feature    273496..273558
FT                   /note="ScanRegExp hit to PS01293, Uncharacterized protein
FT                   family UPF0035 signature."
FT   CDS_pept        274025..275221
FT                   /transl_table=11
FT                   /locus_tag="DIP0307"
FT                   /product="Putative serine protease (mycosin)"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551 serine
FT                   protease MT3772 TR:AAK48139 (EMBL:AE007175) (397 aa) fasta
FT                   scores: E(): 1.5e-47, 38.19% id in 398 aa"
FT                   /db_xref="GOA:Q6NJT6"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJT6"
FT                   /protein_id="CAE48811.1"
FT                   /translation="MTPGMTVDAAIVIALVIAIFTGWRQGAVSSVLSTLGVVAGLICGA
FT                   AAAPFVMGLTEHVALRFLLALGTVILLVGVGNLVGGILGAQLRDHFLWKKTMWIDSAIG
FT                   SVFQTLATLLVAWLVSIPLATGLSGGISQGIKNSEILGFVDHGAPSQLSALPSKISAML
FT                   NESGLPPLVSPFMEKQHSSQVEAPAIKVADTALVERLRPSVIHVLGESEECSRRLMGSG
FT                   FVVDATHVMTNAHVVAGTQRVSLDTVVGMVDATVVYYNPQLDIAVLEAEGLNLPALQWA
FT                   PEPAETGADAIVMGFPESGPFEAAPARISDRIIIAGPDIYANGRVERESYTARGSIRQG
FT                   NSGGPMVDAEGNVIGVVFGASVDATDIGYALTAKEVLNMVGDTSALHTPVATQQCVVN"
FT   misc_feature    order(274034..274093,274112..274180,274208..274276,
FT                   274313..274381)
FT                   /note="4 probable transmembrane helices predicted for
FT                   DIP0307 by TMHMM2.0"
FT   misc_feature    274682..274735
FT                   /note="FPrintScan hit to PR00839, V8 serine protease family
FT                   signature"
FT   misc_feature    274706..274744
FT                   /note="FPrintScan hit to PR00834, HtrA/DegQ protease family
FT                   signature"
FT   misc_feature    274766..274828
FT                   /note="FPrintScan hit to PR00834, HtrA/DegQ protease family
FT                   signature"
FT   misc_feature    275003..275056
FT                   /note="FPrintScan hit to PR00834, HtrA/DegQ protease family
FT                   signature"
FT   misc_feature    275015..275065
FT                   /note="FPrintScan hit to PR00839, V8 serine protease family
FT                   signature"
FT   misc_feature    275066..275104
FT                   /note="FPrintScan hit to PR00839, V8 serine protease family
FT                   signature"
FT   misc_feature    275207..275218
FT                   /note="ScanRegExp hit to PS00294, Prenyl group binding site
FT                   (CAAX box)."
FT   CDS_pept        complement(275218..276156)
FT                   /transl_table=11
FT                   /locus_tag="DIP0308"
FT                   /product="Putative hydrolase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   hydrolase SCH5.29 TR:Q9X931 (EMBL:AL035636) (324 aa) fasta
FT                   scores: E(): 5.8e-17, 31.21% id in 330 aa"
FT                   /db_xref="GOA:Q6NJT5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJT5"
FT                   /protein_id="CAE48812.1"
FT                   /translation="MAAFFRRSNHSPKVPPVPISPHVVELEGPFSHIMLHTRGVRLHAA
FT                   TAGDPTNPLIVLLHDSFGGWFDFKECLAPLAAAGFHVAAIDFRGYGLSDKPPTGYDHYL
FT                   ATGDIAGSIRTLGHESAHVIACSSGAAIAWLLAANYPRHVASLTTMGAIHPLDMRRAII
FT                   GRPWLFTYPVSMTTMFRLPRVLSKRLWRLKDMWVERDLRRWTSLSFQASPKFADTLALR
FT                   RLAMSIDSTFPAVAKTSRYVVNVPPLKWASQHVTAPTHVLVDATPYARYLARRAASRCT
FT                   GDFDTFSIPSTRMRPHLEDPAAFVAQVLKLL"
FT   misc_feature    complement(275221..275919)
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold"
FT   misc_feature    complement(275707..275748)
FT                   /note="FPrintScan hit to PR00111, Alpha/beta hydrolase fold
FT                   signature"
FT                   /note="FPrintScan hit to PR00412, Epoxide hydrolase
FT                   signature"
FT   misc_feature    complement(275731..276000)
FT                   /note="ProfileScan hit to PS50187,
FT                   Esterase/lipase/thioesterase active site serine."
FT   misc_feature    complement(275749..275790)
FT                   /note="FPrintScan hit to PR00111, Alpha/beta hydrolase fold
FT                   signature"
FT                   /note="FPrintScan hit to PR00412, Epoxide hydrolase
FT                   signature"
FT   misc_feature    complement(275875..275922)
FT                   /note="FPrintScan hit to PR00111, Alpha/beta hydrolase fold
FT                   signature"
FT                   /note="FPrintScan hit to PR00412, Epoxide hydrolase
FT                   signature"
FT   misc_feature    complement(275926..275982)
FT                   /note="FPrintScan hit to PR00412, Epoxide hydrolase
FT                   signature"
FT   CDS_pept        complement(276244..276765)
FT                   /transl_table=11
FT                   /locus_tag="DIP0309"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   18.9 kDa protein Rv3669 or MTV025.017 TR:O69637
FT                   (EMBL:AL022121) (172 aa) fasta scores: E(): 1.8e-20, 51.85%
FT                   id in 135 aa"
FT                   /db_xref="GOA:Q6NJT4"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJT4"
FT                   /protein_id="CAE48813.1"
FT                   /translation="MIWRDRPVSNDKGFFTEGNDAFEAKVNAIPLTDVDATNKGSIGSL
FT                   VSDATAQMSSLFRAEVELAKTELAVEAKKGVIGGGMFGVAGTIALYSSFFFFFFLAELL
FT                   NLWIDRWAAFLIVFLFMLVLAGVLALVGFKKVKKISKPKETINSVNELKKLVPGKAQAK
FT                   LEASNRGLYS"
FT   misc_feature    complement(order(276367..276432,276463..276528))
FT                   /note="2 probable transmembrane helices predicted for
FT                   DIP0309 by TMHMM2.0"
FT   CDS_pept        276872..277525
FT                   /transl_table=11
FT                   /locus_tag="DIP0310"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   26.4 kDa protein Rv3662c or MTV025.010c TR:O69630
FT                   (EMBL:AL022121) (256 aa) fasta scores: E(): 3.1e-07, 31.44%
FT                   id in 229 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJT3"
FT                   /protein_id="CAE48814.1"
FT                   /translation="MNGLLDREDIRTLLAEAESTIAAVHRRPVSLRRSDLTSAEGVLRG
FT                   ARSSAQLTPQISEQHHISAYSVLAPDHIARSSTTFVRAPLQLLARIDVLSGGTGRPEQG
FT                   SAALQSLAGFISARPHSGLGPAVVHGEILAHAPFGPRSAIVARVASRVLAYGLGFDPRG
FT                   LCVPEPYLRRHHEDYHRCADHWADSADAAADFVALHLRAWIAGAAEAESIAAAV"
FT   CDS_pept        complement(277463..278368)
FT                   /transl_table=11
FT                   /locus_tag="DIP0311"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   30.7 kDa protein Rv3661 or MT3761 or MTV025.009
FT                   SW:Y0G1_MYCTU (O69629) (287 aa) fasta scores: E(): 2.2e-40,
FT                   45.22% id in 272 aa, and to Streptomyces coelicolor
FT                   putative morphological differentiation-associated protein
FT                   SCH5.21 TR:Q9X923 (EMBL:AL035636) (268 aa) fasta scores:
FT                   E(): 5e-38, 45.8% id in 262 aa"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJT2"
FT                   /protein_id="CAE48815.1"
FT                   /translation="MATNTGHSNPKEALTFMNAPQLDIHQPRIAAFFDLDKTIIATSSA
FT                   LAYGREFMHSGLITPAEALQMSMAKATYMFSGYSSEQMDHTKNQLAHLITGWSEEQVRE
FT                   IANDTLQSVVAPAIYAEARDLIHMHQETGHDVVIISASARILVEAIAAELGVDQVVATE
FT                   LTVVDGKFTGEVPFYCKGAAKAQAILDLTDKRGYQLDRSFAYSDSITDLPMLEAVGNPR
FT                   AVNPDRALKKVALDRDWEIHTFKNPVALFSKPTKRDLQISTGVAAGVAAVVGSVMWWKS
FT                   LNGRSDRLRLSCTRDPGTQM"
FT   misc_feature    complement(277685..278287)
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase"
FT   CDS_pept        278791..279828
FT                   /transl_table=11
FT                   /locus_tag="DIP0312"
FT                   /product="Putative morphological differentiation-related
FT                   protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   35.8 kDa protein Rv3660c or MT3760 or MTV25.008c TR:O69628
FT                   (EMBL:AL022121) (350 aa) fasta scores: E(): 9.7e-19, 30.29%
FT                   id in 340 aa, and to Streptomyces cyaneus (Streptomyces
FT                   curacoi) inhibition of morphological differentiation
FT                   TR:O33612 (EMBL:AB004855) (370 aa) fasta scores: E():
FT                   1.6e-13, 33.08% id in 266 aa"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJT1"
FT                   /protein_id="CAE48816.1"
FT                   /translation="MNTPHPSAPVLVAVANPTIHPEALHIVAATGRECIDTTDPREISR
FT                   HAHRVAAMLVDATTAPHMASLPPNTRVMYLEPEPGPIDYEKAMKSGAELAVIVPAQSPE
FT                   LLKALGRRDVAPRAGKYPVIAVIGAAGGAGTSTLCAALAADYREALLIDTEHFSGGIDL
FT                   LLGKEDDPGIRWDDVPDSGEKVPASELLASLPCVDPNVRILAATRDSVTHVAEQQLRGV
FT                   VESVRGTCPIIIDVQRHHVLFESCVDLADLVVLLVPAEIRSVAAAAQLVPWLRRRKVDV
FT                   VGVLRERAWASVDREEVARVTGADIVATVPTVKGLPREVELGGMATIPRALRRPLAQLR
FT                   SHIDG"
FT   misc_feature    279748..279771
FT                   /note="ScanRegExp hit to PS00687, Aldehyde dehydrogenases
FT                   glutamic acid active site."
FT   CDS_pept        279821..280918
FT                   /transl_table=11
FT                   /locus_tag="DIP0313"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   36.7 kDa protein Rv3659c or MTV025.007c TR:O69627
FT                   (EMBL:AL022121) (352 aa) fasta scores: E(): 6.7e-51, 52.21%
FT                   id in 316 aa"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJT0"
FT                   /protein_id="CAE48817.1"
FT                   /translation="MGDQRQRIAEEVQRYVAEHPDVAAGTSLAQVVRRYAGGVIGDVEV
FT                   LEILRQIRHDSVGVGPLEHILAIPGVTDIVVNGVHGVWFDRGRGLEQAAPCFDDEGEVM
FT                   RLATRLLVASGNRLDSAQCYSDGRITRDDGSSLRVHAVLSPPSESGPLISIRVLRQADV
FT                   SMTDLIAHNTFTAEVAQILENLVRERRPLLIVGGTGSGKTTLLSALLATVAHDQRIICI
FT                   EDTPELQPVHPHVVKLISRSSNTEGRGHITMTDLLRQALRMRPDRIVVGEIRGAEVVDL
FT                   LAALNTGHDGCAGTLHANSLREVPARLEALAAVGGLDRNALHSQLAAARPVVIVVRSTP
FT                   QGRRLHQIGELSGTPITPHVIWEEA"
FT   misc_feature    280391..280450
FT                   /note="ProfileScan hit to PS50101, P-loop nucleotide
FT                   binding motif (does not find all)."
FT   misc_feature    280394..280720
FT                   /note="HMMPfam hit to PF00437, Bacterial type II secretion
FT                   system protein"
FT   misc_feature    280406..280429
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    280445..280495
FT                   /note="ScanRegExp hit to PS00778, Histidine acid
FT                   phosphatases active site signature."
FT   CDS_pept        280915..281661
FT                   /transl_table=11
FT                   /locus_tag="DIP0314"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Mycobacterium tuberculosis putative
FT                   transmembrane protein Rv3658c or MTV025.006c TR:O69626
FT                   (EMBL:AL022121) (266 aa) fasta scores: E(): 6.1e-17, 36.52%
FT                   id in 230 aa"
FT                   /db_xref="GOA:Q6NJS9"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJS9"
FT                   /protein_id="CAE48818.1"
FT                   /translation="MSMSFFLCALACVVPSVRWKPIVCNKIVSLAALVLLPIMLVIWEP
FT                   VMIAAVLITATVIRTVMGIRRNRADRTTQEALSSALGIIAGDLRCGLGTWDALARVAQE
FT                   PTTHAPLAAACAAAARRARAGGSAADVLADYSHSIAGLQRVARVWKLSETHGISVAPLV
FT                   EQLHNEIDDRLRHRDRTKAALQGAQATAIVLSLLPLFGLGMGIGLGAPVLAFLLNNAIG
FT                   QTLLIVGTALQCAGLLWSQALIKAVG"
FT   misc_feature    order(280975..281043,281053..281106,281479..281547,
FT                   281575..281643)
FT                   /note="4 probable transmembrane helices predicted for
FT                   DIP0314 by TMHMM2.0"
FT   CDS_pept        281661..282239
FT                   /transl_table=11
FT                   /locus_tag="DIP0315"
FT                   /product="Putative secreted protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   19.1 kDa protein Rv3657c or MTV025.005c TR:O69625
FT                   (EMBL:AL022121) (191 aa) fasta scores: E(): 2.9e-10, 36.66%
FT                   id in 150 aa"
FT                   /db_xref="GOA:Q6NJS8"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJS8"
FT                   /protein_id="CAE48819.1"
FT                   /translation="MLSLSAFILATAIFLTNPPPRMSADTKLALPSWLSALMAYNQRLR
FT                   TRCDYHAAAEQLDIFVATSRAGLSLAQACAAVAATTSSAVDAEPWRQVAAMASLGVPMS
FT                   RACTPLANTEGLVAVVAVMRAADASGASIAAGCERIARSLRDHAVDTYTAQAERTGVLI
FT                   ALPLTLCFLPAFFLLGLAPVAISLGMDIL"
FT   misc_feature    281661..281729
FT                   /note="Signal peptide predicted for DIP0315 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.964) with cleavage site
FT                   probability 0.790 between residues 23 and 24"
FT   misc_feature    281814..282065
FT                   /note="ProfileScan hit to PS50310, Alanine-rich region."
FT   misc_feature    282141..282209
FT                   /note="1 probable transmembrane helix predicted for DIP0315
FT                   by TMHMM2.0"
FT   CDS_pept        282263..282460
FT                   /transl_table=11
FT                   /locus_tag="DIP0316"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   7.1 kDa protein Rv3656c or MTV025.004c TR:O69624
FT                   (EMBL:AL022121) (68 aa) fasta scores: E(): 2.6e-05, 43.33%
FT                   id in 60 aa"
FT                   /db_xref="GOA:Q6NJS7"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJS7"
FT                   /protein_id="CAE48821.1"
FT                   /translation="MLTTIVNRFRLLASDDSGMTTIEYALGAVAATALAGALYLVASSG
FT                   AVADALEGIITNALNNAPGK"
FT   misc_feature    282323..282391
FT                   /note="1 probable transmembrane helix predicted for DIP0316
FT                   by TMHMM2.0"
FT   CDS_pept        282457..282732
FT                   /transl_table=11
FT                   /locus_tag="DIP0317"
FT                   /product="Putative secreted protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   13.0 kDa protein Rv3655c or MTV025.003c TR:O69623
FT                   (EMBL:AL022121) (125 aa) fasta scores: E(): 1.4, 31.81% id
FT                   in 66 aa"
FT                   /db_xref="GOA:Q6NJS6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJS6"
FT                   /protein_id="CAE48822.1"
FT                   /translation="MTTLEAAIAGASVIVLTALMGAGIVTIAAQISAIDQANAAARAHA
FT                   IGVAYTPSRGHIDIDNTGGIVTVHAHVGSPLGIRSAEASFPKEMMP"
FT   misc_feature    282457..282591
FT                   /note="Signal peptide predicted for DIP0317 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.255 between residues 45 and 46"
FT   CDS_pept        282729..283055
FT                   /transl_table=11
FT                   /locus_tag="DIP0318"
FT                   /product="Putative secreted protein"
FT                   /note="Similar to the central region of Streptomyces
FT                   coelicolor membrane spanning protein SCH5.14c TR:Q9X916
FT                   (EMBL:AL035636) (230 aa) fasta scores: E(): 2.6e-05, 35.23%
FT                   id in 105 aa"
FT                   /db_xref="GOA:Q6NJS5"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJS5"
FT                   /protein_id="CAE48823.1"
FT                   /translation="MNLLDNDHGNATVVGAGAALFLSAMFFAIVALATRTVDTHQAQLA
FT                   ADMTAVAAAWSYAQGHDACAQARVVATAHHAELAECTIDGEDVELTTSVREQRATARAG
FT                   PLRE"
FT   misc_feature    282729..282827
FT                   /note="Signal peptide predicted for DIP0318 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.894) with cleavage site
FT                   probability 0.523 between residues 33 and 34"
FT   misc_feature    282774..282965
FT                   /note="ProfileScan hit to PS50310, Alanine-rich region."
FT   CDS_pept        complement(283045..285381)
FT                   /transl_table=11
FT                   /locus_tag="DIP0319"
FT                   /product="Putative ATP-dependent RNA helicase, DeaD/DeaH
FT                   box family"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551
FT                   ATP-dependent RNA helicase, DeaD/DeaH box family MT3751
FT                   TR:AAK48112 (EMBL:AE007173) (771 aa) fasta scores: E():
FT                   1.3e-152, 54.73% id in 760 aa, and to Bacillus subtilis
FT                   putative helicase YprA SW:YPRA_BACSU (P50830) (749 aa)
FT                   fasta scores: E(): 4.7e-67, 34.86% id in 763 aa"
FT                   /db_xref="GOA:Q6NJS4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJS4"
FT                   /protein_id="CAE48824.1"
FT                   /translation="MSSSSPFMGYQLGEELAESVAQRYPNSTCTHIENIPPRSAHYLPW
FT                   PAWTAPELQRELERRGIAQLYSHQAQAADLAWTGTNVVVATGTSSGKSLSYLLPILSAM
FT                   SQDPQACALYLTPTKALGSDQLAHVMSLVGNVDTLTGVHPAPYDGDTPTDARAGIREQS
FT                   RFVFSNPDMLHTGILPNHQRWARFFRHLRFIVIDECHSYRGVFGAGVALVIRRLLRLAA
FT                   RYGSTPTVMLASATSNDPAAHASTLIGQPVVAVTEDGAPTGARTVMLWEPGFVDGAEGE
FT                   NGAPIRRAASTESAGIMATLIAAGARTLTFVRSRRQAEVVALRCAEELACHGRHDFASR
FT                   VAAYRAGYLAEDRRALERKLDDGTLLGVASTNALELGIDVGGLDAVVTAGYPGTVASFW
FT                   QQAGRAGRRGQGSLVTLVARDDPMDTYLVHHPEALLGRPMEKIVFDPHNPHILSGHLYC
FT                   AAAESPLTEAEIDALNAREVAQQLAHDGYLRHRPTGWFAVEQPGQPPAHSLVSLRGSGH
FT                   HVAIVDRSDGRLLGTIDSARAASQVHPGAVYLHQGETFVIEELDDQVALAVPDQPDYQT
FT                   FARSTTDIRIVGEVDKVCNPAPGLWVSNLVVEVTDRVVGYTMKASDGSVLAMVPLQMPP
FT                   QTLVTRAVAYTVDPLVLDSLGITDVPGALHAAEHAAIGLLPLIATCDRWDIGGVSTAEH
FT                   PDTGLPTVFVYDGHPGGAGFADCGYERFPEWVATTFEAIRSCQCESGCPSCVQSPKCGN
FT                   GNDPLSKEGAIALLGAMCTMLGVTP"
FT   misc_feature    complement(284134..285048)
FT                   /note="ProfileScan hit to PS50136, DNA/RNA helicase domain
FT                   (DEAD/DEAH box)."
FT   misc_feature    complement(284155..284403)
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain"
FT                   /note="HMMSmart hit to SM00490, helicase superfamily
FT                   c-terminal domain"
FT   misc_feature    complement(284578..285201)
FT                   /note="HMMSmart hit to SM00487, DEAD-like helicases
FT                   superfamily, catalytic domain"
FT   misc_feature    complement(284614..285219)
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase"
FT   CDS_pept        285652..285855
FT                   /transl_table=11
FT                   /gene="cspA"
FT                   /locus_tag="DIP0320"
FT                   /product="cold-shock protein"
FT                   /note="Similar to Mycobacterium smegmatis cold-shock
FT                   protein CspA TR:Q9KGW0 (EMBL:AF281675) (67 aa) fasta
FT                   scores: E(): 5.8e-23, 86.56% id in 67 aa"
FT                   /db_xref="GOA:Q6NJS3"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJS3"
FT                   /protein_id="CAE48825.1"
FT                   /translation="MAQGTVKWFNAEKGFGFIAPEDGSADVFVHYSEIQGNGFRTLEEN
FT                   QKVEFEVGEGAKGPQAQQVRAI"
FT   misc_feature    285652..285852
FT                   /note="HMMPfam hit to PF00313, 'Cold-shock' DNA-binding
FT                   domain"
FT   misc_feature    285658..285852
FT                   /note="HMMSmart hit to SM00357, Cold shock protein domain"
FT   misc_feature    285661..285708
FT                   /note="FPrintScan hit to PR00050, Cold shock protein
FT                   signature"
FT   misc_feature    285694..285753
FT                   /note="ScanRegExp hit to PS00352, 'Cold-shock' domain
FT                   signature."
FT   misc_feature    285694..285843
FT                   /note="BlastProDom hit to PD000621, PD000621"
FT   misc_feature    285724..285753
FT                   /note="FPrintScan hit to PR00050, Cold shock protein
FT                   signature"
FT   misc_feature    285769..285825
FT                   /note="FPrintScan hit to PR00050, Cold shock protein
FT                   signature"
FT   CDS_pept        286029..286646
FT                   /transl_table=11
FT                   /locus_tag="DIP0321"
FT                   /product="Putative ABC transport system ATP-binding
FT                   protein"
FT                   /note="Similar to Streptomyces coelicolor ABC transporter
FT                   ATP-binding protein SC4A2.02c TR:O86658 (EMBL:AL031182)
FT                   (229 aa) fasta scores: E(): 6.7e-12, 39.3% id in 201 aa"
FT                   /db_xref="GOA:Q6NJS2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJS2"
FT                   /protein_id="CAE48826.1"
FT                   /translation="MEAPIVSMRDVTIETDGGVRLVHVDELDIFRGDTIAITGRSGSGK
FT                   TMLLRALCGAHTAGITVRGSIQRAQRAALIMQDSLGSLNPLVRCEKQVRLMAGDPHAAR
FT                   QALADCGITPELARRYPLELSGGQRQRVAIAGAIASNPKLLLADEPTSALDPVATLAVV
FT                   DALRAFQSATGGAVAISTHSMGVARRLGSRRFHVAEGKVTQL"
FT   misc_feature    286119..286628
FT                   /note="HMMSmart hit to SM00382, ATPases associated with a
FT                   variety of cellular activities"
FT   misc_feature    286122..286628
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    286128..286190
FT                   /note="ProfileScan hit to PS50101, P-loop nucleotide
FT                   binding motif (does not find all)."
FT   misc_feature    286143..286166
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    286398..286442
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   misc_feature    286398..286598
FT                   /note="ProfileScan hit to PS50100, 2nd half motif for
FT                   nucleotide binding, associated with P-loop."
FT   CDS_pept        286643..287350
FT                   /transl_table=11
FT                   /locus_tag="DIP0322"
FT                   /product="Putative ABC transport system ATP-binding
FT                   protein"
FT                   /note="Similar to Escherichia coli hypothetical ABC
FT                   transporter ATP-binding protein YddO or B1483 SW:YDDO_ECOLI
FT                   (P77622) (308 aa) fasta scores: E(): 1.7e-15, 36.36% id in
FT                   209 aa"
FT                   /db_xref="GOA:Q6NJS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJS1"
FT                   /protein_id="CAE48827.1"
FT                   /translation="MSTSALIEFHGASVAGRVTNLSFSVHTGDKLGVIGPSGAGKTTLI
FT                   SLITGMLTPDSGSVDIHANVVGYIPQDPGSSLCPRMTVAECIIEPQVIRLRGHADKARE
FT                   LQRLQESIPVILTALGLDPEIARRKPRQLSGGQRQRVAIARALLGEPELVIADEAFSAL
FT                   DQDTARLLQDLLLGSSSTVIFVSHNVTALRATCDDLLIMIDGTVRYHGPADNVDTTDPE
FT                   VAAFLAAAKELAQ"
FT   misc_feature    286721..287284
FT                   /note="HMMSmart hit to SM00382, ATPases associated with a
FT                   variety of cellular activities"
FT   misc_feature    286724..287257
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    286730..286807
FT                   /note="ProfileScan hit to PS50101, P-loop nucleotide
FT                   binding motif (does not find all)."
FT   misc_feature    286745..286768
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    287039..287083
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   misc_feature    287039..287245
FT                   /note="ProfileScan hit to PS50100, 2nd half motif for
FT                   nucleotide binding, associated with P-loop."
FT   CDS_pept        287347..288594
FT                   /transl_table=11
FT                   /locus_tag="DIP0323"
FT                   /product="Putative ABC transport system membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   transport system permease protein sc4g2.20 TR:O86692
FT                   (EMBL:AL031371) (436 aa) fasta scores: E(): 4.5e-47, 42.61%
FT                   id in 406 aa"
FT                   /db_xref="GOA:Q6NJS0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJS0"
FT                   /protein_id="CAE48828.1"
FT                   /translation="MTRAKLPVHITFLLVTQMLFSIGFYLVVPFLAVQLSENLGASGTI
FT                   VGLVLGIRTFSQQGLFFFGGGLADKFGAGPILLIGVAIRVIGFLTVGMAETVTLMTLGV
FT                   VLIGFAAALFSPAVESIFAAEGHRLEKLGVITRARLFALDAAYSRIGTLTGPVIGAVLI
FT                   PLGFATVSIAGAAIFGSIFVIHLALRRTWTASAQPQRTHAPSMMAVWGEVIRNKKFVVF
FT                   ALLYSTYLLAYNQQYLSLPVELRRATGSDEALGWFFAVSAVFVIALQSRVTRWAERQAA
FT                   AAALGGGFGLMALSFAVVAVASISLELEGWIAYVPAAAMMILLHTGIMIAVPIARDLVG
FT                   DLAGNNNLGSYYGFLNSFGGLAVLLGSLTVGATLDHAETTQPMAAIPWLIMVAVLAVSA
FT                   VGLAQLKEKQKVDITQ"
FT   misc_feature    287347..287469
FT                   /note="Signal peptide predicted for DIP0323 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.788) with cleavage site
FT                   probability 0.567 between residues 41 and 42"
FT   misc_feature    order(287461..287514,287557..287625,287650..287718,
FT                   287830..287898,288001..288060,288103..288162,
FT                   288196..288264,288274..288342,288400..288468,
FT                   288496..288555)
FT                   /note="10 probable transmembrane helices predicted for
FT                   DIP0323 by TMHMM2.0"
FT   CDS_pept        288591..290078
FT                   /transl_table=11
FT                   /locus_tag="DIP0324"
FT                   /product="Putative secreted protein"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   solute-binding lipoprotein SC4G2.18 TR:O86690
FT                   (EMBL:AL031371) (503 aa) fasta scores: E(): 1.3e-64, 39.63%
FT                   id in 497 aa"
FT                   /db_xref="GOA:Q6NJR9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJR9"
FT                   /protein_id="CAE48830.1"
FT                   /translation="MKKKLGLAVATLAVATTLSGCFTDAGQANDDALRVALQFKPVADF
FT                   SPYSDDAVLNLRMGAVETLVTLDEDGKPKPVLAEKWEMKDDRTAVLTLRKDVSFHDGSK
FT                   LTGEVVKNALDHALSATTRPKGLGKADLKVEATGESEVTITAPEADPILVQRLTDPGAA
FT                   ILSKDAYAGENPDPFNHGTGPFKLVKKESDGSVSAEAFADYWNGTPETSALKVSFIEDG
FT                   AARANAFRAGDFDVIKGVPVVALPELSDAHVTDVHLPRATLLHLNAEKGVFADAKLRTA
FT                   VAGAIKTDAIVDKIYEGKANKTEGSLFNLDAQWAQKAKPLAGAPADATIGKGKTVRLAT
FT                   WDSRAELPETANLIADQLRALGFNVDITVADYASLENRLLDGSFDAVIGSRSYMIGAGD
FT                   PVAFLDTDFTCDGSYNLSRLCDPEIDKKIAAAKSEKDLDTRHKDAAAIGADVVATGSVV
FT                   PLAHEQLLVVSKDVEGIAADPMERSLITEKTKKTAKK"
FT   misc_feature    288591..288674
FT                   /note="Signal peptide predicted for DIP0324 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.974 between residues 28 and 29"
FT   misc_feature    288780..289484
FT                   /note="HMMPfam hit to PF00496, Bacterial extracellular
FT                   solute-binding proteins, family 5"
FT   misc_feature    288822..288887
FT                   /note="ScanRegExp hit to PS01040, Bacterial extracellular
FT                   solute-binding proteins, family 5 signature."
FT   misc_feature    289572..289595
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    289638..290063
FT                   /note="HMMPfam hit to PF00496, Bacterial extracellular
FT                   solute-binding proteins, family 5"
FT   CDS_pept        290085..291839
FT                   /transl_table=11
FT                   /locus_tag="DIP0325"
FT                   /product="Putative transport system membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   transport system permease protein SC4G2.19 TR:O86691
FT                   (EMBL:AL031371) (601 aa) fasta scores: E(): 1.9e-62, 37.01%
FT                   id in 570 aa"
FT                   /db_xref="GOA:Q6NJR8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJR8"
FT                   /protein_id="CAE48831.1"
FT                   /translation="MRSPRTLATVIIAVATYALALVATALLPWFTGREPAFAVLRARER
FT                   EREATPELLQAIREQLDLPRTPWESVSRWFAGVARGDFGTSWVNPAQGAWAQATHGLGI
FT                   TATLTFVSTVLCLIVALLIVMPRIAAAARGRRGGVAAPQLLAALAALPDFVVAVILLWL
FT                   CALVLHILPVGGWSSPAHMVLPSLALGVCAGGVYGRVLLITADSASQEPWVEAWRINGV
FT                   AHSRITRALLWRSFVPTIPLLTLFFAGTLASTAAVEVTFNIPGFGRTVVNSALNADLPV
FT                   LQAAVFVVLVVGALSGIVANTLRRIILRRLEGDVAGVSLSTGTTATSVVFDRVSLIIAA
FT                   IPLVAVAAGMIRSAAINTDDRFASYSAAHPLGADQLGRDIWARLADGFTYSIGVAVLVT
FT                   ALCALIGLIAGHLGSWVLHIGDALNAFPAVLLGLILAGALGPSTTTAAIAVLMVGWIPL
FT                   ASHCAAVVQEARASGHYRYAATMGASRWHLLRHHVLPWTTPAVIRHAVVRIAHNAISLA
FT                   ALGYLGVGASVGSPDWGVILEESTHYLERAPWMAIGPMLCLVALGVVAAVTTDSVGRRE
FT                   ASSYHQPE"
FT   misc_feature    290085..290198
FT                   /note="Signal peptide predicted for DIP0325 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.385 between residues 38 and 39"
FT   misc_feature    order(290103..290171,290388..290456,290514..290582,
FT                   290625..290693,290772..290840,290925..290993,
FT                   291084..291152,291246..291314,291333..291401,
FT                   291414..291482,291609..291677,291720..291788)
FT                   /note="12 probable transmembrane helices predicted for
FT                   DIP0325 by TMHMM2.0"
FT   misc_feature    291480..291710
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   CDS_pept        complement(291817..293310)
FT                   /transl_table=11
FT                   /locus_tag="DIP0326"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   oxidoreductase SCF43A.31 TR:Q9XA84 (EMBL:AL096837) (520 aa)
FT                   fasta scores: E(): 7.8e-84, 44.21% id in 484 aa"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR021295"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJR7"
FT                   /protein_id="CAE48832.1"
FT                   /translation="MNSTITPTLNLKAQHAERRVVVTGASGYVGARLVVELLSTGFNVR
FT                   ATSRSLSSLKRFPWYDQVEAVEADLSISEDVNRLFEDVDTVFYLVHSMSGTQNFEELES
FT                   KIASKVAQAAHSNGVRQIIYLSGLHPRTELDKLSPHMRSRENVARILGSTAVPAITFRA
FT                   ATLIGSGSASFEMIRHLTERLPIMVAPQWINNKIEPISIRDTLYYLVKAADLPEPINEE
FT                   FDIGSGHIYTFADLLRIYGKIRGLRRTIVSLPIPLPLDTLSGLWIAAITPAPLSLAQPL
FT                   AQSMQEDAICSNRSIRDYISDPPSGLADYPTSVRRALQQESMGVLSSWDSSWKNLSSTD
FT                   HLPSDPEWTGRTVYSDVQEQSFRSEPAKVWRVIEGIGGHHGWYSTPLLWFVRGVIDKAI
FT                   GGPGLGGRRDPNRLRVGDRVDFWRVEEVTPEKQLTLRAEMRASGQAWLQFTINGNTLRQ
FT                   RAVYFPKGLLGRVYWLALIPFHAVIFPTMLRNIIQAGDN"
FT   CDS_pept        293451..296345
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="DIP0327"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="Similar to Mycobacterium tuberculosis DNA
FT                   topoisomerase I TopA or Rv3646c or MT3749 or MTCY15C10.06
FT                   SW:TOP1_MYCTU (Q59567) (934 aa) fasta scores: E():
FT                   3.1e-164, 62.66% id in 959 aa"
FT                   /db_xref="GOA:Q6NJR6"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJR6"
FT                   /protein_id="CAE48833.1"
FT                   /translation="MAAKTGNKRLVIVESATKAKKIAPYLGDDYIVEASVGHIRDLPRG
FT                   AADVPAKYKKEPWARLGVNTDKGFEPLYVVSPDKKKKVADLKAKLKLVDELFLATDPDR
FT                   EGEAIAWHLLEVLKPKVPVKRMVFNEITKPAILAAAENTRELDDNLVDAQETRRILDRL
FT                   YGYEVSPVLWKKVMPRLSAGRVQSVATRVIVERERERMAFISADYWDVEAEFDTGKPAQ
FT                   DSNPTSFTGRLTALDGKRVATGRDFNDRGELKGDAVVVDKQRAEALVEELTGVAMSVTK
FT                   VEEKPYTRRPYAPFMTSTLQQEAGRKLHYTSERTMRIAQRLYENGHITYMRTDSTTLSE
FT                   QGLKAAREQAISLYGADYVADAPRRYDRKVKNSQEAHEAIRPAGERFATPGDLHGQLDA
FT                   EEFKLYELIWQRTVASQMADAKGTSMKVTITGNNAEFSATGRTITFPGFLRAYVEVSTL
FT                   ADGRDVADNAESHLPRLAEGDGVETKNLEADGHSTNPPARYTEASLVKKMEDLGIGRPS
FT                   TYASIIKTIQDRGYVYSRGNALVPSWVAFAVIGLLEKSFAALVDYDFTSSMEDELDEIA
FT                   AGHENGAHWLTGFYFGDAEASDAKAESIARHGGLKALVGDNLEQIDARLVNSLPLFKDQ
FT                   EGRDVNVRVGRYGPYLERQVGVSEDGEPEYQRANLSDSTTPDELTLELAEKLFATPQSG
FT                   RELGRNPKNNRMIVAKEGRFGPYVTELVNDDERTEVEAKAEEIVAAEREAEDLQRAAEG
FT                   KRAKNWGTKTAAAQKEKRIAQIIEETLKPSTASLFKTMEPSSVTLDEALQLLALPREVG
FT                   VDPSDNEVITAQNGRYGPYLKKGSDSRTLASEDQIFSITLDEARRIYAEPKRRGRGATS
FT                   QSVIKQLGDNDVSGKPMSVRDGRFGPYVTDGTTNASLRRGDDPTQLTEARANELLSERR
FT                   AKEAADGGSSKKATKKASKKTTKRVAKAGARKKK"
FT   misc_feature    293472..293816
FT                   /note="HMMSmart hit to SM00493, No definition"
FT   misc_feature    293472..293837
FT                   /note="HMMPfam hit to PF01751, Toprim domain"
FT   misc_feature    293736..293777
FT                   /note="FPrintScan hit to PR00417, Prokaryotic DNA
FT                   topoisomerase I signature"
FT   misc_feature    293814..294080
FT                   /note="HMMSmart hit to SM00436, Bacterial DNA topoisomeraes
FT                   I ATP-binding domain"
FT   misc_feature    293877..295175
FT                   /note="HMMPfam hit to PF01131, DNA topoisomerase"
FT   misc_feature    293988..294044
FT                   /note="FPrintScan hit to PR00417, Prokaryotic DNA
FT                   topoisomerase I signature"
FT   misc_feature    294297..295097
FT                   /note="HMMSmart hit to SM00437, Bacterial DNA topoisomerase
FT                   I DNA-binding domain"
FT   misc_feature    294408..294452
FT                   /note="ScanRegExp hit to PS00396, Prokaryotic DNA
FT                   topoisomerase I active site."
FT   misc_feature    294423..294452
FT                   /note="FPrintScan hit to PR00417, Prokaryotic DNA
FT                   topoisomerase I signature"
FT   misc_feature    294660..294710
FT                   /note="FPrintScan hit to PR00417, Prokaryotic DNA
FT                   topoisomerase I signature"
FT   misc_feature    294984..295028
FT                   /note="FPrintScan hit to PR00417, Prokaryotic DNA
FT                   topoisomerase I signature"
FT   CDS_pept        complement(296265..297290)
FT                   /transl_table=11
FT                   /locus_tag="DIP0328"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Streptococcus pneumoniae Pap2 family
FT                   protein SP0489 TR:AAK74647 (EMBL:AE007360) (216 aa) fasta
FT                   scores: E(): 2.3e-06, 30.43% id in 207 aa"
FT                   /db_xref="GOA:Q6NJR5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJR5"
FT                   /protein_id="CAE48835.1"
FT                   /translation="MYGAVVVAGDHQRGAGVGMLRTRKLAQVAEINVVKSLDYLRLWHP
FT                   ILQNLRGRDFPTIELLLLRWRPARSAPPLSPPRTQDFENPWSPKSHRTALPWVFVFLSS
FT                   RSRDRGPKNPTRAQWVPMNRLTAACGLAFVLILGVVVSGFTYDAHITAAFNAHKEGAVG
FT                   SVVGFLYAGLQPRFSLFTTVFIAALVAAVRRKAWLGVCYALTVALTWAPVVVMKVVFQR
FT                   PRPDHALLRFPPEVTPADWSYPSGHTAFVTASVITLYLIAKTAQHQLWRSVAAAGVVLG
FT                   IVAVAAVVMTQGVHYPTDVLGSVVWAGCVAPAISLFLLASTRFGHALGGLFRGFFGRFL
FT                   R"
FT   misc_feature    complement(296322..296765)
FT                   /note="HMMPfam hit to PF01569, PAP2 superfamily"
FT   misc_feature    complement(order(296325..296390,296421..296486,
FT                   296508..296573,296634..296699,296721..296786,
FT                   296832..296897))
FT                   /note="6 probable transmembrane helices predicted for
FT                   DIP0328 by TMHMM2.0"
FT   misc_feature    complement(296346..296699)
FT                   /note="HMMSmart hit to SM00014, Acid phosphatase
FT                   homologues"
FT   misc_feature    complement(296376..296573)
FT                   /note="ProfileScan hit to PS50226, PA-phosphatase and other
FT                   phosphomonoesterases."
FT   stem_loop       complement(297342..297381)
FT                   /note="Score 51: 17/17 (100%) matches, 0 gaps"
FT   CDS_pept        complement(297398..299374)
FT                   /transl_table=11
FT                   /locus_tag="DIP0329"
FT                   /product="opt family protein. Putative membrane protein"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551 opt
FT                   family protein MT2465 TR:AAK46760 (EMBL:AE007086) (667 aa)
FT                   fasta scores: E(): 3.6e-138, 61.18% id in 644 aa"
FT                   /db_xref="GOA:Q6NJR4"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJR4"
FT                   /protein_id="CAE48836.1"
FT                   /translation="MSQPDIHKPKVSSPVRELTLRAIIIGGLITLVFTAANVYLGLKVG
FT                   ITFATSIPAAVISMAILRKFAGHTIQENNIVQTIASAAGTLSAIIFVLPGLIMVGWWTG
FT                   FPYWTTAFVCALGGILGVMYSIPLRRALVTGSDLPYPEGVAAAEVLKVGDDASQVTDHE
FT                   ENKRGLAVIIVGALTSAGYSLLAAMKAVTAEIIGTFKLGAGGTIFGSSLSLALIGVGHL
FT                   VGPTVAISMIVGLIISYGVLLPYFSAAGIAAGGELAEVVSTTFVQEVRFVGAGTMAVAA
FT                   IWTLIKIIAPIAKGIKDSLASSRARAAGNNVDITERDIPFTIVLGTILASMLPIGALLY
FT                   LFVHTTEISHHTSTLIILSIVFVLAIGLIIAAVCGYMAGLIGASNSPISGVGIIVVLAS
FT                   ALLIKFVTGNESQSNAPALVAYTLFTSAVVFGIATISNDNLQDLKTGQLVSATPWKQQV
FT                   ALIIGVLFGSIIIPPVLQLMLNGFGFVGAPGAGENALAAPQAALLSSVANGIFGNSLDW
FT                   SRIGLGAIIGVCVIILDEVLRRTKGWSLPPLSVGMGIYLPIALTLIIPIGAFIGLSYDK
FT                   WAARQANPEASKRMGILLATGAIVGESLFGVFNAAIVGGSGKDEPLALFDFGAATQWIG
FT                   LVVFAIMVTVLYKWLRTKSTEAA"
FT   misc_feature    complement(order(297425..297490,297536..297601,
FT                   297653..297718,297764..297814,297836..297892,
FT                   297938..298003,298067..298123,298169..298234,
FT                   298250..298315,298346..298411,298502..298567,
FT                   298613..298678,298700..298765,298811..298867,
FT                   298991..299056,299072..299137,299177..299242,
FT                   299258..299314))
FT                   /note="18 probable transmembrane helices predicted for
FT                   DIP0329 by TMHMM2.0"
FT   CDS_pept        complement(299461..301524)
FT                   /transl_table=11
FT                   /locus_tag="DIP0330"
FT                   /product="Conserved hypothetical protein"
FT                   /note="C-terminal region similar to Micromonospora
FT                   viridifaciens sialidase precursor NedA SW:NANH_MICVI
FT                   (Q02834) (647 aa) fasta scores: E(): 1.8e-23, 34.24% id in
FT                   403 aa"
FT                   /db_xref="GOA:Q6NJR3"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR026856"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJR3"
FT                   /protein_id="CAE48837.1"
FT                   /translation="MTNTLESNPMTTTTGALTITFATTCDGPLAHIPHHLDLNIIHGRI
FT                   QGTTAHRRIDAEDPDGLDDGLPHHLCLSVDTTGTHLFIDGYEAFSTTQTEWFDTSELTL
FT                   NPHGDLTIIDHQILNHAPTPRQARNLAPAAEPLVWFAGSHLSTRDTQRISHLTHGSLRL
FT                   LMKTRGTGQGGVAFQAHTINGDLTLEIIDGTLIFSVRCHDEDYVRITAPGRWDDGHIYD
FT                   VVIVCGRGATDIYVDGQQLIHSPGAAFFNDLSGELSVHIGTSASGVRLFGEVQSGMIYP
FT                   HVFNHHQVQRLATVEPIATQALFDCLLDGAQSYRIPSLITTDSGVIIAGADKRVSIAND
FT                   APNDIDFVLRRSVDGGRTWQPPRTILQLPDTACVTDSVLLQDHTTGRIFAFLDQFPAGI
FT                   GQPNAAFGTGFDADGNRIGHFADGSTCTMPREVDQLEASFFSDPHTAPPGIVFQHPSCH
FT                   LWMLTSDDDGLSWSTPRDLTPDVKEEWMRFCGTSPGNGIQLQRGTHAGRLLIPMYYTKG
FT                   DQFFAAALYSDDHGDTWHRGESPDLEMYESTLVEASDGSVLLWARNQHPSGAVAHARST
FT                   DGGHSWSQVTFNPNVPEIFSQPNALRVTNPDGIIFANASQLLPFRGRGVLRMSTNDGAS
FT                   WQHNRVFNPRHYVYQCMTQLPDGSIGLLWEREMQGLFFSIIPMTWIMQGYAL"
FT   misc_feature    complement(299611..299646)
FT                   /note="HMMPfam hit to PF02012, BNR repeat"
FT   misc_feature    complement(299773..299808)
FT                   /note="HMMPfam hit to PF02012, BNR repeat"
FT   misc_feature    complement(299917..299952)
FT                   /note="HMMPfam hit to PF02012, BNR repeat"
FT   misc_feature    complement(300106..300141)
FT                   /note="HMMPfam hit to PF02012, BNR repeat"
FT   misc_feature    complement(300442..300477)
FT                   /note="HMMPfam hit to PF02012, BNR repeat"
FT   CDS_pept        301604..302503
FT                   /transl_table=11
FT                   /locus_tag="DIP0331"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Klebsiella oxytoca YiaX1 TR:AAK69523
FT                   (EMBL:AF282849) (315 aa) fasta scores: E(): 4.4e-18, 31.94%
FT                   id in 313 aa"
FT                   /db_xref="InterPro:IPR032344"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJR2"
FT                   /protein_id="CAE48838.1"
FT                   /translation="MNTTPLVIGAYAALPATRADQETFYDRLHADLEATGLELPFRDSI
FT                   HDDPAWLASQLAGRFTDSIITAIPGTMMRVWDGGTFGLASPDDDGRNAAIAFTRSIIDS
FT                   ARALDDAAGHRVIAGIHIHSAPSVTANRDQFLRSLTELLEGMDNDDPRLIIEHCDRYNE
FT                   AVTGEKRFLSIEQEIAIAKETGIGITVNWGRSAMEAYDTQLPARHIQALVAEGVFEGVM
FT                   FSGAGDKENTFGAAWADLHLPHHVDEPASLMDDDRIAECLSAAGGAQKYHGAKIQAPAD
FT                   VDVATRVTMLGHITRHLR"
FT   misc_feature    301958..301990
FT                   /note="ScanRegExp hit to PS00087, Copper/Zinc superoxide
FT                   dismutase signature 1."
FT   CDS_pept        complement(302520..304046)
FT                   /transl_table=11
FT                   /locus_tag="DIP0332"
FT                   /product="Putative adenylate cyclase"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551
FT                   adenylate cyclase, putative MT3748 TR:AAK48108
FT                   (EMBL:AE007173) (549 aa) fasta scores: E(): 5.4e-73, 42.99%
FT                   id in 507 aa"
FT                   /db_xref="GOA:Q6NJR1"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJR1"
FT                   /protein_id="CAE48839.1"
FT                   /translation="MTKLWRAFKWLFKTSWPLYATTVLGSNVLGAVGVMLFLKYLVPLP
FT                   EFDQFTDEASYLPELGIGYLILAVIFGGAVTFLLFRPVLDWQRHPDTHDPNMVRNLVMR
FT                   IPIYQAALCSVVWALGIVVLAIAAGQTSPRLALAIAVASTLSGAVIVVLTYLEAQRLVR
FT                   PVAATALARRFEDSTLEPPITSRLRLTWALTSAVPIIGILLMVMGHHLGMFTDNVSDIM
FT                   PAVIALAMAALITGFLGTTLSIMSVVDPILELQGAINRVRRGDSGVQVDIYDGSEIGVL
FT                   QAGFNEMMRGLKERQRVRDIFGRYVGVEVARRALEERPQLGGEDREVAVVFVDVIGSTT
FT                   FAVNHDPEEVVEELNRFFEHVVEVVHRNKGIINKFQGDAALAVFGAPVTLSDATGHALT
FT                   AARELRQELMGLRLEAGIGVASGHVVAGHIGGHDRFEYTVIGDAVNTAARLTEIAKNTP
FT                   GRVLTNSATLQRANEAEQARWTMMKSVELRGRSLMTQLARPIRPTLADRS"
FT   misc_feature    complement(302604..303170)
FT                   /note="HMMSmart hit to SM00044, Adenylyl- / guanylyl
FT                   cyclase, catalytic domain"
FT   misc_feature    complement(302694..303062)
FT                   /note="ProfileScan hit to PS50125, Guanylate cyclases
FT                   profile."
FT   misc_feature    complement(302697..303080)
FT                   /note="HMMPfam hit to PF00211, Adenylate and Guanylate
FT                   cyclase catalytic domain"
FT   misc_feature    complement(303156..303314)
FT                   /note="HMMSmart hit to SM00304, HAMP (Histidine kinases,
FT                   Adenylyl cyclases, Methyl binding proteins, Phosphatases)
FT                   domain"
FT   misc_feature    complement(303165..303374)
FT                   /note="HMMPfam hit to PF00672, HAMP domain"
FT   misc_feature    complement(order(303303..303368,303414..303479,
FT                   303579..303635,303666..303731,303795..303860,
FT                   303921..303986))
FT                   /note="6 probable transmembrane helices predicted for
FT                   DIP0332 by TMHMM2.0"
FT   CDS_pept        304045..305310
FT                   /transl_table=11
FT                   /locus_tag="DIP0333"
FT                   /product="Putative DNA polymerase III, delta' subunit"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551 DNA
FT                   polymerase III, delta' subunit MT3747 TR:AAK48107
FT                   (EMBL:AE007173) (404 aa) fasta scores: E(): 1.4e-57, 46.59%
FT                   id in 397 aa, and to Escherichia coli DNA polymerase III,
FT                   delta' subunit HolB or B1099 SW:HOLB_ECOLI (P28631) (334
FT                   aa) fasta scores: E(): 6.9e-11, 28.61% id in 304 aa"
FT                   /db_xref="GOA:Q6NJR0"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJR0"
FT                   /protein_id="CAE48840.1"
FT                   /translation="MPTTLTVGYYKRYSIEVMSTEITGSDIFAQMGVSEHIAPILRTAA
FT                   RAARNHDIGSAMTHAWLFTGPPGSGRSVAAVAFAAALECTDPTMVGCGRCEQCRAVLHD
FT                   AHGDVLHIVPRELSIPVEMMRDDVVEPAAKRPTVGQWRVVILDNADRLTPESANALLKT
FT                   VEEPPAHTVIILCAPSTDPTDIIPTLRSRSRHLYVPQPSIDEAVAVLTRDGTIPEPAAR
FT                   LAAATTGGHIGRARWLATNKDAQMRRSAVLNIAELVFHGDQAFRAGGSLVKQITKQAEA
FT                   QLKEENEEEIDKLRNALGMGSRGKGVHKALRGADSAIRDLEALQKKRKTRFVRDHLDMA
FT                   LVDLSGIYRDAIMTHTHATVGLIHPDLSGLSAELAQRVPLAGLVACLDAITICREQIPN
FT                   NVRPEAAFDAMLGRIRIACGAT"
FT   tRNA            305408..305480
FT                   /gene="tRNA-Thr"
FT                   /product="transfer RNA-Thr"
FT                   /anticodon="(pos:305441..305443,aa:Thr)"
FT                   /note="tRNA Thr anticodon CGT, Cove score 81.26"
FT   misc_feature    305484..323838
FT                   /note="Anomalous G+C content (51.29%). Putative
FT                   pathogenicity island. Not present in C.glutamicum. Contains
FT                   a CDS possibly encoding for a starch degrading enzyme: This
FT                   ability of degrading starch is a characteristic of the
FT                   Corynebacterium diphtheria strain gravis and not of strain
FT                   mitis nor strain intermedius"
FT   CDS_pept        305695..305946
FT                   /transl_table=11
FT                   /locus_tag="DIP0334"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJQ9"
FT                   /protein_id="CAE48841.1"
FT                   /translation="MIEMLLYEDTRMRAVEILRSLPIGNSGVSGLVQLAATLGASVEFR
FT                   PSIPPFPESLSKKMNKTQKYTSTQMSQKFDNASHSPTK"
FT   CDS_pept        306195..306602
FT                   /transl_table=11
FT                   /locus_tag="DIP0335"
FT                   /product="Putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="GOA:Q6NJQ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJQ8"
FT                   /protein_id="CAE48842.1"
FT                   /translation="MPDVKPQDSAEESNFDKPPAKVAEENKDIDPATKRAIEKPEHPSA
FT                   TPSRKDIDSKFQSPAFYTSLTRWHPRIAYFQFLSGNNFPAEWSPDKRFKNCIEQHLSLY
FT                   KVCYWNDLIMMCSILTLMGIIATLIACKTII"
FT   misc_feature    306516..306584
FT                   /note="1 probable transmembrane helix predicted for DIP0335
FT                   by TMHMM2.0"
FT   CDS_pept        complement(306606..306815)
FT                   /transl_table=11
FT                   /locus_tag="DIP0336"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   8.5 kDa protein Rv1055 or MTV017.08 TR:O53403
FT                   (EMBL:AL021897) (78 aa) fasta scores: E(): 0.00013, 45.16%
FT                   id in 62 aa"
FT                   /db_xref="GOA:Q6NJQ7"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJQ7"
FT                   /protein_id="CAE48843.1"
FT                   /translation="MAIAAGADVKTVQLMLGHASAATTLDTYAHLWETGLDSVPGAMSA
FT                   HLQRERERLALRERRRVECELQVI"
FT   CDS_pept        complement(306912..307370)
FT                   /transl_table=11
FT                   /locus_tag="DIP0337"
FT                   /product="Putative phage integrase"
FT                   /note="Low similarity to bacteriophage BIL309 Integrase Int
FT                   TR:Q9AZR0 (EMBL:AF323670) (377 aa) fasta scores: E(): 0.45,
FT                   27.41% id in 124 aa"
FT                   /db_xref="GOA:Q6NJQ6"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJQ6"
FT                   /protein_id="CAE48844.1"
FT                   /translation="MIGSGSQRKIGIVIKALLDQAEELDIINKNKIRCTDIPRQGKAER
FT                   RYLTIRGIDRLLAAAIPMNEVALMRNVLLFTGLRPREAKGLKVKDLDPMRGRLSIRRDV
FT                   DDLGNPDETKTRNHRGVPIGGDLLFDLDDQAEGKQPHDWLLTDETGHV"
FT   CDS_pept        complement(307437..307559)
FT                   /transl_table=11
FT                   /locus_tag="DIP0338"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJQ5"
FT                   /protein_id="CAE48846.1"
FT                   /translation="MWDVWIASKQGRTESTKAGYIAAWKHIQPVFGNTACWKIE"
FT   CDS_pept        complement(307596..307805)
FT                   /transl_table=11
FT                   /locus_tag="DIP0339"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJQ4"
FT                   /protein_id="CAE48847.1"
FT                   /translation="MAFVRDLWTKPNPNATSRTKRIRSARWGKGKRWQAVWVKNGKHVT
FT                   TSCHAKDEAELHIARASVGQADGT"
FT   CDS_pept        complement(join(307990..308235,308235..308516,
FT                   308518..308775))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="DIP0340"
FT                   /product="Putative phage protein (pseudogene)"
FT                   /note="Pseudogene. Similar to Salmonella typhimurium LT2
FT                   putative cytoplasmic protein RhuM TR:AAL22613
FT                   (EMBL:AE008874) (345 aa) fasta scores: E(): 3.5e-25, 46.87%
FT                   id in 224 aa. Presents frameshifts at residues 86 and 180"
FT   CDS_pept        308897..309421
FT                   /transl_table=11
FT                   /locus_tag="DIP0343"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJQ3"
FT                   /protein_id="CAE48849.1"
FT                   /translation="MAHAVTSEQVPNEVVTNGTVDQRRVSSLELSREPNERRDQLLNEG
FT                   FLKEAEQEFPGYTIETYRNTSNGVTVEYDVVAWNDDLTTVTPYINFEWNWDPRIYITGA
FT                   EFWSLGSSGFAGAVCSHFAGWKAGAACSAVASAAWNKIASRHAILSDQTCYDLSQFINI
FT                   GWKRAPQEKCA"
FT   CDS_pept        309428..309568
FT                   /transl_table=11
FT                   /locus_tag="DIP0344"
FT                   /product="Putative exported protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJQ2"
FT                   /protein_id="CAE48850.1"
FT                   /translation="MKKIDSLSMRNSRLAPVVCVILVFFLLSTLSFAMGFLHLMQWFLL
FT                   L"
FT   misc_feature    309428..309526
FT                   /note="Signal peptide predicted for DIP0344 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.992) with cleavage site
FT                   probability 0.651 between residues 33 and 34"
FT   CDS_pept        309574..309753
FT                   /transl_table=11
FT                   /locus_tag="DIP0345"
FT                   /product="Putative exported protein"
FT                   /note="No significant database matches"
FT                   /db_xref="GOA:Q6NJQ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJQ1"
FT                   /protein_id="CAE48851.1"
FT                   /translation="MLARRLGKTKNKESESAIGIIAVGSVVHVLDLAHMIDLPAFGLGL
FT                   IIAGAVVLFVADYL"
FT   misc_feature    309670..309738
FT                   /note="1 probable transmembrane helix predicted for DIP0345
FT                   by TMHMM2.0"
FT   CDS_pept        309772..309933
FT                   /transl_table=11
FT                   /locus_tag="DIP0346"
FT                   /product="Putative IS element tranposase (partial)"
FT                   /note="Similar to Escherichia coli transposase InsI for
FT                   insertion sequence element IS30B/C/D (InsI1 or B0256) and
FT                   (InsI2 or B1404) and (InsI3 or B4284) SW:INSI_ECOLI
FT                   (P37246) (383 aa) fasta scores: E(): 0.72, 45.45% id in 44
FT                   aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJQ0"
FT                   /protein_id="CAE48852.1"
FT                   /translation="MESSGCAIKPQSTVELSQYPEDYLDAVAEELNDRLRKTLEYDKPS
FT                   ERILKLLA"
FT   CDS_pept        309946..310104
FT                   /transl_table=11
FT                   /locus_tag="DIP0347"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJP9"
FT                   /protein_id="CAE48853.1"
FT                   /translation="MQPPLEPAGEKNVHRLEPLTTSEDFSVLADAFGTPYCFWLLGGAP
FT                   GRWRRQA"
FT   CDS_pept        complement(310129..311286)
FT                   /transl_table=11
FT                   /locus_tag="DIP0348"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Neisseria meningitidis hypothetical
FT                   protein NMB0459 TR:Q9K0V1 (EMBL:AE002402) (369 aa) fasta
FT                   scores: E(): 1.8e-58, 45.47% id in 365 aa"
FT                   /db_xref="GOA:Q6NJP8"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025758"
FT                   /db_xref="InterPro:IPR026287"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJP8"
FT                   /protein_id="CAE48854.1"
FT                   /translation="MSIFRPKIDITHQYVYSFDMSSTTFDPNRPFNELPPLPPAQVVET
FT                   VPVLKAIIAAKEKLAELRTACQLIPNPEILTSTIPLREARASTEIENIVTTNDELFRAA
FT                   WNVDAEPTPATKEALRYNAALHAGLESIGQRPLSAKTTQIVCGTLQSDEPHIAPFRSYP
FT                   GTFIGNPHTQQRIYTPPEGREVIEQHLSRWERYIYNEHDVDSLVKMALLHYQFEAIHPF
FT                   TDGNGRTGRILNVLYLLQEALLPFPVLYLSGYIVENKAQYYRCLNRVTTESAWEDWLLF
FT                   MVRGVEVAATDAATMIADLRQVQDEITAVIRDAGIISPAKEISEITMVRPYLRIQDVED
FT                   SGLVKRQTAATWLNHLVDIGVLSETKRGRQRIFINDAALRVLTRE"
FT   CDS_pept        311422..312120
FT                   /transl_table=11
FT                   /locus_tag="DIP0349"
FT                   /product="Putative alkylated DNA repair protein"
FT                   /note="Similar to Streptomyces coelicolor putative DNA
FT                   repair protein SCG20A.20c TR:Q9K3M0 (EMBL:AL360055) (216
FT                   aa) fasta scores: E(): 1.4e-27, 44.54% id in 220 aa, and to
FT                   Escherichia coli alkylated DNA repair protein AlkB or AidD
FT                   or B2212 SW:ALKB_ECOLI (P05050) (216 aa) fasta scores: E():
FT                   5.6e-10, 32.46% id in 231 aa"
FT                   /db_xref="GOA:Q6NJP7"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJP7"
FT                   /protein_id="CAE48855.1"
FT                   /translation="MLFDSLPRPSERIAPGVAHLPGWLGVDKQAELVREIREIARTYAD
FT                   TPMAMLRPTLKSGGQMSVYQLHLGRYWHYPSYRYIDKIAGTTVPPVPDSLAALAPEALR
FT                   AAAEVAEELAPWVETFVPEMVLVNYYPPGSRMGMHVDEFEESRAPVISVSIGDEALFRM
FT                   GHTESRTQPWDDVTLCSGDLVVFGGPKRFAYHGVVRVNDATLPDGCGLEQGRINITIRQ
FT                   VSAAPNVQGR"
FT   CDS_pept        complement(312169..312993)
FT                   /transl_table=11
FT                   /locus_tag="DIP0350"
FT                   /product="Putative secreted protease"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   hydrolase SCBAC14E8.01c TR:Q9ADJ8 (EMBL:AL590435) (228 aa)
FT                   fasta scores: E(): 1.6e-05, 28.49% id in 186 aa"
FT                   /db_xref="GOA:Q6NJP6"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJP6"
FT                   /protein_id="CAE48856.1"
FT                   /translation="MRKIVALAAASLLGIAGTSGVLGAATATALTNGTPVSPADDTAAE
FT                   GVVQVASCTGTVVASQWVLTAQHCVEVPNLQRPVYVGTTREQQRREENTFTSDYAVWAP
FT                   HGDVALVHVTDALPQRLVRKVRRAPVSFGEQGRVYGWGAGTGETLQYARAAVGKTSSGV
FT                   RPQGNQHGAFIVQYLDEAKAGRGDSGGPLFVDGEVAGVTSFKAPQGGGRFSLFASLHGL
FT                   GDWIAQTTAAPSPSPRNPNSKNQQSQQPRGPLATPGRSGAGGGGSSLGLSSS"
FT   misc_feature    complement(312301..312906)
FT                   /note="ProfileScan hit to PS50240, Serine proteases,
FT                   trypsin domain profile."
FT   misc_feature    complement(312316..312906)
FT                   /note="HMMPfam hit to PF00089, Trypsin"
FT   misc_feature    complement(312316..312954)
FT                   /note="HMMSmart hit to SM00020, Trypsin-like serine
FT                   protease"
FT   misc_feature    complement(312415..312453)
FT                   /note="FPrintScan hit to PR00722, Chymotrypsin serine
FT                   protease family (S1) signature"
FT   misc_feature    complement(312517..312540)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    complement(312643..312687)
FT                   /note="FPrintScan hit to PR00722, Chymotrypsin serine
FT                   protease family (S1) signature"
FT   misc_feature    complement(312787..312834)
FT                   /note="FPrintScan hit to PR00722, Chymotrypsin serine
FT                   protease family (S1) signature"
FT   misc_feature    complement(312877..312993)
FT                   /note="Signal peptide predicted for DIP0350 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.345 between residues 39 and 40"
FT   CDS_pept        313246..313617
FT                   /transl_table=11
FT                   /locus_tag="DIP0351"
FT                   /product="Putative plasmid replication protein"
FT                   /note="Low similarity to central part of Corynebacterium
FT                   glutamicum replicase RepA TR:Q9EUN5 (EMBL:AF164956) (479
FT                   aa) fasta scores: E(): 1.8e-16, 56.86% id in 102 aa"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJP5"
FT                   /protein_id="CAE48857.1"
FT                   /translation="MSSVTAPRLDRATMGRKGGQKAAERWKTDPESDYATAQRETLAAA
FT                   NKRGARQGTGTRGRVLAVYSQTLVDTGEVPTARQIAGEIGITKRMVNIHLKELRDAGLV
FT                   EQGLRDIWACGRNLGGFPV"
FT   misc_feature    313468..313533
FT                   /note="Predicted helix-turn-helix motif with score 1076
FT                   (+2.85 SD) at aa 75-96, sequence PTARQIAGEIGITKRMVNIHLK"
FT   CDS_pept        complement(313721..313888)
FT                   /transl_table=11
FT                   /locus_tag="DIP0352"
FT                   /product="Putative exported protein"
FT                   /note="Similar to Clostridium perfringens hypothetical 6.1
FT                   kDa protein SW:YPI8_CLOPE (P18018) (55 aa) fasta scores:
FT                   E(): 1, 42.85% id in 35 aa"
FT                   /db_xref="GOA:Q6NJP4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJP4"
FT                   /protein_id="CAE48858.1"
FT                   /translation="MDVNKLYIISSVIMAIAGIVVLFNRNFLAASAMLIASGLAADIYR
FT                   LRNNMSGNQR"
FT   misc_feature    complement(313766..313888)
FT                   /note="Signal peptide predicted for DIP0352 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.977) with cleavage site
FT                   probability 0.291 between residues 41 and 42"
FT   CDS_pept        complement(313903..314421)
FT                   /transl_table=11
FT                   /locus_tag="DIP0353"
FT                   /product="Putative exported protein"
FT                   /note="Similar to N-terminal region of Streptococcus
FT                   pneumoniae 3-hydroxy-3-methylglutaryl-CoA reductase SP1726
FT                   TR:AAK75803 (EMBL:AE007465) (424 aa) fasta scores: E():
FT                   8.7, 26.38% id in 144 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJP3"
FT                   /protein_id="CAE48859.1"
FT                   /translation="MKKFGLLSIPLGMALILSAVESPANVQSSMSSVPQTLGATSSLGI
FT                   PDDEVEQLLTAIDSIPDEVLAEGDEATAEWVQENLASKEIVPYIATEVACAGAILWAIG
FT                   STLLPVAKIIKSKKAIKALGGVKAAVSQLAQKGFNWPSIQQTGGALRDLGAELIGVAGV
FT                   SDTVSTKIQ"
FT   misc_feature    complement(314305..314421)
FT                   /note="Signal peptide predicted for DIP0353 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.365 between residues 39 and 40"
FT   CDS_pept        complement(join(314471..314635,314637..314750,
FT                   314856..315488))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="DIP0354"
FT                   /product="Putative IS element tranposase (pseudogene)"
FT                   /note="Pseudogene. Similar to Streptomyces coelicolor
FT                   insertion element IS110 hypothetical 43.6 kDa protein
FT                   SC3C8.10 and SCC57A.30c and SCG2.18 and SC5E9.30
FT                   SW:YIS1_STRCO (P19780) (405 aa) fasta scores: E(): 7.8e-21,
FT                   37.09% id in 337 aa. Presents frameshifts at residues 211
FT                   and 249"
FT                   /db_xref="PSEUDO:CAE48860.1"
FT   misc_feature    complement(314991..315287)
FT                   /note="HMMPfam hit to PF01548, Transposase"
FT   CDS_pept        complement(315605..315754)
FT                   /transl_table=11
FT                   /locus_tag="DIP0356"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJP2"
FT                   /protein_id="CAE48861.1"
FT                   /translation="MFPPFPHPPSGLEELVAGFGMALIHPVKKIIQGVMPPKAVTYSNS
FT                   SIGT"
FT   CDS_pept        316102..323838
FT                   /transl_table=11
FT                   /locus_tag="DIP0357"
FT                   /product="Putative secreted bifunctional (alpha-amylase and
FT                   endo-alpha-glucosidase): starch degradation and integral
FT                   membrane protein"
FT                   /note="C-terminal region Similar to Deinococcus radiodurans
FT                   alpha-dextran endo-1,6-alpha-glucosidase DR0405 TR:Q9RXB0
FT                   (EMBL:AE001900) (910 aa) fasta scores: E(): 3.1e-110, 41.4%
FT                   id in 942 aa, and N-terminal region similar to Streptomyces
FT                   lividans alpha-amylase precursor Amy SW:AMY_STRLI (Q05884)
FT                   (919 aa) fasta scores: E(): 1.4e-86, 41.56% id in 676 aa"
FT                   /db_xref="GOA:Q6NJP1"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024561"
FT                   /db_xref="InterPro:IPR040671"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJP1"
FT                   /protein_id="CAE48862.1"
FT                   /translation="MRDSALPRYFRALVAVISAISLVGVGLHATQPTARADEELAPAVV
FT                   AGTFQKNLGCSKEWEESCDKTRMKRKGNLYATTLKIPEGDWKFKVVLNGDWGTSYGAPG
FT                   FDENNIPLKLTKDTELEFSFDPLSHRIGLKPVGLDDEKLKTYDDSKDKDIVGAPFKHSA
FT                   AGKNFYFVLTDRFQNGNPENDRGGAKDGDKNDHGFDPTDKAYYHGGDIEGLIKQLDYIK
FT                   NLGTTALWLTPSFKNRAVQCGHDPKDCSSGYHGYWITDFTQIDPHLGSNDDLKRLIEEA
FT                   HNKGIKVYFDIVANHTADLIQLAGGNQYISEDQQKYKDVDGKEFLLKDYAGKKEFPELN
FT                   DFSFPYKPIRKPEDNIIVPKELNDVHLYHNRGNNTWEGESVIHGDFEGLDDLMTEHPKV
FT                   VSHMIEAYNKWAGFGLDGFRIDSVKHVNMEFWKEWTEAVKKHAKESRAGEKEDFFMFGE
FT                   VFNGTAESLSPFVRDTQMDAALDFAFHYKALDFAKGQSTQGLHDLFYSDDWYTTTRSDA
FT                   TNLPTFLGNHDVGRIGYLLRDNDDKVQRDVLAHQLMFLTRGQPVVYYGDEQGFAGTGDG
FT                   KDKQARQDMFGTQVDEFKNEQDIYGKQLGSDNHFKESGELYGKIKQLAELRTANKALAT
FT                   GAQIERWETPGPGIYAFSRVDRDEKQEYLVALNNSHLEQTATPAPLTPNASFTKIYGEG
FT                   PDKISPNLDGTVNLKLPRLSAVVYKVESNQKVSGAVDGTGLSVKGQALKDNAPIMTNIG
FT                   GKAWSETSFAWRELGTEEWKKLGTDTGQNARVFHDVRDLKPGTIVEYRTVTVDADNNKT
FT                   ASTGWGVVGVDLGVDTAALLAPSAVVAGDFTKDLGCTGGDQGNWDPACAKTELKSVGGT
FT                   DWHTVKLNLKAGEHQYKIAVAGSWNENYGQEKDGDRPNDRGYHNGKNVKFNLDREQEVQ
FT                   FFYNPVTNEFFNSVEHGVITLPGTMGGALNCPKNDQKSDEHGNWGPACLATLMTKTGDH
FT                   IYEFSSPKVPTPGNYDVKVAYGLEWGNDWGPDGHKTQRNYDVKITDSGILHYRWDENKH
FT                   ELTWNITERSSLDLQDTFAHWLDDRTIAVPRSQLRDASPSDVEGLLVSVSDGKPSIKSG
FT                   KGASSQADAKIEEQKLHYVGQIGGDLLARNPHLDGMVTFRFKDEVQKDKARELLQGGLG
FT                   FAVVKKKEQEPVSFTGVQIPGVLDAHYAADARDAQLGVHWKGDKPTVSLWAPTAKNVKL
FT                   KLFGEEGSLGNGEDHKMDYDKTTGVWSVEGKPDWKNHAYQFEVEVYAPSTHKVEHNLTT
FT                   DPYSVGLSMDSKYSVMLNLNDPELKPADWGKAMDPIDPVDRMIYELHVRDFSASDKSMD
FT                   QQYRGKYKAFTQSGSKSVMHLKELADAGLNSVHLLPTNDIATIPEDPAKAKTPAITSTG
FT                   AADTQQQEAVAAVQKEDAFNWGYDPYHYMAPEGSYATKPDAKTRVKEYREMVKALNGMG
FT                   LHVVSDQVYNHAFQGQQDEKSVLDKVVPGYYHRLMLDGKIANSTCCANLATEHVMMEKL
FT                   MTDSVKSWAKNYHIDGFRFDLMGHHSAANMINVQTELSELTVEKDDIDGSSIYLYGEGW
FT                   NFGEVENNQRFIQATQENLAGTGIGTFNDGLRNGVHGHEGRTQGFGTGLAMEGNGTDQK
FT                   DQGHLRHLTDIVRVGMAGNLQDFKFNSKDGYKRGGDIWLDGKRIGYGLMPQDTVNYVDA
FT                   HDNQTLYDLSVLQLPQSLSMDDRVRMNTVQLATVALGQSPAFWHAGTEIMRSKSLDRDS
FT                   YNSGDHFNKLDLSMQEHNFGVGLPIAEKNDKQWELYKGFLNDEHLKAKPEDLKKANDMA
FT                   KELMTLRKDNPLMRLGDVDQIQEKVTFPANGPDAQPGLIVMNIDDTKGEDRDAKRDGIL
FT                   IVINSSPKQIEQTINELEGLDFTLEKTLAEGVDKETQKGSTWNKAEKKLTIPARTVAVF
FT                   ERTQNEAAHHDPQYPETKVFKDATEDVKVEGPKDMPETAKYSIDPAVDGVSVDEKTGAL
FT                   TVKPTAIKEDGLVVTVTVKYSDGSEDRAVAKFVTDTSIASMYDPTYEETKAESADKKVT
FT                   IKKPMSGEKSLPEDAHFTLEGESAKKATIDGFTGEITVEPLKDERRLELDVKVTYADES
FT                   VDMVKAVVVAGDTLADQHDPKYADTQMEKGTKTVIAAPEGMPENIKYELAEPQDGVTVR
FT                   DDGSIEVTTDAESLDIKVKVTYSDKSTDTAVAHVTTVAQTEQSVEVTPGTQTLVDVPGN
FT                   GDVTVTVPQNSGLKAEVAGNLVTLTSDGSVEGHVTVTYQVKDADGKTTTGKINVQVAKL
FT                   AEASWPKSASVAAGDSTVITPEGVDTLPYGTTLSVGSLPEWATFDQTTGQLTLTADEDA
FT                   TDESTTATITVAYPDGLTKQYSVALSVGAATETTADQHDPQWESVVVNGDSVTSHGVDV
FT                   PADAEVSVDKLPEGWTATVTGSDVEITPAAGSPAGHVIALPVTVRYADGTTDTAVINVL
FT                   TQPDWSTSNKAPKADSGMFYQAGPGAPAWVRVNNDGSMTWADNAPEGTHEIPVIVTKDG
FT                   VHYLVTASVNAPKKVVLDTEGSSSILGVVVAILAAGGIMALFALLFNCTWFKNCR"
FT   misc_feature    316102..316209
FT                   /note="Signal peptide predicted for DIP0357 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.874 between residues 36 and 37"
FT   misc_feature    316612..317982
FT                   /note="HMMPfam hit to PF00128, Alpha amylase, catalytic
FT                   domain"
FT   misc_feature    319699..319986
FT                   /note="HMMPfam hit to PF02922, Isoamylase N-terminal
FT                   domain"
FT   misc_feature    323740..323808
FT                   /note="1 probable transmembrane helix predicted for DIP0357
FT                   by TMHMM2.0"
FT   CDS_pept        complement(323875..325527)
FT                   /transl_table=11
FT                   /locus_tag="DIP0358"
FT                   /product="Putative CoA-ligase"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551
FT                   substrate--CoA ligase, putative MT1470 TR:AAK45735
FT                   (EMBL:AE007017) (535 aa) fasta scores: E(): 8.6e-57, 36.1%
FT                   id in 529 aa"
FT                   /db_xref="GOA:Q6NJP0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJP0"
FT                   /protein_id="CAE48863.1"
FT                   /translation="MPQIAPLLTTLTSMARHMPTIAASGLLSTEGKPLAALSTPATMAR
FT                   YRFTTAREVEQAARVCPDRIALIDDDGSLTYQELRDNSRALARYFYQLNSKDLRIGVMA
FT                   RNGRGSIYPLTAKGYAGASIYLLNIGSSRDQLDGCIRRDGINLLVIDEEFLPRLPENIQ
FT                   IPVIVAHREAEPHPRAAECLDLEEIVATHTSGNLPVFPQHGAIVLMSSGTTGIPKGVMR
FT                   NEPKAPTILGAVLSEIPFRTNMNVQLTASVFHTWGWGILNLSFAMRCTVVTRRIFDPER
FT                   TLRDVERFKIHAMISSPIFLKRFFEVEGQEDIDCSSLEFIFSSGHALSPWLVEAVHNRF
FT                   GKILCNLYGSTEISAAAIANMEEVAKNPTVAGKICEGTTVRILDDNDQPVPAGTVGRIF
FT                   CYNNTTLNGYTDPRIPIKRVGELVQIGDRGYIDERGLLYVLGRADDMIIVGGENVFPRS
FT                   VEEVLEPMPGIQDLYASGVDDDETFARIAVWIVKSPTAAGEALTEDAVRDWVRTKLADH
FT                   SIPRDVHFIDELPRNATGKVMPRMLPGISHPTA"
FT   misc_feature    complement(324106..325305)
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme"
FT   misc_feature    complement(324874..324909)
FT                   /note="ScanRegExp hit to PS00455, Putative AMP-binding
FT                   domain signature."
FT   CDS_pept        325657..326445
FT                   /transl_table=11
FT                   /locus_tag="DIP0359"
FT                   /product="Putative secreted hydrolase"
FT                   /note="Low similarity to Streptomyces scabies esterase
FT                   precursor EstA SW:ESTA_STRSC (P22266) (345 aa) fasta
FT                   scores: E(): 0.12, 26.28% id in 331 aa"
FT                   /db_xref="GOA:Q6NJN9"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037460"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJN9"
FT                   /protein_id="CAE48864.1"
FT                   /translation="MRLLTAFCATLLGLLAAPPAHAGIAHDNVVIFGDSMVADPLVSEV
FT                   ITGRLSSQPHCPHSPTSYAEIAAKRLGLESRNFSCAGAQVHIGGPFLKTSFIAQIDTAI
FT                   AAGALDTHTRRVWITQGFNDAWSGHPAAQVVATMSEVIGRIRAHAPNARIQIVGYPQIT
FT                   HQGQLCLVRLPGQPAWPIAAAVIAAWEDQALLIQREVAAATGSELIDVRSATADHSMCA
FT                   PDEQRYISSVVDVAGASTHLPVHVNERGHQGIADLIVRSR"
FT   misc_feature    325657..325722
FT                   /note="Signal peptide predicted for DIP0359 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.977 between residues 22 and 23"
FT   CDS_pept        complement(326409..327281)
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="DIP0360"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="Similar to Escherichia coli glucose-1-phosphate
FT                   thymidylyltransferase RfbA SW:RBA2_ECOLI (P55253) (293 aa)
FT                   fasta scores: E(): 1.5e-64, 59.93% id in 287 aa"
FT                   /db_xref="GOA:Q6NJN8"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJN8"
FT                   /protein_id="CAE48865.1"
FT                   /translation="MKGIILAGGSGTRLHPITLGISKQLMPIYDKPMIYYPLTTLIQAG
FT                   ICEILIITTPEDQAAFQRLLGDGSSWGIELSYAVQPRPDGLAQAFIIGRDFIGNDSVAL
FT                   ALGDNIFDGPALGQALKGCHSPDGGTVFAYEVSDPSRYGVVTFDATGTALSIEEKPAHP
FT                   RSNYAVVGLYFYNNDVVRIAETTTPSARGELEITAINDAYLQQGKLHVRKLERGDVWLD
FT                   TGTIDSMSEAASYVEVLQKRTGVIIGSPEVAAWKAGLITDTQLEALAQPLKKSGYGNYL
FT                   LRTIRSAIP"
FT   misc_feature    complement(326565..327278)
FT                   /note="HMMPfam hit to PF00483, Nucleotidyl transferase"
FT   CDS_pept        complement(327293..328639)
FT                   /transl_table=11
FT                   /locus_tag="DIP0361"
FT                   /product="Putative bifunctional protein"
FT                   /note="N-terminal region similar to Streptococcus
FT                   pneumoniae dTDP-4-keto-6-deoxyglucose-3,5-epimerase CPS19AM
FT                   TR:Q9Z642 (EMBL:AF105113) (197 aa) fasta scores: E():
FT                   2.5e-29, 51.68% id in 178 aa, and C-terminal region to
FT                   Serratia marcescens putative dTDP-L-rhamnose synthase RmlD
FT                   TR:O52480 (EMBL:AF038816) (288 aa) fasta scores: E():
FT                   6.7e-28, 38.79% id in 281 aa"
FT                   /db_xref="GOA:Q6NJN7"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJN7"
FT                   /protein_id="CAE48866.1"
FT                   /translation="MQVRPTAIAGVVIVDLDLHGDNRGWFKENWQREKMVAAGLPDFQP
FT                   VQNNISFNAERGVTRGLHAEPWDKFVSVAHGEVFGAWCDLREGSDTFGEVVTCTITPHT
FT                   AVFVPRGVANGFQALVDNTSYTYLVNDHWSPDATYTAVNLDMIDWPLPPTEISEKDRCH
FT                   PQLAEATPMPPRRILITGAHGQLGRALAELLPDAELCSHVDFDVVHPPQRSWRQYEAII
FT                   NCAAYNNVDAAEDDRARAWEVNAVAPARLAQIATENNLTLVHVSTDFIFDGTTSVHEET
FT                   EAPSPLSVYGASKAAGDIAAAVTPKHYVVRTSWVFGQGGNFVETMRSLAQRGIRPNVIS
FT                   DQRGRPTHAADLAAGIVHLLRSSADYGVYNLSNSGDVVGRDDLARAVFEHCGVSGEAVT
FT                   SVTTAEYEVHRGPLAKRPAESTFNLDKIVATGFQPRPWRDAVRDYLGTK"
FT   misc_feature    complement(328133..328633)
FT                   /note="HMMPfam hit to PF00908, dTDP-4-dehydrorhamnose
FT                   3,5-epimerase"
FT   misc_feature    complement(328136..328621)
FT                   /note="BlastProDom hit to PD001462, PD001462"
FT   CDS_pept        complement(328678..329685)
FT                   /transl_table=11
FT                   /gene="rmlB"
FT                   /locus_tag="DIP0362"
FT                   /product="Putative dTDP-(glucose or
FT                   rhamnose)-4,6-dehydratase"
FT                   /note="Similar to Mycobacterium leprae putative
FT                   dTDP-(glucose or rhamnose)-4,6-dehydratase RmlB TR:Q9X7A3
FT                   (EMBL:AL049491) (331 aa) fasta scores: E(): 8.3e-84, 63.77%
FT                   id in 334 aa"
FT                   /db_xref="GOA:Q6NJN6"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJN6"
FT                   /protein_id="CAE48867.1"
FT                   /translation="MAVKRMLVTGGAGFIGSNFVRRVLATRPEYRVTVLDKLTYAGNAA
FT                   NLDGCDATLVVGDICDAQLVDRLVADSDVVVHFAAESHNDNSLVDPSPFVQTNVVGTFT
FT                   LLEAARRHDVRFHHVSTDEVFGDLELDDPNRFTEHTPYNPSSPYSATKAGSDHLVRAWV
FT                   RSFGLRATISHCSNNYGPYQHIEKFIPRQITNILSGLTPKLYGTGEQVRDWIHVDDHND
FT                   AVIRILESGRIGQTYIIGADNDHVNNKTVITLICELMGADGFEHVADRPGHDMRYAMDS
FT                   STLRAELGWQPRFTDTDTGMREGLLQTIEWYRTHRDWWEPQKAAVEQRYLAQGH"
FT   misc_feature    complement(328738..329670)
FT                   /note="HMMPfam hit to PF01370, NAD dependent
FT                   epimerase/dehydratase family"
FT   CDS_pept        complement(329691..331043)
FT                   /transl_table=11
FT                   /locus_tag="DIP0363"
FT                   /product="Putative metallopeptidase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   metallopeptidase SCD95A.06c TR:Q9KXW8 (EMBL:AL357432) (473
FT                   aa) fasta scores: E(): 5.2e-42, 32.16% id in 457 aa"
FT                   /db_xref="GOA:Q6NJN5"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJN5"
FT                   /protein_id="CAE48868.1"
FT                   /translation="MSRLRSTPIPGTRDSYTQVDFNLGFHVRHYDVSLDYVVAPNRLKA
FT                   VVTLSMDTYQPLRSLTLDLSDALTVKSVTAQGTSAVAVRVQKFRHRNHKLRISFTEEIP
FT                   VDQEFKITVTYSGNPRPIRSTWGLIGWEELSNGSLVASQPNGARSWLPCDDTPDEKALY
FT                   TMSITCDSPYTVVANGELLGTTRHGSRTQWRYQTQHPMASYLATVQVGRYERYELGAAG
FT                   EVPVIAYAPPALAAGVRHDFSDQTAMLELFSQLFGPYPFDQYSVVVTEDDLEIPLEAQG
FT                   LSIFGANHAGGTKQWERLIAHELAHQWFGNSLGLAQWDDIWLNEGFACYAEWLWFEHSA
FT                   GIPAAVTASQHYERLAQLPADIVVAAPGARDMFDDRVYKRGALTLHALRTLLGSAAFFR
FT                   AIARYVAAGRHCVVEPVDLRRELLKEVDSSAQLDALWHAWLYETALPECPR"
FT   misc_feature    complement(330030..330155)
FT                   /note="HMMPfam hit to PF01433, Peptidase family M1"
FT   misc_feature    complement(330054..330092)
FT                   /note="FPrintScan hit to PR00756, Membrane alanyl
FT                   dipeptidase (M1) family signature"
FT   misc_feature    complement(330102..330149)
FT                   /note="FPrintScan hit to PR00756, Membrane alanyl
FT                   dipeptidase (M1) family signature"
FT   misc_feature    complement(330120..330149)
FT                   /note="ScanRegExp hit to PS00142, Neutral zinc
FT                   metallopeptidases, zinc-binding region signature."
FT   misc_feature    complement(330240..330971)
FT                   /note="HMMPfam hit to PF01433, Peptidase family M1"
FT   misc_feature    complement(330414..330461)
FT                   /note="FPrintScan hit to PR00756, Membrane alanyl
FT                   dipeptidase (M1) family signature"
FT   misc_feature    complement(330555..330602)
FT                   /note="FPrintScan hit to PR00756, Membrane alanyl
FT                   dipeptidase (M1) family signature"
FT   CDS_pept        complement(331040..333034)
FT                   /transl_table=11
FT                   /locus_tag="DIP0364"
FT                   /product="Putative prolyl oligopeptidase family protein"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551 prolyl
FT                   oligopeptidase family protein MT0473 TR:AAK44697
FT                   (EMBL:AE006950) (673 aa) fasta scores: E(): 9.6e-118,
FT                   46.64% id in 671 aa"
FT                   /db_xref="GOA:Q6NJN4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJN4"
FT                   /protein_id="CAE48869.1"
FT                   /translation="MHHPPVEELELIDSPAALEWAREWSQATQERWSNDALQRSIREAL
FT                   DTDARIPYVTRRGEYLYNFWRDRDHPRGVWRRTTLESFTSDSPQWQVLIDVDRLAASEE
FT                   ESWVWKGAHVRPHHFDRALIRLSRGGADAVEIREFDLDSGSFVEDHAFAVPEAKTQVCW
FT                   VDRDTVLVGTDMGAGSLTESGYPARVHVWRRGTNLAEAEEFFCGLSSDLAVSAWAETVP
FT                   GFERLFVRRALDFYRSRTFIQRDGHLQIIEVPEDCTVVVHREWMYVLPREEYAGIASGG
FT                   VGAILFEDFLAGRRDFFTVFSPTPQSSVQDLTLTASYVVLTILEDVTSRIEVVDRGAPG
FT                   SASRRINVGDMVTARVVAADSESDELWLGASSFTQPDTLYRVELGQHTTPEVAKQAPAL
FT                   FDASRMETRQHWATSADGTKIPYFIVGDFSQGPRPTLVGGYGGFEVSLVPGYSSIRGRA
FT                   WLSKGNYFVQPNLRGGGEFGPHWHESVIRRHRMKIYEDHQAVLEDLRQRGYASQIAVRG
FT                   GSNGGLLTSVALTRYPEAIDAAVIQVPLTDMLRYHTWSAGASWMAEYGDPDDPAERAVL
FT                   ESYSPLHHVAARAQVAYPPALVTTSTRDDRVHPAHARLFARALEVAGQAVDYWENSEGG
FT                   HAGAADNAQVAASEAMIYTWLLDALGGVR"
FT   misc_feature    complement(331190..331258)
FT                   /note="FPrintScan hit to PR00862, Prolyl oligopeptidase
FT                   serine protease (S9A) signature"
FT   misc_feature    complement(331274..331321)
FT                   /note="FPrintScan hit to PR00862, Prolyl oligopeptidase
FT                   serine protease (S9A) signature"
FT   misc_feature    complement(331424..331486)
FT                   /note="FPrintScan hit to PR00862, Prolyl oligopeptidase
FT                   serine protease (S9A) signature"
FT   misc_feature    complement(331433..331735)
FT                   /note="ProfileScan hit to PS50187,
FT                   Esterase/lipase/thioesterase active site serine."
FT   misc_feature    complement(331463..331699)
FT                   /note="HMMPfam hit to PF00326, Prolyl oligopeptidase
FT                   family"
FT   misc_feature    complement(331511..331570)
FT                   /note="FPrintScan hit to PR00862, Prolyl oligopeptidase
FT                   serine protease (S9A) signature"
FT   misc_feature    complement(331580..331654)
FT                   /note="FPrintScan hit to PR00862, Prolyl oligopeptidase
FT                   serine protease (S9A) signature"
FT   misc_feature    complement(331679..331735)
FT                   /note="FPrintScan hit to PR00862, Prolyl oligopeptidase
FT                   serine protease (S9A) signature"
FT   misc_feature    complement(331847..333034)
FT                   /note="HMMPfam hit to PF02897, Prolyl oligopeptidase,
FT                   N-terminal beta-propeller domain"
FT   CDS_pept        complement(333123..334190)
FT                   /transl_table=11
FT                   /gene="slpA"
FT                   /locus_tag="DIP0365"
FT                   /product="surface layer protein A"
FT                   /note="Similar to Corynebacterium ammoniagenes surface
FT                   layer protein A SlpA TR:BAB62413 (EMBL:AB055224) (358 aa)
FT                   fasta scores: E(): 1.4e-69, 52.76% id in 362 aa, and to
FT                   Mycobacterium tuberculosis antigen 85-A precursor FbpA or
FT                   MPT44 or Rv3804c or MT3911 or MTV026.09c SW:A85A_MYCTU
FT                   (P17944) (338 aa) fasta scores: E(): 9.7e-18, 31.56% id in
FT                   320 aa"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJN3"
FT                   /protein_id="CAE48870.1"
FT                   /translation="MKFRRSLAALSIAATSVVGTMVAPAQAANLNPDTVRGQVAPATVY
FT                   EGATPGLNPAWREKATGDRVVEMWAHSPSMNRNVPLVVLKAANPGRPTIYLLNGGDGGE
FT                   GSANWVMQTKALDFYRDKDVNVVIPMAGKFSYYTDWVSEAPSLGGKQNWETFLTKELPG
FT                   PIERHLGASNKRAIAGLSMSATSALVLAEHAQGFYDAAGSFSGCAATSSPLTYHFLRLT
FT                   LERGGATPEQMWGPQGSEVNRYNDALINAERLRGTEVYVSNNSGAVGKYDLPSSPRLAG
FT                   KDPVTIFATNLITATEGGIIEAGTNMCTHDLKVKMDSLNIPATFNFRNTGTHSWGYWEE
FT                   DMVASWELFNMAFNK"
FT   misc_feature    complement(333408..334052)
FT                   /note="HMMPfam hit to PF00756, Putative esterase"
FT   misc_feature    complement(334110..334190)
FT                   /note="Signal peptide predicted for DIP0365 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.823 between residues 27 and 28"
FT   CDS_pept        complement(334217..334318)
FT                   /transl_table=11
FT                   /locus_tag="DIP0366"
FT                   /product="Hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJN2"
FT                   /protein_id="CAE48871.1"
FT                   /translation="MPYFFYLLFYQAVNIFFLESDDSTKCSSHSSPL"
FT   CDS_pept        complement(334359..334622)
FT                   /transl_table=11
FT                   /locus_tag="DIP0367"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJN1"
FT                   /protein_id="CAE48872.1"
FT                   /translation="MPSAQIKQKDGLPRSVAFGVGHWCSDLSEESQKVENKAQSGRSRV
FT                   AKSTENAGDCKDNLIHGKRTPYLTWVSAFHCDVTQVNQSSLL"
FT   CDS_pept        334658..336067
FT                   /transl_table=11
FT                   /gene="lpd"
FT                   /locus_tag="DIP0368"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="Similar to Corynebacterium glutamicum
FT                   dihydrolipoamide dehydrogenase Lpd TR:Q9Z466 (EMBL:Y16642)
FT                   (469 aa) fasta scores: E(): 1.1e-135, 78.03% id in 469 aa,
FT                   and to Zymomonas mobilis dihydrolipoamide dehydrogenase Lpd
FT                   SW:DLDH_ZYMMO (P50970) (466 aa) fasta scores: E(): 5.7e-66,
FT                   43.55% id in 473 aa"
FT                   /db_xref="GOA:Q6NJN0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJN0"
FT                   /protein_id="CAE48873.1"
FT                   /translation="MTEHYDVVVLGAGPGGYVAAIRAAQLGKKVAVVEKQYWGGVCLNV
FT                   GCIPSKALLKNAEVAHIFNHEAKTFGISGDVSFDFGAAHKRSRQVSSGIVKGVHYLMKK
FT                   NKITEIDGLGSFKDAKTIEITEGNDAGKVVTFDDCIIATGSVVRSLPGVTIGGNIVSFE
FT                   EQILKEEAPKSMVIVGAGAIGMEFAYVLVNYGVDITIVEFMDRVLPNEDADVSKEIAKQ
FT                   YKKLGVKLLTGYKTTAITDNGDNVTVEVESKDGSKKDSLTVERCMVSIGFAPRVEGYGL
FT                   ENTGVKLTERGAIEIDDFMRTNVDHIYAIGDVTAKLQLAHVAEAQGVVAAEVIAGAETQ
FT                   ELGDYMMMPRATFCNPQVASFGYTEEQAKAKFEGREIKTATFPFSANGKAAGLAETAGF
FT                   VKIVADAEFGEIVGAHMVGANVSELLPELTLAQRFDLTCEEIGRNVHTHPTLSEAMKEA
FT                   AEGIMGHMINL"
FT   misc_feature    334673..334741
FT                   /note="FPrintScan hit to PR00469, Pyridine nucleotide
FT                   disulphide reductase class-II signature"
FT                   /note="FPrintScan hit to PR00368, FAD-dependent pyridine
FT                   nucleotide reductase signature"
FT                   /note="FPrintScan hit to PR00411, Pyridine nucleotide
FT                   disulphide reductase class-I signature"
FT   misc_feature    334673..335623
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT   misc_feature    334676..334762
FT                   /note="ProfileScan hit to PS50205, NAD binding site."
FT   misc_feature    334703..334759
FT                   /note="FPrintScan hit to PR00945, Mercuric reductase class
FT                   II signature"
FT   misc_feature    334769..334816
FT                   /note="FPrintScan hit to PR00411, Pyridine nucleotide
FT                   disulphide reductase class-I signature"
FT   misc_feature    334772..334804
FT                   /note="ScanRegExp hit to PS00076, Pyridine
FT                   nucleotide-disulphide oxidoreductases class-I active site."
FT   misc_feature    334808..334867
FT                   /note="FPrintScan hit to PR00945, Mercuric reductase class
FT                   II signature"
FT   misc_feature    335072..335101
FT                   /note="FPrintScan hit to PR00368, FAD-dependent pyridine
FT                   nucleotide reductase signature"
FT                   /note="FPrintScan hit to PR00411, Pyridine nucleotide
FT                   disulphide reductase class-I signature"
FT   misc_feature    335165..335239
FT                   /note="FPrintScan hit to PR00469, Pyridine nucleotide
FT                   disulphide reductase class-II signature"
FT   misc_feature    335177..335230
FT                   /note="FPrintScan hit to PR00945, Mercuric reductase class
FT                   II signature"
FT   misc_feature    335177..335254
FT                   /note="FPrintScan hit to PR00368, FAD-dependent pyridine
FT                   nucleotide reductase signature"
FT                   /note="FPrintScan hit to PR00411, Pyridine nucleotide
FT                   disulphide reductase class-I signature"
FT   misc_feature    335180..335275
FT                   /note="ProfileScan hit to PS50205, NAD binding site."
FT   misc_feature    335447..335491
FT                   /note="FPrintScan hit to PR00368, FAD-dependent pyridine
FT                   nucleotide reductase signature"
FT                   /note="FPrintScan hit to PR00411, Pyridine nucleotide
FT                   disulphide reductase class-I signature"
FT   misc_feature    335561..335617
FT                   /note="FPrintScan hit to PR00469, Pyridine nucleotide
FT                   disulphide reductase class-II signature"
FT   misc_feature    335576..335599
FT                   /note="FPrintScan hit to PR00368, FAD-dependent pyridine
FT                   nucleotide reductase signature"
FT                   /note="FPrintScan hit to PR00411, Pyridine nucleotide
FT                   disulphide reductase class-I signature"
FT   misc_feature    335687..335752
FT                   /note="FPrintScan hit to PR00411, Pyridine nucleotide
FT                   disulphide reductase class-I signature"
FT   misc_feature    335699..336034
FT                   /note="HMMPfam hit to PF02852, Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain"
FT   misc_feature    335888..335935
FT                   /note="FPrintScan hit to PR00411, Pyridine nucleotide
FT                   disulphide reductase class-I signature"
FT   misc_feature    335933..335992
FT                   /note="FPrintScan hit to PR00945, Mercuric reductase class
FT                   II signature"
FT   misc_feature    335954..336016
FT                   /note="FPrintScan hit to PR00411, Pyridine nucleotide
FT                   disulphide reductase class-I signature"
FT   CDS_pept        complement(336275..337699)
FT                   /transl_table=11
FT                   /locus_tag="DIP0369"
FT                   /product="Putative regulatory protein"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551
FT                   DNA-binding protein, putative MT0481 TR:AAK44705
FT                   (EMBL:AE006950) (474 aa) fasta scores: E(): 2.8e-101,
FT                   55.34% id in 477 aa"
FT                   /db_xref="GOA:Q6NJM9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJM9"
FT                   /protein_id="CAE48874.1"
FT                   /translation="MGMTYVGSRLRQLRKERDLTQAALAELLGISASYINQIEHDVRPL
FT                   TPQVLRKITASFGVDATFFSRDDSSRLIAELHDVMFDKEVCPQPIDVTELSTLVDHHPE
FT                   AARAMVEMHRRYRRLRDNLDAVTDKRRLSGLDTPNPLAVLSMPHDEVRDFFYSHHNYLD
FT                   ELDRIAERIATELGITTFNIRANEAALTQRLQEDHDVKIIPSVDLGATLHKFDNVSRQL
FT                   TLSTRLIAGQRAFRLAAELGYLEAGEQMHALVADGHFQSEEARRLALRGIASYFAAAVM
FT                   LPYGIFHQQAEKCGYDIEYLCQVFGLGYETVCHRLSTLQRPQLKGIPFTFVRVDRAGNI
FT                   SKRQSATGFHFTHSGGTCPLWNVYEAFSSPGTIMRQLSEMPDGRSYLWIARTVRHHQGR
FT                   FSEPGKIFSIGLGCEARHAHRTVYTAGLDLDGFSNAVPIGAGCRVCSRTNCPQRAFPAV
FT                   NTLLSIDPHASQVAPY"
FT   misc_feature    complement(337121..337204)
FT                   /note="ScanRegExp hit to PS00622, Bacterial regulatory
FT                   proteins, luxR family signature."
FT   misc_feature    complement(337508..337672)
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix"
FT   misc_feature    complement(337508..337675)
FT                   /note="HMMSmart hit to SM00530, Helix-turn-helix XRE-family
FT                   like proteins, DNA-binding"
FT   misc_feature    complement(337580..337645)
FT                   /note="Predicted helix-turn-helix motif with score 2003
FT                   (+6.01 SD) at aa 19-40, sequence LTQAALAELLGISASYINQIEH"
FT   CDS_pept        338150..338908
FT                   /transl_table=11
FT                   /locus_tag="DIP0370"
FT                   /product="Putative succinate dehydrogenease cytochrome B
FT                   subunit"
FT                   /note="Low similarity to Bacillus pseudofirmus succinate
FT                   dehydrogenease cytochrome B-558 subunit DhsC SWALL:O54447
FT                   (EMBL:U91843) (159 aa) fasta scores: E(): 0.011, 28.22% id
FT                   in 163 aa, and to Streptomyces coelicolor putative
FT                   cytochrome B subunit SCM10.12c TR:Q9RCY6 (EMBL:AL133469)
FT                   (243 aa) fasta scores: E(): 1.8e-18, 36.01% id in 236 aa"
FT                   /db_xref="GOA:Q6NJM8"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR011138"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJM8"
FT                   /protein_id="CAE48875.1"
FT                   /translation="MTVNNIDRDAIAHGKITEKPLRERPQFPTWALKLGMAVTGLIFAF
FT                   FVVFHMVGNLKIFLPFYEDGTHPIDIYGEWLRNLLYPLLPHGVFLWIFRLVLLACIVIH
FT                   IYGAFALTARSHQSRGKFRRTNLMGGMNSFTTRTMLVTGIVLLAFIIFHILDLTVGAAP
FT                   AASDAFEHGAIYANMVAGFSRWPVTIFYVIAMVTLFMHLSHGIWLATSDLGITGKRWRA
FT                   VMLFLAYLVPAIVMIGNIAIPLSIALGLVG"
FT   misc_feature    order(338237..338305,338417..338485,338546..338614,
FT                   338708..338776,338813..338881)
FT                   /note="5 probable transmembrane helices predicted for
FT                   DIP0370 by TMHMM2.0"
FT   CDS_pept        338927..340942
FT                   /transl_table=11
FT                   /locus_tag="DIP0371"
FT                   /product="Putative succinate dehydrogenase"
FT                   /EC_number="1.3.99.1"
FT                   /note="Similar to Bacillus subtilis succinate dehydrogenase
FT                   flavoprotein subunit SdhA or CitF SWALL:DHSA_BACSU
FT                   (SWALL:P08065) (585 aa) fasta scores: E(): 5.8e-26, 34.71%
FT                   id in 579 aa, and to Escherichia coli fumarate reductase
FT                   flavoprotein subunit FrdA or B4154 SWALL:FRDA_ECOLI
FT                   (SWALL:P00363) (601 aa) fasta scores: E(): 5.7e-18, 31.72%
FT                   id in 580 aa"
FT                   /db_xref="GOA:Q6NJM7"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011280"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJM7"
FT                   /protein_id="CAE48876.1"
FT                   /translation="MSINSDTTVSTDFTQPASIVDGVKLGSILESHEPKGVPTKDMWEY
FT                   QKNHMNLVSPLNRRKFRVLVVGTGLSGGGAAAALGELGYDVKVFTYHDAPRRAHSVAAQ
FT                   GGVNAARGKKVDNDGAYRHVKDTVKGGDYRCRESDCWRLAYESVRVIDHMNAIGAPFAR
FT                   EYGGTLATRSFGGVQVSRTYYTRGQTGQQLQLAGAAALQRQIGLGTVEIFTHNDLADLV
FT                   LTEKDGKKRCEGVVMRNLITGELTAHTGHAVILATGGYGNVFHMSTLAKNSNASAMMRA
FT                   YDHGAYLASPSFIQFHPTGLPVNSEWQSKTILMSESLRNDGRIWSPLEPKDDRDPNTIP
FT                   EEERDYFLERRYPAFGNLVPRDVASRAISQQINKGLGVGPLHNSAYLDFRDAISRLGED
FT                   TIRERYSNLFQMYEEAIGENPYKAPMRIAPTCHFTMGGLWTDFNEMTSIDGLFAAGECS
FT                   WTYHGANRLGANSLLSASVDGWFTLPFTIPNYLANHLGEPRLAEDSAEAQEAVNRAKAR
FT                   IDKLMNIKGNDPHGPEFFHRQLGEILYFSCGVARNVEDLKTGIQKIRALRKEFWANLRI
FT                   TGAADEMNQVLEYASRVADYIDLGELMCVDALDRDESCGAHFRDDHLSEEGEAERDDDN
FT                   WCFVSAWEPGAVEGEFIRHAEPLTFEAIPLMTRNYK"
FT   misc_feature    339413..339892
FT                   /note="HMMPfam hit to PF00890, FAD binding domain"
FT   misc_feature    339962..340351
FT                   /note="HMMPfam hit to PF00890, FAD binding domain"
FT   misc_feature    340532..340936
FT                   /note="HMMPfam hit to PF02910, Fumarate reductase/succinate
FT                   dehydrogenase flavoprotein C-terminal domain"
FT   CDS_pept        340942..341691
FT                   /transl_table=11
FT                   /locus_tag="DIP0372"
FT                   /product="Putative succinate dehydrogenase iron-sulfur
FT                   protein"
FT                   /note="Similar to Bacillus subtilis succinate dehydrogenase
FT                   iron-sulfur protein SdhB SWALL:DHSB_BACSU (SWALL:P08066)
FT                   (252 aa) fasta scores: E(): 1.3e-08, 27.45% id in 255 aa,
FT                   and to Escherichia coli succinate dehydrogenase iron-sulfur
FT                   protein SdhB or B0724 SWALL:DHSB_ECOLI (SWALL:P07014) (238
FT                   aa) fasta scores: E(): 6.8e-08, 29.43% id in 248 aa"
FT                   /db_xref="GOA:Q6NJM6"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJM6"
FT                   /protein_id="CAE48877.1"
FT                   /translation="MKLHLEIWRQAGPNSEGHFEPIDVNDAVPQMSVLELLDHVNTGLI
FT                   EEGKEPFVFASDCREGICGTCGLLVNGRPHGLDKNKPSCQQRLDHVPDGSTLKIEPLRS
FT                   AAYPVVKDLLVDRSALDRVLEKGGFVSINAGTAPDADTLHQNHESAELALDHAACIGCG
FT                   ACVAACPNGAAHLFTGAKLIHLSLMPLGKEERGKRARKMVDELETNFGHCSLYGECADV
FT                   CPAGIPLSAVAAINKERARAFFRGKDD"
FT   misc_feature    341113..341139
FT                   /note="ScanRegExp hit to PS00197, 2Fe-2S ferredoxins,
FT                   iron-sulfur binding region signature."
FT   misc_feature    341395..341466
FT                   /note="HMMPfam hit to PF00037, 4Fe-4S binding domain"
FT   misc_feature    341416..341451
FT                   /note="ScanRegExp hit to PS00198, 4Fe-4S ferredoxins,
FT                   iron-sulfur binding region signature."
FT   misc_feature    341557..341628
FT                   /note="HMMPfam hit to PF00037, 4Fe-4S binding domain"
FT   CDS_pept        341769..342119
FT                   /transl_table=11
FT                   /locus_tag="DIP0373"
FT                   /product="Putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="GOA:Q6NJM5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJM5"
FT                   /protein_id="CAE48878.1"
FT                   /translation="MSHSLDATQESGNYPVFEGRMHYIDGYDPSSLWAPHSSLQRTSTW
FT                   VGMGAILAGLAGLGTLIFGLASSTVGSQEAWSTYALIGGVIAAVLLIGGFGLIHMGRAA
FT                   YRQYRAETGRVN"
FT   misc_feature    order(341898..341966,341994..342062)
FT                   /note="2 probable transmembrane helices predicted for
FT                   DIP0373 by TMHMM2.0"
FT   CDS_pept        342204..342299
FT                   /transl_table=11
FT                   /locus_tag="DIP0374"
FT                   /product="Putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="GOA:Q6NJM4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJM4"
FT                   /protein_id="CAE48879.1"
FT                   /translation="MSNWNKIAWVLITVIAVIIGIRYIAMGLALI"
FT   misc_feature    342222..342290
FT                   /note="1 probable transmembrane helix predicted for DIP0374
FT                   by TMHMM2.0"
FT   CDS_pept        342318..343586
FT                   /transl_table=11
FT                   /locus_tag="DIP0375"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Mycobacterium tuberculosis putative
FT                   membrane protein Rv0473 or MTV038.17 TR:O53758
FT                   (EMBL:AL021933) (456 aa) fasta scores: E(): 2.5e-69, 44.47%
FT                   id in 416 aa"
FT                   /db_xref="GOA:Q6NJM3"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJM3"
FT                   /protein_id="CAE48880.1"
FT                   /translation="MGTHSAELDRRRTLRNHKAFATGLLLVAAVIFLSCQWYTAHTDPT
FT                   PVWVGFVRAAAEAGMVGGLADWFAVTALFRYPLGLKIPHTALVRNKKDQVGESLSSFVS
FT                   ENFLNPTLITQKVRQAQVPTVLADWLVQPDNAKRVSQEAGTFVAKVVRALDPQDAETVI
FT                   NAALLDKLAQPEWGPHVGKTLQQLIDEGLTDPIVDQLAGWMHKKATTSEALIIRILDER
FT                   APSWAPRFINDIVGERVYRELVQWTAAVDRDKNHEARHAIRRFLEKFAVDLQEDPVMIQ
FT                   KVEEIKHDIMGSGPVRNAAASIWASTSSAILAAVADPESIIRTKIAEYAMAWGERIHND
FT                   EQIRTQLDRRITGAAEFLAENYADQITSIIGETIERWDADEASDKIELMVGKDLQYIRL
FT                   NGTVVGALAGLAIYTVSYLLFGL"
FT   misc_feature    order(342375..342434,342477..342545,343512..343580)
FT                   /note="3 probable transmembrane helices predicted for
FT                   DIP0375 by TMHMM2.0"
FT   CDS_pept        343599..343874
FT                   /transl_table=11
FT                   /locus_tag="DIP0376"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative membrane
FT                   protein 2SCD46.14 TR:Q9FCG9 (EMBL:AL391406) (113 aa) fasta
FT                   scores: E(): 0.0064, 32.14% id in 84 aa"
FT                   /db_xref="GOA:Q6NJM2"
FT                   /db_xref="InterPro:IPR019662"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJM2"
FT                   /protein_id="CAE48881.1"
FT                   /translation="MISFGILTILYWPIAVCGVVGAVLVAATRADAFEAADRQNKWVWT
FT                   ALLGGSALALFSGFPFLSWIGIVIIGLYWFDVRPQITNILNGNYGW"
FT   misc_feature    343599..343694
FT                   /note="Signal peptide predicted for DIP0376 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.982) with cleavage site
FT                   probability 0.611 between residues 32 and 33"
FT   misc_feature    order(343611..343679,343722..343823)
FT                   /note="2 probable transmembrane helices predicted for
FT                   DIP0376 by TMHMM2.0"
FT   CDS_pept        343881..344369
FT                   /transl_table=11
FT                   /locus_tag="DIP0377"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="GOA:Q6NJM1"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJM1"
FT                   /protein_id="CAE48882.1"
FT                   /translation="MIPIVSGPEASVDKARELAAGGEGVCVPPTLLTALGQVPGPVVSW
FT                   AGYPTGQHHSLIKASEARLAVQCGAGMVLVVPDPAAVVAGTSTALITELVTTREAVPHP
FT                   ASLALVLDTDLFAADVIARTAEHAQAAGFDAVVVKKETPQLALPTYVWDEANAGLLVR"
FT   CDS_pept        complement(344366..345109)
FT                   /transl_table=11
FT                   /locus_tag="DIP0378"
FT                   /product="Putative secreted protein"
FT                   /note="No significant database matches"
FT                   /db_xref="GOA:Q6NJM0"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJM0"
FT                   /protein_id="CAE48883.1"
FT                   /translation="MADVTTTKGSRVGKVSLIIALIVVILLVVAEFGLRAMMSQQLKES
FT                   TSPEASISFGASPLLVGIATKNLPSVTIDTPEMGESPRSHITMKNLDIHNSDAPIAEQL
FT                   KLETTLSDAYLLAAMQNGLAENTAPKPAAGELDLGSLLQSIVKVTAVTTQPAEKTITIE
FT                   FTNGAASLQLKPVVDNGSLGFEAVNANLLGFDLPQSVSDALTQQLSKQAGDSLHNMTIS
FT                   NVDVIEGGMNLTLNGNNVNLAELEN"
FT   misc_feature    complement(345008..345073)
FT                   /note="1 probable transmembrane helix predicted for DIP0378
FT                   by TMHMM2.0"
FT   CDS_pept        complement(345115..345990)
FT                   /transl_table=11
FT                   /locus_tag="DIP0379"
FT                   /product="Putative oxidoreductase"
FT                   /note="Similar to Clostridium pasteurianum pyruvate
FT                   formate-lyase ativating enzyme Act SW:PFLA_CLOPA (Q46267)
FT                   (238 aa) fasta scores: E(): 1.4e-32, 44.24% id in 226 aa,
FT                   and to Escherichia coli pyruvate formate-lyase 1 activating
FT                   enzyme PflA or Act or B0902 or Z1246 or ECS0985
FT                   SW:PFLA_ECOLI (P09374) (245 aa) fasta scores: E(): 1.1e-31,
FT                   38.68% id in 243 aa"
FT                   /db_xref="GOA:Q6NJL9"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NJL9"
FT                   /protein_id="CAE48884.1"
FT                   /translation="MADGINSTVTVERSDGPRHRGTAAGIGGLDLDLEDVTHKELIEAR
FT                   RTGDVGLVHSWELVTAVDGPGTRMTMFMSGCPLRCLYCHNPDTMGMKEGTVERVESIVK
FT                   KIKRYRNVFKASGGGLTISGGEPLFQIAFTRRVLKEVHDAGIHTTIDTSGYLGARLTDE
FT                   DLENIDLVLLDVKSGDEETYHRVSGGRELQPTIDFGNRLNAIGKPVWIRFVLVPGVSDA
FT                   PENINNVADIVAQWKDNVERVEVLPFHNMGADKWHELGLNYELEDTKPPTQESVEFAKE
FT                   TFRSRGLTVY"
FT   misc_feature    complement(345727..345837)
FT                   /note="BlastProDom hit to PD004758, PD004758"
FT   misc_feature    complement(345736..345753)
FT                   /note="ScanRegExp hit to PS00190, Cytochrome c family
FT                   heme-binding site signature."
FT   misc_feature    complement(345736..345801)
FT                   /note="ScanRegExp hit to PS01087, Radical activating
FT                   enzymes signature."
FT   misc_feature    complement(345739..345834)
FT                   /note="HMMPfam hit to PF02143, Radical activating enzyme"
FT   CDS_pept        complement(join(346069..346251,346373..348466))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="pflB"
FT                   /gene_synonym="pfl"
FT                   /locus_tag="DIP0380"
FT                   /product="formate acetyltransferase 1 (pseudogene)"
FT                   /note="Pseudogene. Similar to Escherichia coli formate
FT                   acetyltransferase 1 PflB or Pfl or B0903 SW:PFLB_ECOLI
FT                   (P09373) (759 aa) fasta scores: E(): 1.5e-171, 57.65% id in
FT                   758 aa. Presents a frameshift at residue 698"
FT                   /db_xref="PSEUDO:CAE48885.1"
FT   misc_feature    complement(346138..346164)
FT                   /note="ScanRegExp hit to PS00850, Glycine radical
FT                   signature."
FT   misc_feature    complement(346379..346411)
FT                   /note="ScanRegExp hit to PS00136, Serine proteases,
FT                   subtilase family, aspartic acid active site."
FT   misc_feature    complement(346628..348436)
FT                   /note="HMMPfam hit to PF02901, Pyruvate formate lyase"
XX
SQ   Sequence 348517 BP; 78223 A; 94972 C; 100081 G; 75241 T; 0 other;
     gtgtcggaaa cgccatccgt gtggaacgag acgtggaatg agatcaccaa tgaactcatt        60
     cagctatctc gcgaacccga aagcgagatt ccacgaatca ctgctgaaca acgcgcttat       120
     ctcaaactcg tccgacctgc ggcttttgtc gaaggcatcg ccgttttacg ggtaccgcac       180
     tcccgcgcca aggagacgat tgaaacccat ttggggcaag cgataacctc cgtgctctcc       240
     cgtcgtatgg gacgcccctt tactgtggca gtcaccgtcg accccacgtt ggacgtcatc       300
     caagatttgc cgcatgacgt gccagaacag cacattgttc agcaccacgt gcccgagcac       360
     ccccactact cgccggtatc ccaagggtat ccaccgcact atgctccgga acagtcggaa       420
     tacaacaccg agtattccga cgagtacccc tctggttggg ctacttacca cgtgcagacc       480
     ccacagccat cgcaatcttc gcagtcggca cagcagcaac cagctcaacg catgccggat       540
     cgtcgtcgtt atgctgagca gcagcaagtt ccacagcgtt ccgaagaacc agttatgggg       600
     caacgccgcg cgagagaaaa gccagctcac gacccagatc gcaatggttc attgaatccg       660
     cgctacacct ttgacaccta cgttgtctca gattccaaca aacttccgtg gtcggcggcg       720
     tgggctgtcg cagaaaaacc tgcgcgcgca tacaacccac tgtttatctg gggcgattcc       780
     ggtttgggca aaacccacct catgcacgca atcggtaact acgcccaaga gctcgatcca       840
     aagctcaagg tcaagtacgt ttcttccgaa gagttcacca acgattacat caattcagtg       900
     cgtgatgacc gccaggaagc atttaagcgc cgctaccgtg acctcgatat tttgatggtc       960
     gacgatatcc agttcttgca gggtaaagag ggcacccagg aagagttctt ccacacattc      1020
     aatgctttgc agcaggctga taaacaaatc gttttgtctt cagaccgccc gccaaaacag      1080
     ctcactacct tggaagatcg cctgcgcacg cgcttccaat ctggcttgat cgcggatatt      1140
     tacccaccag atttggaaac tcgtatcgct attttgctga ataaggcatc ggcggaaggc      1200
     attactgcag atcgtgatgt attggagctt attgcgagcc gtttcaacgc gtcgattcgt      1260
     gagctcgaag gcgcgttcat tcgagtatct gcctatgcgt cgctcaacga ggcccccatc      1320
     aacatggcca cggcacagga agcactgcgc gatatgatgc ctgagcaggc agatatcgaa      1380
     attacggcag gcatgattat gtcggtgact gctgagtact tccacattga cgtcgatacg      1440
     ctcaaaggca gcggtaagtc gcgttcggtg gctcatccgc gacagcttgc gatgtatctg      1500
     tgccgtgagt tgacggattt gtcgttgcct aagattggtg agcattttgg tggcaaggac      1560
     catacgacgg tgatgtatgc gtaccgcaag atcggtaaag agatcacgga aaagcgtgat      1620
     acttacgacg agattcagca gttgacgcag cagattaaga gctctgatcg cgcctagtta      1680
     ggctattttc gcagttcaga acgttaagag gctgtaggtg gcccctgtgg ggatacaaca      1740
     cctacagcct ctttttatga gcaacacgcg aggataagaa aatatcccac aaaactatcc      1800
     acaggtgtgt aattacagaa ttgcaattcg gtgatctcta tcactttccg cggaatattt      1860
     atacccgcag acccctgtgt ataacccgat ctaagctgtg taaaaattag ccctgaactg      1920
     gggaaggatt gtggagggaa tacggcttgg aaaagttatc cacaaccctc tatagttatc      1980
     cacagagatt ccacatccgg actcacaact cgaaaaacgg ccgccaccac gagcgatacc      2040
     ctgtcttcca cagattccac aggacttact gtagttacca actatttagt ccaaataaac      2100
     ctagggagaa ataggggttg gggaattaca cgacttgctc ggcctcgcga gcgaagcgag      2160
     cgatcttgta attacaaaaa tctggcgaat acgagttttc gttcttggcg ttcacaggta      2220
     cggttagttt ttgtaatttc aagaagtctt ccgatccgca ggctcctcct catggcagcg      2280
     cctacgtgat caatcacatc gaggagccct caagcatgga cgcacacgct gtctcattcc      2340
     gggtcgaaaa agacgacctt tccggtgcgg tgagctgggt tgcacgtaat ttgcccacca      2400
     aacccacgca gccggtcttg cgcgcggttg tcatcaccgc cgatgacgag ggactcgagt      2460
     tcgctggttt tgattacgaa gtttctacaa aagtccatat caacgcggat gttcgccagc      2520
     caggtcgtat cgccgtagcc ggcaagctga tgtcggacat catcggcacc ctgccgaaca      2580
     agaccattga ggttttcgtc gaaggcactc aggtgcaggt cgtatgcggt tcttcccgct      2640
     tcgagcttcc cctgattcct ctcgacgagt acccaccgtt accacagttg ccagcggtaa      2700
     ccggtgccat cgacccgaat ttgttcacgg atgcggtgct gcaagttgct gcggccgctg      2760
     gtcgcgatga gacgcttcca atgctcacgg gtatccacat ggagatcgac ggcgagaacg      2820
     tcaccttgac cgcaacggac cgtttccgtc ttgcgttacg acgtttcacc tggtcaccgg      2880
     ctaatccaga agccaaggca aagctgttga tccctgcgaa gaacctttcg gataatgctc      2940
     gcagcctcga ttccggttcc actgaacccg tcgagatcgc cgtgggcact ggcgaaaaca      3000
     tcggtgctga aggcctgttt ggtattcaca tcgataaccg ccagaccacc acgcgcatgc      3060
     tcgacgcgga cttcccgaat gtcagcccgc tgctgcccaa ggtgcataac gcaatggcca      3120
     gcgtggaaat ttctgcgctt tccgacgcca tccgccgcgt agccctagtt gctgagcgca      3180
     acgctcagat ccggatgcag ttcacccgtg acgaggttat tctctctgct ggtggttcgg      3240
     atgcaggtca cgccgaggaa tccgtgcctt gtgcttttac cggcgaccaa gaatttttga      3300
     tcgctttcaa ctcggcatat ctgcgtgatg gcttgagcgt gatccggact agccgtgtag      3360
     tcttcggttt cacggagcca tctcgccccg caattatgat tccggagccc gagacgctgc      3420
     cggaagcaag cgctgatgga acgtacccta cgccagatac cgaattcacc tacctgctca      3480
     tgccagttcg actgccagga taaaaacact ctctgactag tgcaaaggac gtcgccccac      3540
     cgtgtacatt cgtgagcttt cgcttcgaga tttccgctcg tggccagagt gcactgtcac      3600
     tttggaacct ggggtgacgc tttttgttgg ccgtaatggt tttggcaaaa cgaacattgt      3660
     tgaggccatc ggctatgtgg ctcatctggg ttctcaccgt gtgtttcacg attctgcgct      3720
     ggtgcgtcaa ggaaaagaat cggctcgtgt gtcggtaaca gcggttaacc acggccgcga      3780
     gctcaccgcg catctgttga tcaaagctaa gggagctaac caagctcaga tcaatcgaac      3840
     tcggctaaaa agccctcgtg agctgcttgg tgttgttaaa acggttctgt tttctcctga      3900
     agatttgagc cttgttcgtg gcgatccggc agagcgtcga cgctatcttg accatgtgat      3960
     tgctacacgc aaaccccgcc ttggcggtgt gaaagcagac tatgacaagg tgctgcggca      4020
     gcgtaactcg ttgctcaaaa cagcaggtgc tgctttgcgt cgtggctatg gcgctgatga      4080
     tggtgcgctt tctaccttgg atgtgtggga ttcccagttg gcacgtcttg gtgggcagct      4140
     cattcatgca cgtcatagtg tggttcggga gttaggtccg ctggtgcatg atgcctatgc      4200
     gcgtattgct ccggagtcgc gtcctgctca tattcgctat gtgtcgacgg tgccgtttgc      4260
     ggatgttgtt gagttgccga gccccgaaga attcgaggcc gctatgcttg ctgagctggg      4320
     gcaatgtcgg gataaagaaa ttgatcgtgg agtgtcgctg gtggggccac accgtgatga      4380
     tcttgatgtt gtcttgggtg attaccctgc gaaggggttt gcgagccatg gggaaacgtg      4440
     gtcgatgtgt ttgtcgttgc gcctagctga gtttcatttg ctgcgtaatg atggcaccga      4500
     tcctgtgctt attctcgatg atgtgtttgc ggagttggat acgcagcgtc gtgagaagtt      4560
     ggtgagtgtg actgccgagg ctgagcaggt gctcatcact gccgcggtgg gtgatgatct      4620
     gcccgatact cttacggagt cggcggtgca tcgtcacttt gtcagtgttg cggacactcc      4680
     tgagggacgt atttcgcttc tcgacgccgc cacgggggta ccacatgacg gataatgatg      4740
     cggtttctgc tgcttttgca catatgcgcc aggaggcgaa aaaacgcaca ggcactgttc      4800
     cgaacctgaa caggccgttg ccgaaggcgt cgaaaagcct cgcggataac gacgccaccc      4860
     ctgcggtgcc gaaacaacgg ggcatggcaa ctggccctga tggtcgtcgg cggcggcgta      4920
     gctactcggt gcagcgggct ggaagtatcc tcagcgatga gattaaaaaa cgtggttggc      4980
     gcaaagaaat cgcaggtgga tgggtaaatt cgcactggga tgatttggta ggggcgcaaa      5040
     ttgctgcgca taccaaagtg gaaatgttca aagataaagc tttgtttatc acatgtgatt      5100
     ccactgcatg ggcgaccaat ttacgcatga tgcagcgtat tattttgcgg tctattagcg      5160
     agcaaatcgg cccagatatc atcgttgaac tgaagatttt tggccccaag gcaccgagtt      5220
     ggcggcatgg tcctttgcac gttaaaggca ggggcccacg cgacacatac ggataacagg      5280
     cgctgtgtag cctgtggggc gtgtgcgagg ggctacctag tggggaggta ggcagtgtaa      5340
     tatgggagag tctaggctca aatctcgcat agcaaggagt gcacgcttcc gtggcaaccg      5400
     ctgaacatga atatggcgcc tcatccatta cgatcctcga gggtctggag gccgtccgca      5460
     agcgtcccgg tatgtacatc ggttctaccg gtgaacgcgg cctgcaccac ctagtgtggg      5520
     aggtcgtgga taactccgtc gacgaggcaa tggccggtta tgctacccac gtcgatgtga      5580
     ccctgcttgc cgacggcggc gtggaggtcg tggataacgg ccgtggtatc cccgttgaaa      5640
     tgcacccatc tggtgcgccg accgtccaag tcgttatgac ccagctgcac gcaggtggca      5700
     agttcgactc cgattcctac gcggtttccg gtggtctaca cggtgtgggt atctccgtcg      5760
     tgaacgccct gtctacccgt gtggaggcag acatcaaacg tgatggcaag cactggctgc      5820
     agaacttctc catggccatc cctgatccgc tggtcgaggg cggtaatgct cgtggcaccg      5880
     gtaccaccat ccgcttctgg ccagatgcgg agatctttga aacgaccacc ttcaagtttg      5940
     agacgatcag ccgacgtctc caagaaatgg ccttcttgaa caagggtctg accattacgc      6000
     tggtagacaa gcgcgttact gacgaggaac ttgaactcga agcgatcgcc gaagaaggcg      6060
     acaccgctga aaacgtttct ttggaccaaa tcgatgtcga tgccgacggc aacatcgatg      6120
     cacctgctgc accaaagaaa cgcgagaaga agaaggtttt cttctaccca gatggtttga      6180
     aggactacgt tgcacacctg aacaagtcca agcaggttat ccaccccacc atcatctcct      6240
     tcgacgccaa gggcaacgac cacgaggttg aggtggcaat gcagtggaac aacagctact      6300
     cgcagagcgt gcacaccttc gctaacacca ttaacacgtt tgaaggtggc acccacgaag      6360
     agggcttccg tgccgcgctg acgtcgttga tgaaccgcta cgctcgtgag cacaagctgc      6420
     tcaaggaaaa ggaagcaaac cttacgggtg acgactgccg tgagggcctt tccgccgtga      6480
     tctccgtgcg cgttggtgat ccgcagttcg agggccagac caagaccaaa cttggaaaca      6540
     ctgaggtcaa gggctttgtt cagcgtatgg tcaatgagca cattgctgat tggctggatg      6600
     ctaaccctgc agaagccaag acgatcatca acaaagctgt gtcctcggcc catgcgcgcg      6660
     tggcggctcg taaggcgcgc gatttggtgc gtcgtaagtc ggccaccgac ctcggcggcc      6720
     tgcccggtaa gctcgctgat tgccgctcca aggacccaga aaagtccgaa ctgtatatcg      6780
     tggagggtga ctccgcaggt ggttccgcta aggctggccg tgattccctc taccaggcaa      6840
     ttcttccgct gcgcggtaag atcctgaacg tggagaaggc acgtttggac aaggtgctta      6900
     agaacgccga ggtccaagcg atcatcaccg ctttgggtac cggcattcat gatgagtttg      6960
     acattaagaa gctgcgctac cacaagatcg tgctgatggc cgacgccgat gtcgacggct      7020
     ctcacatcgc aaccttgctg ctcaccttgc tgttccgttt catgccacag ctgatcgaag      7080
     aaggccacgt ctacctcgcg cagccaccgc tctacaaact taagtggggc aagggtgagc      7140
     caggctttgc ttactctgat gcggaacgcg acaccttgct tgctgagggc ttggcgcaaa      7200
     accgcaagat caacaaggac gacggcatcc agcgttacaa aggtctaggc gagatgaacg      7260
     cctctgagct gtgggaaacc acacttgatc cgaagtaccg cgtcctgcgt cgcgtggaca      7320
     ttaccgacgc acagcgtgcc gacgagatct tctccatcct catgggtgac gacgtatctg      7380
     cacgccgtag ctttattacc cgccgtgcta aggacgtccg tttcttggac atctagcatg      7440
     acgctagcat gacgaaggcc cgccgcagag tgtttctgta gcgggccttc gtagtggggg      7500
     agttacttca tgtagttctg catgatttgt cccaaacctg gcaggttggg ctcgataaaa      7560
     cttgctgcct taccgcgcaa ggaaccgtat gcctttttca gcgctggcat gtcgactttc      7620
     tcagcgttgc gatccgcaac ttcgaggatc ttgtcgctga cctcggactt gtgctgctcc      7680
     aggaactcgc caaagtgggt gctgtcggag gcttcgaaag aagcccagta gggatccaat      7740
     acttcgacaa cctcgggcaa gaggcgctcg gcacccttgg tgacgatgtc agggcggact      7800
     ttcttggcgg ccgccacggc acctttaagt gctacgccag aaatgccgct ggactgcgaa      7860
     actgaacgat caatgaagcc tgcgagctca gctgctaggg cagtgcgctt ggtgtctaga      7920
     agttgcgcga gtgtactcat ccgctagtcc tttcgtttaa aaacagaaat tgtggagtgt      7980
     tattcggcat tctagcctgt tatgcggttg gtgctagttg aaacataaaa gcgacctcca      8040
     ttgctggatc tccacaccaa cggggtgcgt gttggaaatc cagcgacggg ggtcgcctgc      8100
     gttgtcattc ttccgccaca gtaatgtact gcaatcacaa cagtcacaaa tgttacagga      8160
     gtggcgcagt ggcatacaac aaaaccgtgg gattttcggc tcaaaggccg ttgaggtcgc      8220
     gaaggactgc cactaaaaaa tcggcaaaat ccgtgttgcg atcatccaaa ggcgaaagct      8280
     gaataaccaa gctgcgcacg tatttcacca tgtgatgggc ggtagggaag accactaccg      8340
     cgtggatatg tgcggtggtt acggcggcga ttgcgttaag agctgcataa tcgcgcacac      8400
     tgagatctcc tgaagtctgc gcgcagaagg cgtcggcaag catgagcgtt tgttcgggag      8460
     taagcccgcg cacggggcta cctgcctagc ctatgttcgg tggctgcata gtgggggagg      8520
     tgctggcggg cgagggtgcg cacttcttcg tcggcaagca tgcgggctgc tgcggcgatg      8580
     attgctctgg tggctgcctc ttgtttgctg cagccttggg cctgggcgag gagggcgagc      8640
     gcgcggtcgt gttctgctgt gagacgaagt gtcatagcca tgcggaaatg gtatcaatct      8700
     gataccaaaa atgcttggat gtggcgttag aagctagaat agaggggtta ttgcctacat      8760
     actcgatgaa tcttatagaa aaaggtgaca tatgagcgac gatcttctcg gtggtgacgg      8820
     ctacgaccgc gtccacccga tcgacctcaa cgaggagatg gagaccagct acatcgatta      8880
     tgcgatgtcg gtcatcgtcg gccgtgcttt gcctgaggtc cgtgacggac tcaagccagt      8940
     gcaccgccgc atcctctacg cgatgtacga ctccggctac cgccccgacc gcagctacgt      9000
     aaagtctgcg cgcccagtct cagacaccat gggccagttc cacccccacg gcgactccgc      9060
     aatttacgac accttggtgc gcctcgccca agactggaac atgcggtacc ccatggtcga      9120
     cggccagggt aacttcggct cccgcggcaa cgacggcccc gcagctatgc gttacaccga      9180
     gtgtcgcctg accccattgg ctatggagat ggttcgcgac attcgcgaga acaccgtgga      9240
     cttctccccg aactacgacg gcaagaccca agaaccagac gtattgccat cgcgcgttcc      9300
     taacctgctg atgaacggct ccaacggtat tgccgtcggt atggccacca acatcccgcc      9360
     gcataacctg cgcgaacttg gcgacgccat cttctggctg ctagacaacc ccgaagcaga      9420
     cgaagcgtcg gcgctggaag cctgcatgaa gtatgtcaag ggccccgatt tccccaccgc      9480
     gggccagatc gtcggctccc aaggcattaa cgacgcctac accaccggcc gcggctccat      9540
     ccgcatgcgc ggtgtcactt ccatcgagga agaaggcaac cgtcagatca tcgtgatcac      9600
     cgagctgccc tatcaggtca acccggacaa catgatctcc aacattgcgg agcaggttcg      9660
     cgacggcaaa ctcgcgggca tctccaagat cgaggacgaa tcctccgacc gcgtgggcat      9720
     gcgcatcgtg gtcaccctca agcgtgacgc tgtgccgcgc gtggtactca acaacctgta      9780
     caagcactcc cagctgcaaa ccaacttcgg tgcgaacatg ctgtccatcg tggatggtgt      9840
     gccacgcacc ctgcgtctcg accagatgct gcgccactat gtgacgcacc agatcgaagt      9900
     gatcgtgcgc cgcacgcagt accgcctcga cgaggcggaa aagcgcgccc atatcttgcg      9960
     tggtttggtc aaagccctcg acatgctcga cgaggtcatc gccttaatcc gtcgttcgcc     10020
     aaccgtcgac atcgcccgca ccggcctgat ggaactgctc actgtcgacg aaatccaagc     10080
     agacgccatc ctggctatgc agctgcgtcg cctagctgcc ctcgagcgtc aaaagatcgt     10140
     cgacgaactt gccgagatcg aactggaaat cgccgactac aaggacattc tggcccgccc     10200
     agagcgtcag cgcgctatcg tgcgtgacga gcttgcggag atcgtcgata agtatggcga     10260
     cgaccgccgc acccaaatca tcgccgcaac tggcgatgtc accgaagaag acctcatcgc     10320
     ccgcgagaac gtggtagtca ccatcacctc caccggctac gccaaacgca ccaaagtgga     10380
     cgcctacaag tcccagcgac gcggcggcaa gggcgtacgc ggcgccgagc tcaaacaaga     10440
     cgacgtggtc cgccacttct ttgtcagctc cacccacgac tggatcctgt tcttcaccaa     10500
     ctttggtcgc gtctaccgac tcaaagccta cgaactacca gaagcatcgc gcaccgcccg     10560
     cggccagcac gtggccaacc tgctggaatt ccagccggaa gagcgcatcg cccaggtcat     10620
     tcaaatccag tcctacgagg atgcccccta cctcgtactg gcaaccgcgc agggtcgtgt     10680
     gaagaagtcc cgcctctccg actacgagtc caaccgctcc ggcggactta tcgccatcaa     10740
     cctcaacgaa ggcgacaagc tcatcggcgc agcactatgc gacaacgacg acgacctgct     10800
     gctcgtctcc gaagaaggcc agtcgattcg cttcaacgcc aacgacgacc aactgcgccc     10860
     catgggccgt gctaccgcag gcgtgaaggg tatgcgcttc aagggcgacg accaactgct     10920
     ggcaatgaca gtggtcaagc cggatgcatt cttgctggta gctacctccg gcggctacgg     10980
     taagcgcacc tccttggatg aatactcacc acagggacgc ggcggccagg gcgtgcttac     11040
     cttcaagtac acgccaaagc gtggcaagct catcgccgca gttgttgttg acgaagacga     11100
     cgagatccta gctatcacct ccgctggcgg cgttatccgc accgtagtga accagatccg     11160
     cccgtcgtca cgcgccacca tgggcgtgcg cctcgtcaac ctcgaagatg gcgtcgaact     11220
     gctcgccatc gaccgcaacg tggaaggcga aggcgaagaa gccgccgaag ccgtagccac     11280
     cggagctgtc gacggccccg ccgaacgcgg caagcaaacc gaagttgacc tcggcataga     11340
     taacgccgac gaggaggcct aatggcaaca cgcgacgtga tcattacccg agtagcacca     11400
     ggcagtgcgt ttaaaaccgc actctccctg tcgctgatcg gacttatctc atggctgatc     11460
     tgcgttgtca tcctgtactt cggcatgcaa gccgtaggaa tctgggacaa aatcaaccag     11520
     gtcatcggcg gcgttggtgg cgaccaaatc gtctccttcg ggctgatcat cagcctagcg     11580
     gcgctgctag gaaccatcgt ggccatcatc gctacggtgc tcgccccgct cacagcactg     11640
     gcatacaacg cattcgttga tcttttcggc ggtgtcgaag taaccatgcg cgaagaactc     11700
     gactaacgcg tatcttttag caaaacaggc cgtgtaagcc gtcatcatcg tggcagcaca     11760
     cggcctgttt ttgtattatt gccggaactt gattaaagtt ggcatacgtt cctatgaggg     11820
     cctatagctc agtcggttag agcgcatcgc tgataacgat gaggtcgcaa gttcgattct     11880
     tgctaggccc accagggacg aatggggcat tagctcaatt ggtagagcat ctgctttgca     11940
     agcagaaggt caggagttcg attctcctat gctccacagt gtggaaccca gccggtgagg     12000
     ctgggttctt ttttgctttg cgtgccattt ttcgcctcct cgaactcgag actacgaaaa     12060
     ccgcaggaag gctgttatgc cgcgcgagtg ctgtccttgg gttttcgcag tcttgaactc     12120
     gagttcgcgg ttggggaaga gccgcagtgg gaaacgtcga taagcgtgct tgtgtttagt     12180
     gcgaagtcag ctcgtagaaa tccgcaatgt ggtcgtgaac gagggtgcgg gctttatctg     12240
     ggttgcgttc ttcgatggcg cgcaggatat tgcggtgttc gcgttgtagt ttttctgata     12300
     cttctgccca gtcggtgcgc atggcgagtc gttcgatgac gaatgcgatg gcggagtagc     12360
     gcagggattc catgatggtt tctgtgacga ggttgcctgc tagtgaggtg atcagaatgt     12420
     gaaagttgac gtctttgatg tggtagtcgt ggaacggcag ggtggggtcg tccatgctgt     12480
     cgagaagtcg gtgggcttcg ttgaggacgt ggctgcgttc gggggagtct gggctgatct     12540
     taggagtggc tgcgtcggcg gctgcgttgg attcgatgag aatgcaggtg ttgacgaggt     12600
     ctttaagcgg gagtgatcgg gcgctgagat gcatgcgaat ggcccaggag agccctgctg     12660
     atggttcgga gataacgatc gctccggagt gcgggccgga tccggtgccg gtgcgtacga     12720
     gtcccatgga agtgaggatg cggatggctt cgcgtacgga tgccctagag agttcgaatt     12780
     gttctgcgag tgcgcgttcg ccggggagtt tgtcgccgat agcaatggag cctttgcgca     12840
     gctctttttc cagccaatct aggacttctt gataggcccg ttgggtggat tgagacatgt     12900
     gcaaaggctc ccttgttcaa ggcggatgtg ggcggatatg ggtggatgtg ttaggtgtaa     12960
     tcctaatcca cgtgccttgg aagtcgtgcc gttatggtgt tggtagcatc catgccaata     13020
     cattggattg taggaacacc atggtgcata ggactacgag gagtcctatg gaccaccaga     13080
     tgacggagcg gaagatctgg gattctttgc cttccattcc tacggagctt gcggcgatgg     13140
     cgagtgattg tggggagatc atcttgccga cgacgccacc ggaggtgttg gctgcggtca     13200
     tgaggtgggg atctagtccg atgttttcag ctgcggtttt ttgcaggttg gagaagagtg     13260
     cgttggctga ggtgtcggag cctgtgacgg cggtgccgac ccagccgagt actggggaga     13320
     agaatgcgaa tgctgcgccg aggcttgcga ctgcggtgcc gatggcgagt gtttggccgg     13380
     agaagttcat aacgtaggcc aaggagagga cgctgacgat ggtcagtgcg gagaagcgca     13440
     tcctgtagaa gcataatccc agctccatgg ctgcgcgtcc gagtgggagt tggtagcggc     13500
     ctttgtcgtc gaaaatcgag tagacgatgg cgacgatgat gccggtgatc agcaggaggg     13560
     tgccgggtga agatagccac tggaagttgt aagtggtgga tttgatggct tcaccggagc     13620
     tgttcaggat atgtccgtgc aggcctggcc atgggatttt cacgtcggtt gcggcgagtg     13680
     ctttggggat gtcgatgccg agcgtccata gtttggcaac accgaagatc gcgacgacca     13740
     aaacgtaggg gaagacggcc atccatgtgc gtgacagggt gagacggccg gcggcttcgt     13800
     gcttttcgac gcccagacgc tcgcggactg cgtcgagtcc tttgggcttc cacacctgca     13860
     gcaacagtac ggcggcgatg aggccaacga gggatgcgac gacgtcggta agctcgtagg     13920
     agaagtaggt ggcactccac cactgggaga tggcgaagct taggccgatg gtgagcgctg     13980
     ctggccaggt ttcgcgcagg ccacgtacgc catcgatgat gagcacgatg ataaacggca     14040
     cgagtgctgc aaagaagggc gcttggtggc cgacgacggc accgatgtgg gccgagtcga     14100
     gtccggtcag ggtaccggcg gtggtaattg ggatggcgac cgcaccgaat gcgacgggtg     14160
     cggtgttggc gattagtacc acggtggcgg tcttgagcgg tttaagacca agcgccatga     14220
     tcatggttgc ggtgatcgct actggggcac cgaaaccggc gagtgcttcg aggagtcctc     14280
     cgaaacagaa cgcgatcaag attgtttgga tgcgcaggtc gccaccgccg acggtgtcga     14340
     agatggcgcg catgtcttga aagcgtccgc tagcgactgt gacttggtag aaccacaggg     14400
     ctagtaccac gatccatacg atggggaaca ggccgaatgc tgcaccttgg gtggcagata     14460
     gtagggcgaa attccagggc atgtggaacg ctgcgatggc cacgatgatg gcaacggcga     14520
     gggctgtgag gccggaaaca tatgcttttg ctttaacgac caaaagcatg acaaagaacg     14580
     tgatgagggg cagaagtgcg acgatagccg aggcagtggt gctgcctccg actgcgctca     14640
     cgtttgcggt aaaagtgtcc atcttgagga aactcctgga gtctttaagt tagctgccca     14700
     atgggagcta agaacaggca ggggctctac cactatcgac tcgaaaacaa tccgagttgg     14760
     tctgaccaca gtggtaagac cacagacttt atagttgatc tatgtcacat gtcaatgctg     14820
     tggtgatgat gtgcggtgtt gtagaagtgt ttcaaatgaa aataattcga aaaatgacgc     14880
     ggtcgaataa aaaaattttt ctcggattct tgcacctagg gtcggctgca cgcgtgctga     14940
     tcgcttacaa atctttaaaa cactcttgaa atgagaatga ttatccgtat ggtgtgtggt     15000
     gtccggccgg acgaaccaca gagccttaga ccaaaaggct gtgtttttcc attcaatcga     15060
     taccgatctt tctatttgag aggggaatct ctttgtctcg tagcaagaac gcactaattc     15120
     gaaatctttc gattgccgca ggagcggcag caataagcgt gggtgctgcg atgggaccgg     15180
     ctttggcagt agatgctgct caggaagcac cgaccgcaga taattcccca gcagtagagg     15240
     caccgcagac accagaagag ggagagcagt ccgcgcagac ttcgcaggac aaccctcgtt     15300
     atgagtcgca aatcgtgcga gcaggacact ccgcggaagc tgagcaagta ggcgatgttt     15360
     ccgaggacac catctttgaa tactccgaat ttgacatccc agaaggctgg tttgtcagcg     15420
     ttgacgaaga ctccggcaag gtgaccgtca gcacgccccc agatgcccag gacggtgaca     15480
     actacaccgt caaggtgaag gctgttgacc ttgacggcaa cgtcacgtgg agcgaagtaa     15540
     ccttcacggt cggtgaccca gaaaccgaca acccagagat cgagccgctt gacgctgacg     15600
     ctcctgaggt agagcttcca gccgcagagt aatgtctgtg ctcctgtcct aggcgtggcc     15660
     tagggcgggt ggagaaagaa tagggaaaga cttttaaaac cccaagctgg gcatggtcgt     15720
     gtgattatgg tccggcttgg ggttttgtgc atggtgcatg ggctaacatc gacacatatg     15780
     aaagttaggc aatccaaagt tggcgggcgg gctcgttggg ctctgattct cagcgttgtt     15840
     cttacatggt tctcggttat tggcatgtgt atggccatta ttggagctgg tcgcattatt     15900
     gatggcggtg gggtgtcgcg gtggatcatt gcgggaccgt ttgtggttat ggtgtcgttt     15960
     gcgctgcggg ggtgggtgct tgccggcggt caggttgctg aggagcggcg ggtgcgtcgt     16020
     cagcttgttg agcgtgtgtt tcaggctggt gagattcgta cgtcgaagtt tccgacgggg     16080
     gctgtggtgg ggttggcgac ggagtccgcg gagaagatga tggcttttcg tgtggggttt     16140
     atgtcgcaaa tagtggcgtc gttgacgtcg ccgttgttgg ttttggtggc gatggggtgg     16200
     tcgtctcggt ggtggctggc ggcggttgtg gctgctatgt tgccgattgt tccgcttgtg     16260
     gtgggtgggt ttcgtaaaat ggtagtgcgg gtgtcgcatg gttcgcagga tgcgcgtaag     16320
     gcgttggctg ctgattacat ggatgccctt cgtgcgttgg gaacgctgca gttgttgggg     16380
     gcgtcggcac gcgtggccca gcgcctggct gcgcgcgggg aggataatcg tgtggcggtg     16440
     atgcagctgc tgcgtgggaa tcagctgatc ctttttgcta tcgacgccgt ctttagcctc     16500
     gcaattgtgg ccgtttccgc aggtctggct ctttttcaag ttcgccaagg ggtgctaact     16560
     ccagggcagg ggatcaccgt catagcgctt agtattttac tgcttgaacc aatggaccat     16620
     atcggtgcgt ttttctatgt aggaatggcc ggctggggtg cgcagcgcgg aatccacgga     16680
     tttatcacct cattaccaac cggacacgcg cacgtaccca gtgcccaacc ggggtgcatc     16740
     accatgcatg atgtcagctt ttctcacggg gattccgtgg tgctatccca tgcacaactg     16800
     gagattcaac gagggcagcg cgttgccatc gtgggccgtt ccggtgctgg caaaaccact     16860
     ctcttgtcgt tgatcgcagg gatgaaaact ccccaagctg gggcgataac gcgtggaggg     16920
     gattgtgcgg tggttgctca gcacacgtgg cttttccaag gaacaattgc agacaacctg     16980
     cggttagccc gccccgaggc aactgaagaa gagatgtggc aggcgctgag tagcgcccag     17040
     cttgccgacg aaatccgcac catgcccgca ggtcttagca ccctcatcgg cgagttcggc     17100
     gtggggcttt ccggtggtca ggcccagcgt ttgtcgctgg cgcgcgcttt gatctcaggg     17160
     cggcgcatcg tgcttttcga cgaacccact gcccacgttg atcttgcctc cgaggcaaaa     17220
     atcttagatg cgatcaacaa ccttggtcgc gactacaccg tggtcatggt gactcaccgt     17280
     gacacctcac ttgcccacat ggaccgcatt gtccgcgtga ccaatggtcg tatcgaggaa     17340
     gaagaacacc agcatgcgca ctgaacccac cccctggcac ctgatccgct ggctactagg     17400
     cattacccgc ccagtgctac gccccttggg ggcttctaca ttgtgccgaa tcataaacca     17460
     aatattgggc atctttttgt atgtgatccc cgcatattcc ctggttgctg gcgtaggaag     17520
     tgtctcatct gtggtggcca tcatggtggt catcgcattg ctaaaagcat tattgcgcta     17580
     tgcggagcac tatcttggcc atcttgttgc cttcaaagca ctagagctga tccgtattcg     17640
     tgtttttcgt gacatctacc cgcaagcccc agcgatcatg cgtcgtactg ggccggatgc     17700
     ggttggtagc ggcgacatgc tgacacgact gactcgcgac atcggacaaa tcgaggtgtt     17760
     tttcgcccac accaccgcgc cggtgatctc tgctgctgtg gtgccgctgg gggtagttat     17820
     taccattttc atgctctctc cagtgcatgg cctgatcgcc gctgtcattt ttggtgttgc     17880
     agtggtggtg tctttagaca acagtgctta tcgctttgcg atccgcgtca gcgaacaccg     17940
     cggcaacatc acccagcaca tcacagactc agtcggcggt gtggcagaaa tagtgggata     18000
     cgacgcgcaa cagcgcaggc agcacgaatt acgcgacagg gaagagcctt tgcagacggc     18060
     ggttcgacgt cgcgggggaa tcgtcggcac gcgattaggc gttgtagccg ccgctcgcat     18120
     ctgtgtgctc accatgctcc tgccaaccac cgacaacatg gcactagctg tggtctgcat     18180
     gtttgcagta ctgcgttgct gggacatgat caacgaggtc gccgacctag gcaaccattt     18240
     ctctaactct ctagccgcag cgcgccgggt atggtcactc gcccacgcag ggctcgcgct     18300
     taacgacggc ccccaaccgc tgccaaccgc caccaccggt gcaacagtcg aatgggacaa     18360
     cgtgaccttc acatacccag cagaaaccac accagcactt cgcaacgtat gcctcactgt     18420
     tcccgcggga agctggggtg ccatcctagg ggccaccgga tccggaaaat ctaccctcgc     18480
     ggcattactg ctccgctatt gggatcccac aaccggcgcc atacgcgtcg atggccacga     18540
     cattcgcacc tgtccgctgg agcaactccg tagcactgta tctatagtca cccaagacat     18600
     caccttgctg aacaccacgg ttgccgacaa tctgcggctg gcacaaccaa acgccaccga     18660
     cgcagagctt atcgacgcct taactgtggc atgcctcgac cgcgaactca ccctcgatac     18720
     cgcggtagga gaacaaggtg cgaacctttc tggtggacaa cgtcagcgac tctctttagc     18780
     ccaagcattg ctgcgccacg gtcgcgtgct gattcttgac gaattcaccg ctcaccttaa     18840
     cccagctctg gcagccaaca tccgcagccg cctgcgtgaa gcgtgcccgc acaccacgat     18900
     tatcgaaatc acccatgacc tcacctacct agacagctat caatgggtgg ctgctattga     18960
     ttccggctcc ctaatcgacg cagcacagta ctcgaggtaa acatgtgctg acatgccgtt     19020
     ttggaattac gtggcgtatg ctgtaaagtt ccttttcgtt cctatgaggg cctatagctc     19080
     agtcggttag agcgcatcgc tgataacgat gaggtcgcaa gttcgattct tgctaggccc     19140
     accaggaacg aatggggcat tagctcaatt ggtagagcat ctgctttgca agcagaaggt     19200
     caggagttcg attctcctat gctccacagt gtgggaccca gccggtgagg ctgggttctt     19260
     ttttgtttgt gtgccatttt tcgcctcctc gaactcgaga ctacgaaaac cgcaggaagg     19320
     ctgttatgtc gtgcgagtgc tgtccttggg ttttcgcagt cttgaactcg agttcgcgga     19380
     ggaacgggta gtgtgccaac aatttttggc gtgttctttt gggagtgaat ttgtgatgtg     19440
     acgtagagaa atcatcggtg ggctaacggt cgcgttggag ctgattccag aaacgatcgc     19500
     ttttcggtgg tcgcaggagt tgatcccgcg gtgggacgta tccccatggt ggcattagtg     19560
     gccgtgatga tgaaggctgt gatcagtacg tttgatttgc agtcggttca tccgcgcgcc     19620
     cagctggtga ttgttgattt gtcggatgcg gatcgagggg actcgatagt tcgagccttg     19680
     atcgtctcga ccacctcagc ggtcgggttt aacctagtgg ggttgggcgc tgccagacta     19740
     gggcagcacc ttcgtgacct gccatgatga tacgcagtgt gagagtgttg gcgaagcgta     19800
     gcgatccgac tgctgtgagg aagagaatcc cgcaggcaat gacgctggcg tcggcaagct     19860
     cggtgtgcgt ggacaccgga cccggctgcg cttcgctgag cccgagggtt gccatgaggc     19920
     tttcgccggt caccttggca agaacaatag ctgccgacgc caccgtgacc acgcctaccg     19980
     tgagcttgcc gattttgggg taaagcgtcg ggcgaatgct caaggctaat gagaggagtg     20040
     ctgcgaccgg aaccgctacc accgccaagt ggacgatgag cgggtgaaat ggcaaagaag     20100
     caatcatggc gtcatgctag tgcgtgtggg ctatgccacg atagcaaact aaagctacgc     20160
     tgtggcgggg atggggatta ggggtttttg ggtcggggtt gttatagtgt tgttgcacaa     20220
     ggggcattag ctcaattggt agagcatctg ctttgcaagc agaaggtcag gagttcgatt     20280
     ctcctatgct ccacagtgtg gaacccagcc agtgaggctg ggttcttttt gttttgtgtg     20340
     tcatttttcg cctcctcgaa ctcgagaaca cgaaaaccca aggacggcac gcgcgggtca     20400
     caacagcctt cttgcggttt tcgatgtctt gagttcgagg agacggtcta cgggacctaa     20460
     aacgcctgaa aaatttgtcg caaaccgctc gcggacgtcg agggtggcgt cgataagcta     20520
     ggggtggaat tcggggcgta cggcgtcgtc gctaccgagg cgctgtgggt agccaggcag     20580
     tgtgaacaag atgcacgctg cagtgattgc tttgtcgcgg ccaacaacag aagcaatgcg     20640
     ggaaacgtcg tgattgccta cgaatgtttg tgggataaag gagtccgccc attcaatgtg     20700
     gcgcttgatg cactagtcta attcgaagaa gttttcgtct ttgagggagg agcagatggc     20760
     tttccagagc tcgtattgtg ttacggaatc catactgtta tcggctacga tttgggcgta     20820
     gtcgccgtgg attacttcgt caaaaatgaa ggcgtggggt gagtagtgtg gacttggtgg     20880
     agcacttcgc gccagaattc cgagtcgacg gaataggctg cgtcgagacg ccaccccgta     20940
     gcgccttggt ctaatcaata ccgcataacg tccgccacgt ggctgaacac actattgagt     21000
     atcactgcaa tcccgcgctc atcacatgcg gcgaccagcg actgccaatc ctcggccgtg     21060
     cctaaccgtg gcgctggatc caccggctcg cgtaccggca caccagcaaa tcccagcgga     21120
     tatacctgcc acatgatcgt ggtgggatcc cacgctctcg tatcactatg agttatgggg     21180
     ttcatgatag gcggaatagc agtgccagca gtgccactgg gtcaacttga tcaagcaatt     21240
     tctcttcctt gctatggtga gctgccgcta cattgcaccc ccagatgggg gaggaatctg     21300
     tcccagctca accccactga atcggtaaag atgcaggtca gcggtttgac ctcaagccgt     21360
     tgatgcgaca ccatgcttga gtgaaaagta taaagaagac cctcaaagcc gccgcagccg     21420
     ctgtggcagc ccttgttact gtcaccgcat gttccgctac tggcggtgcc ccgagggctt     21480
     ctgacaatcc caacggccaa gcaggaggcg tggatactcc tcgttacacc gttgcgatga     21540
     ttactcatgg cgcaccgggt gatacattct gggatttggt gcgtaagggc gctgaggatg     21600
     cggctcgtaa aaataacatt gagctgcgat attcttcgga tcctgaggct cctaatcagg     21660
     cgaatcttgt gcaaaatgca attgattccc gtgtggatgg tattgcggtg acgttgccta     21720
     atgctgatgc gattggtccg gtggcgcgta aggctgccga taagaagatc ccgattgtgg     21780
     ctctgaacgc tggtatggat gcgtatcaga agtacaacat cagcgcgttt tttggccagg     21840
     aggaaaaggt cgctggcacg ttggctggtg agcgcctggc taaggatggt gctcgtcatg     21900
     cgttgtgcgt gatccatgag cagggcaatt cttcgcagga ggcgcgttgt gctggtgtga     21960
     aacagggcat gggcggcaat gtggagacgt tgtatgtcaa tggcaaggat ctcacgagtg     22020
     tgcagtcgac tgtgcaggcg aagttgtcgc aggataagag tattgattgg gtgatgggct     22080
     tgcaggctcc ggttgcgatg accagcgcgg aggctgtgaa gaacgcgggc agtgcggcga     22140
     aggtggctac gtttgatacc aacgcccagc ttgtcgacgc catctcttcg ggtgcgattg     22200
     cgtgggctgt ggatcagcag ccgtatatgc agggttattt ggctgtggat tcgatttggt     22260
     tggcgcatcg taatggttcg acgatgggtg gtggtcgtcc ggtgtatacg ggtccaagtt     22320
     ttgtggatag ttccaatgtg gatgcgattt ctgaggctgc gaaggcgggt ctgcgatgag     22380
     ttctgtttct gctgatgatc gacttcgtcg tcgtactggt ttttctgcgc tgattcgtcg     22440
     ccctgagttg gcgagtttgc tgggcgctat tgctattttc gtgttgttta tggtgttggc     22500
     accgtcgttt cgttcgttgg aatcgttttc cacggtgttg tacgcgagtt ccactatcgg     22560
     cattgttgcg gtagcggtgg gcatgctgat gatcggcgcg gagtttgatt tgtcttctgg     22620
     tgtggcggtg acgagtactg cgttggcggc cacgatgctg aactacaatt tacacctgaa     22680
     tagttgggtg ggtgccggta tttcgttggt gtttgcgctg ggtattggtg cgtggaatgg     22740
     ttttttggtc acgcgtactg gcattgatag tttcttgatt actctggcag gttttttggg     22800
     tttgcagggt ttgaatttgg cgatcactaa gtgggtgacg ggccaggttg ctactccgat     22860
     tatttctgac atggaaggtt ttggttctgc gcgcgtggtg tttgctggca cgattcatgt     22920
     gggttcggtg tcgatccgtg ccacggtgtt gtggtggatt ttcttcgtcg tgatcggttc     22980
     gtggttgttg tttaaaactc ggtttggcaa ctggattttt gcggtgggtg gcgatgccga     23040
     tgctgctcgt gcttcgggtg ttccggttga tcgcgtaaaa attattctgt ttatgtttgt     23100
     tggttttgcg gcgtggtttg tgggcatgca caatcttttc gcttttgatt cgattcaggc     23160
     tggccaggga gtgggtaatg agtttttgta tatcattgct gcggttattg gtggctgtgc     23220
     gatgacgggt ggccgcggaa cgatcattgg tacggcgatt ggtgctgtga ttttcggtat     23280
     gactaatcag ggcattgtgt acgcggggtg gaatccggat tggtttaagt tcttccttgg     23340
     tgccatgttg ttgtttgcgg tgttgactaa tacgtcgttt gctagtttga ccaaggggag     23400
     gcgctaaatg tctgagatta ttgcgttgcg ggatgtgacc aaatcctatg gcagttttga     23460
     tgcgctgcgc ggggtgtcgc tttccatttc cgcaggtgag gtcctgtgtg tgttgggtga     23520
     taatggtgcc ggaaaatcta cgttgattaa gattttgtcg ggtattcata agcccacgag     23580
     tggcgagatg cttatcgacg ccaccccgac ggtgttcaat ggtccgaggg atgccctgaa     23640
     tcagggcatt gctacggtgc accagaattt ggcggtggtg gggcacatgt cggtgtggcg     23700
     caatttcttt ttgggccagg aactgacggg gtttttaggc cggctgcgtg aagacgagat     23760
     gcggcgtatt acccaagagc agttggctgc tatgggtatt gatcttcctg atgtggatgt     23820
     ggaagtggag tcgttgtctg gtggtcagcg ccaagtggtg gcgattgccc gtgcggttta     23880
     ttttggtgcc cgtgtgatta ttcttgacga gcccacggct gctcttggag tgaagcaatc     23940
     cggtatggtg ttgcgttttg tggcggctgc tcgtgaaaaa ggcattggtg ttgttcttat     24000
     tacgcacaac ccccatcatg cgtatcttgt gggcgatcac tttacgatct tgaatctggg     24060
     taatcagatt ctggatgctg atcgcagcaa cgtgactctt gaggagctca ctcagcacat     24120
     ggctggcggt ggcgagctag aagcgctgag ccacgagctg cgtcgataac gtggcctgcc     24180
     gcacgtgaac gcgtggcagg ctatgaatct gatgggttag tcgtcgttct tttcgctgtt     24240
     tttgagctgc tcttcgaggg agttgagtag ttcctcgtcg cgctcaggga ttccctcttc     24300
     tggggtttgt gtggaataca ccaagcggga ttcttcggtg ttaacggtat cggcaccgaa     24360
     gtcctcaacg cgtggtggtt catcggatac gccggagccg gagaatttat cccacaggaa     24420
     gtaggctgcg gcgccgagtg ctgcgagtac tacggtgtag agggagcagc gcacagcttg     24480
     ggcgccggcg ctgcgtttct ttttggtgag gccagctttt tgagcttgtt tgcgtgcttt     24540
     cttgcgggct ttcttggaga gtttctttga ggtcttagcg acgtcttttt tggtgctctc     24600
     ggcggtgttt tgtgcatccg cgagggctgc gtcgagacgc ttgcgggctt ggcctgctag     24660
     cgaggttacg ttttctacgg cgctgtcgcg gacatcttcg gcggtatctg ctgcggacag     24720
     gagagcgtcg tacgcctcac tggccttgcg gtcgcggtag tccgcgtact tgttgtatgc     24780
     cgcctttgtt agtacaactg cgccacggat ggtggttggg ttcatccttt atcgtccttc     24840
     ccagttgtgg ttacttatcc atcaagcgta gcgaggttgc gggtttcatg cttatgatga     24900
     atggcatgac tttgaagacc gctactgcga ttttgcacac caaccgtggt gacgtttcca     24960
     tcgagttgtt tggcaaccat gcgccaaaga ccgtcgaaaa ctttgtcacc ttggcaaacg     25020
     gtaccgctga gtacaagacc gaaaacgctt ccggcaccaa cgagggcccc ttctacgatg     25080
     gcgcagtgtt ccaccgcgtt atcgacggct tcatgatcca gggtggcgat ccaaccggca     25140
     ccggtcgtgg cggcccaggc tacatgtttg ctgatgagtt ccaccctgag ctccagttcg     25200
     atcgcccatt ccttctggct atggcgaatg ccggcccagg aaccaatggc tcccagttct     25260
     ttatcaccgt ggtaccaacc ccacacttga acaaccacca caccatcttc ggtgaggtca     25320
     ccgatgcagc ttctcagaag gttgttcttg acatcgctca gactgcaacc gatcgtatgg     25380
     atcgcccagt tgagccagtg gttatcgagt ccgtcgaaat caccgaataa aaagcttacg     25440
     ctgagcgctt taacgcttaa cgacgcccct gctagcactt tttactgaac tagccccaga     25500
     ggttggactg gtttaattct aggtggttag ggccttaagg gtctgatccc gatactgcat     25560
     cggagtcagg cccttgaacc gttgttgaag ccggtcgttg ttgtaccaga agatgtaatc     25620
     atctacggcc cagtaaaact catcaacact ggcgaagtgc tcgccgtagt acattttggt     25680
     ctccagatga ccgaagaagt tctccatcac cgcgttgtcg tagcagttga cctcacgcga     25740
     catcgactgc actccaccaa tagactcaat taactaacac caactggagt gctggtacta     25800
     gatcccttgg tcagtgtgca ccatcaaccc ttcaccatgt ttatgccatg tgatcgcatt     25860
     ctttaacgaa gtgggggtgg tgcatactga agtgatgaac gcactcaaac gcgcatatgg     25920
     tcaagcgcct gcgaccgcgg ttctttgcgc gctgacgata cttatctatc tgcttactgt     25980
     tgtggagtcc cgctcgattg aacacaacct tagtgattcg tggattgcag atcactggac     26040
     tctttatggt ccgtattctc atggcctagg gtggctgcgc atggtgggga cggtatttct     26100
     ccacagcggg cccacacatc tggcgttgaa catgtttatg ctgttcttct ttggtcgcga     26160
     gattgagcat tatttaggca gtggtcgttt tactttggct tatatcgtga gcgggattgg     26220
     ggcctcggca actgttctgc tgatggatcc gcttgcgcct acggtgggtg cttctggtgc     26280
     tgtgtatggg cttatggcga tttttgtggc gatgtcgtac cggttgcgta gggatctcac     26340
     agcaccgttg attcttatcg cagtgaatgt gggctattcc ttgcttatgg atggtgtttc     26400
     cctgtgggga catttgggtg gcttgctgac gggttgtgtg ctggggattg ttttggtgat     26460
     tgcgcagact actcgaggta ataagcgggg gtgagataag gggtttatct aggggcgtct     26520
     cgtgtttgca tgaggcgcct attttttgag aaaatcctta tcacacaaac cacataaata     26580
     acatgagacc cagcagttag ctgcagtttc gtgggttgac tgctggtggg gagcaatgtg     26640
     gttatcagct gtcacaagag gcgacatgag gctactgggg tggcccaacg ccccagtttt     26700
     tggtggggta tagtgcgcag ctgttctgag ttatccccag atttttgtaa ttatccacca     26760
     aaatttcaca acttttggtc tgtgaacaca gcgctgatcg tgtgaaaaag attccacagc     26820
     agttatccac aatgtggata attacatgtg tgttgttcac agagtgatga tcgaatagct     26880
     gtgtgttcga agtgtgcgac ctgctatttt cccacaagat ttcgaacaaa tccgcaggtg     26940
     gggaagaagt gcacaacttt atccacaggg tgtggataaa gtctggggat aacttccacc     27000
     cgtgtaattc cacaatttct tccacagcct gtggataact tttggtgata gatgttcaca     27060
     agtggtggat aacttgtgag taaacctcac atctggtggt tctgacctaa aaggggagcg     27120
     ctgtgtcgtg cacgctaggc ataagagtgc aagtcaacgc cggggacttg tttggtttga     27180
     ggtgactatt tgtgcagata gatagctact tttgtgcaag aagtggctac ggggtgataa     27240
     aaacccatcc accatgccgg taactgagaa aaattaaggt tttgtgtggt gatggggagc     27300
     gttctagata tcgcgtgatt gaggggctag gtggtggcgt aataccccta ggcgttttac     27360
     taaaaccgca tgtcgcctcg cgctttaaaa gtgttgttac ccccatcgga gtggggtgtg     27420
     gcggcacaat gttgggtgcg tgttctaggt tagtgagtgt cccccgcggg cgcccgagca     27480
     cgggctgaga ttgcgctgat gctgtgcaag caccgtttga acctgtctgg ttaacaccag     27540
     cgaaggaaga gaggagcgcg agcctagtgt cggcagcctc agctaattca gtaaccaatc     27600
     catctgcttg ggaaaactcc gagatccatc cgaagcactc gtattcgccg atcgtttccg     27660
     gtgaccttga ggtcccagaa acagagattc agcttgacga ttctcctacc ggccccaatg     27720
     atccagttcg gatctatcgc acccgtggcc ctgagtgtga tcccacggtg ggattgaagc     27780
     cactgcgtgc acagtggatt gatagtcgtg aggacacgga agaatatgct ggccgtgagc     27840
     ggaatttggc tgatgatggc cgctccgcgc agcgtcgtgg cgcagcttcg ctggagtgga     27900
     aaggcgtgaa acccacaccg cgacgcgcca agcagggcaa gcgcgtgact cagatgcact     27960
     atgcacgcca gggcattatt acgaaggaaa tggagtttgt ggcgctgcgc gagcacatgg     28020
     acccagagtt tgtgcgcagc gagatcgccc gtggccgtgc gatcattccg aacaacatta     28080
     accacccaga atcggagccc atgattattg gtcgaaagtt tttgaccaag atcaacgcca     28140
     atatcggtaa ctccgcagtg acctccagta ttgaggaaga agtatccaag ctgcggtggg     28200
     ctacccgctg gggtgcagat accgtgatgg atttgtccac cggcgatgat attcacacca     28260
     cccgcgaatg gattatccgc aactccccag taccaatcgg tacggtgccg atctatcaag     28320
     cgctggaaaa agtcaatggt gtagcagaag accttacgtg ggagattttc cgcgataccg     28380
     tcattgagca gtgtgaacaa ggtgtggact acatgaccat tcatgccggt gtgttgctcg     28440
     cctacattcc actgaccacc aaacgcataa ccggaattgt atcccgtggt ggatccatca     28500
     tggcgggttg gtgcctagct caccataagg agtccttcct ttacgagcac tttgatgagc     28560
     tgtgcgagat tttcgcgcag tacgacgtcg ccttctcgtt gggtgatggc ctgcgccctg     28620
     gttctgttgc cgatgcgaat gatgcggccc agttcgcgga gctgaaaacc attggtgagc     28680
     tggctcgtcg tgcgtgggaa tacgatgtgc aggtcatgat cgagggccca ggtcacgttc     28740
     cgctgaacat ggtgcaggaa aacaatgagc tggagcaaaa gtgggctcac gatgcgcctt     28800
     tctacactct tggcccattg gtgaccgata ttgcgccagg ctatgaccac atcacctcgg     28860
     caattggagc tgctcatatc gctatgggtg gtacggcgat gctgtgttat gtgaccccga     28920
     aggagcactt gggtctgccc aaccgtgacg atgtaaaaac cggtgtgatt acttataaac     28980
     tcgcagctca cgcggccgat gtggctaagg ggcaccctgg tgctcgtgcg tgggatgacg     29040
     cgatgagcaa ggcacgtttt gagttccgtt ggcacgatca gttcgcgttg tcgcttgatc     29100
     cagataccgc gattgcttac catgacgaaa cgcttccggc ggagccggca aagaccgcgc     29160
     acttctgttc catgtgtggt ccgaagttct gctccatgcg cattagccaa gatattcgtg     29220
     acatgttcgc agataagatc gccgacttgg gtatcccgca ggttggcggc gacgcagaag     29280
     ctggtatggc ggcaaagtct gaggagtttg tggcccaagg atcgcagctt tatagcgagg     29340
     tgcgtgacaa tgctgcccac gcctaggtgg ggtcgagact ttgatccgcg gtgctacttt     29400
     gtcaccggca cgggctctgt ggatcacatt gtcgacgtag cgcgccaagc agcgcgcgcc     29460
     ggcgctgggc tcatccaagt gcgcagcaaa cccattgctg cccgtgacct gtacattctt     29520
     ggccgtgagg tagcccgcgc ggtggcggag gttaatcctc gcacccgtgt gcttatcgac     29580
     gaccgcgtgg atgtcgccct tgcgttaatg aataacggcg agcacatcca cggggtacat     29640
     gttggccaag atgaccttcc ggtgcgccat gttcgcgcct tgttgggtga taacgccatc     29700
     atcggcctca ccacgggcac cttggagcta gttcgtgctt cgcgccaggt tgccgaggtg     29760
     atcgactaca tcggtgccgg tccatttcga cccacaccga caaaagattc gggccgtgcc     29820
     cccgtgggct tagctggcta tccgccactg gttgctgaat cattggtgcc agttgttgcc     29880
     attggggatg ttcgccccga agatgcggct gatcttgctg caacgggggt cgctggtgtg     29940
     gcaattgtgc gcgcattaat gaactcacag ggcgtagcaa ccgatgtaaa actcgtattg     30000
     aaaggttttg cacaatgaaa atagccgttg taggtggtgg aatcgtaggg ctaagcaccg     30060
     cctttgaact tagttcccgc gggcatagtg ttcacgtatt tgaccccaac ccagcaagtg     30120
     gggcctcaca ctttgccggc ggaatgctcg cccccgcagc cgaagtgcag ttccaacaag     30180
     acccgttgtt tccgttgatg aagcgcgccg gtaagctgtg gccagacatg gtgcgtcggg     30240
     tagcgcagcg caccaacctg cctaccggtt atcgcaccga aggcaccctc gttgtggcag     30300
     ccgatcgcgc cgacgcggaa caccttaaac aattgcgcgc aacccaagag gcggccggaa     30360
     tggatgttcg ccccattact acccgacagg cccgtggcct cgaaccggca ctaggacctc     30420
     ggctatcggc ggccgtacac atccccaacg acacccaagt cgcaccacgc gtattcctca     30480
     ccgcactact cgacgcactc gatgactgtg gagtaggggt aataaaagag aaaatcaccg     30540
     acctcgaacc cctctaccaa caattcgatg ttgttgtcct cgcagcaggc cttggtgcac     30600
     aacacctaag ccccataccg ttagcactac gacccgtgcg cggcgacatc ctacgagtac     30660
     aaacagaacc aggggcagtc aacatggttg tgcgcggctg ggtcaacgac cgccccatct     30720
     acatcatccc gcgcgcaaac ggcgaaatcg ccatcggagc caccagccgc gaagacgaac     30780
     gcgatttgcc cagtgtagaa ggaatatacg acctgctccg cgatgccata cgcgtagtac     30840
     cgggtatcgt cgatagttcc cttatagaag ccaacgttgg tgtacgcccc ggcacacccg     30900
     acgacctccc atacctcggg tgggcatcag accgactcat tatttccacc ggatacttcc     30960
     gccacggcat cttgctctca gcactcggcg cccacgtcac cgcatgcctc atcgacggca     31020
     ccgaccccgg catcgacctc acagcatgcg caccagatcg acaccacaac gaaaggggca     31080
     caacccatgg acatctacat taacgacatc cccaccgcca tagaatcacc ccagctcacc     31140
     gacattatca gcaaccactg caacggaatc cgccgaggga ttgccgtagc catcaaccaa     31200
     cgcgtgatac cccgctcaca atgggacacc accacagtca ccgcaggcga ccacctcgac     31260
     attctcaccg cagtgcaggg aggataacat gctcaccatc gcagaccgca gcttccaatc     31320
     ccacctcatc atgggaaccg gtggcgcaag ctcctttgac accctagaaa aatccctcat     31380
     cgcctccgga accgaactca ccaccgtagc gatgcgtcga cacgccgccc acaccggagc     31440
     ccacggcgaa tccgtcttcg aactcatgca gcgcctcaac atcaccccac tacccaacac     31500
     cgcaggctgc cgcaccgccc gcgacgccat cctcaccgca caactcgccc gcgaagcact     31560
     cgacacctca tggatcaaag tggaagtcat cgccgacgac accaccttgc tccccgacgt     31620
     cctcgaactt atcgacgcca ccgaaaccct caccaacgac ggattcaccg tcctcgccta     31680
     cacctccgac gaccccgtag tcgcacaacg actcgaagac gccggcgccg ccgcagtcat     31740
     gcccctagga tcacccatcg gaaccggact cggcatcctc aacccccaca acatcgaact     31800
     catctgctca cgcgccacag tccccgtact cctcgacgcc ggcatcggaa ccgcctccga     31860
     cgccaccctc gccatggaac tcggctgctc aggcgtactc ctcgccagcg ccatcaaccg     31920
     atgcatcaac cccatcacca tggccaccgc catgaaacac gccgtcgaag caggacgact     31980
     cgcgcgcgaa gccgggcgca taccgcgccg ggagcatgcg gtggcgtcgt caagctttga     32040
     agggctcgcc tcctgggcgg acgaggtgct gtgatgctcg acgagctgga acgccaacgc     32100
     gtagcccgcc aactgcggct acctggtttt gggattgagc agcaagaacg gctcaacaac     32160
     gggcgagtgc tggtgatcgg tgctggggga ctgggcagtc ctgccttgca gtcccttgcg     32220
     gcggctgggg tggggtcgat ccgactcgtg gataacgaca ccgtggatgt gtccaacatt     32280
     caacgccaga tcctgtttgg tgttggggat gtagggcgct ccaaagttca cgtcgccgcc     32340
     gaaagattgc gtgcaattca acccgggatt cgtatcgacg cccgcaccga acgcctcacc     32400
     gcacacaacg cacacgaact cgccgaaggc tgcgacgtga tcctcgacgg ctccgacacc     32460
     tttgctacca aatttctctg cggcgacctc gccgaaataa caggcatacc gctcgtctgg     32520
     ggcagcgtac tgcaattcga agggcacatg ggcgtattca cccgcgaggt agggctacgg     32580
     gacctgttcc ccgaagcccc cacccaagga ctcaactgtg ccgacgcagg cgtactcggc     32640
     gctaccaccg cagtgatcgc caacctcatg gccactgaaa ccatcaaaat cctcgccgga     32700
     atcggaaccg tccaaccagg agccgtcacc acctacaatg cgttgaccag cacatttcgc     32760
     acatacactg tggggcgtga cccccttcga tctgcagccc gcacacttta cacgtggacg     32820
     ctacccaacg aatacgaact tatcgacgtc cgcgaacccc acgaaataga acacacaccc     32880
     agcggcgcgc acatcaccct gccacaatcc atgtggaatg acaccacggc gatccaacat     32940
     gcgctcgaca acatcaccac agacaatgtg gtcgtcgtct gtgcctctgg cataagaagt     33000
     gccgcattta tcgaacaatt cgcacacctt aacccacacc tcaccttcca caacgtcccc     33060
     agcggaatca acgaactacc atgaccccac acatactcac catcgcagga tccgacccct     33120
     ccggcggggc cggaatccaa gcagacctca aatccatcat ggcagccggc ggctacggca     33180
     tggcagcaat caccgccctg accgcgcaaa acacctgcgg agttaccgca atacacaccc     33240
     cacccacgga gttcctcagc gaacaactcc gcgcaatatc cgacgacatc accatccatg     33300
     ccatcaaaat cggcatgatc ggatcctctg atgcagccac cgccatcgcc acatggcttg     33360
     accaactaca ccacacatcc atcgtggttc tcgacccagt catggtagcc acctccggat     33420
     cggtacttgg ccaacgtcat tattttgaac ccctgctcca ccacgccacc gtgatcaccc     33480
     ccaacctgcc agaactcgca gtcctggcaa acaaccacgg ccctgaacag gccgaacatg     33540
     ccgcacgcag cctcgcagaa caatacgact gtgcagtgct gctcaaaggt gggcaccgac     33600
     acggaaccga cgaccttggc aacacctgga ttactgccag tggcccccaa ttccacgcac     33660
     ccagcccccg catccacacc accgacaccc acggcaccgg ctgctcgctc tcctcagcac     33720
     tcgccacccg gcttgccatc gaacccccag aacccgccct ccactgggct accacttggc     33780
     tcaacggggc aatcgcccac ggcagtgacc tcaacgtagg ccacggcaac ggtcctgtcg     33840
     accacagcta ccagctaagg gaatactcag ctaactgcaa cacaatcaat gcaccctaaa     33900
     accggaagtg ccaccacacg ggggtatttc gaaggatttt tctccgaact tcacaccaaa     33960
     tcgcttccaa accggccgtt tgactggatt tggtgtgaag tgccgttttt tcgggggtgg     34020
     gcggggtggc tcgcccacca gtgcccacca gtgcccacca gcgcccacca cggcgccaac     34080
     atccgacaca caatcaatgc actctaaaac cggaagaacc gacaatggtc gctagttaat     34140
     atccgcaacg tgcgaccacc accgagatcc cgcgcatgca actgctcgga atcaacacca     34200
     ggtagggaag gggtagtcga gataatggag ttcatatgag gtgcgattgt gcgcgtagaa     34260
     atactcttgg cggagctact gggataacag cgttgtaatt aatagggtgg gttaaggggg     34320
     tgaaaataga aaatctgttg cctaactttt gataagtcac taacttaatt aaatagaact     34380
     gaacctcagt aagcattggc tcgtttccaa tgttgattgc tccgccggtg ctccttattt     34440
     ttaagggcgc cggctttctt aatagaaagg cgtaaaggtg aaataccacg taggtataga     34500
     cgtcggtaca ttttccgtgg gactagctgc catcgaagta gatgacgctg gaatgcccat     34560
     taagacgtta agcttggtat cgcatattca cgattcggga ttagatcctg acgagattaa     34620
     atctgcggtg acgcgattag catcatcagg tattgcgcgt agaacacggc gcctctaccg     34680
     gcgtaagcgt cgtcgtttgc agcagctgga taagtttatt cagcgccaag gttggccagt     34740
     aattgaattg gaagattatt ctgatccgct ttatccatgg aaggttcgtg cagaactcgc     34800
     ggctagctat atagctgatg agaaagaacg gggagaaaaa ctgtcggtag cgttgcggca     34860
     tattgcgcgt caccgaggtt ggcggaatcc ctatgcaaaa gtttcttcgt tatatcttcc     34920
     cgatgggcct agtgatgctt ttaaagcaat ccgagaagaa ataaaaagag catccggcca     34980
     accggtgcca gaaaccgcaa cagtaggcca gatggttact ctatgcgaac tgggtacttt     35040
     aaaacttcgt ggtgaaggtg gcgtgctgtc agcacgactg cagcagtctg attacgctcg     35100
     agagatccaa gaaatctgcc ggatgcaaga aattggacag gaactatatc gcaagattat     35160
     cgacgtagtt tttgctgctg agtcccctaa aggttctgct tctagccgag taggaaaaga     35220
     tcccctgcaa cctggtaaaa atcgcgcact taaagcttct gatgcctttc agcgataccg     35280
     aattgcagca ttgatcggca atctaagggt gcgggttgac ggtgaaaaac gaatcttatc     35340
     ggtggaagag aaaaaccttg tgttcgatca cttggtcaat ctgacaccaa agaaggaacc     35400
     agaatgggtg acgattgctg agattctggg aattgatcgt gggcaattaa tcggtaccgc     35460
     aacgatgacc gatgacggag aacgcgcagg ggcacgtccg cctacacacg acacgaatcg     35520
     cagcattgtg aacagcagaa tcgcaccact tgtagattgg tggaaaactg cgtctgccct     35580
     agaacaacat gcaatggtaa aagcactcag caatgctgag gtagatgact ttgattcccc     35640
     agaaggagca aaggtccaag cctttttcgc agaccttgac gatgatgttc acgccaaact     35700
     agattcgctt catttgcctg tcggtagagc tgcttacagc gaggatacgc ttgtgcggct     35760
     tactcgacgt atgttgtctg acggtgtgga tctctatact gcaagactgc aagaatttgg     35820
     tattgaacca tcttggacgc ctccgacgcc tcggattggg gaacctgtag gaaatcctgc     35880
     tgtcgaccgt gtactcaaaa ctgtttctcg ttggctagaa tccgcaacaa agacatgggg     35940
     tgctccagag cgtgtgatta ttgaacatgt ccgagaaggc tttgttactg agaaacgggc     36000
     ccgcgaaatg gacggtgaca tgcggcgacg tgctgcacga aacgcaaagc ttttccaaga     36060
     aatgcaggaa aaacttaacg ttcagggaaa acctagtagg gctgacttgt ggcgttatca     36120
     gtctgttcag cgccagaatt gtcaatgcgc ttattgtggt tcgcctatta ccttctcaaa     36180
     ctcggaaatg gatcatatcg ttccacgagc agggcaagga tcaacaaaca cgcgtgagaa     36240
     tctagtggcc gtttgccata gatgtaatca atccaaagga aatactcctt ttgcaatatg     36300
     ggcaaaaaac acttctattg agggcgtaag cgttaaggaa gctgtagaac gcacacggca     36360
     ttgggtcacc gatacgggga tgcgcagcac tgactttaag aaatttacca aggcagtggt     36420
     ggaacgcttc cagcgtgcca ctatggatga agaaatcgat gctcggtcca tggaatctgt     36480
     cgcatggatg gccaacgagc tacgttctcg agttgcgcaa cattttgctt ctcacggaac     36540
     cacagtcaga gtttatcgag gatctttgac cgcagaagcg cgaagagctt caggtatttc     36600
     aggaaaactt aaattctttg acggagtcgg aaaatcacgt ttggatcgcc gacatcatgc     36660
     aatcgatgct gcggtgattg catttactag tgattatgtg gcggaaactc ttgctgtgcg     36720
     atcaaatctc aaacagtctc aagcacatag acaggaagca ccacaatggc gtgagtttac     36780
     tgggaaagac gctgaacata gagctgcatg gcgagtgtgg tgccagaaaa tggagaagct     36840
     atcagctctg ctaacagaag atctacgcga tgatcgcgtc gttgtgatgt ctaatgtgag     36900
     gcttcggcta ggaaatggct ctgcacataa agaaacaatc ggaaagctct ctaaagtaaa     36960
     gctaagtagc caattatctg tgtccgatat tgataaggca tccagtgaag ccctttggtg     37020
     tgctttgaca cgtgaaccag gttttgatcc caaagagggg cttccagcaa acccagagcg     37080
     ccatatacgg gtaaacggaa cacatgtgta tgcaggagat aacattggat tattccctgt     37140
     ttcggcaggc tctatagctc ttcgaggtgg ctatgcagaa ttgggaagca gcttccacca     37200
     tgccagggta tataaaatca cttcaggtaa aaagccagca tttgcaatgc ttagggtcta     37260
     taccattgat ttattgccat atcgtaatca agacctgttc tcggttgaac taaaacctca     37320
     gaccatgtcg atgcgacagg cagaaaagaa acttcgagat gcacttgcta ccggtaacgc     37380
     cgaatatctc ggttggctag tcgtagacga tgaacttgtt gttgatacct cgaagatcgc     37440
     aacagaccaa gtaaaagctg tagaagctga gcttggaact attcgtagat ggcgggtaga     37500
     tgggttcttt agtccttcta aacttaggtt gcgtcctctg caaatgagta aagaagggat     37560
     caaaaaagag tcggctcctg agctatcaaa gattattgat agacctggat ggcttccggc     37620
     tgtgaataag ctgttctctg acggaaacgt cactgtagtg cggcgtgatt cgttagggcg     37680
     tgttcgtctt gaaagcactg cgcacctccc cgtgacttgg aaggtgcagt agacaatgaa     37740
     tcctggatgg cgagttgtgg atctgatcga ttttgatggc aaagtctcat atcagcgtgg     37800
     acagctcgcc atcacatcag attctggtga attacgtgca acgttgccgt tggcacagat     37860
     cgctgttgta cttatcggca ataagctaat cattagcggt gcagttttgg tcaaactttc     37920
     tgagtatgac attgctgtgt tggtatgcga ttggcgcagg gttcctgtcg cagggtcttt     37980
     ttcatggaac gaacatacgc gtattgcggc acggcaacgt gctcaagcga gtttatcgct     38040
     tccacgacaa aaatccgctt gggctcaaat cattaaggcg aaaatattag gccaagcacg     38100
     gactgctgcc cagttaggtt ttgatgctac cgatttaaag aacttggcta gggcggtccg     38160
     ttctggggac gtggataacc gcgaagctat ggctgctaag agatactggg aaattatctc     38220
     agctgaagat gatttccgaa gattacctgg gcttgctgct acggggtgga acggggcttt     38280
     ggattatgcg tatacagtct tgcgtggaca tggtatgcgt gcgatttgtt ctgctggtct     38340
     agtagggacg ctgggcgttt ttcatcatgg ccgaggtaat cagtttgctc tggtggatga     38400
     tctaattgag cctttccgtc cggctattga ttacgcggtt ttttcaattg tgtctaattc     38460
     acaagagcta gataaggaaa ctaaacgcca gcttgtggct gctgtggaag agcctttcaa     38520
     ttctgcgggg cagtcaattc cgacggtttt taccgcgttc gctcaacagt atgggcggta     38580
     tgtggaaggt gatgttgaga aattagtacc gcctatttgg gaaggtccct tcgatgccga     38640
     agaaaggtag cgatccggtg tggtgtgtgg tgatgtttga tcttccggtg aagacaaaga     38700
     ctcagcgaaa gcaagcaacg gcgtttcgtc agaatctttt agatcttgga ttctgtatgg     38760
     cacagctgag tgtatatgtg cagtacctgc ctctggccgc aaagttatct aatttggtga     38820
     aattaattaa agaaaaatta cccccaggtg gggatgttcg aatcctttcg gtatcggaca     38880
     tccaatggtc gaagatgatc cgtttttctt cttctgcaga ggtttctggc gaagaaaagc     38940
     ctgatcaact cgcgattttt tagacttcag gtagcccaaa aaaccatgtt aaacaggatt     39000
     ttttgggcta cctgaagtct atcagggttt ttgagaactg aaccccagtg cggttcaaca     39060
     ctcaaaaaca attccatgaa gtctatcagg gtttttgaga actgaacccc agtacgctgc     39120
     ctgagccttg agcgagtgct ggaagtctat cagggttttt gagaactgaa ccccagttgc     39180
     gggctttggt ggtgtcggcg tccacgaagt ctatcagggt ttttgagaac tgaaccccag     39240
     tgcgcgagcg gcttccacgt accatagaag aagtctatca gggtttttga gaactgaacc     39300
     ccagtatcgt ctaacagttg ctaaattttt tgcgaagtct atcagggttt ttgagaactg     39360
     aaccccagtt cggcgcgagc ctcgctaggt gctgctggaa gtctatcagg gtttttgaga     39420
     actgaacccc agcccgcgcc agcggagatg agccgtagga gaagtttatc agggtttttg     39480
     agaacgagcg tgtctgatgg tttgtgtgtg ggattccatt ccgcataagg agataagtca     39540
     gaatggctac tgtggcaaga cgagacccag ccgataaggc caagattggc acgacctgag     39600
     gaaaagctgc ttgctaacct tggctatcaa tccggtgatc gggaagctaa agctgctgct     39660
     gggatcgaca attatcgcaa cggtacccgg gatagagctg ggacgtatat tcccaccatg     39720
     gtcccgaaag gttcgaggcg tttaacggat gtcgatggct tgatcgtgag tttgtatgcc     39780
     ggtgggattg ttagcggaca tgagaaactg accagtggcg gacacgacgg gggtggacat     39840
     ctcttgtgat accatctctg cagtaacaga tgcagtactt gatgaagtaa tggtgtggca     39900
     aaaccgccag ttagacgagt tctaccccgt gatcttcctc gacgcgctgc gtatcaaagt     39960
     ccgtgatggt ggccacgtag tcaacaagag cgcctatatg gacatcgaag gaatcaaaaa     40020
     cattgtgggc ttgtagattg ccaaggaaaa ggcgcgtcct tttgggcgca gatatgctcc     40080
     aacctgtcca accctggggt caaagacgtc ttcattgtct gctgtgacga gcttcaaggg     40140
     ccttcctgaa gcaggagagg caacttggct aggttcgatg gtgcaaacct gtgtggtgca     40200
     ccttattcgt gctgctaacc ggtgggtagc ttacggggat cgcaagcccg tgtcggcagc     40260
     gttgaagaag gtttataccg tctttgatga ggccggtgcg gcggcggcac tggcagaatt     40320
     cgcttcctct gagcttggcg agaaataccc taggtatgtc aaggtctggt gcaacgcgtg     40380
     ggaatggctc attccatttt gcagtttccg ccggctgcta ggaaagtcat ctatacgacg     40440
     aactctatcg agtcgtttaa caatgagctg cgtaaagata tctgcaaccg cgtccaattt     40500
     actaacgatg agtcggcgtt gaatacattg tggttgctga tctgcaatat cgaagataaa     40560
     cgcttagcta agcgagccaa ggaaggccgg cgagttgccg cctcagctgg ccgccttgtc     40620
     gaaggtggga aagtctccgg atggaaacaa gccatcaacc aaatggctgt cgcctacccg     40680
     gaccgcttcg acgaatacct ctaagaaatc atccccacac acaaacaact tgacatgctc     40740
     tctcggaatc gttgtaaata caaacttgct aagtagcaat ggtgacatct cggtatttga     40800
     gtatggttgt tcataatgtt cctacaaaat aaatggcacg gagtcgaaaa ataagcgcat     40860
     agcaggggtc tgcgctagag tagctgaaac atacgaaatc tccgctgata ctgtcaggat     40920
     catttacgta atcgttggaa tctgtggact gtctatgatt gctgtctact taatacagat     40980
     ggttcatcta cccaaagtaa taaacaacag ctaaagatgc gtcatactat tttcccaact     41040
     tagcgtttgc ctgacttggc tcaatttagt cagacggttg gggcaacttt tcggcgagtt     41100
     cacggatgtc agcgggcagg tcggtctgtg catggagggt ctggcctgcg atttcgacgg     41160
     taaacgtccg gtatttcttc aaggttcgca ccaatcgctt caacgatagg cccgaggctt     41220
     cttccaacac gtggcctgtg gccatcgcgg ccatcacaat ggtcaggtgc gcatggatgg     41280
     agtcttcttt acggtgataa atcggtcggg ctttcaggtc tgatttcgcc atccggaacg     41340
     atttctcgat cttgaacagg cgccggtagg caccaatgac ctcttggggt tttaagtctg     41400
     tgcgtgaggt ctcgtatcct ttaatccccg ccagggtcag gtgcttgttg gctagggcgt     41460
     ggttgacctg cttattcggg gccttgagat tgacgtatcg attccgcttg acgggtatct     41520
     ttccgtcaac agcacgctgg gctttatcta attgttcgcc gatgccgcgc cttgtgcgac     41580
     gagccctatc gtaggaatat tggtaatagg tcactgcctg cggtgtcccg ctggtgcggc     41640
     gtctgtcgct gtggtgacgg tgggtccaga tgtgtccgtc gtcgtagtcg gtgtagctgc     41700
     gcccttccac cgtatccagc caggctttaa ttggttctgg gatttcgcgt tctttcgtgc     41760
     ccagaatgta gtccaacccg gcatcgataa tcgcggtctt gttggcggct gaaaacatgc     41820
     cagcatcagc gacaatcgtg atgtcgtcaa ggtggtaggc gtctttaaga cgcaggatca     41880
     ttggcaacat ggtttgcgtt tcagcacgat tgccttcaaa tgcaccgatc gccaagggga     41940
     agccgatgga gtcggtgagc atcccgacag tgatctgggg ttcgagtcgg cgttctttac     42000
     taaacccggg tttgcgtagc tcgtcgggca cgtcagtttc aaaatataag gtcgtcacat     42060
     cgtagagaac catcacacca ggaccaatgg ccgcgtgtgt ggctagggcg tgggttatct     42120
     ggtcgcggaa gtctttgtcg gcataccgcg gaaggtagcg ctttatcgtc gcgtatgaag     42180
     ccgaggtcac gccgacttct gccagagttt caatagaatc aaatttggaa cccagcgaga     42240
     taatacgggc ttgaaccagg ttgaaaaaca cctcatcctc gccgcttgcc gcatccagac     42300
     caaggagttg gaaggccccg cgaatcgcgt ccaggagaag acctgcgcgt tcaccggata     42360
     ccgtgacggg attatcaacc gtgcctgttc cagacacagc aaccgcagaa ggcagcattt     42420
     ttgaggtcga gtgagatttg ctcgccatcg ataagccgct gagccttggc catcagcgct     42480
     gcgagatcgt agtcggtgtg ggcggagccg acgtgttcga tgtcgggttt gcggttgcgg     42540
     tagcgccaga ttatttgaac agcggtcgca cccgacgccg tcgggacccg gcggatactc     42600
     ggtgacatat tcaacagact accggcaccc ccaccgctac ccgcttagtc agacaaaacc     42660
     caccccctga tacccaaacc cacaggcaga aacgtcaata tgaactacac cacaccaaaa     42720
     tgagccaagt cgggtatgac aatgctttgg ctgagaatgt caatggtccc tcacaagaac     42780
     gaactgattt atacctacac ttgggtcgat gtcgttgacg tagaaatcgc ggcgttcgag     42840
     tgggtgaatt ggtggaacga atcaaggctc caccagagtc tgggctatcg cacgccggct     42900
     gaagtcgaag ccgagttttg ggaacatcac cccagtcgag aaataataga aatcaaggca     42960
     aatgcctagg aacaaaacct ggggcacttc aaagcaataa acagcagcta aagatgcgtc     43020
     atactatttt cccaacttag cgtttgcgct tactacgctg atcgtcacca aacaacccac     43080
     gctcaacaca gtgttgacgc atggggttca ccatgtccgc caaggcgaaa acattcgcaa     43140
     agaacggact tttactcgca gtccccgtgc ttgaggtcaa tggggattat gcatagggct     43200
     tgtttgttcc actgtgatgt tatggacaac ctacgtgcgg aaggcaagag gtgtgtttac     43260
     gtagtgcaca agaaaaacga ctgacgatgc ctctaactag caagcgccta acgccatccc     43320
     atggtcatga gcaggccgat gatgaagagt ccgaagccga tgccatagtt ccatggtccg     43380
     agttcggtca tgaaggagat gtcttggcct gctaggtagt taacgatcag ccagagtagt     43440
     ccggcgagga tgaggccgaa catgatgatt ttgtaccaca gcggggtgcc cgtggagttg     43500
     attttcactg gggtgcggtt tgcggtggaa ccagcggtgt aagcggtgga gctgtggttg     43560
     atctttgact ttggcatcgt ggggtgtcct tgttggtttg taagtttcta agagtctatc     43620
     aatctatcag gttagcgcca gccgccgcac gagcagcact ggtgccactg gcagcaccag     43680
     cagcggttaa ctgctagtgc tgtgctggtg gcacgagtgc cgcaaggttg aattcgtaga     43740
     ggcgaatttc aatgggtgcg tctttgcgca gtgctgtgcc tggggttggt agttgtgagg     43800
     cgatcaggtt ttggtcggtc acagctacgg tgggcacttt cgctgcttgg atgagtcggg     43860
     aggcgttgcc tttccagcca gcgtcgtgca ggatgcgcac tgcgtcgtca atcgtttggc     43920
     gggtgatctc tgggacggtg aacattgccc cgttggagat ctgcacggtg acgctagaac     43980
     ccttgggtac ttcggcgcct tcgtctggta cggcgaccac ggttccggct ggttcgacgg     44040
     aatcaacgcg gacgacttcg ggtttgaaac ctagggaggt caggttgcct tcggcttggt     44100
     cccatttcat gccggtgatc acgggaacgc ggactgtttc tacaccggtg gagacagtaa     44160
     tggatacctt ggacccacgg gatacttggg atccggctgc gggggagact tcgatgattt     44220
     cgcccttggg cacggtgtcg gaggagtctt cacgcacggt ggggtcgaga agcagacctg     44280
     cggcttcgag gatcttaacc gcgtcggcgg tgttcttacc gctgaggtcg ggaacctcag     44340
     tgatctcttt accggaggag atggtaaggc gcacggtgga gttgcgttgc acgttggaac     44400
     catcggtggg gttggtgcga ataaccttgc cgcgaggaat atcagggttg ggttcttcga     44460
     tcacattgac ctgtaaccct agcttttcca gctggttgac agcatcttgc tgcgtggagt     44520
     tttgcagctt agggatggtc acggtggatc gctgagaaaa cggtccgcca ccaaaatagt     44580
     caatggcaaa tccggcaccc acagccaaaa cgagtactgc caaaatagcg gcgagaatcc     44640
     gcaggccacg gttggatgat cgtggtgcag catgcgcacc accggaaccg gccaccgcag     44700
     ccgaaccagc tacggcaccg gcaggaacca caccagcacc aatgccagca ccagcctcgg     44760
     catggtccaa ctcagtcacc tgggttactg gaaccacagt ggtagacgct gggtcttggg     44820
     tagcaaagct ggtcggggtg acatagtggc gtgccgcgtc agtgaccgca ttgcgcccaa     44880
     ggcgttcaag atccgcgcac atttcttgtg cggtctggta gcgatcccca ggatgcttag     44940
     ccatggcagt aagcacaaca gcatcgacgt taatcgccgc ggtaggcgag aggtcagcga     45000
     tgtattcgct gggctttaca gggtcttctt gtacgtgttg gtacgcaaca gcgaaggggg     45060
     tttcaccctc gaaaggtggt ttaccagtga gggtttcata aagcacacag cctagggcgt     45120
     agacatcgga gcgggcgtcg gcaagcttcc cgcgtgcctg ctctggtgag agatactggg     45180
     cggtgccgat cactgcggag gtctgcgtca tggcgctggt ggcgtcgtca agcgcgcgtg     45240
     cgataccaaa gtccatgatt ttgaccgcgc cggtgttggt gatcatcacg ttagcgggtt     45300
     tgatgtcgcg gtggataatg ccagcatcgt ggctgacctg cagcgcatgg cacacaggga     45360
     tcaaagtatg tgccgcctgg ctaggtgtta gcggaccatc ctcacgaaca atgtcacgca     45420
     gggtacggcc gttgaccagc tccatcacaa tataaggagt gtttaaacca gcccgtggag     45480
     tttcaccggt gtcgtacacc gcgacgatcg cagggtggtt gagcttgccg gagttttggg     45540
     cctccctgcg gaagcgctcg cggaagttca catcccgtgc caagtcggca cgcagcattt     45600
     ttaccgcaac cttgcggccg agaagaacat cggtggcctc atacacctca gacatgccac     45660
     cagtaccgat gacgtcgcca aggcgatagc ggtcggcgag aacgatatcg gtcactgggc     45720
     acctccttgg ttgagcttgt tcagattctc gatcaaagaa ccgagagtat cgggagcagg     45780
     tgattcggca ggctgatcag catcctgcgt aggcgcatgt ggcgcttgcg agctggggcg     45840
     accattatgc gacgggcgca ccgaaggcaa ctggtgatcc gacgatgggt gcgaatcgtc     45900
     aggagtatgc tccgtttcac tcggagttgg ctctgggctc gacgtaggca acggctccgg     45960
     gatcacagta gtgatctgcg gtgtgggagt ctccgtcacg gtagccgtca caggtggcgg     46020
     cggaaccgag gactccgagc tttgcgacgt cttatcaaaa aggtcatcaa acatgccctg     46080
     acttgcagcc cacgcagcag tacccaacaa caatgcggcc aacgcgccga ccacaatgcc     46140
     ggcaccccaa ccgctagatt gcttctccgg ctcctggcgt ggcgtgccag caggaatcac     46200
     cgtcgatgcc ggatacgcag cagcagcggg agcagcaggc acctggccgg tagccggaat     46260
     aaccgtcgtc ggttgcgcag tagcccccaa cgcataggtg gattccgtgg gagccggctg     46320
     cggcgcaata tgctgcaatg gtgccgactt cggctgtggc gggcgctgcc ccatacgggt     46380
     agcagaaacc gccaatgcca gctcgttgcc atcggcataa cggtgtgccg gatccttgcg     46440
     cagcgcaatg ccgatcagct cgcgcgccgg ggcggacaca ctagtgggca tagccggtgg     46500
     ggcttggttg atgtgggcga tagccacaga aaccgaggag tcgccggtga aggggcgctg     46560
     acccaccagc atctcgtatc ccacaacgcc tagggagtag acgtcggtag ctgcggtaac     46620
     atcgcggccc tgcgcttgct ctggggagac atactgggcg gtgcccacca ccatgcccgt     46680
     tcgcgtcagt ggtactgctg cggctgcttt ggcgataccg aagtcggtaa tttttacctg     46740
     gccgttttga gtgatcaaaa ggttgccagg tttgatgtcg cggtggacca tacccatgcg     46800
     atggatgatg gatagcccgt gggctgcctg ctcgagaacg tcgagagcaa ggtcttcttc     46860
     gaggcgacct ttgcgtgcca gcatgtcggc gagggattcg ccgcggacgt attccatcac     46920
     gatgaagcac agggtgcggc ccatgtcgtc ggtgacttcg cggtagtcgt aagtgcgcac     46980
     cacgttgtcg gagtcgatgt gctcgctggc gagtgcctcg ttgcggaagc gtgagaggaa     47040
     ttcttcgttg tcggagaatt ctgggcgcaa caccttgatg gccacttcgc gctggttgcg     47100
     gaggtcgtcg gcaagccaaa ccgtggacat tccaccgttg cccaccaccc attgcagggc     47160
     gtagtcggaa ccgacgagtg cctgcagtgc cggatcaggt gactgtgatt gtgtcatgat     47220
     gtctcccctc tatcctcgtg ctgctagggc tgcttgtgct gctgcgatga cggcgcggcc     47280
     aatgggtgcg gccacggaac caccggtggc ggcttgaccg gcatcgccac cgtttttcac     47340
     caccacggcc acggcaacgt cggcattggc ggaaggaccg aacgcgatgt accaggcgtg     47400
     cgggttggaa ttacgggaat cctcaccgtg ctcggcggta ccagtcttgg aggcaatgtc     47460
     ggcaccggta taaccagccg tgtggcgttc cgatagtcgc attaggtccg tcaacgtggc     47520
     ggctacctcg ggggtaacag cctcgttgat ctggtgcggc ttagtctcct taatcacctt     47580
     gaggtcttgg ccgacgatcc ggttcacaag gtgcggctcc atgcgcttgc caccattggc     47640
     cacggtggcg gccacgacgg cgttgtggag cacagacatg gcaacgtcgc gctggccgat     47700
     cgacgactgc ccgcgtgccg acggatccga cacgtcaccg atggtgccag gggccatgtc     47760
     gacgccaaga tcgtagcgat cattcacgcc gaaagcatgg gcggcctcgt cgaacttttc     47820
     tttgccaaca tcaataccca tctgcacgaa tgcggtattg cacgagtact ggaatgcggt     47880
     agccaaggtg acgttttggg aaccggcaca ggtttgccct gcatagtttt ccaaggtggt     47940
     gatgccgtcg ggaagcgtaa tgcgatcttg ccccgtgagc atcgagcccg ggccgtaacc     48000
     agcgttaagg ccagcagccg tggtaatcac cttgaaggta gaacctggtg gcagcgtctc     48060
     ttgggtggcg tggttgagca gcgggttgcc ggggtcggcg ttcaacgcag cccatgtttg     48120
     ctcagcggta tcggggttga cgatcgccga ggggtcgtag ctaggggttg atgccatagc     48180
     aaggatttcg cctgtcgacg gcttgatcgc cacaactgcg ccctcatagc cagcattggc     48240
     catctggttg tatgccacct cttgcacctg tggcagcaag gtgagctcaa cgttggctcc     48300
     gctgtgtttg cggcccaaaa gctcatctgt ccagcggcgc actgacacgg aagaatccgt     48360
     gccactgagt acaccgttga ggttggactc catgcccgaa gccccataaa tatcagaaag     48420
     gtagccttcg atcggaccat agatcgcagg gttggtcacg taacgacgct ggtagaaccc     48480
     ctcctcatcc tggtaggact cggctagtac ctgcccgcca gtggagatct ggccgcgggc     48540
     ctgcgacttc aactcaataa agccgcgtcg attaagcgca ttatgcgcgt atttttcctg     48600
     actaaaaccc tgaatgatcg tcaagttgac caacaaaatc aggatcagca gcagcgcgaa     48660
     cacgctggtg aatcggatag atcggttcat cggtgggcct cctgacctcg tgccgcctgc     48720
     tcgtccatag acaccacgtc gttggcggcg gcttgtgtgg agtgggagat cctaaggatc     48780
     agtccgagaa gaatgtagtt agccatcaaa ctagacccgc cttgagacat aaacggcgtg     48840
     gtcagacccg tcatcggcat gagggcggta attccagcgg tgaccacaaa gacctggatg     48900
     gccaaggtca gcgagaggcc agcagccatg agcttgccgt aggaatcacg tgcccgcagc     48960
     gcagtgcgca gaccgcgggt gataaagatg gcaaagagaa ccagcacggc agcaagtcca     49020
     ataaagccga gttcctcgcc cacggcggcg aggatgaagt cggactcagc aactgggatc     49080
     agctctgggt ggcctaaacc aagcccagcg ccggccacgc caccagaaga cagcccgaag     49140
     agtgactgcg agagctggta acccgtgccg ttgaagttat ccagtgggtt aataaagttg     49200
     gttacgcgcg actggatttt gctggagatc tggtacagcg cggtaccacc aacggccaca     49260
     agtgctgcac caatgatcag ccacgatacg cggttggtgg ctaggtacag catgccgagc     49320
     acggtgctaa acagcagcag tgcggggccg aagtcgttct cgccggccat gaccaaaatg     49380
     gcgaaggccc acacgccgag gatggggcct aggtcgcgga ggcgcgggaa ctcgagcccg     49440
     aggaatcggt agccggccac gttaaatagg gcgcgtttgt tgaccaaaag ctgcgcgaag     49500
     aaaatcagca gcaagatctt ggaaaactca cctggctgca cggagaacgg tccgatggag     49560
     atccaaatgt tggcgtcggc attcatcttt gtgggccaca ccatgggcag tgcgagcaag     49620
     atcagaccaa gcaagcccag cacataggag tagcgcgaca acatccggtg gtcgcgaata     49680
     aacaccaaga cggcgatcat gaggaggata cccacaaggg tccagatcac ctggcgacta     49740
     gcaagggcgg tgtcacgtgc gaggtcgatg cggtacacca tgaccagccc tagcccgttg     49800
     agcacgctgg ctaccggcag catgacttgg tcggcatgcg gggcggtaaa acatagcgcg     49860
     aggtgggcga tggtgaacac gccgatgaag ccgccaatca cccagagtgt ttcggaggtg     49920
     accgaaagcc cttgggccat gttgaggtta attagggtga ctgcgatgag cagggttgcc     49980
     atcacgagta gcccgaattc cacggggcgt gcggtaatgc gtcgtaggga ggtcatttat     50040
     ttgacctccc tgcaggtttc gccaggtgtg gagagatcat cgggggagcc ggtactgctt     50100
     ggcgacgccg cctttgtagt cgtaggggct gcactcgacg gtgccgctgg cttcttttta     50160
     tccttatcct ttggatgcgc agcctgacga gtaatacatg ctggcagggt ttgttctgcc     50220
     aagcgctgca gctgctgctg cacttcgtcg tagctgccgt cgggaagcgt ggacacctgt     50280
     ccgcgtgccg actccttcag atcgctcaac cggaaccgat ggcaagattt ttctgcgtcg     50340
     gcagaatcca caaacgtgag atccccctcg gggctcaaac aagcgaactg gtacgtgctg     50400
     tgcaaggatt tgcccagcaa agagacgtcg ataccgtttt cgatgaccaa cgcgccctgc     50460
     gcagaatccg aatccgcggt ggtgacatag tagttgttct tcaccatcga agaaccccac     50520
     caaccagcac tgatcagcac agccaatacc accagcgcac taatcacggc caccatgcgg     50580
     cgtcgtgggc tcggcgtagc ctccttgaca ggctccggat ccggaaggat cacctggggc     50640
     tgacgctgtg caatcgccat cgcagcccgt cccgccgccg tatctgggcg gggatcctcc     50700
     ggcatacccg aattaagagc acccaccgtc agcggtgtga ccggcaacga tgcggcagca     50760
     gcggacttat ccgagccatc tgcctctaca acatctgcca ccacaaccgt gacgttatcg     50820
     gggccacccg aacgaagcgc caaatcaacc aaccggcgag cagcctcttg gggcgtgccc     50880
     tgctgcagag tcgtctcaat cgtcgaatgc gtgaccggat cagacaatcc atccgagcac     50940
     aacaagaaac gatcgccagg gcgaatatca atcatcttca acgtgggctc aactgggcga     51000
     ccagtataag ccttcaaaat cattgagcgc tgcgggtgcg tggacacatc ctcaggggcc     51060
     agctgcccct tatccacgag ggactgcaca taggtgtcat ccaccgtgat ctgttccaac     51120
     gcgccatcgc ggagacgata accacgggaa tcacccacat ggcacatcgc caaatcggca     51180
     ccgttaaaca tcagcgccgt tagcgtggtg cccatgccgt cggtttccgg aacatcgcgg     51240
     acaccttgag cgatggcacg gttggcgtcg tcagctaccg atgccaacaa cgccagcatg     51300
     tcgttgtcgt cgacgtcggc gtcgagacgc atcaaatgat taatcatcaa ctgcgaagca     51360
     acctcgccag ccgcatgacc acccatgccg tcggcaagcg caatgaggtg aggacccgca     51420
     tacgccgagt cctcattatt gcctcgcacc agcccccgat cggaagccgc tgcataattc     51480
     aacctcagca tcaagcaacc aacctcaccg ttgtacgacc aatcttaatg tcactaccag     51540
     cagaaacctt ctccggctga tcaatgcgat aaccgcccac atacgtgcca ttgcgggaat     51600
     ccaaatcctc cgcaaaccac tcgctaccac gcttaatcaa acgagcgtga cgagccgacg     51660
     cataatcatc gcccaccaca aaatcgcaat ccttcgaacg gcccaacgta atctccgtca     51720
     aagaatccaa ctgcatagac gaacccgtca acgggccctc aaccacaaca atctgctgag     51780
     gtgcgccacc acgacgagac accttcttca acggactcga cgccgacgac accccaagtc     51840
     ccgtcacagc ctgcggtgcg accatcgttt gagcagccga cttagcatcc ttgcgctgaa     51900
     tataaagagc aagaagaatc aagagccaca acaaaaccaa caaggcaatg cgcagcaaaa     51960
     aaacaatgac ggattccacg aggtggggct ccttaattcg gctctacgat acgaacttca     52020
     atatgagaat gaccaacagt aatcacgtcg ccatcctcca acaaccagtt ctccacagga     52080
     gtgtcattca ccgtcgtgcc attcgttgac ttcaaatcag tcaaaatggc atcgcggcca     52140
     ttccacgtaa tctccgcatg ctgacgcgac acacccgtat ccggcagccg gaaatgggcc     52200
     tcattagaac gcccgataat attcgagccc tcttccacca gatacgtccg cgacgaacca     52260
     tcctgcaaca acaagctcac cgtcggagtt gccttcggct ccggaaccgg aacctccgta     52320
     taaatagcat ccggcgcctg cgccgtcatg tactccgtcc gagggtcagc atcataagaa     52380
     ttcatgccgg actcgctttc atagttgctt tcatcattgg taggcgctgc agccgccaca     52440
     tcatcttcaa ccccaataaa gtggctgtac tcctgcggga caggatcaaa agctgacgac     52500
     gcatgcagct ggccagtgcg aagacccgaa tccgcggcga tcgtgaccac caccggaccc     52560
     tcagtagacc agccctgatt acgcgtataa cgcgacaaac gatccgcaaa atcatcagcc     52620
     aacgacggat accgctgggc caaattctgc gcatcctttc ggctcacacg cacacggaat     52680
     acattcggag actccacacc gccctcataa gcgcgcacga tattatcctg cacctcttgc     52740
     ttaagcagtt cctcaatctc cgccggaacg agcttgccac cgaaaacgaa agcgaaacta     52800
     ttatccaagc cacgctgcat agcactatcg agcttggcta ctttgcccat gatcgacaaa     52860
     gaacttcgcc tccttaaatt tctcggttaa acatagtgac aacacgatgg cactaagtat     52920
     aggtgtccaa cggccatgtc cctagctgtg cgcattgacc caccggtatg aagtagggtg     52980
     ctggcccatg tagaaacagt gtttgacgtt gacatttgca cggaaaactt aatgctgtga     53040
     tatagtagcg cagtcgcaaa aaaaattgct tcaccacctg cccaggtggc ggaattggca     53100
     gacgcgctgg cttcaggtgc cagtgttcgc aaggacgtgg gggttcaagt ccccccctgg     53160
     gcacaaagag cagttgtaca aactgtgaca ccggaggtaa caaactcgaa agggttcgtg     53220
     accttcggtt tctttgtttt tctgaacttt ggcggtcaag gattgtaagt gtggggattt     53280
     acatccgaac tcccgctctt ggctttcgta cttttgtttt cgatggtgtc aacaagtcat     53340
     cttgcttgtt gtcttgatct gagggccttg gccaggaaac gcttcgctgc ggccacgttc     53400
     tgcttcgaag agaggtaaaa gtccagggtc tggccaccgg cggtgatcgc ccgatagagg     53460
     tagcaccacc tgccgccgac ccggatatag gtctcatcca cccgccagga actagcctgc     53520
     cagtcaggta cctgccgttt gcttgtccag ctcaggggcg tatttctgga cccagcggta     53580
     gatcgtggtg tgatcgaccg gcacgccccg ctcggtcatc atttcctcca gagcgcggta     53640
     gctcaccccg tagcggcagt accacctact gcccacagaa taatgtcagg ggggaaatga     53700
     cgaccggaaa agatacccat gactgtgact atttcacgtc actcttccta ctgccccaac     53760
     tttgcaacag cacctttcag ggtcatatgg ggcagtggag agaagtggtg gatcagtgga     53820
     cggcggtgga tgccggagta ggcgtggtgt gttcctcttt cgactcggtc ggagccaggt     53880
     gagccggatc cagatcaatg cggcgtaaca gctgggcgtt cagggccacc acgatggtcg     53940
     aggcagacat taagatcgcg cccacggccg gggacagcac gaacccgatc gaggcgagca     54000
     ctccggcggc caacggcacg gcgaggatgt tgtagccaga ggcccagatc aggttctgga     54060
     tcatcttgcg gtagctggcc tgggacagct caatcatcga cagcactgcc cgcgggtcat     54120
     cactggctag gaccaccccg gcagattcca tggccacatc cgtgccggca ccgatggcga     54180
     taccgacgtc cgcgcgggtc agagcggggg cgtcattgac accgtcaccg accatggcca     54240
     cgctcaaacc ccggtcctgc agctgcgtga ccttggtgtc tttgtcctgg ggcaggacct     54300
     cggcgaagac ctcatcaatg cctaggtcct gaccaaccgc ctgggccacc tgctgcgcgt     54360
     cgccggtgat catcgcgacc ttcaccccgc ggtcctgcag ggctttcacg gcggcgcggg     54420
     attcggggcg gatcttgtcc tcgacggcca ccgcaccgat gatctgaccg tcgcggacaa     54480
     tatggagcac accggcccca cgcccggtcc aggcgctggt ggtgtcggtg agctcggccg     54540
     gggtggtgag gttgaactcg cgcagcatgt tcggcccgcc cacgaggatc tcagcgccat     54600
     cgacagtggc ccgaaccccc cggccggagg cggcgctgaa accagttgca cggatttgcc     54660
     gacgggaggc ctcgggatgg gcggccgcgg ccgccacgat ggcgcgggcc acggggtgct     54720
     cgctgtcggc ctccgcggcg gcggctaggg ccagcagctc gccctcggtg acgccgacag     54780
     ctgccgcgac accggtgacc gcgtgcgcac cctcggtcag ggtgccggtt ttgtcgaaga     54840
     gcaccacgtc gatggtgcgc atccgctcga gcgccatccg gtccttgatg agcaccccgg     54900
     atttcgcagc ccgctcgctg gagatcgcaa tgaccagcgg aatcgccagg cccagggcgt     54960
     gcgggcaggc gatgaccagc accgtgactg tgcgcaccac ggcatcgtcc gggctgccga     55020
     tgatggtcca caccaccgcg gtgatcagag cggagatcag cgcgaaccag aacaacaacg     55080
     ccgccgcccg atccgccagg gcctgggccc gggaggagga ctcctgggcg tcggcaacca     55140
     tgcgttggat cccggccagg gcggtgtccc cgccggtagc ctccacccgg atgcggacgg     55200
     tgttgtcggt ggccacggta ccggcgacca ccttgtcacc ggtgtcgcgg aagacgggac     55260
     gggattcgcc ggtgatcatc gcctcatcga attcggcggc tccgtcgagg atggttccgt     55320
     cggccggcac ccgggcaccg gccctcacca gcacgacgtc gtcgacgatc agctcggaga     55380
     tggccacggt gcgggtggtc ccgtcgatga ctttctcggc ctcatccggc agcagggcag     55440
     ccagcgcatc aagcgcggag gacgcggccc cgagagcgga catctccagc cagtggccca     55500
     gcagcatgat ggtcaccagc agggccagct cccaccagaa gtccagctca aaaccgccca     55560
     gccccagagt ggtgacccag gaggcgacaa acgccacggt gatggccatg gcgatcagga     55620
     gcatcatccc gggttggcgg gatttcagtt cattccatcc gcccttaagg aaaggcgttc     55680
     cgccgtagac gaagatgatc gtgcccagca ccggggggat ccaggtggat ccggggaatg     55740
     ctgggaggtg gtagccgagc aggtgggcga ccatggggct gaaaataacg acgggaatgg     55800
     acagaatcag cgaccaccaa aagcgctccc gaaacattgc ggtgctgtgt ccggcgtgtt     55860
     cgccgtgacc atgaacgtgg tggtcttcgt ccagggcgga gtgcgggtga tcgtggggct     55920
     tcgcatggcc gtgggtgtcg gcatctgcgt ggtgttcgtg gctggcatga tccgggtggt     55980
     aggtgtggtc tgtttccggg gcggggtgat caccatggtg atcaccggaa tggttgggag     56040
     tgttcatgac gttcctttcg ctcaacccgg taggggtcgt gattatgggt aaaactgatc     56100
     aggataagac ggtgtagccg gcctcctcga tggcccggcg aaccatctcc ggaggtacga     56160
     caccggtgac cgtgacggtg gaaacaccac cagcagcgag atcgatctgg acgtcgtcga     56220
     cctgggggag ggcttgaagg gcctgggtca cgcttttggc gcagtgcccg caggtcagac     56280
     cggtgacctg gtagctaggg gaggaccctc ctgctgatga gtcgctggcg gcagggatgg     56340
     aggcggtgtc ggcatgtgaa gcaggtccgc aacagctgca gccgtgggag gccatcggca     56400
     agaggcggga cggggaagtg atcatgggaa agctccttcg ggtcggtggg gatgtgacga     56460
     tgctacgctc taacacatac cccctggggt atattttcga ggggtggagg gcatggccct     56520
     cacgcggggc agggtgtggt caccgagcag cctcctcact gtcgggaggg gacagcggga     56580
     ggcggagggt aaacaccgct ccgcgaccgg gtccggggga ggtggcggtg agagtgccgc     56640
     cgtgggcctc gatcaatgcc ttggagatgg tcagaccgat accggacccg ccgttgtccc     56700
     ggctgcgggc ggcatctccc cggtagaagc gttcgaagat gtgtccgagc tggccaggtg     56760
     ggatgccctc gccgtcatcg gcgacgtgga tgagcgcggt ggacgccccc tgtcggtgga     56820
     cgctgatccg gacctgcccg ccgaccgggg tgtgccgtag cgcgttcgac aggagattgc     56880
     tcatcacctg gccgaagcgt tgccggtcca cgaccacccg ggcggtgtcc gtaatggtct     56940
     caacctgtaa atcgacgcct ttgtcagcat aagcttcccc cgcggcagca gcggcggtat     57000
     ggagcagatc cccgagccct tcctctgcca ggtccaaatc gatccggtgt tcctgggccc     57060
     gggagacata gtcaatgtct tccatcaacc gggtcaggcg ggtgagttgg tcagccatga     57120
     tcgtgtggtt ggcattattc cagtccacga ccccgtcctg gagaccatcg aggtaggccg     57180
     tgagcaccga taggggggtg cccatttcgt gggccagatc agagagcatc tggcggcgga     57240
     cctgttcggt gtgttccagc cggtcggcca tggtgttgaa ggcatgtgcc agggtggcga     57300
     cctcggggcc tgctcctccg gcgggcacgc ggatacggga gttaccggcc gccaggctgg     57360
     tagcggcgcg ggtgagatcc tgcagggggg tgcgcagacg acgcgataac cacaggctgg     57420
     ccagtagggc gctgatcaag gcagtgggca gggcgacagc cagggtgatc aggttggcgt     57480
     cccggtaggc ctgctcggca tggaacagcc ccagcgaggg gtcctcccgg ccggccatca     57540
     acatatgatc atggaacagg gtcgggccca ccatcgtggc cacggccgcg gccaccatca     57600
     ggctaattac cacgaccaac acctgggcag ccaggaagcg gaaggtcagg ccgggtccgg     57660
     gattcatggc tgccccatcc ggtagcccac gccacgcacg gtgtcgataa acccccggcc     57720
     ccgggtgtcg gtgccgagct tgcgacgcaa gttgcctatg tggacatcga cgatgcgctc     57780
     atcaccgacc caggtggtgt cccagacctc agtgaccagg tcgtggcggg tcagcgcctg     57840
     gccggggcgc agggccaggg caaccagcag ctcgaactcc gtgcgagtga gctccacgat     57900
     cgtctcctcc acccgcacct gatgggcgac ggggtcaagg atgaggtcac caacgatcaa     57960
     gggggtggtc acctgcggtg gggtggtgct ggtgcgcggg cggcgcagca ccgcatgcac     58020
     ccgggtcacc agttcccgga tgctaaaagg tttggtgatg tagtcatccg cccccagggt     58080
     caaaccgctg atcttgtcgt cctcgctgcc acgcgcggtg agcatgagga tgtagcagtc     58140
     cgagaaggtg cggatccgtc ggcacacctc caggccgtcg agttcgggca gccccagatc     58200
     cagcaccaca acatcggggg aaaagcgacg ggcctcgtcc acggcctggg tgccggtgtg     58260
     cgcctgacgg gtatcgaagc ctgcccggat gaggtaggag gccaccatct gagccagggg     58320
     ttgttcatca tcgacgacca gcacccgccc cgggggcgtg gcggtggtcg gtgtgtggtc     58380
     agccatagac cccagtatcg ctccggccag ggaggaatac caccctcacg cagcgcccgg     58440
     cggggaatct tcatcaaatc ttcaaacatc acccttcgac cgccatcacc cttgtgcccc     58500
     accccgggcc ggcggcatcg cctcccctag tcggttcagc aggcgccacc agggatttca     58560
     ctgcctgtac cgcatacccg gggcgggtag aaggacatcg cccacggctg tggagtggtg     58620
     tcccggtggt gacccagccc accgaactca cccctttttc gccctgttat aaggctgtga     58680
     gcagggtttt tgatttctac tccgtcaggc acccgtgcaa gatacaggta tggcaccgac     58740
     cttgaggcgg tgtcttctca cagtcttacc acgagctaag gagattgacg tgaaacgagc     58800
     agcgattgca gccgccgccc ttgccctcgc cctcacgggg tgttcggccg ccgacccgga     58860
     acccacggcc gacgggacgg tgtcccagga tacattcctg actacccatg gcctggccga     58920
     catggacgcg gtggagatca ttgatcacct cgaccggcag aaggtcactg agcgtcccac     58980
     ggatctgatc gcctcagtgc gtgccgatga actgctgctc tcgagcggtg accaggaagt     59040
     cgtggtcgat cttcccgaca atcagacgta tgtctcgatc gcaccctatc tcacatccac     59100
     ccacgactgc ttctatcaca gcctcacgac ctgccagggg gaactcagca atgaggatat     59160
     ccaggtcaag atcaccgatg aggcgaccgg tgaggtgctg gtggacgagg cgacaaccac     59220
     cttcgacaac gggtttattg gcttctggct tcccgatgat gtcaccggcc tgattgaggt     59280
     cagctaccag gggcgtaccg gcaccacgga gttttccacc accgacgacg gtgccacctg     59340
     tgtcacagac ctgcgcctga cgtgatggct cagcagggtc ctcacctgcg cctgtctccc     59400
     gtgtcactga attcttacac cagaaaggtt aaatcatgac gaacgcgttt tcccgacgac     59460
     agtttctgct cggcgggctc gtcctcgccg gtaccggggc cgtggccgcc tgcaccagcg     59520
     accctggacc cgctgcctcg gcaccaggtt cctcccttcg ccccactccc acccccactg     59580
     cgctcggtga gccgacggtg cgccggacac tgaccgcccg gcccctctcc ctggatatcg     59640
     gcggcatcga agccaagacg tggggatacg tctctgacac cggggatgcg gccattgagg     59700
     ccaccgccgg cgacgtcctc caggtcgata tcaccaatga actgcctgag agcacctcca     59760
     tccactggca tggcatcgca ctccacaacg cagccgacgg tgtgcccggc atgacccagg     59820
     accccattga acctggcgag tctttctcct atgtttttga agtcccccac ggtggcacct     59880
     acttctacca ttcccacacc ggcctgcagc ttgatcgcgg cctccacgcc ccactgatca     59940
     tccgtgaccc gcaagatgct gaggaccagg acgtcgagtg gaccatcgtg ctcgacgact     60000
     gggtcgatgg tattcagggc actcccgacg atgagctcga taagctcacc ggaatgggtt     60060
     caggcgacca taacgggaag aaggggatgg gaggtcacgg ccatatgatg cacggcaccc     60120
     cggaccgggt actgggcggg gatgccggcg atgtgatgta tccgcactac ctcatcaacg     60180
     gacgtatccc ccgtgctcac cggaccttcg aggctcgccc gggcgataag gcccgcctgc     60240
     ggtttatcaa ctccggcggt gacaccatct tcaaggtggc cctcggtggt caccgcatga     60300
     ccgtcaccca caccgacggc ttccctgtcc agccctggga gaccgaatcg atctacctgt     60360
     cgatgggcga acgtgtcgac gtcgaggtca tcctcggcga cggcatcttc ccgctcacgg     60420
     ctttggcggt gggtaaggac gaccgcgcct tcgccgtcat ccgcaccgcc ggcggccagg     60480
     ccccccaccc cgatgtcgac ttccccgagt tgtcgtccac cggactgctt ctgtcctccc     60540
     tgaagccagc agaccgtgca ctcctgcccg agggcacacc agaccgagaa gtcagcatcg     60600
     acctgggcgg gcagatgatg ccatatgaat ggcgcattct caccgacggc caatcctcct     60660
     ccgcgaccgt gcaggagggc cagcgcctgc ggatggtcat gcgcaacagg accatgatgc     60720
     cccatcccat gcacatccac ggccatacgt gggcgctgcc cggcagcggc gggctacgca     60780
     aggacaccgt ccttctccgc cacggtgaaa ccatgatcgc cgacctgatc gctgacaacc     60840
     ccggtgagtg ggcatttcac tgccataacg cctatcacat ggaaaccggg atgctcagct     60900
     cgcttcgcta cgagtaaccc ccacagcagg gttgagcgcc gaggtgggcg ggggtgtccc     60960
     ccgagtagtg gacacggcgt tggtgtcagg gttgagcagt gcgtgccaag agtcgacggg     61020
     tttgaagtat gcgtcagcgc gcacggcagc aagttcaatg atgtggtcgt agcgcttgtt     61080
     aaagccggtg gttccggtat caatgaccgc aaagaccggc gtgcccgatg tgcgcggggt     61140
     gtagcggttg aggaggtttt ctaaaaggcc catggcctta agcctagagg cccataccga     61200
     catgcccgcc taaacgctat cgaacactgc aaccaacgtg gatttctgtg gataaccaca     61260
     ctggccccgg ttgcgtccgc tggcgtggtg tatctgtagc ccgcggtagg ccttgtgccg     61320
     gtgcacaatg aggcgaccat cgtgggtacc tttcgaatca actcttacct atcctcgaaa     61380
     ggaccaaccc cacaatggcc gctggccctc attctatcga ccccaccgcc tatctcgacg     61440
     aattgctgtc ccaagcctga ccggacttgg ttgcggcaga tgctcgaggg cttcattaac     61500
     cagattctct cggcccaggc tgacaccgtc tgtggcgccg agtacggcac caccagcgat     61560
     acccgcgtca acctgcgcaa cgggtaccgt caccggccac tggacacccg agtcggcacc     61620
     atcgatgttg ctatcccgaa actacgccac ggttctttct tccccgactg gcttcttgag     61680
     cgacgcacca gggtcgaacg cgccctgacg accgtgattg ccacctgtta tctcaaaggt     61740
     gtctccaccc ggcgcatgaa cgaccttgtt gctacgctcg gcatcaccaa cttgtcgaaa     61800
     tcacaggtca gtgacatggc caaagaacta gacgcgatgg ttgaagactt caggacccga     61860
     cccctggatt ccgggccgta cttattcgtc tcgtgtgatg cgctgacgat gaaagtccgg     61920
     gaaggtggcc gtgtggtcaa aactagtgtc ctgctagcga ccggtgtcaa tgctgacggc     61980
     taccgagaac ttctcggcat gcacgtagct acagctgaat cgaccgcgtc gtggacgggg     62040
     ttcttccgcg acttgaaagc ccgtggcctg gggatgtcta cttggtgacc agtgatgctc     62100
     acttgggtat tcagggcgca gtcggtgatg tactaccgaa tgcgtcctgg caacgctgtc     62160
     gcacgcactt gtccaagaac ctgtcatcca tggtgcccaa gacccagtgg ccgactctgt     62220
     cggcgatgtt tcacaccatt ttccaacaac ccgatgccga cgcggtgtgg gcacaggccc     62280
     gggaggtggt ggagttttgt caatccaagt tccctcatgt ggccgactac ctggaagaac     62340
     atcttgatga tgtgttggcg tttacccaga caccaaagtc ggtatggacg aaagtctggt     62400
     caaacaaccc gaccgagcgg cttaatcgcg agatccgcag gcgcagggat gtcgtgggga     62460
     tcttccccac ccgtgatgcc gtcgtccgtc tcgtcgcagc gatactgtct gagcagcatg     62520
     acgactggat tcagcagaag cgctacatgt ccttgacaag tctcgaacag accaaggcac     62580
     tgatggctgc caacttcatc gatttcggcg aaaccacacc atcccacaag gaagttgcag     62640
     cctaatgcgc caccctcacc gggaccgagc cggccctcaa cacagctaac agttcatctt     62700
     tgatccggaa gaactcatac accactcaaa cagacttgac ccaacacatg tgctgaagag     62760
     ttttgtgaag tcgatcattt atgctttcct atcacgtggg aaatgaaata atcgccggta     62820
     tctggaacta atactatttg gttccagcta ccggcgactc ctcagcgatg ctgagagctc     62880
     cgtcttggtg gtcctggtta gggttgcagg gagattgctt cgttgaggaa tccgtctgtg     62940
     ccccagtatg cccgatccca ccaggtgatt gattccccga gttcgatggt tacgaagtcg     63000
     ttcggaagga taatgtactc agattgagcg atgacctcga ccccttggtg cctgagccca     63060
     gccaagaatt gtgctttggc attgggtccg tagttgaggc caagacctag gaatgtatca     63120
     gtgatgggga ggtcaagata agccatcgta acggtgacac aacgaccgtt ttcaactcga     63180
     cagatgatct tcctaccttc gtcgccaggc tcgatgtttt caatgtcgat aaacccttcg     63240
     agttcggtga cgaagtcatt gtcgatgatt tcatgttcgt agcattgcga ggcaacttgg     63300
     tctgtggttc ctccaagagt gagaggcaaa gaacaatgtg gggatagttt catcgtgagg     63360
     cactccagtg aattgatgca atcttcccct tctcggtcga gaaacccact ggttggttgg     63420
     ctagttcgat accccacttg tccatttttg cctctattcc tgctgtcaga agggaatggt     63480
     aaaaagtttt ggctctttgg ctgagaggta tccccatgaa ggaatcactt gcaacaatgt     63540
     cgataatctc cgcgctggtg accatgtccc tttttgcccc aaacttgata ttgcgcattg     63600
     attcgccaat gagcagtttc ccggaaaggt gcgagaacag cgggttatcg aaaaatttga     63660
     agtcggtgag gatagcggaa tagtcgttca ctggagcgtt gagaacgatc gatgtaacgg     63720
     gtgacttact gaaatccata ctgtccctta ggagcctaaa tctgatgtgt gagaaccttg     63780
     ttgaaggttc tgaccttctg gcatcgtggt tgattcgatg agttaatttc tgtgtttgtg     63840
     atgccaacaa attgaggcaa ctctgccacc ttcaatgaag aaactaacgg gagcgttggt     63900
     gaggtcgatt ccactgtcgt catatgtgaa gtcaatatcc gcagatttca agctgttttg     63960
     gaaagggatc ttcctctgtt tgagtggaat accgcagaag gtgtcacctc gttccagtgt     64020
     catgatttca atactggatg aggtttcgtt ttcaattgct acgctcacct gtcgaaatga     64080
     attgtcaata gggagatggc cgacgacgcg ggtagaaaag gaacctttga tgaacctggc     64140
     gctccgaagc atcccctcga tttgttctcg gcttagatca aaatccaagg gggcacaggg     64200
     ttgttttagg aagtccatgt ttgtccttct ggtagttgct gcaaattttg aattaggcag     64260
     gagaggaaat gagaccttgc tgtcttgtgt aggccatcat ttcgtctagc gcttgaccat     64320
     atttgcctgg gaaagtttgt gaaatgaact catactcgat tctaaaagct tcttccactt     64380
     ttccttcttg cactaacttt tcctatagtt ttctataggc ctttgcctgt gcactctgtt     64440
     cacagatagt tgtttcaaat ctgtgcacta cagtcgcacg ggactcgaag agggtggcaa     64500
     ctactatcgt gatattcgtt tgttgcgaaa cacggtggag tctagatttt tagtactaac     64560
     attcagcaga aaattgtaaa taagtgtcgc agaggagcgc gatggccgac gatcccctat     64620
     atctcgacag gaccggcgaa tgggctggtc tttggtggct tccggagatt cctgacgaga     64680
     aggtcccagg tttcctccgg tacgatgccg agtgtggtct tttgctgtcg ctgatcgggg     64740
     cgttcgagga tcgagttaca tcgaatccct cgccaggtgt gacggcgtac cacgagggta     64800
     ccaggacttg ggaagtgatc cacggtgtag ccgagcagcg cgagattacc ctttttgaca     64860
     ccattccgat tagtagtaag aggacaatcg gggctcgggt ggagagtccg gcaaagcaga     64920
     ctgttaccgc gtcggtcgcg atcatcggtg cgcatgttcg gagcgaaggc gacccacaat     64980
     ttgctggggt agaggtttca gtcgaggatc tgggtcgctg ggctggatct tctgtgttcg     65040
     aaggattact aggcgctccc gacggcaatt tcgatgggac tggaagtatc tcggtgaagc     65100
     cagtcgaggc gcagtcggtc ctggtaggtg gcaccgagta ccgtcttgtg cacactcaca     65160
     cgctcccgta cttcgaccag cgcaaaagtg aaactgtcgg acgtatgagg gacacggtct     65220
     ccatccgcat tgtgccggca tctccgttct cgctgaacgc tgcgttgcac gaggcaagcc     65280
     tcgtgcagga cctaatctcc ctggcgacgc atcagtcggc aggagtgatc tggctccgag     65340
     tggaggttgc acggtccgag tcacagctgc ccgacggacg gacttcgccg cgtcgacgtg     65400
     cggatgtgct ctactcgccc gttgcgctgg gcaagcatga tgcgaagccc gtcgatcatc     65460
     accgaatgtt tttcacctgc aattcgctcc cgttcgagga ggtattgccc cgctggtgcg     65520
     agacccatgt ccgcttgcag gcagcgacca acatgatctt gggcctgcgc tacgcgcccg     65580
     cccgcttcgt cgaaaataat ctccttacag cagttggtgc ggctgaagcg ctacaccgca     65640
     acctccgcat cggcgaaaaa ccattctcca aagcggaatt tacggcaatg cgcggggcta     65700
     tgctcgacca ggttcctagt gagcatcgag aaagattcaa agcagctatc cgcaacgatc     65760
     caacgctccg agatcggctt catgccctgg ccgcgcgacc cgatgaagaa gcgatcgggc     65820
     agcttattcc tgatgtcgac tattgggcga agaggacaac gcgggcccgc aatgacctcg     65880
     cacacgaggg aaggacgcca aaccattcct ttgaggagct ggtcgcaatc gtcgaggtga     65940
     caaccgcggt tgtaatcctc aatgtcttgc aggaactggg gctatctgcg gagcgacagc     66000
     gagagatcgt gctcactcac ccaaagctca gacacacggt aggactttcc cgagagtggt     66060
     tggtcccctc aaaatccgac taattgtcct gcctgttttt cccatactgg ctttcatgag     66120
     tcgttctacc gcagggcgag tcttcgagat tgtgggtggg gttcggcaca actgacttaa     66180
     ccttgttttc tcagagccga ttcacctccg aataggggta cttttgtctc ttctcgtatt     66240
     ggcacaattc agccggtgta gtcaacaccg aaacaactta actggcttat gtggattcgt     66300
     ggaggtctcc aagctgggta accgccgttg aatgaggttt gggtcctgca ctcgatttac     66360
     cagatcacgg gcctcgtcct gcgatctgct gctttgtagt gacgtagcga tgtagtgacg     66420
     tagttttgta tgacaacact acagacacaa aaatgcaggc agagaggcag aaaaagtctt     66480
     gcaccacggt tgggggtgtc ctagcgtatt cggtaccgac cggattacac cgttgtgatt     66540
     cggcggtgac ccgagtggag gaggtgcaca tggcagaaat ggttgagatc ccagcggcgc     66600
     tctatgggcg tggagcggtg cgtgtcgtgc ccgttgacag cacggtgcgg ctggacgtca     66660
     agattcctgc tgccctcatg cggaagctaa tgatcgaatc taatcggtct ggtgtgcctc     66720
     tgaccaaaat tgtggatcgg ctcttaagcg ctgctatcgc gcaggactcg gagcaggagg     66780
     aaatccgccc tcgctaatca atgtcagcgc actgtagcac aaaaaatacg gagccgaatc     66840
     cgccaagatt cgactccgtg aatgattgaa gatcctgcca gaccttcaat cgcagtcctc     66900
     aaaaccagga atgaaccaat ttggaggaga tatggctatc ttgtcatgcc ctagtttttc     66960
     acacaacccc gacgcagcgt ctctgcgttg gttggggtga gctagctgtg ggccgttttg     67020
     tgaaaatggc tgctgcccct gccccggaga tgacgccgcg tcttgatgtg tccaaaaatg     67080
     ctactgaccc ggactcgctt accgatcacg gatttcaata ttcccggcat cggcctgtca     67140
     ttaccgacca taagcgtttc gaccggctcg tcgggtttag tatcaaacag tccaacgtcg     67200
     agctcgcggc agaggctatc aaacaggctg cgacagtgtg gtgcctgacg gaaaagaagt     67260
     cggacaagcg cgacgaagac agtgtgaaat tcttagcaac ctacctgtac aaagagtcgc     67320
     tctattgggg caagatcgat ccgcgccgag cgttgcagcg tgccacagcg gaatcatggc     67380
     ttggttccca gtcttttgct ccaaccagtg ctaggacgta caaggctgtt cttcatactg     67440
     cgggtcgagt actgtacccg gcagaatttc cgccagctaa tcggtacagc aatccacgag     67500
     caaaaccggt cgaccccgcg tcggtcgagc tcattgatga gttgtacggt gtcgcggcga     67560
     cattgccagc cgttcaccga ttgcgtttgc agttgatttt ggacttgacg actcagtcgg     67620
     ggctgcgctc ggctgaggta ctcgatttgc ggggcagtga tgtcaccgca cgaatcctcg     67680
     acacaggcga gcgtatagct cttgttcgtg ttcataggtg aaggaaagtc gatcgtgtcg     67740
     tgccggtgat ttctcctgct cgcagcaaaa ggcttcttga ccacgcaaaa actgtggggc     67800
     gcgggcactt cttcccatca ccttcgggtg gccgtccgta caattcgtcg gttgcgaatg     67860
     tctttcggta tttgcgtgag cggggttttc cgtctacgac cgtggaggca ctgcgggcgc     67920
     gttggctggt ggatcttgca aactcgccgt tgcccgcggc aatggtgttc caattggccg     67980
     ggaattcgca ttattggtcc ttggcgactc accatgacca tttgatgtcg atggagccga     68040
     agggtgtcgc tgagctgatg cttcgggcga agggggttgg catgatctcg atgctggagc     68100
     atggttttgt catcaaagcg gatgtgtgga gtcgcgcgca ggaggtcatc cgtagaggtt     68160
     atgccgctga atatattgag cagattaatg cccaatatcg gggggcggga ggtcgtaagg     68220
     ctactgcggt ggtgccttct atcgaggccg tgctaacggc gggattggcg ctgatcatga     68280
     ttggtaagcc ggcgtcgatt gcgggtattc atcgattgtt atgtgagtta gaacctgatc     68340
     aacgcctcga gtgtgggttt gctaaagacg gtgcactcct tgcgtatccg gcgttcgcga     68400
     attggctgac tcggcagctc gaggtctttg accctggtgc tgatcttgtg gcgcgccgcg     68460
     tgctcaatca cgtccatcga gagcagcttg ccgcgcgcac tgcggagcag cgagaagcta     68520
     gtgagcttgc tcgcgcgcgt agagacgagc tagtcaacct tattgttgcc ggcagtcgat     68580
     gatcgttgct caggtggcta tgccggtgat gtcgtggccg atgaaacgat tattgacctc     68640
     gcaggcccaa gtgaaggctt aggtgtgcgg ccggataagc agcgcgcagc tgcttacgcg     68700
     ggtgcgtatt acattcggga taaaacgcat cagctgggca ctggcgagaa aatgcgtgag     68760
     gtgaccaagc gaggtttcgg tattggtgtc acagctgtgt cgagggtggg gagcgccgat     68820
     gacttgtatt cggtttctcc tgtgattacc gcgataagta ttgacaagcc ttcgcctgga     68880
     tcaacggttg cattgggtcg ggctttgcag atgcatcagg cgaatgggtt tgcagcgtcg     68940
     gtaaagacaa aagctaacgc acgtttgccc tacttgtgtg tggatatggg gtattcggtg     69000
     cgtcctgatt tcacgacagt cgtccatgat cacggttttg ctccggtaat gcgctacccc     69060
     gtgtcgaggc agaccgtgtg ggcgagtgag aaaccggagt ttggttctca gtcgcccggt     69120
     cctgtacaga tcaacagtgc cttctactgt ccggcggctt tgccgctagc acgacagcgc     69180
     cggttggttc gtcggctcaa tgagctgctt gatgaacagg acgggttcga agcccatgac     69240
     caagcactac agaagcttct tcctctattg atggggacga actcgcggcc cctcaagttc     69300
     gtcagtaagc ggaaacgatc cccggaaact atcccgacct atcagatcga tcttgtgtgc     69360
     ccagcagtgc aggggcgagt gaagtgtccg ctgaagccag aatcactgat cattgctttt     69420
     gatcagccgg aagtgaaacc gacatggtca gctgatcggt accggtgttg ttcgaaatcc     69480
     cagatccggc acacgtactc gtctgagcaa tggaagctcg cgcaatgggg gatggtgccg     69540
     gggtcatggg aacatgcgat ttattatgaa gccgcgcgga gtctaaccga gcagcgtttt     69600
     tcgatcatga agtcgcagca tttgtcgggg cgagagcatt tgaaatggtc tccgcgtcga     69660
     gaaccgatga tcagtgtgat tatcgctttg tggattgcgg ctaccaacct cgcgattcag     69720
     gacagccacg tggcaaagat gcctcgtccg tcgtcgatca agaaacagaa acgtcggctg     69780
     gagcgcgatc tgggtcgcgc gctcatgagt accccgccac gcacatagcg aagtgttgcc     69840
     ctcctgcggt tgtattgaat tacgcaggag ggcctttctg gttcttaagt tcttcgggac     69900
     ttttgatggc aaaaagtcga cgaagttaat ttgaaggcat gtatgcgtgg gcacacttga     69960
     catgggttta cgctcggatc gcaacatttc gggttgttgg aaggcgatca aatgggcttt     70020
     cgcgttgatt ttctaccagg ggttttgctg cggggaagtt cgggactttt gatttttgac     70080
     ctcggtagca gctttgaaac tttggtggtt gacctaggtt cgtgaaccgc tcacaaagag     70140
     cagttcacga actgcaacgg ccggaggtca caaactcgaa agagggagtg acctccggtt     70200
     tcttcttttt ctgatttttg gggccgagga tgggttaagt agcgggttaa gtagcaaaaa     70260
     tgcccgcatc cccgtatgca cttttagtga accttggcca gaagtcggaa cggatcaacg     70320
     attgtcgggc gaaaaagtct cgtgccaaga cgacggaatc gccttgctct caaacactgt     70380
     cttacggtgt gggtttttgt tcgtggacgc aacggtgaac tgtgccgacc aactaaacta     70440
     cccgatttta gcggcgatga cgtgcatgga taggtctgtc gcgcggagtt tgcacactcg     70500
     gcggtgcgtg gtcgcaagag gaaagtccgc ctttcgggtg tgatgacttt aactatgttt     70560
     ctgaaaagtg ctgcagatta ctttgtttac tttcatactc attttattag cactaaaatc     70620
     agatcatttt ttgccgccgt tgcaactgtt ttttcagccc ttgttttttc ttgcccattg     70680
     gcttctgctg cttcggacgc gataccagag gacgcaacgt ctcgtgtcgt ggtcgagccc     70740
     ggagaaagct ttacttttac gtttgatgat gagacttcga atgatggagt atttactcgt     70800
     tctgtgaatg cagtggcatt cacaggaaca ttcgctgctc ctcaggcaga agctggggga     70860
     atcatttctt atggcttgca tgtcagatgc actggaactg ggttccttcc actaagcgca     70920
     aagatctgac tccaagaaga acattttgga tttttctatg agactgtaga cgaaaccttt     70980
     aagagcctta ccgaaggtgg ctacggattt gtccgtggag aagcaatctg tgggccaact     71040
     acttccggtc atgattaccg aatttctgga gagatttttg caggatcgca tcatggcttt     71100
     ggcatctcta gagaagtcca tcttccgtgc aatgtgaact agttagtgcg catgagccag     71160
     gcttttagtt ctttttctgc gcgctcacaa ccacctgggt agttttttgt ttagctcttc     71220
     agctacagaa tcgaaaactt ttttagcgag agcttcggcg tggtcaggct gaagctgccc     71280
     ttttaactcg tttaagggga cggagaggga ggcataaggg ctaggtcgaa aagaataaga     71340
     ccgtatgtca tcagcgtata ttcggatggt tgtctccaaa atctgagatt caagaataac     71400
     gtttccgaat actaaggacg atagtttttc tctttcatat tgggcagtct acggaaataa     71460
     agcagtacta gctgctggcc ctagacgata gactggatag atcgttctgt ggcgttgaac     71520
     aacgcaaatg cgagtcgtgt acccgaagtg cgtacatgcc ccgtagggtg tgtggtgaca     71580
     ttagccgtgg tggtgccagt gactgtcttt gttcttcgct ttctgatgaa agctatgaaa     71640
     gcaatggata ttatgatcga gaacaacaag tgggacggtg catcgtctga tgaaaagtga     71700
     tgtgttatta aatccgtgtt gacgcgtcac cgtgagtagt tcgtgccaaa ttaaaccatt     71760
     tcttatgtct ccgaactgcg gaaatgctgc gcggcccaaa aagttttggc acgaactact     71820
     cgctgaaact actttccgag gtatttattc ttcgggattg cggttaaatg ttagtgcata     71880
     gcccactgct ggtagggatg acgcgaatat gtatgtgtaa atcatgtata aaccagcgaa     71940
     tatagcgaga aggtttgggc taagagggga atcggtggct ataaagctag cgctggcaat     72000
     gatggccgcg agacctccga taaaaagtag gctaagtgcg gtgctgaggg agcgctgacg     72060
     ccattgatta atcacagctt tttcgtagtc gtcaaggcgg tcttcgggtg ccatatcttt     72120
     gagatcgatg gtcgatcgca ggatcgtcca gcatgtcatt gcgataaaca tgcatgcgat     72180
     aaaaagccag atgaagtgaa tccatgcaaa catgaggagt tcaaagatta aggctaggac     72240
     tagactaacg aaatatcctg tgattaagag gtgggtagac tgggggttgc gccatcgggg     72300
     atagtgattg ccgttgctga tggcgaaatc gtagaagcgt tctttgattt gagaattcat     72360
     cgggtcatgc tccttgagtg agacttgcag cggtgagggg ggtgaagggt atgcgtgaga     72420
     atatcgcctc gataggtagg ttgaatacgt cgcaaatacg aagggcaaga tcgaggctgg     72480
     gggagtgatc tcctcgttct agtgcaccaa tggtttgtgg gttgacgtct acaagctccg     72540
     cgagttgtgc gcgagacata tctcgttcgg tgcgcagtac gcggatgcgg ttgtagatag     72600
     tccgttcaag ctttttcttt ggggacatgc aatatagtgt tgtataaaca taataaattg     72660
     tcaacggtta caacgattta tatgtctatg ctcccgttta tctggacctg tgtttcgcca     72720
     cctacccaga tgcctgaggc atcatcaagg atggtgattt ttccagctgc gcccacaaac     72780
     tttccttggg atgcttcgta ttcgttgtcc accttgtttt gtttgcgtag ccattgagcg     72840
     atggcggcat tcaatgaacc tgtgactgga tcctctccag tacctacaaa tgcgcgtaca     72900
     tggacgtgag tgcggtcggc tatcgcaatg accccaagac gctttcctat ggaaagtgcc     72960
     gtcggggtaa gggtgggaag aaggtctata tcggctagtt gaataagttg ccaacgtgga     73020
     ccgtttactc cccacgcggc ggcggagatg ttgtggacag aaatccccaa agattcagca     73080
     acttcttgga tctcgtcggc agtcagagga ttgttgtatg tgagaggtgg tgctgaaaag     73140
     gaaaggtcga gttgtcattt tggattgtta tgaggccagc ggcgcattct tgtacgagaa     73200
     catcatgtct ttgtggtttc caccaaattc aagccaagca cgtgcagaac ctaatgttgg     73260
     gtggccggcg agcggcagtt cttcggtacg agtaaagata cgtacacggt aatctgcatc     73320
     ggttgttgtc ggagctgata agaaagtagt ttcggagaga tttagccacc gtgcaatatt     73380
     ccgcatctgg gtagtggaca gattatctgc gttaccgacg acgacaagtg gattacctgt     73440
     gaaagaacca gtggaaaata cgtctatttg gataaaaggg agttttatat gtcccatttt     73500
     gcctaaatga cgcgtcaccg tgagtaggtc gtgccaaatt aaaccatttc ttatgtctcc     73560
     gacctgcgga aatgtaaaac ggcccaaaaa gttttggcac gaactactca cttcgacgct     73620
     aaacgccctc accacggcac cgcggcgcta ctcgctgcga tgggtgcgca gcgtgcgggc     73680
     gcataacgga taaagtgccg cgcatgtgat tgctgcgatg ctgaaggcca cgagccagcg     73740
     agggccgtgt gcgatttctg gccaggctgc tgccgcgagt agccatagtg gggtgtcggc     73800
     aaggacatcg ccgccgagtg tggcggagat aattgtccag atgactgccc agatgatggt     73860
     ggttgttgtg ccgaacctgg ttactatcag cagtgcgatc atggtgagca tgcatcctac     73920
     tgggatggct agtgtgagtc gtgtcagttc ggtgcttaag gggctgccgg agatgagtcc     73980
     tgcaagtgct gcgatggcgc tcatggcact tacgcatagt gcgtggatgc tgaggagtgt     74040
     tggtgtgcag tgtgggtttt ctatgcgcat gatgttccat gcaggggcgg tggtgggcca     74100
     gatgagtgct ggtagtatgc cggctccgat ggggagtatg gcgaatgtga ataggccgtg     74160
     gacgtagctg ggtgggtaga tcatggcaac acacagtatt aatattgtgc acaatatgat     74220
     gcagctgcgc acggcggggg tgagggctac gggtaggagt gcggggagta cgttgcgtgg     74280
     acggtcagcg ggcctgcgtg tcgacgcctc ccgcaggact gcagtactta cgtgttgatg     74340
     ggcgcgtcga aaagcgatgc agtatcgagg cgtgaccacc gcgatgatcg ctcctgcaac     74400
     agcaagaact aagcacaaca gcagtgctag ccatggtgat tcgtggcgta gggcagcatc     74460
     gggttcgagg gggacggcgt tttggtgcac ctgcaacacc ggtaaaacga ggcgcaccgg     74520
     ccaagcgaag ggaaacgccc accacacaga tccttcgacg atagggcggg tagtcccagc     74580
     caactgccaa accaagaaca ccaccagtgt tatcacgatg ttggtgctcc ttgcgcaggc     74640
     catagcaagc ccggccactc ctatggcacc gacccagctc agcaccccga ggaggaggat     74700
     tcggttggcg cccgtgcggc cgtcgagaag cgcaagcagc caggtgcctc caaagttgag     74760
     cacgtggaac accgccacgc aggcgatcac tgcaacaaag cgtgccagcc gcagggaccg     74820
     catgctcagg ccgcgccaat gccgtccacc catgcgggca tggtgttcgc gcagctctgc     74880
     ggatgccgca aacattgctg tcagtggtgc tgcaatacct gtggcgtaca tgctttgcca     74940
     catcaggatt ccggtggcgt cgggatcttc agtgacaacg cgggcgagtg taaaggtgag     75000
     caagagtaag gggagtgcag tgagggtgag ccacgctgtt gacgaggatc gcgaggcgat     75060
     gaactcggag gcgaagtatc tattcatggt ggtcaccagc ttctagcacg cctggttggg     75120
     tgaggcggaa gaattcctgc tcgagctggc cttggggtgc gagttgattg agggggccgc     75180
     tgtagcggat ggtgccttcg gcgaggatgg tgacggtgtc ggcaagctgg gtgacttctc     75240
     ctagctggtg ggagctcacg agcacagttt tgccactggc tgcccatgcc cgcagcagtg     75300
     cgcgcaggtc gcggatacct tgcgggtcaa gaccattttg tggctcatcc aagatgagga     75360
     tgtcggggtc accaaggatc gcctgcgcta gtgctaatcg agccttcatg ccggtagaaa     75420
     aactccgcgc ctttttcgac ccaacatcgg aaagccccac cacgtcgagc acgcgatcag     75480
     cctctgaatc tggcagcccc aacaacgtgc tgtgcacccg cacattggaa cgcgctgaca     75540
     aatgcccata gaaggctggc ccatcaatag aggcacctac ttgggaaata tcgatagtca     75600
     cctcaccgga atcggcgggg atcaaaccaa gcaaaatgga aaacaacgtg gattttcctg     75660
     caccgttgcg ccccaacagg gcgtggactt ccccagggcg aatatcgcag gaaacattgt     75720
     tcaaaacatg ctggccgtgg aagcttttag agacttcatt gactcgaata gttgtactca     75780
     tggttgttga ttgttatcca gcaaccacaa gcgcagatcc taccgtggta ggagaagccc     75840
     agctttatgt acaaacaaca ccaaagcgac gcggtcacgg gcatgcacct ttgctagtag     75900
     tgcggtgata tgcgttttta cggtcgtttc tgcaatccca aggtcagcac tgatctccgc     75960
     gttggtgagc ccttgtgcaa cgcacagtag tacatccatt tcgcgccggg tgatcaggct     76020
     gagtccttgg cgctgctcag ggctgagatc gctgccatag gcgtggcgga atgtgtcaat     76080
     aacctgcttg gttactccgc tggctagaac ggattcccct gagtggatcg cctcgattgc     76140
     ggtgaggaag atttcggggt cggcgtcttt aagaagaaat ccgtgcactc cggcggtgag     76200
     cgcttcgcgg acgagcgtgg ggtcgtcgaa agtggtgagc atgacgatgc ggatgcgagg     76260
     gtgccgggcg aggatggcgc gtgctgcggt gatgccatcc atgacgggca tgcggatatc     76320
     catgactaca acatccacgt tgtggctcat gcacgcattg atggcttcgg cgccgttggc     76380
     ggctgtggcc actacgcgca tggtgtcgcg ggagtggatg attgtggaga acgctttgag     76440
     gatgggcggt tggtcgtcgg caagcacaat gcgaatcatt aatggtcctc ttggtgcatg     76500
     ggaatggtgg cacaaacatg aaaatcggat gcggttcctt gggcactaaa acgaccgccg     76560
     agtgcggttg cgcgttcgtt aagccccagc agccctgagc cggggcttgt cgacgcccca     76620
     gtcggtgccg ttgcctggga atcgacggtg atctgcagct gttcgtctac ctgcacactg     76680
     agctgcacag tgctaccaac accttggtgt ttcaccacat tggtaagcgc ctccgacaca     76740
     atgcggacac cagcaagctg caccaaggtg ggcactggtg gacaatgctg gggaaggtga     76800
     gccgagatat tcaacccggc acgttcaaag ctggcaatga tctccgctag atcggcgagc     76860
     tgacacaatg gctgcattgc acctgattgt gtgggatcgc gaagtgcctg cacaatcccg     76920
     cgcacctctt caagggaagt ggcggctgcg ttaaggatct cctctagtgc ttcgcgttgg     76980
     tcgccaccat atagtcccgc ctgcgcctgc accttgatca gggttaagga gtgcgctaga     77040
     acatcatgaa gttcccgtgc gatcagcagt ttttcttctt cgcgagcgga ttggtatgca     77100
     gtctcacgtg cttgatcggc gaggaaatag cgcgcaccaa cagcgtaaac gcaccctagc     77160
     aatgcccagt ggaacccgat ggctagcact aactccatgc cttcgcggta gtgcagtaga     77220
     agatgtgagt ccagtcgcca cattgcaggg gagacaaatg aacctgctag ggtgagcaac     77280
     aggattatgc gaccccaatt tctttgggga agataacgtg cgggtgcgta taccgccatg     77340
     ggtgctaaga ctgcccacgg ggtgattccc atgttttctg gtagtgcatg gcaccagact     77400
     gctgcccagg cgccgaggag cgtgacaaat ccggcggagc tgagtttggg gcgggatcgc     77460
     cagtgccaga taaaaggcag aaataggatg gagatggctg cgtgtgccgt gttgtgggcg     77520
     gagggggtct gagtagcgaa aaatagatag cctgcggtga tgatagtcgc ggttgctgtc     77580
     aggatcttgt cgcctaggcg tgccatggtg gcaatggtag tggtgtggtg agtagttcgt     77640
     gccaaatctt tttggggtgc gcggcgtttc cgcaggtggg atatataaga aaaaattaaa     77700
     tttggcacga actactcact ttccgtgatt gcgctactaa agcacatgat ttccattaat     77760
     gaaaacgtat tgaaaatatt ggcgcagcgg tgtattttca tttttagagc ttgttgaaaa     77820
     acaatttttc acatctagat aagggagtct cgacatcatg acccacgtag ttcacgagaa     77880
     ccacacccac cagcacggcc cgaactgtgg ccatgtggca gttcctcacg gcgaccatgt     77940
     tgactatgtt cacgacggcc acctgcaccg cgaacatgac ggccactggg atgagtgtga     78000
     aacctccgag catcacaccc acgccgacca tgagcatcag catggcccag gttgcggtca     78060
     cgtagcagtt cctcacgacg accacgttga ttacattcac gatggccacc gccacgcact     78120
     gcatgacggc cactgggatg atcactaaaa ataattaatt tttctacgga ttgcgcttcc     78180
     aacaatggat ggcgcaatcc gttttttatt gcgtcactta gactctagaa acctcaaaaa     78240
     ttggaaaata accacccggt tgaggggcca gtgctgggtc ggcgattgtt ggataacgat     78300
     tccgacgtca ccccgtggga ttttatacaa tcgcgtgctg cgcttttatg attgcggtgg     78360
     caagattacc aacaatgtac gtgtggtcct cgaccccgtc tacgatttgc ttcttaagga     78420
     gcaggcgtag cggtgcgggt gcgttgagag atcagttttt gcgcgccccc gagtagggcg     78480
     tcgaaaagca acgcgagtgc gatcaccagc acggaggccg ccaacatctc gatgtaatcc     78540
     ctcgttttga ggccgtggaa aataaatcgg cccaacccca catctgcggt atatgcagca     78600
     agtgtggccg tagcggtcac ctgcaacact gcggcgcgaa tgccacccac cagcacggct     78660
     gcagatagtg gtagctcaat ggaactgatt acttggcggt gggtaaaacc catggcgtag     78720
     gcggcgtcga tggtcgcgcg atctacggcg gccacgccgg aataagcacc agccagcagt     78780
     gatgggatcg ccaaaataat cagcgccagc atcggtgccg taagtccaat gccaaaagcc     78840
     agcccaaaga tcgtgagcaa gcccaaggtt ggcagcgcgc gggcagcacc gctgacacca     78900
     ccaacaaggc cggcgccgcg gccagtatgg ccgatcagaa caccggccgg aagggcgagc     78960
     agtgcggcaa tggcgaccgc agccaggctg attccaacgt gttctagaag acgggcaaga     79020
     aagccttgcg agccccacca gtgcgcggca gtggtgagat aggagaggag atcaccaaac     79080
     caagtcatgt ggggttaccg tgcctttcct gggcgagtcc atggggtgca aaggcgttgc     79140
     aggatgaggc aagcgacgtc gaaaagcacg gcgaggagca caacggccac gatgcccacc     79200
     actacctcgg cggtgatgtt gcgttgaaaa ccgtcggtaa acaggctgcc taagctggat     79260
     acaccaatca gcgcgccgat ggtgacaagc ccgacggtgg aaacgcacag cacgcgcagg     79320
     ccagagatca acacggggat tgccagcggc atatctacct tccatgcgat ctggctcggg     79380
     ctcatacctt gggccaccgc ggcggtgcgg acttcctccg gtaccgagcg aaacgcgtcg     79440
     gtggcggtgc gcacgatcaa agcaatgccg tacacgcaca gcgcaatgat cacattgatc     79500
     tgcgagcgca gcggcacagc cacgataaaa ggcacgatga ccagcatggg aagcgctggg     79560
     atcgtatagg ctaacgacgt cacctgcacc accgtgttac ccacccgcgg atggcgtgcg     79620
     gcaaacagac ccacaggaac tgccaccagc acgctgatca cgatggcggg aacactgagc     79680
     agcacgtgcg cgcgcagtag atccagcact tctggccagg catgcattag ccacatgtgg     79740
     caccatcacc tagggttcca agcggcctgc cgaaggtgtc aacgactacg gtgtggccgt     79800
     cgataagctc ggtgtgcagg ctgcgatttt cctggtcaga gcccaagaag gatgcgacga     79860
     agtcattggc ggggtgggcg aaaatatggg cgggggagcc ctgctgggca atcttgccac     79920
     ccttttctag caccacgatg tggtcgccta cgcagaaggc ctcgtcgatg tcgtgggtga     79980
     ccatgaccac cgttttatgc agtcgggatt gcaagtcgat gagttgtttt tgcaatgagc     80040
     gtcgcacgat gggatccact gcgccgaagg gctcgtccat gagcaagatg tcggggtcgg     80100
     aggccagcgc ccgcgccaca ccgacgcgtt gttgttggcc gccggagagc tcgccagggt     80160
     agcggttggc taacgacggc tccaggttga cgtcggcaag cgcttgtttg gcacgccgct     80220
     caatttcagc tttgggctcc ttgttgagcg tgggaaccaa agcaatgttt tgaatcacgg     80280
     tgcggtgtgg caacaaccca gcgctttgaa tcacatagcc gatggaacgt cgtaactgca     80340
     ccggatccgt ctcagcgaca tccttaccgc gcacaatcac acggccctcg gtgggctcga     80400
     ccatgcgatt aatcatgcgc aacagcgtgg tcttaccgct tcccgacgac cccaccaaca     80460
     ccgtcgtctt gcccttgggg ataaacaggc tgaaatcggc cacggctttt tcaccacgct     80520
     tgccatagcg cttactcacc gactcaaact cgatcatgac gccacgctac actacgacct     80580
     cggcaagtac ctttcctcgc ggagaagtac taccagccat aggctcttca gtaatcatca     80640
     ccttgtgggt atctcccggc aacggcatcc acacatcagt gtgttcctcc ggcccaataa     80700
     caccagccga ttccatcgaa ccatccgtct taaccgccca cacttgggcg cccatgccgt     80760
     gcccaaccgc aggagcacca tcaaccatgg caccaccaga attcatcgac tgcgacacca     80820
     caatatccaa tgtggcaccc atcgccgagg catccgcttg gcgtacatca gaggcagcca     80880
     aaatgctatc catttgagca tgtggatccg cagcctgcca cggctgatac accgctgtca     80940
     ccgcaccagc aagcaacact acagacgcag ccatcgacgc aaataccagt cctgggcggc     81000
     ggcgtcgcaa cggcgtaacc gtagccaact gctccggttc cggctgtgct ggctgctcct     81060
     gtggggtagc tgcgatggta tccataacgc tgagcttcaa cgccggtggt ggtgtcagcg     81120
     gagcagggga aacattgaga gcatcttcta tatctcgggg gaagttgtta ctcatcgtgc     81180
     tgctcccgtc gcagataaat gggggtgaac aatctgacgt agttttttca agccgtcgcg     81240
     tagccgtgtt ttcgctgttc ccaacggaac gcccgtggcc tctgcaatct cgctatgagt     81300
     aagaccttgg aaatacgaca acataatggc cgtccggtgt ggctcgccaa tggaatcgac     81360
     aagcgcacga acctgctgcg actccaaaga ctccaccgcc tcctcctcag cggcacacca     81420
     tgtggtggca ctatggagaa aatcagtggt atcgcgcttt ttcgaagcaa tatcagaacg     81480
     aacgcgatca atagcccgcg accgagccaa ccgcaaaatc cacgaccgtg ccgaaccacg     81540
     ggaggcgtcg aaactcggcg cagtgcgcca cacctcgaca aaaacctcct gggttacttc     81600
     ctctgcctgc gcacgatcat gaatcacctg agtgctcagg cctaaaacat agggcgcgag     81660
     ctggtcataa agctgcgcga aagccgcttg gtcaccagaa gcaaccgcga cgagcaaatc     81720
     atcgggatcc atgaccaata actctacagc ggtcacaccg catacagcga ccagcgaaaa     81780
     atctacttct gcattgcgtc agactcgtgg gtcatcttgt catgatccat ctttccgtcc     81840
     atcttgtcgt gctccatctt gtccgactcc atcatcttgt cggattcagg tgtcatcttc     81900
     tcggagctca tatgggtgct tgtctcggag gtcatcttct cggaggtgcc gttatcgccg     81960
     caggctgcaa ggccgaatgc gccggctgcg aacatcatgg tcagggctgc tttggtggtc     82020
     atacgcatga gtgaatactc cttgtgtttc acgattactt gcttacttga aggctgacac     82080
     caggagtgct ccctgtgtgt ctcatagggg tattcggagc tccgatggga aacggattgc     82140
     ggttgggtga aaaaagtttt ttcgcattgt gagcaatcca tagcggtggg tggctccgta     82200
     tcaactcaca gcaacgttga aaacctaacc accactgcga tgagggagta cgtaacagat     82260
     gtttgaattg gccacaattg gattaatcgg tggcattgtc accggtatat ccccatgtat     82320
     cttgccggtt ttgccggtgg ttctcgccgt gtcggtgggc cgcagaccaa cccatgtggt     82380
     tgctggccta gcgctcagct ttgccaccat tacgctgctg ggcactgtga ttttaagttc     82440
     tttgggtctg cctaaagatg tattgcgctg gacgggtatc ggcctgctgg tgatcgtcgg     82500
     tttgagcatg atgatcccta agctgggtga gctggtcgag gaaccattta gtcgcattcc     82560
     gcgcccaact ttcttgcagc aaaaggcccg cgacaagggt ggctttatga tcggcctggc     82620
     cctaggtgca gtgtatgttc cctgcgcagg tcctattctg gctgctatta ccgtcgccgg     82680
     tgcgacgggt gacatcggtt ggccaacggt tgtgctcacc gtggcatttg ccgtaggtgc     82740
     gagccttccg ctgctggtgt ttgcgctggc gggtaacaag atgggtgaga agatcgacgc     82800
     gatccgtaag cacatgaagc ttgttggtgc ggttattttg gcgctggcgt tggctatggc     82860
     gttgaacatt cctgagcgtg tgcagcgtgc gatccccgac tggactgctg gtgtgcaaaa     82920
     gcagattagt gaaaatgaca cggttcgtgg tgctttgagt tccggtggtg gctccttggc     82980
     tgcgtgccgc gacgccgacc catcgatgct gcatgactgc ggtgaggcac cggaatttga     83040
     gggtttgacc ggctggttta acacggataa gcctgtgtct acgcacagcg gccaggtaac     83100
     gcttgtggac ttttgggcct acgcgtgcat caactgccag cgtgcgggtg agcacatcac     83160
     caagctttac gacgcctacc gcgatgcagg cctccaagtc gtaggtgtac acgcccccga     83220
     atatggcttt gagcacgagc ttgccaacgt gaaagatgct gccaagcgcg aaggcattaa     83280
     ctacccagtg gcccaagaca acgactttgt cacatggaag aagtacaaca accgctactg     83340
     gccagcccgc tacctaatcg acgctcaggg caatgtgcgc cacatccacg aaggtgaggg     83400
     tgcatacaag gaaactgaac aactggtacg cgaactcctg cgtgaagcaa acccccaagt     83460
     atcactgccg gagccagtag aaaagggcgt cgaaaagcac gatgcgcaac tcactcagcg     83520
     ccgcaacccc gaaacctacc tcggctacga gcgtgcccgc tacttcacca acagcaacta     83580
     cggcccaggt gaacgcaccc tcgaattcaa cgcaccaaaa gtcgggcaat acaccctcag     83640
     tggaacctgg gagattgcct ccgaccacat caaccctgtt aaagacgctg cactgtccgt     83700
     gaacattcac gcagcaaccg tgcaaacagt tgtctccggc accggaaccc tcgaagtgac     83760
     ctaccccgat ggccacacca aggaatttaa ggtggccgac ggcaccgtca acgtggtgga     83820
     acaagacgag cctctcgacg gaatcgtcac cgtgaagcca tcccaaggcg tgagcttcta     83880
     ctcgctaacc ttcggctaag ccgcatatga aaaacggcca gatgagttgg gcacaatgtt     83940
     gctgtccaac ccacctggcc gatttttatt aggtgtggcg ttgagcgttg ctctgaatag     84000
     ccttctccaa ccagaccgcc aagcctttcg cgtacttgtc ataatgcgcg gtaaagcgcg     84060
     gatcggcagt gtagccctga gcaatcagcg catgcttgct gtgtgaaacc ggaaaccatt     84120
     gcgataaaca tgcccggtgt tcctctgcga gtgcatgtgc gtctggggaa tcaggggcca     84180
     tacccgattc gaaagcttgg gcaagtcgct ggtctagctt gtgcatgacc atctgccgag     84240
     cagcaaagtc gtccttgccc atctgtgctg cgcgctgttg gaagattgcc cagtcttcgg     84300
     tgtcacccca tcgctcctcg gcttccttct cccacttgct ccattcgcgg ccaaggacct     84360
     tcgcggtgtg gtctgcagag agcggttcgt tgtggttcat ggtgtcctcc aaaagttgat     84420
     gtacagattc gatcatggaa gtcacacgat gtttccgctg ttgcagaagt tccagctgtc     84480
     gttggagatg gtccgcggga gagctgttgc cttcgagcat gtcgcggatg gtttttagcg     84540
     gcatgccagt ttcgcggtac agcaagacct ggtaaatctg ggcaacatcc tcctcgctgt     84600
     agaggcggta atcggcccaa ctacgccatt gggggctgac tagtccgatg tcatcccaat     84660
     ggtgaagagt gcgcacgctt acaccgacga ggtctgctac ttcaccaaca gtgcgaagat     84720
     tgtgttcttc catgggagtt accattcacc ctgacgcggt gtgagggtca agtgggccga     84780
     tttttattag attcgactac tgctcgtcga tcttcttctt tacggcttct tgtacttggt     84840
     ctaccttgtc cgcgtacttg ccttcggttt tggagtcgat aaagtcgccg gccttatcca     84900
     cggcctcctt caccttgtcg gagttgttgt tgatcaggtc tttagctttg ttgagaatat     84960
     ccatgcaggt cagtctacag aaatttctct actagctgct ggtatccggc aacagtgagg     85020
     cggagatctt cgaggtggag gtactcgtca tgggagtgga gctggccgtg aacatgccct     85080
     agggtgcggt cgggtgcatg gactgcaaat ccgtagccat tgccacccat tcgccgtgca     85140
     aagcgcaggt cagaaccacc gggtgcgatc atggggatca cggtggtgtc ggggaaagag     85200
     tcgtggagga cctcggctag tgtgcggtag agcggggtgt cggtggggga gatggtggcg     85260
     ggttcgcaga tgaggtgttc gatggtgacg tggggtgcga gatcaccgag gacttgggtg     85320
     agcaggtcgt ccacgtaggc gtcgtcgtgc cctgggagag tacggatgtc catgtcgagc     85380
     caggcgtggc tgggaaggac gttgatggct tgacctgcgc gcagcacggt ttgggcgatg     85440
     gtgaggtggg agatggcgtg gccgaaggct gcgaggtcgc cgaggtgttc gtagccggtg     85500
     ccgtctcgca gggcggcggt agtggtgggg tcgaagcgga aggcgtcgat aaagccgtgc     85560
     cagatgtcgt cggtgcttac ctcgggttca aaggcggcga tccggcgtgc tacttcgccg     85620
     atcgtggcga tggcgctgtc cttgttatag ggggcggagc cgtggccggc gtcgccatag     85680
     acgtggaggc gacgctgggc agcacctttt tcaccgacgt agatgatggt ggagtcggag     85740
     tcatcgcggc ctgggatgtg ggacccgccg gtttcagaga tgcagttctt ccagctcaac     85800
     gcgtcggggt ggtgttgggc tagccatgct gcgccgaggc caccgcgggc ttcttcgtcg     85860
     gcaagcgctg tgaagtaaag ggtgccggcg ttgccaccgg tgcgggcaac gtggcgggtg     85920
     acggcggcca tggtggcggt aataaagagc atgtcgacgc tgccgcggcc gtagagtttg     85980
     ccatcgatga tggtggcgtc gaaaggcggg acgctccaat gttgcgtatc gacgggcacc     86040
     acatcggtgt ggcctaggaa ggtgaggggt tcggcggcga ggtcgcttcc ggcgacggtg     86100
     acaacgagac tgacgcgccc tgggtgaggt tcgaagcgtt ggatgttcac gggacttcct     86160
     gcgaagaact cttctaaagt ggccgcattg cgctcctcgt ggccggagtc tggtgtgagg     86220
     tcgttgacgc aggcgttgcg gatgagttcg gtgagcaggg cgagggtgtc gtcgtaaagc     86280
     gtcatgtgta ccacattaag ggcaatgggg gtgattgaca tccaagatta aacaccgttc     86340
     aatgattatc gctaggattt ttggacatct accaattgcc acaacatggg agcatcacgt     86400
     gactgacatt ctagaactcg cccgcaccaa agtgctcaac aacggcgaag gcctgaacaa     86460
     agaagaagtc ctccaagtac tacaactcga cgaagcacgc atcccagagc tgctcgaact     86520
     cgcccacgaa gtacgcctca aatggtgcgg cgaagaagta gaagtagaag gaatcatctc     86580
     cctcaaaacc ggcggctgcc cagaagactg ccacttctgc tcccaatccg gactcttcga     86640
     atcccccgtg cgctccgcat ggctcgacat cgcaggcctc gtagaggcag caaagcaaac     86700
     ccaaaaatcc ggtgccaccg aattctgcat cgtggcagcc gtcaaaggcc ccgacgagcg     86760
     tctgatgagc cagcttgaag aagccgtcgc cgctatcaaa tcggaagtcg acatcgaagt     86820
     cgcagcctcc atcggcatcc tcacccaaga acaagtcgac cgcctcaaag ccgccggcgt     86880
     gcaccgctac aaccacaacc tagaaaccgc acgctcctac ttccccaacg tagtgaccac     86940
     ccactcctgg gaatcccgcc gcgaaaccct acgcatggtc ggcgaagccg gaatggaagt     87000
     ctgctccggt ggcatcatcg gcatgggtga aaccctagag cagcgcgccg aatttgcctg     87060
     tgacctcgca gaactcaatc ccaccgaagt tcccatgaac ttcctcgacc cacgcccagg     87120
     aaccccattc gcggactatg aagtcctcga caccacagat gcattgcgcg caattggagc     87180
     attccgactt gcacttccta aaaccatcct gcgcttcgcc ggcggccgcg aactcaccct     87240
     cggcgacctc ggcaccgagc aaggcctcct cggtggcatt aacgccgtga tcgtgggcaa     87300
     ctacctgacc accctcggcc gccccatgga acaagacctc gacatgctcg gcaaactccg     87360
     cctgcctatc aaagccctga acgcgagcgt ctaatggcca cacacgcaca atccacagag     87420
     ctcctcgaag ccctcctcgc cggcgaagca cctcgctttc aacccaacac cggccaagag     87480
     cttgtcgacg acatcgaaat cgcgctctcc ccatcagccc gcgccgggct cgaagcaccc     87540
     cgcttttgcc agatctgtgg ccgccgcatg attgtgcagg tccgccccga tggctgggag     87600
     gctacctgct cacgtcatgg cagcgtagat tctgcctact tgggtaggcg ctagtgggcg     87660
     cgccaccccc gttcaccccc gaaaagacgg cacttcacac caaatctgct caaacggccg     87720
     gtttggaagc gatttggtgt gaagttccga gaaaaatcct tcgaaatacc cccgtttggt     87780
     ggctcttccg gttttagggt gcattgattg tgtgtcggat gttggcggcg tggaaatcgc     87840
     cacgttcaag cggaagattt ggtgatatgg gtcgccggtg taggcgtagt cccagggggg     87900
     cgccgataag ggtgtggtcg tgcatgcttt tggtcggaaa atatatcaac cagatgatgt     87960
     attgagattt tctttgccta gcctaattag gttatagtaa gccttgcctc aaatctgatt     88020
     ctcaaagtaa aggaaaactt gtgcgtttat ccagaaaaat tacagctgtg gcagtggcaa     88080
     tcgctgccag tggtgctgcg cttactgcat gcagcaatac atcagacact gcaacggatg     88140
     cttcagcaac tggctcgtct gcagcactga ccgtcactga cgtcgctggt cgaacggttg     88200
     aatttgataa acaaccagag cgcgtgttgc tcggcgaagg ccgcgccatg tttgctgcct     88260
     cgatcttgga caaggaaaac ccaggcgagc atatcgtggc cctcggtgag gatctgcacc     88320
     aaggtgcacc gagctttgag gcgaaacttt ttgaggctca cccagagatc aaggacatcc     88380
     ctgttatcgg acacattgct aagggcaatg tgtctgtaga aaacctgttg gctttcaacc     88440
     cagatgttgt ggtgatgacc cttgaccaca agaaggcagc cgagcaaaat ggcttccttg     88500
     ccaagatgga tcaggctggc atgaagtacg tgtttacgga cttccgccag aagccactgg     88560
     aaaacaccac caagtcggtg gaggttttgg gtgctgttct tggcgagcag gacaaggcaa     88620
     aggaattcaa cgagttctac accaagaagc gtgacgacat catcgctcgt gcaaagaagc     88680
     tggaaaacaa gccacgcacc ctgctgtggc gtgctgctgg tctgaaggac tgctgcaata     88740
     ccgtaaagaa ctccaacctt ggcgatttgg ttaacgctgc tggtggcgtg aacattggtg     88800
     acaccttgat cgataccgag tccggcgacc tgaccgctga gaaggttatt gctgagcagc     88860
     cagaaaagat cattgcaacc ggtggcgctt gggcgaaaga ccccaagaag cctgaggttc     88920
     ttcctcacgt tgaattgggc tacaccgcta ccgatgatgt agcagagcgc accctcgaag     88980
     gcctacttaa gacccctggc tttagcgccc tggaagctcc taagaagggt gacctgcacg     89040
     cggtattcca ccagttctac gactccccat acaacatctt tgctcttgag cagttcgcac     89100
     agtggttgca cccagaagag tttaaggatc tggatgctgt gaaggacttc caggagttcc     89160
     acaagaagtg gatgccattt gaattctcgg gcgtgttctt tgtaaccgac aaggttgaag     89220
     ctaagtaaat gagcaacgta gtcgagcagt atcacaagcg ctcacgacgc aaactcttag     89280
     cgattgtgat tctcacagtg ctggctatcg cggcattcgt ggtggccact gtggtggggc     89340
     cggtgaatct tactccggcc accatgctga agggcattat tcagcccgat agtgttgatc     89400
     ccaccacacg tactgtgttg tggaatttac gcctgccggc gtcggttatg gctgtgctga     89460
     ttggcgctgc gctgtcgctt gctggtgccc atatgcagac cattttggat aatccgttgg     89520
     ctgagccctt tacgctgggc atttcggcgg cggcggcttt cggcggcgcc gcgtcgattg     89580
     ttttgggctg ggtgcttatt ccgcatgcgc agtttaattt ggctgcggtg gcgtgggcgt     89640
     cgtccttggt cgctgtggtg attgtggctg gtgcttccgt atggcgtggt gccggcgcgg     89700
     aatcgatgat tttgctgggt attgcgctgg tgtttttgtt ccaggcgctg ttgtcgttga     89760
     tgcagtatcg tgccacgact gaggctttgc aacagatcgt cttttggacg atgggttcgc     89820
     tgcagcgtgc aacgtggact gctaatgcga tcattgcggt gatgttggcg attgcgattc     89880
     cgtacacggt ggtcaacgcg tggcgtttga cggcacttcg gcttggcgac gctcgcgcgg     89940
     ccgccttggg cattaacgtg acaaggctgc gcgtggtcac ccttgtggtg gcgtcgttgt     90000
     tggcagccag cgcggtggcg tttgctggca tcattggctt catcggcttg gttggccccc     90060
     acgtggcccg cattttggtg ggcgaggagc agcgcttctt cgcgccggcg tcgatggcag     90120
     cgggtgcatt cctgctggct acggcccacg cggtgtctat tacgatgatc cctggtgtgg     90180
     cgcttcctat cagcattatt actgcgctgg tgggcgttcc gttcttcgtg atcttggtgt     90240
     ttactcgccg ccgcgcaatg tgggggtcct agcatgagct tgagtatttc tgacctgcga     90300
     gtctcctatg gtcatggccc gcgcatgcgc catattttga atggtgtgag ctttggccca     90360
     gtgccactag gaacggtgac gggcttgttg ggccctaacg ctgctggtaa atccacgttg     90420
     attaaggcca ttgctggttt gaaggccacc tcgggtggca cgcgcaccat catgagcaag     90480
     ggtgcggagg tgccgcatca tgagctgcgc aatgtggtgg gctatgtgcc gcaggatttg     90540
     ttgaccagtg cgtcgttgac ggcgttcgag tcgattttgg tgtccgcgcg taagggatac     90600
     gatccgctgt tgagctctgg ggcggtgatg gaacgcttgg gcattactgc gctggcagat     90660
     cgttacgttt cggagttgtc gggtggccag cgtcagctgg ttgcggtggc gcagatgttg     90720
     gtgcgtcagc cggaggtttt gcttctcgac gagcccacgt cggctcttga cctgcgccac     90780
     caggtggagt tgctcaagtt gctgcgtgct gaggtgaatt ctcgggattg cctcgctgtg     90840
     gtggcgttgc atgatctcaa cctagcggca cggtattgcg atcatttggt ggtgcttagt     90900
     ggcggccatg tgattgctga gggtgcaccg acgcaggtgc ttacttctga cctgttggag     90960
     caggtctacg ggctgcgtgc ccgtgttctt gacgacgccg gagtgccggt ggtctgtccc     91020
     gtggaggatt aggtctttca cttcttaggc cggcgggagt tgctaggctg gggtgcctga     91080
     accccagctg taaccaccac atccctagga gggatttgat tgtgcgactt cttaagccgg     91140
     cccttgttct cgccattgtg gcgggtatga cgctttctgc ctgcggttct gattctgcga     91200
     caaaagacat cagcgttgca ggcagtgaac tgtccttaga taaaacagcg ctggttgcgg     91260
     attcttctgg ggtggaggtt tcgcaagcgt ttttccctga tgccgacaaa gtagattcgg     91320
     ttgtggtggc aggtagcacc gcgcagcacc gctgggaggg agcacaagag gccattaagc     91380
     gcggggtccc gttgcttgtc gacgactcct ccaacaccga ggccatcaat gccgagatcg     91440
     aacggcttgg ggtaaaagat gtggttcgca ttggtgatcc agcagccgac gcccagcaag     91500
     tggcggccaa cgcagctgct aagaaacaac acaccgagga cgtgatggca cgccagatca     91560
     ctgagctttc tgcagaacac ggtcaccttg atggcggggc agcggtgttg gtatcgaagg     91620
     cgacgtcggc agctagtgtt gctactgcca aagcctccgg cgccaccgtg gaatacctct     91680
     cttcaggtga cccacgtgaa tccgctactt tgcaaaaaga tgcccacgcc aaagtggtgg     91740
     gcttagggcc gagctttagc aaccaagagc gcttccaccg cgcggtagat atgctgcagg     91800
     gcccagaagt cccaggtggc gggcacttga ttttccctga acatcgcctc gtcgctttgt     91860
     atggtcaccc ctctggcggt gcactcggtg tgatgggcga acaacctgct ccggaggcag     91920
     tggccaaggt aaaagagctt actgagcact atgccgccat cgatccgcag accaccaccg     91980
     tgcctgcttt tgaaattatt gccaccgtag ccagcgcgga tcccggccca gacggcaact     92040
     actccaacga agtcaccatt gatgagctgc gtccgtgggt agacgagatc ggtaaagcgg     92100
     gcggatatgc ggtccttgat ctgcaaccag gcagcgcgaa cttcctcgac caagccaagc     92160
     agttcgagga gctgctcaaa cttccgcacg tggggcttgc tcttgacccc gagtggcgca     92220
     tcaacccagg tgaaaagccc atggagcggg tgggaagtgt tgaggccgct gagattaata     92280
     gcacggctga gtggcttgct ggccttgttc gcgataataa cctgccgcaa aagccctttg     92340
     tggtgcacca gttccagtgg cagatgatcc gtgatcggga gcagcttaat accaccgccc     92400
     ctgagttggc gtggattctg cacgctgacg gtcatggtcc ggcgcgcgat aagtttgcca     92460
     cttgggagat ggtgcagcag gatctgcagc cggagttcac tatggcgtgg aagaacttta     92520
     ttgatgagga caccccgatg tttaccccag agcaaactat ggatatttat cctcgcccag     92580
     ggtttgtttc ttaccaataa ctgtattgtg gtgggctatg gctactcgta ttgctgaacc     92640
     aggcgagccg atcatcgagt tcttcgctga ttggctcgac gggatttcta atcccaccaa     92700
     ccgtgccatc gccgagcgga ttctggcatg ggtgcacgaa gaattccctg acctgggcta     92760
     ccgttttgcg tggaaacaac ccatgtttac tcaccacggc acgttcatta ttgggtttag     92820
     cccagcgacc aatcacattt cttttgcccc tgaacgcgca ggcattgtga aatgggagcc     92880
     gcagttgaaa caacgagggt tgtcttacgg gaagatgatg gtgcggttgc cgtgggatca     92940
     gccgattcct ttcgatctgc tgcgcgatgt gatcgccttt aacatcgacg ataaacgcga     93000
     tgtgacaagt ttctggcgca agtaatacag gaggatatga tggctcgctc agtggtggtg     93060
     tggttccgtg acgatttacg cgtccacgat aatccagctc ttatgaaggc atgggagctt     93120
     gttcgtgcca accctgcgga cttgcatgcg gtctacattg ccaacgaggt gggggttcgc     93180
     ccccttggtg gggcagtcaa gtggtggctg caccacagcc tgctggcatt gtctgagcag     93240
     ctggcgcagc gtggtgtgcg tctgcatgtg ctctccggtg acccactcac gctgttgcca     93300
     cagctagtga cttcctgtgg tgctacagcg gtgacgatga atcgtcgcta tgatcccgca     93360
     gcacgcagta ttgatgatgc attcgtcgct gatgccagtg cccacgatgt ggaggtctac     93420
     gacttccctt gccatctgct ggcagaacca ggggagatca ccaccacaac cggtggcagc     93480
     tacaaggtgt ttacgccctt ttcccgtaac cttcgcgacg ccatcggtga cctgccctta     93540
     gatacgcttg cggcaccacc caaggccgaa cagcccatag acgacacgga aacccaggcc     93600
     gcgattgcgg acttaggctg ggacgcatgg tgggctgcgt cgataagcaa ggcgtggacc     93660
     ccaggtgaac ccgccgcccg cgaagccctc gccgagctcg acgacatcct cccgcgctac     93720
     ctagacgacc gcgaccgccc tgacatcgac ggcacttcta ggctaagccc gcgcctgcgc     93780
     ttcggggaac tcagcgtcgc tgaggtgtgg aaccatgccc acacctcgga ggggttccgc     93840
     cgccaactca tgtggcgaga tttcgcctgg caccgcctcg acgcgcaccc cgacatggcg     93900
     accgccaaca tccgccccga atttgaccac ttcccttggg acggcggtga cttcgaagcc     93960
     gaactgaacg cttggcgtca tggccgcacc ggcatcgcgc ttgtcgacgc cggcatgcgc     94020
     gaactatggg ccaccggaac catgcacaac cgtgtgcgca tggtcgccgc atccctgctg     94080
     gtcaaaaacc taggaatcca ctggcggcac ggcgagcaat ggttctggga caccctcgtt     94140
     gatgccgacc cagcgtccaa ccccttcaac tggcaatggg tagccggcag tggtgacgac     94200
     gccgccccct acttccgcat cttcaacccc gatacccaag cgcgccgctt tgaccccgac     94260
     ggcacctacc gcacgcgatg gctgcccatc atgagcgcgg actatcccga agaggcgatc     94320
     gtagacctta aagaatcccg acttcgggct ctcgacgcct ataacgcttg taaacgctga     94380
     gtaatcagat aggttaaggg gtatgagaaa actgtattat gcctcgttaa cctacctcat     94440
     tctcgggctc gtagccgggg tgttctaccg tgaatggacc aaggtgttca acgccgtgga     94500
     ccgctctcaa ctcaacacct tgcacaccca cctcctcgtg ctaggaacct tcttcttcct     94560
     catcgtctta gcactcgaca agatgtttca cctctctggc caaaagaaat tccagcagtg     94620
     gttcatcttc cacaacgtgg ccctagcatg gaccaccctc gccatgctgg ccaacggcat     94680
     cgtagctacc agcggcggca tgtggggccc agcccaatcg ggtatcgctg gcatgggcca     94740
     catcctgctc accggcggtt tcatctggtt cttcagtatg ctcaacaccg ccatcaagcg     94800
     cagcgaagct aaccagaaat aaactgctcc agctccgcgc gggcagcctc gtcgcgcatc     94860
     tggcgcggcg gggacttcat caaatacgca gccgctggat acaccggccc accgataccg     94920
     cgatccttgg cgatcttcgc cgcacgcagg gcgtcgataa taatgcccgc agaattcggc     94980
     gaatcccaca cctccagctt gtactccaga ttcaacggca catcgccaaa cgcagtgccc     95040
     tccaaacgca catacgccca tttgcggtca tctaaccagc ccacataatc cgatgggcca     95100
     atatggacat cccgagccgc aatttcttga tccaagttcg acgtcacagc ctgcgtctta     95160
     gagatcttct tcgactccaa acgctcccgc tccaacatgt tcttaaagtc catgttgccg     95220
     cctacattca gctgcatcgt gcgatccaaa tgcacaccac gatcctcaaa caacttagcc     95280
     aaaacgcggt gcgtaatcgt ggcaccaacc tgcgacttaa tatcatcgcc cacaatcggc     95340
     accccagcct cttcaaactt ggcagcccac tgcggatcag aagcaataaa caccggtagc     95400
     gcattcacaa atgccacgtt ggcgtcgata gcacactgcg cataaaactt atccgcctcc     95460
     tccgagccca ccggaagata ggagacgagg acgtcgacac gctcatcctt gagtacctgc     95520
     accacatcca ccgcctgggc aggggactcc tcaacggttg cgcgataata cttgcccaaa     95580
     ccatcaagag tagggcctcg ctgcactgtc acacccgtct ccggcacatc gcaaatacgg     95640
     atcgtgcagt tctccgaggc attaatcgcc tccgacagat ccagccccac cttcgcgcga     95700
     tccacatcaa acgcggcaac aaactcaata tcgcctacgt gataatcccc aaactgcacg     95760
     tgcataaggc ctggcacctg ctgatcaggg gacgcatcct tgtaatactc cacgccctgt     95820
     accagcgacg atgcacagtt gcccacaccg gcaatggcaa cacgaatagc agacacacat     95880
     actcccttgg ctttgataac aaccgaacat aagcttcacg acgtacccac tgcgggggag     95940
     gcccacgggt aggtgctgtc gtggatctcg gccactatac cgccggtgtg gagcattaaa     96000
     actgctggtt aatcggttaa gtaaatcggt acagatggat catgcagcta caaaagggcg     96060
     agaaaattac tgctaaaaat accaaaagcc tccccacttt gagggggagg ctaaagatga     96120
     tgctaggcca ccgcgccgaa ggcataaccg gcaccgaaag tcagtgccaa gccgagaatg     96180
     ccaccgatgg tcaggcgcag tactgacttc acaggcgagg tgccgccgat gtgtgctgag     96240
     acatagccgg taatagccaa ggccagcaag gtgacggcag ttacggcaat cgcgccggcc     96300
     acgcgggaga gatctgggat caagaagacc gtgagcagtg gcagcagcgc gccgagcagg     96360
     aaggatgctg ctgaggatac cgcagcatga agtgggctgg tgaggtcatg gggatcaata     96420
     ccgtactcga tttgcaggtg ggcacggaag gggtcgttgc ggccaatctc aatggcggca     96480
     cgatacgcag tggcagtgct catgccgtag ttttcaagga tcccagcgat ttctgcgcgc     96540
     tcttcacctg gagcgtgcag aagctcgttg tattcctgct ccatgacctt gtgctcgttg     96600
     tcgcgctggg cagacacgga cacgaattcg cctagtgcca tggatacggc gccggcgatg     96660
     gtggctgcca caccggaaag cagcactgtg gaagtgctgg cgttggtagc gatcacgccg     96720
     agcagcaggg cagagatgga cacaatgccg tcgttagctc cgaggatgcc ggcgcgtagc     96780
     cagttcagct tggagttgag ccccgatact gccactgggt ctatggcttg gcccgtggag     96840
     gagagggtcc ctggcaatgg tgggaaattc ttttgcgtca tcgttgccta ccttgatttt     96900
     atggtgcgac tcggtgtcgc ttgggcttca ttgtgctgct attttcagta gcgaacaagg     96960
     attgaaaccc tatccttagc tggggatagt tagcctttcc actctttcta tctctgcaat     97020
     gacgaggcgc cgtactcgcg gatcgtgggg catgtcctcg tgcaaaatga tcgcgtgctt     97080
     agatactgct tgcgcataaa tattgcgcac aagttttcca tggaggaagc aggattctac     97140
     cggctggata atggtgtcgg aacgggtggc aatgcagctg taatacacgt acggcagggt     97200
     gtcgccatgc tcattgagct gcgcaatgag ctcgctatcg tgcagcattt caaaaccact     97260
     agctccaaaa aatccggtga taagggaatc gatcactgcg gtaccacgcg gtgtgcgccc     97320
     cagcgggctc atcattccgc cgtgggaggt gccgtggtgg gggaccgcaa gtgaaatgag     97380
     gtggcttact ttgtttgcgc cgtcgaggtt gtgcatccaa tagcgtgcca aaattccgcc     97440
     ttgcgaatgc cccaccacaa tcgctttctt ggccttggtg acggtcaaaa cggcgtcgat     97500
     atatgcgcct acttgggccg cggattccgc tacggctgcg gtggagcgca tcccaaaatc     97560
     cggtgcccac acggcgtagc cgaggctgcg aagcgcgtgc ccgagctcca tccaatcgcc     97620
     tttggtgact cccgttccgt ggatcaggat gacgggatag gggtggcgtt tcgacggccg     97680
     atcgcgccag tcgtcctcga agattccacg ggctggcagg cgggcagaaa gcggcaggtg     97740
     atgctggaca actgccatgg ttttctcctt gtactatcag tgcgtgtgcc tttactgtta     97800
     gtgtaaccac accaataata gtgatttatc aacaagcctt gaaaggataa tgcaatgtct     97860
     ttgactgttg cagaagctat cgcccaacgt cgtgccgtac gcacctacac cgaccagccc     97920
     atcccggacg atatccttga tcgcgttgtt gcccaggccc tcgaagcgcc tactgctttt     97980
     aacgcccagc gtgccgacgt tgtggtggta cgcgatcagg ctgtcaagga tgcccttttt     98040
     gcagcttcca agcaggcgca gcttcgcgac gctcccgcag tgctcgtgat cgtcgcccgt     98100
     gccgatgccc ccaccgacct gcccgagctc ctcggtcccg accgcgccgc ttatgccaac     98160
     ggcttctttg cgcgtctcga cgcagccgct cttcgtgaaa ccgcgctgaa agatgccatg     98220
     cttgtcgcag gttttgccct cattgcagcc caaggcgaag gtcttgctac ctcgcccact     98280
     actggctggg atgagtccca ggtcctcgag gctgtcggac ttggcgggcg tgatgaccgc     98340
     gccgtaggac ttgtcatcgc catgggctac cctgccgagc agccactcca ccctggccgc     98400
     gaggcaagcc gccgcgtcaa cgatcactac taaaacgtta tgtccctttg atccatcggg     98460
     ttcccgatcc tcgttgtggg cctgaaggat caatgtgtgc ttttccagcg cgtcgtaaat     98520
     tgcggagaat ctcggtgatc tcgggacgtg gcatgcctat gctctctgca atttcggccg     98580
     ctgaaatcgg ggaaccggag ctgagctttt cttcaaccca tgtttggact gacgattgcg     98640
     ggattgtctc tgactgataa taattggtag tttttcgagc tttttcgctg agaaaccatt     98700
     catccgtgtt gtgaatttgg gtgagaagac cattgctttc aagagcaaac attagctcgg     98760
     tagcttcttt tgaggatgtc tgagtcttca cacgagcttg tttgagcgat atgacaggag     98820
     aagtccagag gtgccacagc actatgagag tgttgacgct atggagcatg tctgggttga     98880
     aactgagact gagctcatgc agtgctttga taaaactctc gtctggattt cctgaatgaa     98940
     ggataacttc gacaaaagtg tcctcggtat gaacatccgg aatatcacga ccgctgccta     99000
     atagcgcagc ccatattcgg tcgaagccac gagaagattc ttctgcgagt cccaacattc     99060
     tcatcgctga catgagtctg ctgtttcgtg gaatagattg agtcgtcaac aggcgattgg     99120
     gggtaacgcc tacagggagt gatcctggtg accaaacttt taatgtttga ggtgattggt     99180
     caataactac tggacgacta agtcgccaat ctcggtgaat gatcgcattg gtaacaacct     99240
     catcaacagc agtttgaggg aaagctgaaa ctgcgatttc ttggccatcg gaaaactgga     99300
     tgcgctttat ttccttgttt gcattttcag taatgcgacg cttgagtgaa ctcaatgcga     99360
     tgaggagtgg ttggttgtag tcggttactt cgggatcgat acccggaaaa gagcgccaaa     99420
     agtggcgaat agagagttga ccctctgggg caggtaagag gaggatagct ccagcacgtt     99480
     ttagtgctcc atagttatct attagaccaa gctctcgcag taagccgttg gtggtggtag     99540
     gtaatgacgt atcgatacca gactgtgcac gtttggtctt taaaagtctc cggacctctt     99600
     ggatggtatc ggccgcaata tcatcgacgt tgaactcgga gattccattg gaatagtcag     99660
     cgtgtgctcg ggttgctgca atagctcgcc gttgttcttc ggatagcggc tcgcaatgag     99720
     aacctacgcg tttactagtc tgccctttgg agcgtgaata tagggagagt gcctcgggga     99780
     tgtagataac gatgagccga ttattttgat aacgaacttc atgaacctcg ggacgaagat     99840
     ttgggcgagt gccgtcgaag atcttcttgg cgattttttc ggtgtcaaat gtggttccag     99900
     taaaggcttc cggacccccg attttatctt taattccaac cacaatatgt ccagtgccgg     99960
     catccccatt ggcaaggcat actgcctcat caatgagctt ttcaatcaaa gccgcttgtg    100020
     gattgccatg ctgtttcccc cgacctgcgc atgatgggtc ttctttgaat tccaaagttt    100080
     ctgattccaa agaatctgca atggatcctt cccagatggc atctagtgca ttcatgacat    100140
     gagcggggag ggatgtgagg gaaacttcca tgaacaaagt atacattttc ccagcaagtt    100200
     gttttatgcg gtggcagttg ttgttctaaa caacttgtca acaacttttg ggtgttatgt    100260
     ggggtggttt tacttgtgtt ttcgcagcta ggagtagttg tttcgagttg ttttaagttg    100320
     ttgggctgtg gatgggaaat gtgtggaaga tttccataat tttattggct cttccggttt    100380
     tagagtgcat tgattaattc gccggaggtt cggacgtggc acaagatact agggttcttg    100440
     actttgtagg aaaaaggggt gcctaaacca tccatctaaa accaaggacc tattgtgcag    100500
     cctaacggaa atgccatcgg cgataccatc tgccgcaccg cagaacacag tgatagttac    100560
     cgttattgaa gccgagcccg tcgagccatg agcgcgctca ttgacacgct tgttggcatg    100620
     aaagacgctg tggtcgctga gatcgtgcag ctaggcagga ctatgaacaa gcgccgcaag    100680
     ggcatcctcg cctacatccg acacacaatc aatgcactct aaaaccggaa gagccaccaa    100740
     acgggggtat ttcgaaggat ttttctcaga acttcacacc aaatcgcttc caaaccggcc    100800
     gtttgagcag atttggtgtg aagtgccgtc ttttcggggg tgagcggggg tggcgcgccc    100860
     accaacgccc accaacacca cccaatccca gccaagccat ggttgtggaa aacgtcctgc    100920
     tccgcgtagt gccacgcccg aacccccggc gaactaatca atgcactcta aagccggaag    100980
     agccattttg tggagttttt gcaggtcaga gatttaaggg gagttgggac ttgtaaaaac    101040
     tatcgtctca agttgtttta tgcggtggca attgttgttc taaacaactt gtcaacaact    101100
     tttgggtgtt atgtggggtg gttttactag cgttttcgca gctaggggta gttgttttaa    101160
     gttgtttcga gttgttttaa cttgttgttg cgtgcctact gggttgatcg agggcttctc    101220
     ggcatagtgt tgtagctatg actggtccac ttattctgcc gtttaatggc aaggttccgc    101280
     gtgttcatga gactgcattt attgctccga atgccacttt gattggtgat gtgacgattg    101340
     ggccctatgc ttcggtgttt tatggctgtg tgttgcgggc ggatattaat tcgattgttg    101400
     tgggggcgcg tacgaatatc caggataatt cggtgttgca tgttgatcgt gacgctgcct    101460
     gtgtgctggg tgacgatgtc acggtggggc acatggcgtt ggtgcatggt tccactgtgg    101520
     gtgatggcac gttggtgggc atgcatgccg cgttgttgtc gcgttcggtg gtaggtgctg    101580
     gcagtttgat tgctgctggt gcggtggtgc tggaggggca ggtgattcct gtgaagtcgt    101640
     tggctgctgg ggtgccggcg aaggtgcgtc gtgagttatc tgatgagcag tcggctgggt    101700
     ttattcccca tgctggccgg tatgttgagg tggcggttca gcatggggag ttgggtgctc    101760
     cgctgagtgt ggaggatgtt cgcttccgtt aacaggatgc gaggatgcgc tttgccagtc    101820
     cgagtgggtc ttcgatgagg tgatcgaggg ctactgctcg ggcggcggcg cgtgcgttgt    101880
     ccaggtgggt ggggaagacg cggatttcta tgttggggtt ggtgggggaa gaacgtagtg    101940
     ctttgcctac ggtccgggcg tcgtcggggt tggagaacgc ggagcctgcg agcacgatgc    102000
     tgttgggggc gtgttctgcg acgaggtgga cggctgcttc gctgagcagt gcgacgtcct    102060
     ctgaggaggt gtcgatggga acggtggtga tgctgtcggg ggtttgtagt gctgcaccgg    102120
     tggagtcgtc ggcgtagaag atgagggtgg tgctgggatg gttggggtct tgtgcttgtt    102180
     gttccgcgcc ggcgatggcg gtgatcacgc tggtgacggc gatggggacg gggattcgtt    102240
     tgtagagtgc gctgacgatg tcgaggcggt cccatccgag gttggctgcg gtgacgagtc    102300
     cggtggggga tactcggccg gagctggaga ttccgatgct ggctagtggc agttcggaga    102360
     gtgtggtgag ctcggtgatg gcggttgtga tggcgtcgat gtaggtatcg atgcttgtcg    102420
     acgccggccg gatctcaatc atcttttccc gtagggcgat gcctcgggtg ttgtatgcgc    102480
     cgatgtaggt ggcgcgggtg cctactgcga cgccgatgtg aacccaaggt gaaggtgcga    102540
     gttcgatggg gatggtgggg cgccctggtc cttgagggat ggagaggtcg gggcgttcgc    102600
     gaacgaggtg cgcttccatg agtgcggcga ctgcgcgggt gacggttggt tgggatttac    102660
     ctgatccgtt gaccagtgtt gcccgtgtga ctggttggag gtggcggatg aggtgcaaac    102720
     atgaggcagc cggggaagtg ggcttagtaa aggacggcgt gttcctcagt gttctgcggt    102780
     tcggcatgtg tcaaatttta ggggttcgta gaccagcttg tctaaattag acggtgttca    102840
     aaagtttgat aaatagatgt tttgaactgc aaatatgctt taaatgcggt gcccctatag    102900
     accgatcggt acgcctaggg gtatatggcc gagaagaaaa acaaaaggtg aaagtgcact    102960
     ttttatataa gcgttatgag gttacatctc ggcgacaagg atgaatatat tcccgacata    103020
     ttgggggtaa cgggggtgaa tttcataacg ttgaaatata gacaataaaa atattgaact    103080
     ttagggaact cttgccttat tgctgccgac aactactgcg ttccattgcc acaacccatc    103140
     acggaaagct gtttatggtt gcaacttaca caccgtccgc cgagaagcag gaagcgtcga    103200
     cacgcgcttt gccccgccac ctgcgacgac tacacttctt cgcaggcatc atctgcgcgc    103260
     cactcatctt catcgcgtcg ctgaccggcc tcggctacgc cttcggcccc agcctcgata    103320
     aggccgtcta ctccgaagcc atcaacgtca cacccagcgg cgatgagcta ccgctagaac    103380
     gaatcgttga catcgcccgc gccacccacc ccgaccttga actcgctggt gtgcgcgtag    103440
     gcaaccccga ccaagccacg cgtgtgatgt tcaacgaccc caccttgccc aagagcacca    103500
     cgcaggcagt ctttgtcaac caatacaccg gcgacatcac cggcgacatg ccgcaatacg    103560
     gtggatcggc cgcacttccc atccgacact ggctctcact cggacaccgc gatctctggc    103620
     tcggcgaacc tggccgcctc tactccgaaa ccgccgcatc gtggctcggt gttctcgccg    103680
     tcagtggcgt gtacctgtgg tggaaacggc agcgcaaagc tggccgccta gctgccatgt    103740
     tgcgtatcga cggccgcggc cgcacccgga atctgcgctg gcacggagca atcggcaccc    103800
     ttgtggccgc cggcatgatc tttttgacca tcactggctt gacatggtcg tctgtagcag    103860
     gcgacaacat tcgttcggta cgcaccgcct tgaactggac tacgccgtcg gtaagcacgg    103920
     cgctcggtgc ggcggccgag caaacccccg ccgaccccca cgctgagcac ggcggacaca    103980
     gcggacacca tgcgcacatg gcagctctgg acgtatctga gcaggcacaa cgcgtagcaa    104040
     ccaccgctgc cggcgaactg cgcaccccct ttaccgtcaa gcccccgaag gaagacggcc    104100
     acgcctggac cgccgcggaa gaccgcgttg cttaccgcct cacctacgac gccttggctg    104160
     tcgacggctc caacgggcag gtgaccgacc gtgtggactt tgagcagtgg tcattgccca    104220
     caaagctcac tgcctggctg atcgaattgc acatgggcac cctgctgggc gtacctaacc    104280
     aaatcgccct cggtctgttg gctattggcc ttctcatcct cgtggtgcgt ggctacctgc    104340
     tgtggttcca gcgccgtggc accgcgtggg ttggtagcgc tccggcgcgc agtgtagacg    104400
     gtgtgcgcgg atatggcgca cttggctgga taggcgttgc tgccatggtg atctatggcg    104460
     tggtggcacc cctgtttggt gttacctgcg tggcgttttt gatctgcagc atgctgaaga    104520
     agtgaagtga gtagttcgtg ccaaaacttt ttgaggctcg cagcgtttcc gcaggtcgga    104580
     gatataagaa aagatgcaat ttggcacgaa ctactcactc gcaatcatca cggcagttat    104640
     tacacaatcc tcgtagtgcc ctagactgtg ttcacatgag cttttcccca gaactgcctg    104700
     actttatgca gggcctcggc gtgtccgtcc atgccatgac caacgccgat gtccccgcgc    104760
     acacggactc cgttttacgt aacctgaatc gttttgagca gcactttacc gccgacgatc    104820
     ttgctgtagt gccgttgtcg gagtacacct tttttaacga ggggcgtggc gatattggca    104880
     tcgtggtaca agatgcctct ggtgccgtcg tgggtaccat gtgcgtgcag tttattaaag    104940
     gactggccta cctcaacccc gctgtgcctg agatgacgct tcgtttggat gaagcgtggc    105000
     gcgggaaggg gatcggtggc tggttgattg agcaggcaac cgagtatggt cgtttgaacg    105060
     gttggcctgg tattgcggtg aatgtggaaa agcagtcgcc agctcgtcgc ctttatgcgc    105120
     gccatgattt cgctgctcag gaccgtgagg ttgaatatgg tgctatcatg ctgaagacct    105180
     tgagtccgaa gattcgtagt gttgctgtgt attgtggctc tgctgtgggg gagcgacctg    105240
     agtatgcgca ggcggcgcgt gagttgggta ctgcgttggc gcagcgcggt atcaccatgg    105300
     tttatggtgg cggcaggcca ggtctgatgg gtattgctgc cgacgctgcc atcgctgcgg    105360
     gtggcaaggt gcatggtgtg atgccgcatg cgcttgttga tctagagcag gcgcatcctg    105420
     gtttgagtgc gcttgatatt actgacacga tggcgcagcg taagacgcgc atggaagagc    105480
     ttgccgacgc ctttgtggtt ctgccaggtg gtatgggcac tatggaggag atgttccagg    105540
     tgttggtgcg tcagcagcta gggccgtatg cggggccggt ggcgttgatg aatattgagg    105600
     agttctggga tccgtttatt gctgcattgc gcacaatgag tgaagagggc tttatttcag    105660
     agcgttatat tgatgcgctg gtgatggcga aagattctga ggagcttttc caaggcttca    105720
     gctcgtgggt gaaccctggt ctgaagtggc tgtccgacta gactgtcgag gcatgaatag    105780
     cccacggatt ccttctgttc tcgacgcctc ctgtgaggcg tatgtgtacg atcttgctgc    105840
     tatttctccc accgatgcga ccgcgtgggg gattagcggc tatgacgatc aactccaaga    105900
     tttttcccca gcgtattggg aaaaagttgc agaccagcat cgcaaacttc tgaacgccat    105960
     ccctgcagaa gacaccctcg actcggttga tcgtgtcacg gctgctgtgt tgcgggatcg    106020
     cctcggggtg gaattagaca ttgacgcagc tggcgacaac ctagcaaagc tcaacaatat    106080
     tgagtcgcca gtacaaacca ttcgcgacac cttcttgctc atgccgcagg ataccgacga    106140
     gcagcgcgat gccattgccg cgcgcctgac tcacctcccg cgcgcactgg ccggatataa    106200
     ggaatccctg caggtggctg ccgcagcagg cagggtagcg gctgcccgcc aggtacagtg    106260
     tgtgatcgaa caactcacgg agcttaccca gccgcaatca atgctgacgc agctgggcgt    106320
     atcgggtgcc gctgtggagc acgcgcaggc agcctgcggg gagatggcgc agtggctgcg    106380
     caccgaacta ctacccaagg cacctgctga ggatgccgtt ggtagggagc gctaccagcg    106440
     cctaagccac ctgtttgttg gtgatgtagt agaccttgac gacgcctacc tgtggggtca    106500
     agagtgcctg cgggagatcg tcgataagca agaagccatc gccgccgaac tctacggtgc    106560
     tggcaccagc gtcgccgacg ccatgaaacg cctcgatacc gaagagcgct acaccatcca    106620
     cggcgtcgac gcactccaac aatggatgca aaaccaagcc gaccgcgtaa tcgccgatct    106680
     caacggaacc cacttcgcca tccccgaacc ggtacgcacc atcgaagcca aaatcgaccc    106740
     cgccggcacc ggaggaatct tctacacccc accatcagac gacttcactc gcccaggacg    106800
     catgtggtgg tctgttcccg caggtcaaga agaattccac acgtggcaag aactcaccac    106860
     cgtattccac gaagcggtac caggccacca cctgcaatgc ggacaagcca cctgcgaacg    106920
     cgacaacctc aacctatggc gacgcgtagc ctgctggaac tccggacacg gcgaaggctg    106980
     ggccctctac gccgaacaac tcatggccga actgggatac cacgacgacc ccggcaccat    107040
     gatgggcatg ctcgacgcac aacgcctccg cgccgcccgc gtcgtcctcg acatcggcgt    107100
     gcacctgcgc aaaaccaccc ccgacggcgg tgtatgggat gccgcctacg cttgggactt    107160
     cctacgtgcc aacgtggcta tggacgagaa gaacctcgcc tttgaactcg accgctacct    107220
     cggctggcca ggccaggcac cgtcttatgc cctcggccag cgcctctggc aagacctacg    107280
     cgacagtgcc gtcgcacagg ggatgaccct gccggaattc cacagccgtg cgctggcgct    107340
     ggggtctatc cccatgtcga ttctgcgacg tgagatactt cgctaaccca tgatttccac    107400
     tccacctgtt gcgcgcaata taatgcggtg tatgtctgac caactgaaac tggaccagca    107460
     gatctgtttc cagctgtaca ccggatcgcg tctcatgcaa cgaatgtacc gcgtctactt    107520
     cgaccagtgg ggaatcacgt actcccagta cttggtccta ttgctgctat gggaaaaaga    107580
     tcgccagacc atcagcgaac tgtcagaccc cctcgaccta gacagcggta ccctctcgcc    107640
     actactgcgg cgcatggagg ccaacggttt tattacccgt gaacatgaac aaagcgacta    107700
     tcgcaaagta gtcgtgtgcc tgaccacccg tggtcgccgg ctgaaaacca aagccaaaaa    107760
     aatgaacgac gagctcaacg acatgctggg ctttgacgac gccgacctcg ccgccgtcac    107820
     ccgcgtccta gaaaagatca acccctccgc agcaatctaa taagctgcgg cagccaccct    107880
     gccagcaaca acacacacaa caggcggata atctgcacgg ccaccacaat cgggccagca    107940
     ccgccctcgc tggcaagggc taggaccgtc tccaagccac cagggctggt agccaaatac    108000
     gcgtcaaaat aatccacgcc catggtcgca gccaacggcc acgccgtaag cgcacaacca    108060
     cccaacaaca ccacgataaa aatcatcgtg gcaggtactt ggcgtgcaaa aaacttcaac    108120
     gcagccaccg ataacccacc gccgcacatc caaccgatgc acaaaaacgc aaaaatgcgc    108180
     accaccattg gcggagtgaa atccacatgc ggcaacaccg cactagcagc aacaataaga    108240
     agcaacggcc ccagaatcga cggcaccgga atccgcaaca ccgccgcaag acgatggccc    108300
     accaccgcaa tcacacacac aagcgcaagc gcccaccatg gctggtcgtc acgcggggta    108360
     accacatggt ccaaacccgt cggcgcaatc atatgagcca cgagcggcaa cgacatcgac    108420
     accgccacca ggcgcaaata ctgcgacaat gccacatagc gaaaatccgc gcccagatcc    108480
     tgcgccaaca ccggcatgac cgacgcccca ccagccaaca tcgacaaaat gcccgtctct    108540
     tgagaaagca acggctgcgc ccgcgccaac accatgccac ccacaatgcc aatcgctaac    108600
     gtgacaaacg tgaccatgag gccaggcagc acgtagcgtg ccagcagcgc cgggttcgca    108660
     gtagctaacg gcaaacccgc gagaattcca atgaagccgc ggccgaggtt aaacacctcc    108720
     ttgtggatcg gtagctccgt gccgctcaca atcgccatcg tggccgatac aaaaatcgcg    108780
     ccgagaatcc atgccgcagg aacatgcaac atgctgaaca catatccggt tgcagccgag    108840
     gctggaacca ccagcagcca tttggcggca acactgctat tccatgccac tttgttagtt    108900
     cacagcctca taggaatcct gggtaatcac cacgcccttg ccatcaggcc tgctgatttt    108960
     tatcgaatcc ggtgccgagg catcgatcgt ccaccctgac tgcggatcgc cgaccacata    109020
     gcggtgctct ttacccaagc gtgcaaaacc ctgatcgcgc accggtggct gcttacccgt    109080
     tgctgtgacc gcaaacggct ccgcctgcat caccacagtg gtggcctgct cgtgggcacc    109140
     ttcggtgttc ttccacgtgg taacaaactg cagcggtgaa cactgggctt gggctggggt    109200
     gaaatcacaa gcaaggtcta catcgctgct aagggctacc acatagccgc cgggctgaat    109260
     ggtttccggt gccgcctgct ggaccgaccc agccgacgaa caaccacaca cccccagtgc    109320
     caccgcagta gcaatcgcgg tagtagttac agtggcctga caaacggtag tcaatctcac    109380
     ggtgctcacc tccacaagct tggttacctc cgagcgtagt gtgtaaccac gaacaacgct    109440
     gacagggcgc agaagacgaa caaaggacaa cacccccatg gatctaggac taagcggctg    109500
     ggcgatactc acctttgggg cggccgccgc cggttgggtc gacgctgtca ttggcggcgg    109560
     tggattgatt ctcatccccc tcatcatggc cgtagcccct gggctattac ctgcaaatgc    109620
     gctggccaca aacaaatttg cggcagtcac cggaacattc tccgcggcgg taaccctcgt    109680
     gcgcaaagtg ggcgtagata cctccctcgc gctacgtatg atccccgttg cggccgtggg    109740
     ttcgggattg ggtgcgctga tggcggcgtc gataagcaaa gatgtaatgc ggccaatcgt    109800
     tatcatattg atgcttatcg ccggcctctt tgtggcgctt agacccgatt ttggccaagg    109860
     caacagcact cacaaaccat ggggacgcgc cgtagccctc atcgccgttg ccgccatcgc    109920
     gctttacgac ggcatcttcg gccccggcac cgggatgttc ctcatcatgg cctttaccgc    109980
     cttgctctcc caagacttca tccgctccgc agccctggca aaagtcatca acaccgccac    110040
     caacatcggc gccctctgcg tcttcatcgc tgcaggccac atcctctgga aactcggcat    110100
     catcctcgcc atcgccaacg ttgctggcgc acaactaggc gcacgcaccg tcctcggtgg    110160
     tggcacccgc ctcctgcgcg cagccctgct caccctcgtc gtcgtgatga gtatctacct    110220
     ggcacaacaa cagtggttca acggatagcc aacggatcct ccggccacgg atgcttgggg    110280
     tagcgtccgc gcatatcgga acgaacctgc tggtaggggc ccgcccagaa actatctaac    110340
     gtgtcggtca ccgcaagcgg gcggccagca ggcgacaaca aatgaaactg aagcggacgg    110400
     ccgcacacaa tgggggactc caacaggcca aaacaatcct gcagcttggt gctcaccacc    110460
     ggccggtcgc cagcatagga gatacgggcg cggcgaccat taggcaactc gagtacggca    110520
     ggtgccagct cgtcgaggtg ggtggcctcc ggccacggga gcaagcgctg gagtgcgggg    110580
     tagaggtcga ttcgtgcggc tggggtgccg gcggccaatg ctgagatctc tgggccaagc    110640
     cacaaagtgg ggtcggctgc atcaacatcc ggccacggtt caccgtaata ctcgtgaaga    110700
     tgtcggaggc gatcgcgcag ctcggtggcc ttatcggaga acgtaaacag ctcaaggcca    110760
     tgggtgcgga tcccctcggc gagtgcttgt tccgcgagct caccctcaac tttcacattg    110820
     gttgtgctca atgttattgc gccggcgtgg cggatgcgtg tgccccgcag ggagccgtcg    110880
     ataagcgtag cctcggtgcg ctccgcaacg ccgatgatgt ccacagcagc ggcctcgctg    110940
     ataggggcag ccgagcggat aacactgcca cgatgcgtga gagacgcctg cgccaccgca    111000
     agccactcat ggccagaaag actagaaacc cccagctcag cacgggaacc gcctgccata    111060
     agatagctgt cgccatcgcg acgcgccaca tttttaggcc acgcccgcgc gatcgcttcc    111120
     cctggtgtgc actcagaatc gggcacgaac cccgctaacc gcgccacctc gcgggtaaaa    111180
     cgctgctgat gagacatcgc cgcgattgcg cgaggaatat ccccgcgggc atcaagactt    111240
     agcgccgcaa tcgtcggtgc agccccgccg ccacaatgca gcaacgacgc acccagccga    111300
     ggatccgtgg gcaacgtagc cagcgtgcga ccaagttcag tgatctggcc tgcggcgtta    111360
     agggcgccga tgtcgcgcaa tgtatccacg gcctgctccc atgattgctt cgggggcgcg    111420
     ctaagcagcg gaaactgtgc gggatcagta caaccccacg cggctaaaaa cagtgccgcc    111480
     tgggtgagat cggcggagcg gatttctggg gtgacgtggt cggggaagtg ctgaaactcc    111540
     gccgccgagt acaggcggta cacggtgcct gggccttcac gcccagcgcg tcctgcacgc    111600
     tggtctgctt gtgcctggct ggtgctggtg gtgaccagcc cggtgaggtc acgggcgtga    111660
     tcgcgtttgg gaacacggct taggccggcg tcgacaacaa tgcgcacacc tggcacggtc    111720
     aaagaacttt cggctatcga cgttgccacc acgatccgct gccgaccagc gcgtagcgca    111780
     gcgtcttgct ccgaactagt caactggcca tgcagaggat aaaccggcac ggatgtgcgc    111840
     tgctctaaag tggaaaccgc agtagtcacg gcagcaatgg tggggaggaa tacaagggcg    111900
     gaatccgtga agtgtgccac cgcatgctgg gtaactgtgc acacatgatc catgtatgag    111960
     cggctcagtg ctatgcgctc ggcagcaggc tgataatgca gctccaaggg gtgaatctcc    112020
     gcgtgggttt ccacgatagg tgctgggtgc tctgggctca gtagctcagc aaagtgcggg    112080
     gcatcgacgg ttgcggacat tgcgatcacc gtgaggtcgt cgcgaagctc tcgtagctca    112140
     acaagcatgc caaggacaag gtcggtgtcg agttggcgct catggacctc atcgaccacc    112200
     acggcagaga ctccgtcgag ctccggatta gaaatcagcc tgcgcaacag cacacctggg    112260
     gtgacaaact ccacgagatc gccccgagaa cgctcgccgc gaatggtata ccccacacga    112320
     tgtgtactgg gctgatcgca actgctctgg tcgagctgta caagatgatg ggcggcagca    112380
     cgaacagcca ccctgcgcgg ggccaccacg atcaccctac cgccagttac attgtgtgca    112440
     atgggtggta caagggtggt tttacctgtg ccaggtgggg cttgtaccac cgccatgcga    112500
     tgggtgcgca gggcgtcgat aagcgtcgtg gtggactgtg cgacgggcag gccggcgccg    112560
     ataacagaaa gattaaagct cataagtggt gtgaggattg gtggtgcgta taactcgggc    112620
     ggggttgccg taggcgatgg tgtcgtcggg aatatcgtgg gtgaccacac tgccagcgcc    112680
     gataacagca cgctcgccga tggtgacccc aggtaaaacg atcacgccag cccctagcca    112740
     tgcctgcttg ccgacgacaa tcgggtgggc aatttcccag ccggcggtgc gcatatcggc    112800
     gttgtcaacg gggtgggtga ccgtgatgag ctggcagttc ggtccgataa gaacctggct    112860
     gccaatggtg acctctgcgg tgtcgaggat ggtcacgccg taattgataa aagtgtcttt    112920
     gccaatggtc gtgttaacac catattcaat ggtcagaggc tgtctgatcg tgcagtcctt    112980
     actggcgggg ctgaggatca accggcggag gcgactaagc tcctcggtat gcgctgggtg    113040
     agtggcgttg taatcgaaaa ccaactcggc ggtacgagcc atagcctgcg tgatctccgg    113100
     agataccggg atatgccatc gttgggcgcg ctggtcggcc atcgtggctg gggtatgcgg    113160
     gtctaagctc atgatggcta ggttagtggg tatgccagat cttttcagtg atagcggttg    113220
     gggtagtggt gagctgccac gggctctgcg ccctggtctt gttcacctgc cacgttggat    113280
     ggggttggac cagcagttcg ccgtggtgca gcagtgccgt gagattgcgc gctcggtggc    113340
     aggtactccg cttgcgatgc accggcagca gtgggcgtct ggcacgatga gtgcctattt    113400
     gatgtccttg gggttgcact gggaataccg cacctaccag tatgtttctc agtggggtgg    113460
     ggtggctgtc ccgcctattc ctgtggagtt ttcggcgctg gcgcatgagg ttttgcgggc    113520
     tgctgcgggt gttgacgact cccttgccgc gtgggtggat tcttatcgca ttgatgcggc    113580
     tttggtgaat tattatccgc cgggtgctgg gatgggtatg catcaagatg cgtttgagga    113640
     ttcccgtgcg ccggtggtgt cgttgtctat tggagattcg gcggtgtttc gggcgggcaa    113700
     tggcgtgaat cggcagcgtc cgtggcagga cgtggtgttg gggagcgggg atgcggtggt    113760
     gtttggtgga ccgtcgcgag acatgtttca ttcggtggtg cggctgcacg cgggcacggc    113820
     accgacgcga tgtggggtgt ctcaggggcg gataaatctg acatttcggc aggtaaagct    113880
     atagcttccc cctgttttac ccccgcgtgt tggagggatg ttttagcctc gctgttatga    113940
     acggtatgga tcttatttct tgtgatgatg gtcgggtacg ccctgcgtgg gcggtggggg    114000
     atgcgctgtt gcgtcattat tacgactatg agtggggcgc accggttcat tcggagtcgg    114060
     ggttgtttga gcgattagcg ctagaggggt tccagtcggg gttgagttgg cggacggtgc    114120
     tgcagaagcg cgctgctttt cgggaggttt tctgggggtt tgatgcggat cgggtggcgt    114180
     gtatgacgga ggcggatgtg caggctttgc ttgtcgacgc ccgcctgatt cgcaatcggc    114240
     gcaaaatcat ggcggtggtc aataacgctc gtgctgtgat tgatctgcgt gagcatggtg    114300
     gcttggatga ggtgttgtgg tcgtttgcac cggcgcagca tacgcctcct cttacggtgg    114360
     cggatatccc ttcgcagacg gtggagtctc gggcgatggc taaagagttg aagcgttgtg    114420
     gtttccaatt tgtcgggcct accacgtgct atgccacgat gcaggcggtg gggatggtag    114480
     atgatcgccc ccgtggcgcg tcgccacttc tcgtggaaag ctagtgccat gtcgaatcaa    114540
     catgtggtta atgagaaaaa gattgcggtt gttaccggtg cctcctctgg cattggtgag    114600
     gctgccgcgc gtgctcttgc ggccgatggt tggcatgtga tcgtagcggc acggcgcaaa    114660
     cacctgttgg atgttctggc tgctgatatt gccggtacag cgattgaact tgatgtgaca    114720
     agcgatgagt ccgtggctgc gtttgcggcg cagattccgc gatgtgacct gctggtgaat    114780
     aacgcgggag gcgcattagg gcttgatccc attgcccaag caaaccttga ggattggcag    114840
     tggatgtata acaccaacgt gttaggcaca ttgcgggtaa cgagggctct gcttgatgcg    114900
     ttgagcagca gtaatggtct gattatcaac atcagttcga tcgccggtat cgcgccctat    114960
     gccggtggcg ctggctataa cgctgcgaag ttcggggtat cggccatgga taaggtcatg    115020
     cgcattgagt tccaagaacg aggtatccgt gtggcagaaa tcaacccagg tcgggtgcat    115080
     actgattttt cgctggtgcg gtttaaaggt gaccagcagg cagccaatgc cgtctatgag    115140
     ggcaaggtga atctcaccgc gggcgatatt gcggaaacga tccggtgggt ggcctcgttg    115200
     cctacacacg tcaacattga ccggcttgtg atcaccccac aggatcaggt gatctagctc    115260
     tatcgttatg actctttcgg cgtttggtgc actagctgcc gtgtgggctg cagattgtgc    115320
     gcatggattg atcttggtgc gggcgtaatt ttcctcgtca ttggcgtaat catcgccgtt    115380
     gaaggagttg ccggaattgt gagttaagcc actttaatct ttttaatgtg tgctagtctg    115440
     cgacacaaga gaggatgcac tgcacccgca gcatgccccc cgtccaacgt tgtctattca    115500
     agaggagaac acacgcaatg cgtacaccac accgtcaagg acatacacgc tggaccaaac    115560
     tcccactcgt gttcgcagta ggaacgctca gtgtcgccat gctggcagcc tgcggatccg    115620
     acaccgcaac cgacaccacc gacggctccg caggaccttc tagcccagca gcagcctcgg    115680
     ccacaccaac cacagccgac gcactctcag ggcgaatcgt cggcgccgaa gacgcccccg    115740
     aaggcctcac acacgaggac ttctacgcca tgttcggctc cacagaagaa acccccaaag    115800
     acaccatcaa cccaccagaa tgtgaaccac tgatctttga cagccacacc atgttcaact    115860
     ggggatcccg agcccgcggc accaccgcag tatccatgta caacagcgcc gacggccacc    115920
     aaaccgcctt catcaaaatc gaagaagacg cagcagagcc cgtaccagac gcaggtgcct    115980
     gcgccaccgt caccacagaa aacacctcaa cactaggaac ctcacgcacc acctacgcca    116040
     tcgcaccaaa agaactccca atagaaggcg cagacaccgt cgtagccgtt gaccaaaacc    116100
     tccaaggctt aaccctcgac gacgctgata tgagcggtgc gcgcgccggg gaacgcacca    116160
     cagtggtcat cgcgcaagcg cacggacaca ccatcaccgc agtgggaacc ggtgatattc    116220
     ctgaccaagc gatcaccgac ttggttaaca aacaaatcca caaacttgcc agctaataag    116280
     ctgcgtaagc caacaattgc tccgacaaag agatactcac gttgaaggcc gcaccatcgc    116340
     agagatggtt cgtcgtgcag ccgactgggg gtgttcctat ataggttgtt aattccgtgg    116400
     gtgagttcaa aagtcaggct ggagggccca agtgcgacgg gtagctagcg tcgatggttt    116460
     taagtactgt cagaaggtcg ttgagtcgtc ctcggatgct ggtttccaag aggttttctt    116520
     ggtgtgatac tccgttgcgc aaacgcgtca gccgttcgac cttctgacca aatacctaat    116580
     gtgagttgaa ctattacatc atcatgactg agcggagcgt tcctgcgtgc gtgttcatta    116640
     cctcgacgtt gagattcttt ccgagcccat cccctagcct gtcccatcgg ctttttgaac    116700
     actcgagtcc tataagagta acccgttaga gagtaacgtt ctcccagtaa gggggttgct    116760
     agggtgcgcc ccaagaagac actattttct atgattccag aattattatg accttgatga    116820
     aggcttcccc gcggcaataa ttagagaagt agcgttcgct caagttcctc ctccatcttc    116880
     aaaattccca cacagggaag aacctaaata cactgacatt caggaacgtg gacgatccgg    116940
     cgcttggtta aacttcacaa catcttcacg ctccagagat atagcaggag gtaagtgaaa    117000
     ccgcccctgc tcgtcattct cttgcgtttc cttttccgaa tccacagcct caacctccaa    117060
     ccaaagaata ggctaccgta cacattaaag acacaaccaa agaaacgaaa ccccaaatca    117120
     cgaacttcga tattccttgt atctgcgccc taccttgact caaggtaata cgcttcgatt    117180
     cagtcaacgc tctcatagcc tcaatttcag tctttcccac aagttgcgcc tcaaggctgg    117240
     aaagttttaa ctcttgcccc tttgaacgaa agaaaagcgc tatcgctccg agaattgctg    117300
     caatcacgcc aaaaatcaga gccagtccgt accaacagct atttccatcc ccatttttag    117360
     gaatcgatac gaaaatcaat gaagaggtaa cgagcagtgc tgcccggtta ttcaaggacg    117420
     tggcagaacg gatgtggtct gataactgtc ggttaacctc ggagtcaata atggccaaga    117480
     cagcacgaag ctccttcttc tccgagcgat tttcgaacgg atccggcttc atgaaactcc    117540
     aagtgcatca tcaaacataa taaaacatcc cagatcgtct gaaatgggaa cgacagcccc    117600
     cttgcacctt aactatatcg cttaccctct aggagggaag ggatcgtcac catatgaatt    117660
     gcgctggtgt atacgcccat cgtctttacg atgctttatc cactcactac cactatcctt    117720
     agcgagcttt tggctccact ttcgcgcctc agattccgta tctcgatagc cagaggctcg    117780
     agaagcaccc tctctcccta ccttccactg ctgacgctca ctatcccatg actgatgaac    117840
     attcttaccg gacacttcgc cctcctcagg acccatactt actaaatctc tacacagcca    117900
     ttatgccgca atgcaaatgt atgttctagt gctaaagtgg gtcggcgcat aaccccgaac    117960
     gattgacaat caacctcttc cacaagatga gccgatcagc agccatcaac tattcccaat    118020
     acactgggcg ccccttgtca gaagtcgatg catcagcggt taatcaacac gatgctaatg    118080
     aagataggat gattctgtgt cgacatataa agaagtcacg agggggaagc aacaactgcc    118140
     aaccagctct tgacgagaac acggaaaagg ttggggttgc ccttcctaaa acagaacgct    118200
     atcctcaagg gtttggagtt gatcttcgtt gagagatgaa catcaactcg gcccgcactg    118260
     tagctactgg caggtccggg ccattttatt tcttctgggg agctcttggg ttcagagggt    118320
     cgttgcaaca ctttcatccg aaagaggttg ctcatggcat caaccttggg cccgttccac    118380
     agtctcatcg acgctgacaa gcatcgcctg actgaactga tcacagctgg cagtagtgtc    118440
     catgctgcag tacgtctcct caacgccaac taccggcatt gcttgaacta tgctcatcac    118500
     aacacattga ttaccccacg gcggcagagc acggtcgtcc cacagcaacg cgctgcgttt    118560
     ctcacccaga tcaacaacga gaacacctcc atccgccgtg cagccatcga taccgagctg    118620
     tctttgtcag tggcctaccg cctagcgcgt ggcaccggcc agcacaccag acgcagccgc    118680
     taccaacaac gtgttgattc aaccaaccta cgcctggagt acctacgatt gcggcttgcc    118740
     tgcctgtcgc aacgcgacgc agccaccgcg gtaggcatcg ggcgtcgcgc tgcctatgac    118800
     ttcgaccatg gtgtgtcgca tactggctcc ccacgccgac ggttcatccc aaacggccct    118860
     catgccaagg cgtataacac gtgtatgacc acgcttgctg cccgccatga tgtcatcgaa    118920
     gaaggccgtc tatcggcccc agcgctaccc acacgcattg acccctacaa aacccattaa    118980
     ccgcaggtac ttaagcatcg aagatcgtat tcagatcgct gacctgtatc gggaaggtca    119040
     ttgcccggcg tacatcgccc gagtgatggg caggagccgc tcgggcgatc acccgagagt    119100
     tgcgccgaaa tcatagcgct gaaggtccct accggccgga gactgcccaa ctgaaagcag    119160
     cctcaaggag actgcgaccc aaaccagcca agctgttgat gtgccgcagg ttgtatgact    119220
     atgttgtcgg cgggttgcgg gcacaatggt caccggagca aatttcgaat cgaattcgcc    119280
     tcgactatcc cgaggagcag gagatgcgca tgagccacga gaccatctac gacgcgttct    119340
     acctggatgc gaaagcaaga ctaaaagacc ttgacctgca actttccacc gggcgtaaga    119400
     aacgccggca tcgtggtcgt tgccgcagtg gccaaagcgc cgatcgtttt gttgacgcga    119460
     tgaccatgat cgatgaccga ccacacgacg ttgaagaacg cgtggtaccc gggcactggg    119520
     aaggagatct gatcttgggc aaaaacaacc agtcagcagt gatcacgttg gtggaacggg    119580
     tcagccggtt cgtggtcctt ggccatttac cgagcaatta cacctcagtt gaagtcacgc    119640
     gagtgcataa agacatcgtt ggtcggattg atcaatccat gtggtcgtcg attacttggg    119700
     atcaaggatc tggaaatggc tgggcacaaa cggtttagca tggctacgaa cgttccggtc    119760
     tacttctgtc atcccgcatc tccgtgggag cggggaacta atgaaaatac taacggtcgg    119820
     ttgcgtggga acctcccgaa atcccaggac ctgtcggtct acagtgcaca ggatttggaa    119880
     atgatcgcga atatctacaa tcacaaaccg cgtaaagcgc tgggatggca cacacccgct    119940
     gaagttatga ccgatgtgct tcgtgtggag ggtagtatca ccggataact agtcgttgtt    120000
     gcaacgactc ctagaaccca agtgaccagg gcaaaaggaa aagcacccca cggggtgctt    120060
     ggtggtgtta gccgagttcc tttttcggtt cgatggtgat ggaaggttgg ccgcgttgga    120120
     ttgtgacgcc tttgaggtct gcggtgatgc ctgcgtccgg ccagaacttc gtgacggtcg    120180
     taatggcctt cttgatctcg gtgcggaagt tgactcgatc ttggtggact ggtgttgcta    120240
     gcaggaacaa gctgacacgg accaaccttg tttagacaga acatgtgaaa catatgtcca    120300
     aaatgaaaag caatcctatt aggcaacaat tttataacgc tgccctattt ttggcgtggt    120360
     ccggttgtgt gaaagcttcc aactacctag ggttgcacat cggctgtgcg tcgtgtatga    120420
     agtccatctg gccactgctt agttaaacaa tccttaagta catcttttaa ataaggagag    120480
     agatacatgc caatcgccgc agcgttatcc gcttcagtgg ggctgattct attaagcgta    120540
     ttgtgtctga cgcttcctaa agtggcaatg tcaggaaata ttcagcggaa ctctgccatt    120600
     ggtattcgta ctaaagagac gaagaaatcg gacagtgctt ggttagaagg acatcgcaag    120660
     gcaaccccta ttttgcaagc tacgggaatt atcacccttg ggattacggc aattctactt    120720
     gtgtcctctt tctttcaagc ttttccccct cttctgcctg tagtttctgg aattctagct    120780
     tatggtgttc tcttcgctgg atttattgcg ggggcagtcg ttgcaaataa agcagcaaaa    120840
     aatgtaaaca tccaaaaagg aatataatga gaaaactttc taaagtggct attgctgtcg    120900
     ccatcaccgt cagtgctgcc tgttcgggca ttgcatacgc gcaaacatct cacgctgatc    120960
     aagttacaca gtaacaagat gaggcgaggc ttgcagatgg cttgaagtca actcggcaag    121020
     aatctaccaa taaaaacctt gttatgctcc tgttaacagg aacaggccca tatgcgtatc    121080
     gcttggagga agaggctgct caggttcgtc gcggggagtt gggaactgtt ctgttgagtc    121140
     agcggagggt gagtaagttt ctgcgggagg ttggcgccct tgaggacccg aggttacgag    121200
     gtaaggcatt aacagccaat aagtcgggtt tgctggcatt gtggacgcgc gtgttgtcgt    121260
     cgttgtggtt gacgttgggc accgctcgaa ggtctacgac taaccccttt ggtcctcgcc    121320
     tccgtcgggt ccagcgtttt ccatcacgcg acagaggcgg gggttgtaga ttgtgggctt    121380
     gagggggtgc cgaggccata agcggccgca ccggttagac tgatgtgcat gcaagcgcag    121440
     gatgtcacga ttcgtgatca agaaatcaaa ctcggtcagt ttattaagct cgccaatctc    121500
     gtagaaaccg gcggcgccgc aaaagaagtc atcgccgaag gccgcgtcac cgtcaacggt    121560
     gccgtggaca cccgccgtgg caaaacgctt cgcgacggcg acgttgtctg catcggcacc    121620
     gcctgcgccc gcgtagtcgc aggcgcagca gacgacgatg actactttga tgaaaagacc    121680
     gccaacgatg acttcgatcc agaagtctgg aggaacatgt aatgcccgca tttcaagccg    121740
     agccaggcat gccctactgg attgacctga ccaccagcga cctgcgtaaa tccacatact    121800
     tctactccca cgtactgggc tgggaaattg aagaatttgg tgccgactac cacctcgccc    121860
     gcgtacaagg cctaccagta gcaggtttta tcaaacggcc agaaaaccat cagcagcccg    121920
     atacctgggt cacctacttc atgaccgaca acatcgccgc tgactgtgca gaagtagaaa    121980
     aactaggcgg tcgggtactc gccgtcccca tggaagtccg actcggacag atggcactgg    122040
     tcgtcgataa cgccggcggc ctcttcggcc tgatccaacc cgccggcgaa gatgccttca    122100
     ttgcggccgg cgaacctggc acaccagtgt ggcatgagct caccgctacc acgaactaca    122160
     ccaaggcagt agagttctac ccagcacttt tcggctgggc aacagccacc atggacaccg    122220
     acggctcctt cggatacacc accgcccaag tagatggcgg tgccattgcg ggaatcttca    122280
     acgccgaagg ccaattccca ccccaagtac caagcttctg gcaaagctac ctcggcgttg    122340
     ctgaggtaga cgccgccgtt gcagcgaccg tggaatacgg cggcagtgtt atccgcgaac    122400
     catgggacac cgaattcggt cgcatggcga tcatcgcaga ctccaccggc gccaccgtca    122460
     ccctatgcga agcaccggag ccagtagaag aaggcaacga gtccgattca ctagaaggca    122520
     tcgacctcag ccaattcggt ctctagtcgt catgggcact gattgctcgc agcatgtccc    122580
     gctcagcgat ctcactgagc gggttctagc agatgttgac accataccca gcggcgcagt    122640
     gaccacctat ggtgacatag cgcgccgcgt ggggtgtggc gcccgccatg tcggcagcat    122700
     tatgcgtcga tacggggcgc tgaccgcctg gtggcgggtc gtgcgtgccg acggcaccct    122760
     agcggtcgcc gaccgcgcca tcgaacactg ggaccgtgaa aatatcgcac acaatggaaa    122820
     acgcgtggac ctgtcccagt gctactacca gccataaccg gtgaatctac gcgctgtgtt    122880
     gcgctgcctg atgagcaaaa aattccgcca cgtcgcgcac ccgctgacga gccacctctg    122940
     gggtagaaac ccgatgctca gagacgtatt ccagcaccct gacctgcttc ggctcctcag    123000
     cccatgggta atgccctgcg atggcatcgt tgctagccac ctgcataagc gttggcggga    123060
     actgtgccgc atcagggaaa ctaatacccc caacaacctc aggtggcagc cccgtgagat    123120
     caagatgcgg gaaagttaaa gcctgagcat cccaaagcga atgcgtcaaa gtggtcaacg    123180
     cgccaccgga ggagtatccc caggcaaaca tcgcggtggg ctgctgattg tcacgcaccc    123240
     actgggcagc cgtggtgacc gtcgcaatga cctgttccaa ggtgtgctcg ggcaccagcg    123300
     gataatccag gtccaagaag gtaacatcgg agaggttggc tacagcagca acctcggggc    123360
     gccacgcgtt gtcgagtgct acgcccgagc ctttccacca gccgccgggg tgcaaggaga    123420
     tggcccaagc gccattgggg ttggcggggc ggatgatctg cccgccaagt tcgggaacat    123480
     cttgggtggt cacgccgtcg ataaaggcaa cacctggcat ggtgtggtcg agggcggagc    123540
     cgagcatgag catgcacgca tgggtgatcc ggtcgggcag gcgggcgtcg aaagtatcga    123600
     tggcgtcttt gtcgctgggg ttatccgacc acggtgggtt cttcgcaggt gcctcatagt    123660
     gggcggcgat atatgtggag agctgctcta attgctgctc gggggtaagg atgcgatcgt    123720
     ggccgccgat gaggaattct tcacgctcac ggcgctcttc tgggctgata ttcgatgtat    123780
     ccgtcatatt tttcatccta cgcgtgttgg ggatcacccc cgctgcagga cattaccgcg    123840
     ccacgttctc aacaaaaggt gtagaaacaa taaaaacata atggtcacaa gggtgtgtcc    123900
     gtagcgcgaa agggttagtg cggatcatga gcggtatctc tattatcgaa aacgcagttc    123960
     tcaagcccac caagcgcgag gttgctgaac aatggttggg ctattttgag cacattggtt    124020
     cctaccggtt tgttgacccc gacggtcagg taggtatcga gtcgctgatt ggcttcgacc    124080
     tcgaccgccg gcttgtacaa atgccggtga cgtaccgcag cgccgaattt gatgcggaac    124140
     acacattgac caccatggac cactcggtgt taggcacccg ctacgtgagc aacgccatgg    124200
     gcgatccggt ggcggtacgc gagtacattc gggtgatctt ggaggccgac aacggcgcgc    124260
     agcgttccga cggcaaagtg tcggtcctcg acgtgcgcgg cagcggcaac cgcgaggaaa    124320
     aactcaccct cggggaggtg cgcattcttg aggccacacg gcagcgcgcg gtgggctacg    124380
     tgcgtatcga cggcaccctg cgcggctttg tcctgcgcgt tccgcatctg ctcgtgccag    124440
     agaactcccc gcgcctaggg cataacatct cgcccatgcg attgaacggc tctgtggtga    124500
     tgtctcctaa aaccgttctc atcgcagcgg agctcagctg gcacgatatt taaccaaggg    124560
     ctaccagata gtgactcgct tttctggggc gatccacatg ggggagtcct ctgccacgtc    124620
     gaaggcttgg tagaactcgg cgacgtttcc ggcaatcacg ttgcagcgga actcggcagg    124680
     ggagtgcgga tcaatggcga ggtactgtgc cgcaagctct ggacgaatcg ccgtgcgcca    124740
     cacgcgtgcc catgcgagga acaggcgctg taggccagtg aactgggtct tttccagttc    124800
     tgggtcggca tcttcggcgt ggaaagcagc cagcggggtg gaatcgaaat cgaggccgtg    124860
     gtcggcgagg tagcgtcgat aagcgatgac cgcgataccc aatccgccga ggtcaccgat    124920
     gttttcaccc aaggtaaacc ggccatttac acccgcaccg ctggggttgt tgtccgcgag    124980
     cacactcgga accaagccct cgaactgctc aaccagacga tccgtgagag cgctgaaagc    125040
     agcacggtcc tcgtcggtcc accacgactg caggttgccg tggccgtcgt actgcgaacc    125100
     ttggtcgtca aaaccgtggc cgatctcatg gccaatcacc gcgccgatag caccaaagtt    125160
     ttcagccgca tcggcatcag gcgaatagaa cggcgcccgc agaatagccg cagggaaggt    125220
     gatgtcattg accacggggt tataaaacgc attgacggtt tgcggggtgg tgacccactc    125280
     gttgcgatcc gccaaccgcc caatcttgtt cagctcatag tcgtgggcaa aggcagaacc    125340
     agcgcgaacg ttatcaagga ggtctgtgcc cttggcactg aactccaagc cggcgtagct    125400
     gcgccaagaa tctggatagc cgatcttggc attgaacttg tccagcttgt ccaacgcgcg    125460
     ctcacgagtc tccggcgtca tccacgacaa cccgctgata cgctcacggt aggcctcgat    125520
     aaggtagctg accagcgaaa gcatatcttt tttagaggac tcggggaagt ggcgttccac    125580
     atacaacgca ccgatttctt cacccacgaa agactccgcc aaccccaagg cgcgcttcca    125640
     gcggtcgcgc tgctgtgtcg caccagagag cgtggtacca aagaactcaa agtcggcgcg    125700
     agaaatctca ggggtgagaa caccggcacg agaatgcagg atgcgccagg tggtcagcag    125760
     tttccaatca tcaagacgct gcggtgtcag cagggattct agggcctcaa agtaggaagg    125820
     catcatggaa ataacacggt gctccggcag gccagcggca cgcaacaggg ctgccacctg    125880
     cggcggaagc tcagccatct cagtgggatt gaaggtcttt acagcatctc gacgctgcac    125940
     cacatcccaa tgggcagcag caatatcagt ctctagtgcc aggatccgcg tggcagcgtc    126000
     gataggcgtg gtgcccagct gctccggtgc aaggaaaccc aacatctttt ccacgtgctt    126060
     ttgataagcc tcacgcgtct gcgcatgaga ctcctcacgg tagtaggcct catccggcaa    126120
     cgtgataccg gactgcatga tataagccac ggacttgtca ccagcagaat ccttcgcaac    126180
     ccagaacccc acgggtccgc ccacacccac gcgatccaac gcacccaagg cctgaacaaa    126240
     ctccggcacc gtagcaacat cgatcagcgt gagatcctta tccagggccg ccacgcccgc    126300
     cgactcgata ccctcggtat ccatgaacga ggcatacaac ttgccggcca gcgaatcagc    126360
     agaatccatc acgatcgtgt gcacatcttc ttccgcgcga tcccgcagtc catggaaaat    126420
     gccatccacg ccacgatctt ctggaatcac atgagaatcc aaccacgggc cattaacaaa    126480
     acggtagagg tctgacaggg caaaacggtg ctgattatca ttcatgcgtg ccattctagt    126540
     taggttatcc aacattgggg gtaaccgcat gtcacgatga cctagtaggt tgtactttat    126600
     gtcgcattat caattccggc cggcggtgac ggccaagaca tggagcctgc tcgcactagg    126660
     agtgatcact gctcttgtgc tgccagcgct tctcaacatg gtcaccccag atgtggacac    126720
     taagaccgtg aacgtttccc taggatccga gcaggaaaaa tgggaaatgc ccatgtttaa    126780
     aaacgactcc tcccgcctgc aatgcgaaga atccatgtcg gatttactca cccccacctg    126840
     ggattgtgat ggtgcaacac tgacctccat ggtggtgtgg ggcagtcaag accaagacac    126900
     gacgttacga cgcatgatgc gactgaactc catgatcgac ccaggcgatg aggtcccgat    126960
     cttgcacaag ggtggcgtgc gcattatcag cagccctgag atgcccaacc aggtcggcct    127020
     gagcctagag cgacccgccg acgacgttga gcacaccggc accctattcg tgcttgtcga    127080
     cgggcccgaa tttgatagct acgccgagct ggtgtttaac aacctccgtg ctgaagaagc    127140
     ccgtatcgct ggtggcgagc acgaaccgat gaccctagaa gaactcacca aagggttcga    127200
     caaagcccac aagggggacg cacacacatg agcacccaac gagcacaacc cgcatccatc    127260
     tcatgggtgc tgtggaccct catcggtatc tcgataccag tcatagcgtt tttcaccttc    127320
     gctaacttct tcgcctctcc gatcgcggca ttccttggtg tcctcttcgg cctcgtctat    127380
     ttcgccgtag gcaccgcact atttttcttc tcacccatgt ggcccaccgc cggctggaag    127440
     tggtacttcg cgtgcatcgg ctggggtgcc ggtgcctcct tctgcattgt catgctgtct    127500
     gccgccccct ttacagacct caccgacaaa ctgggatggg aagccgtctc cgcatcattc    127560
     gccggtgcct accccgaaga gatcgcgaag tctctcggcg tgctgctcat cttgtttacc    127620
     ttctccaaac tgactcgccc ttggcacggt tttgttaccg gagccatgat cggattgggt    127680
     ttcgaggtct ttgaaaacat cagctacggc gtactcgggg cgatgagcga ccccaacacc    127740
     gacatcaccg gagcgctata ttcgtggtgg atccgcagca tcgcaggccc aggcctgcac    127800
     gtcgccttca cagccatcgc aggctatgga atcggtctag cggtattccg ctacggctgg    127860
     gacaccctcc agcgcttcct tgtgggacta tgcgcacttg gtgtggcctt ctgcctgcac    127920
     ttcacatgga acttgcagtt tgatagctac gccaagcaaa tcgccaactt tatcatcgtg    127980
     gcgttaatcc tctacccact gatggtgtgg ctctggctgc ggtgccatag gcaagccaaa    128040
     aacgatctcg gggtagtgcg catgaagcgc cccattacga ccatcgctga gctgcagcgc    128100
     cgcaagctcg ccaccacctc tgaagaaagc cagcctcatg cgtcttaaca tcagaagaat    128160
     catcgcagcc accgtcaccg ccggagctct cgcgctttct tcctgtggat ccatcgaatc    128220
     catcgagggc ggaagccacc acaactccga caccatcgtg gtgggatcgc aggattacta    128280
     ctccaacgaa atcatcgcag agatttactc gcaggccctc gaggccaagg gctacaccgt    128340
     ggaccgccag ttccgaatcg ggcagcgcga ggtctacgtc gacgaaatcg aatctgggcg    128400
     tatcgacgtc ttccccgaat acaccggccc actccttcaa cactggaaac cagacactga    128460
     agcccgcgag aaaacagagg tgtatcagca gctcaaagaa gcactgcctg agcaccttgt    128520
     agcccttgac cagtcagcgg ccaccgatca agactcctat gtggtcaccg aggaattcgc    128580
     caaaaaacac cacgtgaact ccatcgctga ccttgccgaa gctgccaaaa aacaacccct    128640
     cacactcggc gccaactctg aggcccaaga tcgccccaac ggccccaaag ggctagaaaa    128700
     aacctacggt gtgtccgtcg gctttactcc catcgaggat tctggcggac cgctaaccgt    128760
     caaagcacta cgcgacaact ccatccagtt ggccatcatc tacagtgcgg acccgtcgat    128820
     aagcacgaac cacctgacca acctcgaaga ccccaagggg caattcctcg cctcccacgt    128880
     ggtcaccatc gcacacgacg atgtccccct cggtgccgca accgtgctca acaaggtcaa    128940
     tgccacgctg acaaccgagc aactccgcga actcaacgcc cgctccgtca acgagcaact    129000
     acccagctcc gtgatcgcca aagactggat caaacagcac ctataaaacc cgaaaaatag    129060
     gggcagctag cgcggaacac catgcgtgac tagctgccct gtttgcgtgg acacatgagc    129120
     ggcgctcaac gtctcagcaa tgtacaaatc gccgcgtccc accagcgtca catcccccgt    129180
     ggtctgcagc gaacccaaac gaacgtcctc gtccaacgac aatcccaacg ggcctgatgc    129240
     ggaaatagat gcaacctctg ggccacacaa aaccagtatg accggctcgg ttgttgtcac    129300
     acgaatatct tgattaccca ccctgtaagt gccaggttct gagatggttc catctgcggg    129360
     cgcgctgcgc acctcagagg atgcagagat caaactagcc gcagtgatgt ggtccgaatt    129420
     gcgcgacgtc atccccgata tcccagcgat cacgctggcg cccaccacgg ctgcagtaat    129480
     cccgaccatg gttagctttc gcatcggcac acctctttga agtctcacgg aagatagttt    129540
     ctagcatgcg tcggcaagct gtggattagc tgtaaagggc taaggggttg gctgccaaaa    129600
     aggggtgggg ataagaaaag tgagtagttc gtgccaaatt aaatcttttc ttatatctcc    129660
     gacctgcgga aacgctgcgg agctggaaaa gttttggcac gaactactca cttgtgatgc    129720
     aaaggctggc tagttcttag tcaccttcgt atcaatgttc atccggcctg ggtaccacag    129780
     tccagatcga gtgatcgttt cggtgtccac ggtggctaca tcgggagctt cgcccttgga    129840
     attagtgcgc agcttgtaca tcttgataga accccagtcg cgaacccagt cattcttgga    129900
     gtagctcggc aactcgtagc tggagttgat cgtctcagca atgccggtga cgccaccgcc    129960
     agcgaagtcc tggaagttca taccgctttg cttgcccttg gcatccgcag aaatacggta    130020
     ctcagggatt tctgccacac ctgcatagtg gttgaaggtg cgctggcacg ggaactgcag    130080
     tggtaccgcc cagtccagta ggcctggggt agaggcaggg aattggttgg ccaaggtgtc    130140
     catggtgggc acgcgtggtg gggtaaaggc gatccactcg tcggggtcga ggctggtgtc    130200
     tttggcatgg atgcggatca cgtcggcgtc atcggggatg tcgctcagtg ggattcgcag    130260
     gttgcgccag gtggagtcga taccactgtc gagcaggtcg agctcgccga gtttttctgc    130320
     cttgcctaag gagccaccag tgttgctgcg gccgtattcc agcacgatct tttggccgtt    130380
     ttccacaatg ccgttgacat ccttgtgctt gatggatcct gcggcggaga caacaaccag    130440
     tggggtgttg tcgttggctt ttggcagctt gaaccagctg gaggttgcct cagcgatttc    130500
     ttgtttgcca tcggtccacg agcccaacac cggtacggtg cggtagtcca agttgaaggg    130560
     gagtcgggaa tgagaaccgt tcacgccttg gtcggcgcgg tgggtttctt tcttcttcgc    130620
     agcttcttct tggttgtcgg aggctgcgtc agctttcgct gcagagccat cagagtcagc    130680
     acccgctgcg gtgttggatg cgtcggagtc agctgcggca gtgtcagaac cgtcgccggt    130740
     gctgttggct gcgccgagtg cttctggtcg gttttctggg gtaaatgccc acggtgagat    130800
     gcggttcggg tcgaagccgc ggacgtcgtc gttagtaagg gagtcgccta gtgtgccggt    130860
     gagcggcgtg aggaaagact cgttggtgtt ggtttctacg aggacatcgt tggcgaggtt    130920
     gcaggtgtca cccttgagcg aacggaggtt gcctaagccg acggagtagt tcgggtattg    130980
     gtcgatgaat cccttgctca atgaggctag ggagaatgcg actgcgaaga tactcaggat    131040
     agcgatgggt gcggctgcaa ggccttcgaa gtgctgcttg cggaaggggc ggttgaccat    131100
     cgcggggtct tcgccgcggg cttctgcttg ttcctcggcg acgtctttgc ggaaggatac    131160
     gagcacaccg gcagccatga cgaccagtga gagcagcaac atcacggttg atgcttcgat    131220
     cccgtggaat tggatggtct tgtcccacca agggatggag tagctcgagg tgtaccacca    131280
     gccgttgggg cctgcgaggg cgaaggcgaa cacgaagagg atgccgccgg tcagcagaat    131340
     gcgggcgcgt ggggagcgta gcgcgatgtg cgaaagcgct acggcaccta caccagccag    131400
     tgctgcggcg atgccggccc acacaccgaa gtggtgcgtc cacttggtgg gggtgaacat    131460
     catgaagaac agggtgccca ccatgacgag catgaggcgc atgacggggc ctttgttggt    131520
     gcctggtact ttgccttggc gcaagatggt ggcaccgacg agtgctgcgg cgacaaaggt    131580
     gaagaagact ccgacgcggc gggcgaagga gccgtcgact gtttgcatca tgagcacttg    131640
     gtagcgcacg agttcgttgt accagctcag ggctgggcct ttgtcgccgc gcacgtggat    131700
     ggattccagc acgttgcgca gtgtttggtc accgaagacg gcgataaaca cggcggtgcc    131760
     ggcggccatg aatggtgcga ccatggccat tacgcttacc gcgatggagc gtttcgacgc    131820
     ccccgtgttc aggtagggca ggcgtcggta gacgatgcgg atgaggtagg acagtccggc    131880
     gaggactgcg gtgactgcca tgaggccggt ggggccgcag gcgagggtaa acgctgccag    131940
     catcgtgcct attgctgctg gtaggaggcg ttgggtggcg attgctacct cgaacgacaa    132000
     ccaggttagt agtgtgccag cggcaatgat gggttcgggg cgcaggccgt tattgtaggc    132060
     cagccagaag gagaggaaca caaatgctgt ggtccattgt gcgacgcggc gctgtgcgat    132120
     tttttcgcca aggcgtggta gtacctcgcg ggagaggacg agccagatca cgatggcgga    132180
     gatcagtgat ggcaagcgca tccagatgga ggcagtggac accttggaca tgaggccgag    132240
     aaggtcgtag tagggggcgc cgaaggggga ttctggcaca ccgaaccagc ggtagtagtt    132300
     ggccatgtag tcggaggccg aggaggccct ggccatggtg aggatgaagc cgtcgtcgga    132360
     ggtgttagcg ccgatgaagt accagaccag caggatggcg cccacgatgg cgtcgagggg    132420
     ccgtgggcgg aagaagccct tgttgaggaa gcggatgtcg gtggcgccgt cgcgacgatc    132480
     gagcatgccg agggagatca gggagatcag cagcatgagg ccgccgagcc acatggaggc    132540
     atacttggcc agggttggcg aggaggtaaa gcgtgagttg atctctacgt gggcgttaag    132600
     tccagcgttg aggaggtcag ctgcggcgtt gctttccagc tcggtgtaga tgcccatgat    132660
     gatggggcga acgtcgcgtt ccacggtttc ggtggtggag tcgtcgcctt cgatgccggc    132720
     ggttgtttcg tcctcggttg cggagatcgc gatggtggcg tcggcaggca gttgggcgag    132780
     ttcgcgtttg ctcaggtcga gcacgagttc gccgtgggag gtgatttgca ggccgtcgtc    132840
     gtttgcgcgc acgaagagtc cgcgggcacc ggcatcttcg ctgttggcgg gcagtgtgcc    132900
     taggatgagg tcttggtcct tgcgcagctt atcgacgctt gccactggga tcttcgcatc    132960
     gaaagagatg ggcgtgtagc tcatcagtgg agcgctcacg ctgttgagtg agccgttttg    133020
     tggccacgac acactcgatt gcacctggtt gacgggcatg agtggggtga tgatgaacag    133080
     gacgaagccg atcacgccgg aaaggatcgc cgcccacttt atgccggtga tgttagtgtt    133140
     cataggctta gtcatgcgtt accaccacga atggtcctac ttgggtgaca gtccatgggc    133200
     tattttctcc ttggaatacc tcggggttaa agcgaacacc cttgaaccat acgttggggt    133260
     tgcttgggaa gatgtcgata gcaaggttga agttccagcc gtcctttgaa tccgaggagc    133320
     ctgtggaatc ggcgcgcagc acgaatgcat cggggctacg ccatggaacg ttcgatacgg    133380
     cacgatcaaa gtcttggggg tccttcaagg aatcccagct ttgcgacgcc caattctcga    133440
     taactgcatt gcgcttttca aactcgccca acgggttggc atagtgcgag gtaaacgcct    133500
     ggaaaccgag gtatgggtag taggtgagga agttgaactc gtcggtgagc accacagtat    133560
     ctgccgccgg cttaccggtc ttttcttgga tcacacgatc tacttccgcg tagtactgcg    133620
     ttgcatccgg tggcaagaag tcagcacggt gaccgtcgcc atcggtgttg gtgtacgcga    133680
     gctcaatggc gtgtgcgtta cgatctggaa ttgcctgcgc atactgaata cccgccaacg    133740
     ccaagaccac cacgcagatc acattgatac gcgtggacaa gcttgtagaa aactgcacag    133800
     gatagaagcg gtgcactgcc acaaggcgca actcggcaag accgagcaca cctgcggtac    133860
     ccagaatgat ggtgatgacc gaatccaggc ggaatcccag cagtgtggtt ccgctcagcg    133920
     caacagacat cgaggcgata acccagaggt acattacggc caagccgacg cccatagcgc    133980
     acacatcggg atccatcaca cgcatgatca ggtagatcaa gccgataaag cacagcacgc    134040
     caacaaagct ggtggcaaac attggcagtg gcaccacggt tccctcaggt gggaggaagt    134100
     gagaggccgc tgcggtgccc tcgtaatggc cggtaaaccg cagccacaag tatggtcccc    134160
     acacaatcga ggcgatagcc atcgaggaca cgccgataac gatgatctga cgaatcggcc    134220
     gccacgaacg aagcacgaat gcgaagaaca ggcccgaaac cgtgaccaag ctcagcgcaa    134280
     tcaccgcagt gtacaaggtg tatgtggaag cggaagcgcc caagtacacc actacaccca    134340
     cggtggccag cttctggcct gatagcgcac gacgccccat caccagtgct gcaggaatgc    134400
     ccatagcaat cacacaggca taaggctcaa aagcacacag tgttagagca atagcggtag    134460
     tgaccagcgc aattgccgta gcaacaggca agctgcccac caatcgctgc cacacaggca    134520
     ccaacacaca gccagtcacc gcaatgctca acaatgccca cggctgatag atcgcccacc    134580
     ccgggtaccc aataagctgc gcaaaccgcg cacctaacca gaaccacgca cctgggtaat    134640
     acgccggaag atcagcatag ttcatatccg gtagcccctg cgtagccgtc agacgggtaa    134700
     ggaactgggt gcggaagccc tggtcaaccg taatgccttc caagtacagg cggcttggag    134760
     agagcggcac accaatggct gccatgacca aaccagccgg tgccatatgg gtcaccgcat    134820
     aggtgatcca cgtgcgccag cgcggccgcg tggtgcccct cttgtcatct gccatccacc    134880
     acagcacaaa aatgcaggtt actagcaggg taaggaagat acccacggta gcgcccgcct    134940
     tggtgacctg cgaaccacca aacggtggca gtttgaccac cttgaggaga taccacaagc    135000
     ccaaagtaca gatggagcta ccaaagatcg tggccacaat ggcaatcaga gtagcttttg    135060
     cagagagctg atccggggcg tacatcacca cggatgtgag ctctgagtct gaagcctctc    135120
     cctgggtggt attcctttgc gcacgcacct gcgaagaacc ccctgaaggg gaggcatgtt    135180
     tactcggggc agattcagtc atagataaca gtttggcaca tggtcttgac atggcaagca    135240
     gcgccgacct agaaacgcaa aaaatggtgc cccttatgac cagatcggag tacttttccg    135300
     gtcacaaggg gcactacaaa gtgatgtgag acaacctaca aactagaagg gcagcttgcg    135360
     gaagattgcc tgcgggatga acttgaacgc caaggaaacg tactcgaaca gtgggtgaac    135420
     aaagatggcg ctcttgcggt tgagcacagc gtcgaacgta gccttagcca catcctcttt    135480
     atttaccgtc aatggtgcct cgccagcgtc ggcggacatc ttggtgcgca cctggcctgg    135540
     gcgcacaacc acaacgttgg caccggatgg gcgcagagcc tcgccgaggt tgacgtagaa    135600
     gccgtccatg ccggccttgg aggcaccata gacaaagttc gaacgacgca cacgctggcc    135660
     agcaacggag gacagcgcca cgatggtgcc gtgaccctgc tccttgaact tctcgcctag    135720
     gagcacaccg acggacacag gtgcggtgta gttggtctgt gccgaggtga cagcagcctt    135780
     ctggtcctgc cagagctgct cttgatcgcc tagggtgcca aaggccacaa tggcgagatc    135840
     cacatcgcct tgagcccatg cgaggtcgat aacctcggcg tgcttgtcaa agtcggtggc    135900
     atcgaagtcg atcacgtcga cctccgaagc gcccgcagct ttcatctggg cgacggctgc    135960
     gtcgatacgc ggggagtcct gacgcgctgc caacgtgaca tgagctgggc ctttggccaa    136020
     aaactcggcg acgatggaaa gaccgatttc ggacgtgccg cccaacagaa gaatattttg    136080
     tgcttggcct actgcattca gcatgaggaa gtagtccttt cttttagtgc agctcgaggc    136140
     ggcgggacat atcggacgca aagacacccg tggggtcgat agcgttgcgg gtcttcaacc    136200
     agccttccat acctgggtac atcttgtgga agttctccgc agaggtacgg gactccttag    136260
     ccaagtacag gcggccaccg aattccatca cgcgcttatc cagatcatcc aagaaagcgc    136320
     caagaccagg cttgatgggg aagtcaacgc agacgttcca accaggcatt gggtaggaca    136380
     atggtgcctt gttaccctca ccgaacagct tgaacacgtt cagtgcagag tagtggccgg    136440
     acttctgaat gtccttgaca atgtccttga atggctcgac tgcctcgcgt ggcaccacga    136500
     actggtactg caagaagccc ttggagccgt agccgcggtt ccactcaccg atgaggtcta    136560
     gtggctggta gaactgcgtg aggttttgca ccttgttctt gtaggttccg gacttgagcc    136620
     accacagctc gccgatggcg atcatggaga gcttgttcat ggtgaagctt gggaagatat    136680
     ccggcacagt gaccagctgc ggagcattga acttcagtgg atccttagcc agcttcggcg    136740
     cgatctcctc cagctgtgcc aaggtggcca gcgaaccgcg ggagatggcg gcacggccga    136800
     gctttggctc aggggagatg gcgtcgaacc atgcagacga gtaggtgtag ttgtgctcgg    136860
     agccatcgga gtggaactcg atggtttcgt cgaggttggc ggtcaggtcg ccgtcggcaa    136920
     tgaagtacgc ggtttccgtc ttggtcatgc ggatgcgtgc gcgcacgata atgccggtca    136980
     ggcccatgcc gccgacggtt gcccagaata gttcgccggt ggggtcgtct gcggagcctt    137040
     ctggctcaag gtgcaggata cggccgtcgg caacgagcag ttccatggag gcaacgtggt    137100
     cgccgaagga acctgcggag tggtggttct tgccgtggat atcagggcca attgcgccgc    137160
     cgatggttac ttggcgggta cctggtagaa cgggaaccca caggccataa ggcagtgcgg    137220
     ctttcatgag ctggtccaag gtcacgccac cgtcgacgtc gacaatcgcc gattctgggt    137280
     cgatggagtg gatcttgttc agggcttgca tgtctacgac gaggccaccg gagttctggg    137340
     cggggtcacc gtaggagcgg cccatgccac gagcgatcac gccgcgcttg aggtgcgctg    137400
     gcttggaatc attctgctcg gccacctggc ggactgcatc aacgattacg tcgagatctg    137460
     gggtggacag aacctcggcg gtggttggtg cggtacggcc ccaacctgtg agtttcttgg    137520
     cttctgtgta tagggctccg gaggcaccgt tcgaagctgc ggtgctggac gtgcccttgt    137580
     cggtcgtcat cgttttacaa cggtacccgc ttcacgtgac atgtgactat gactgggcgt    137640
     gtccgagcgg gtggtttttc tcacgttctg atgtgggaac aaacattttc ggggacgaac    137700
     gctaccttat agatccatca tttcgcggat ttcgcgtggt agttcctctt gagagcagat    137760
     ggtggggccg tcgtactgct cgaggatttc gtaaacgcgt actcgcgagt tgctgtcgag    137820
     catggggatt tcttctgcca tgagcagcat catgtcgttg cttaatggcg ctgaggtgtg    137880
     ttgcgttgcg atggtgtcgc ttgtggcctc ttggggctgt ggtacgggtt gggacttgcg    137940
     caaaaaaccg aacatactgc cactttactg tgaatggggg tgcatgtcat gggggttcgc    138000
     tagtgtgtgt cctatgacga accaagcacg tatttgccgt ctttccgccg cgttgtctgt    138060
     cggcctgatt accgcgttgc cggattatgt tgccaacaag gctgttcgct ggctgcttaa    138120
     ctcgctgatt gcgggcgctg gtgttggtgt ggtggcgtat gtgaacaagc aggacgagga    138180
     ccccacgaac gaccttgacg ttgttgcccg cgagcttatc gacgactccc agttcgggcc    138240
     cgcagccacc tgggggctgt ttctcgccgt tgtggtgctg ctgttcgtgc agcgtatcga    138300
     cgccaaactc accgccgtgg tcaccggctg gttgcgtcgt cgcggcgtgc gcgccccaca    138360
     cactgtgctc ggtgttcttg ctgcggcact gacctatgcg gaagtatcaa agtcatgatc    138420
     agcgttatcg atgtgttgtc aggcctagct gataacccca ccgtcgtcat gtggcacgtg    138480
     cacacctcgc ccgactatcc cacaagcctc atgtccggtg cgtgggtgct cggaccagcg    138540
     gaaagccacg gagttgatag cctcggctct ctgcttacta acacatgggc gttgccgctg    138600
     actccggcgg ccgcagcgct agttcccgct gggatccccg tgatttccct cgacgatgtg    138660
     cgcgcagcag tagaagcagg gctaggcgag atcaaatcag tgatcgcctc ggcaaagcaa    138720
     gacaacccca agctcgtcgc cccgcgcttt aacgccctgc ccacaatcag ccccgatgac    138780
     ttccgtgccg cctaccacgg cgaaccccag gcagaaaccg catggtctgc tgctagcgcg    138840
     gtcgcagcat ggatgcaaac atggctcgac attgaacaac agcgccgcag ccgcgcctac    138900
     ctcaaagacg cgctgggatc ttcggcgcgg tcgcttccgt tgcatttgct acctacacgg    138960
     taagattccc gcccgtgact acaaccaact cggccgcacc acaaagcgtg acatcccaag    139020
     gcattaggtt catcatctcc ggcggtatct ccgcagtcgt ggacttgggc cttacctaca    139080
     tctgccagat cctcttcggc ttctccgccg caggtggccg cacgatcggc ttcatctttg    139140
     gcacgctgac cgcctatttg attaaccgcc gctggacttt ccaagcggag gcctccacca    139200
     agcgtttcat ccaggtggct gtgctgtaca cgatcaccta ctttgtgaac gtgggcggcc    139260
     acgctttgct gtttggcttg ttcacctcat ctggtctggg ggaccgcgtg gctttggtga    139320
     tcgcctttgt gatttctcaa ggtgttgcca cggtgatcaa cttcttcgtg cagcgctggt    139380
     tcattttcaa gtagcctgtg ctgccctgtt gggcctcagt gagtagttcg tgccaaaact    139440
     ttttcgcctt cgcagcgttt ccgcaggtcg aagatataaa aaataattta agttggcacg    139500
     aactactcac tcggctactc tcccacggag tatgggggaa ataacacaga aaataccgca    139560
     cgctactctc acccgaaagc tagagagcgg ggaaattatc cgtgtgactc acggactgta    139620
     ctggcagggg gacgtcaacg tagatgagct ggcggcagcc ctgtgccggc ggggctttgt    139680
     gcttacgggt gtcacagaat tagagctttt ggctcggcag cctcttacgc tgccgttgca    139740
     tgttgttgct aatcgcaggg tgaaatctac agagtatgtg gtgatacatc gcagctctgt    139800
     gcgcaagtat gcgcgtgtgg cagatgtgct cattgagctg ccggtttatg cgatgcggtg    139860
     gcttggtaga aggcaggcga ttcgactggc ggagattgct tatgctgggc gtgaggggcg    139920
     tgcgcggttg gagcgccatg cgcagggtgc ggttcctgtg cgggttcggg agattgtgca    139980
     ggcttcggtt attggtgctg atagtccgcc tgagcgtgat ctggtgcgtg cgttgcgatc    140040
     tgctggtgtg gagtgtgaga gcaatgtgcg ggtgggggat tatcgttggg atattcgtat    140100
     ttgtggcagt gcggtgctta ttgaggtgga tggctatgcg tatcacaatg ccgaaaatcg    140160
     tgagactttt cgtttagatc gctggaaggc taacgacgcc accctgcgtg gttatttggt    140220
     tctgcggtat tcggcggtct gtgtgcggga gtctttggat gtgattgttg atcaggttgt    140280
     tcaggcggtg cagtgtgcgc cgaagcagct tcgtgatgtt gatgaggcga ggtgttggca    140340
     tcgcggagcg tggaagtgga tgcctgggtt ggcgtggctc taatcgctgt tgatacgtca    140400
     ccgtgagtag ttcgtgccaa aactttttcg cctctgcagc gttttcgcag gtcggagata    140460
     taagaaacga tttattttgg cacgaactac tcacatcaga gctcagtgcc ccagaactag    140520
     gggcgttcga atttctcgga gcgcccgagt tggtggagtt tgaaccattc gaggaatccg    140580
     cgggggtcgc gtcgctggat gaggaagaac caggcgaagc gggcgtattc ctgtgggagg    140640
     aggcgtcgca tgccgggttg gttcatgagg tagccgcggt tgcggtaggt gaagtagcgt    140700
     ttggcgtcgc tggcggggta ttgggtgtgc atgcgtccgc cgaggatggg tttgaattcg    140760
     tcagagccgt cggggtggag gtatgcggtg gtgaggcagg tgccaaagtt gagtccggag    140820
     cgtacgaggc ggcggtggta ttcgacttcg tcgccgcgga tgaatagtcg caggtcagga    140880
     acaccgatgc gttccatggc ggcggcggag atgagtgcgc cgttgaagag ggatgcgatg    140940
     ccgggtagga gggtgtcgct ggggttgttg gggtcgatga gttcgctgcg gtagcgtcgc    141000
     cattcgagtc cgcgtcgtag ggggaaggcg agtcggttgg ggtcgtccat gttgcagacc    141060
     acgggggaga cttcgtcgag ttggtgggtg acggcggcgt cgataagcgt ggcaagtact    141120
     tgggggcctt cggggcggcc gtcatcgtcg gcacaccaga tggcgtcggc tccgagggcg    141180
     agggcggtga ggaatccgta ggcgaatccg ccggcgccac cgaggttggt gtgcgatggc    141240
     agatagatgc ctcggtcgcc ggcgacgctg tggaggaggt cgcgtactgc gtcttcgcag    141300
     ccgttgtcga ccacgatgat ccacttcact gggtgtgttt gcgcggccac cacctcgagg    141360
     gaggcgcgga ggagctcgac gcgcttgtgg gtcacgatga ctgcggcgat gttatctgaa    141420
     gtggaaagcg gcatggttct tattgtggca cattgtgagg tttgccctac aacgacacaa    141480
     acagtgaggt cagggtaagt gaggacaggg caggcttacc ccgtttgtgt gttgttttag    141540
     cttagcccta gctaatttgc ttcttatcgc aataagattc attttcatga ctaaggaaac    141600
     ttctcgcatg tcacgacgcg gcttcattcg cactgctgcc gcttccgtgg ccgcattggc    141660
     tttaacgggc agcctcgttg cgtgctcgac tgattctgct agcacctccg ctaccaccag    141720
     cgcagctaac aaagcgctga cggtgtttgc taccactggc tacattggcg acgcagtaaa    141780
     gaacatcgcc cctgatgccg acgtaaccat catggtgggt cctggcggcg atccgcacac    141840
     ctatcagccc actacacagg acatttctaa gattgagtcc tctgatgtgg tgctgtggtc    141900
     tggtctgcat atggaggcca agatgctgga tcagctcaag gcgcaggggg atcgtcaggc    141960
     ggctgttgcg gaggcgatcc ctgaggataa gcgtttggat tggccagagc caggcgataa    142020
     tggcgaaaag ttgtatgacc cccacgtgtg gaattccacg gagaactgga agtacgtggt    142080
     ggatgcgatt gcgaagaagc tgtctgaggt agataaggac aacgctgcta cctataagga    142140
     caatgctgag aagtacaaga aggagatcga cgagactgct gcgtatgtga aggagcagat    142200
     cgatcagatt ccggagcaga agcgtatttt gatcactggt catgatgcgt ttagctactt    142260
     tggcaagcag tttggtgtgg agattcacgc tacggacttt gtgacctccg agtcggagat    142320
     gtcgccagcg gagcttgctg agttgggcaa gtttattgct gagaagaaga tccctacgat    142380
     tttccaggac aatttggcta atccgcaggc tattaactct ttgaaggaga ctgtgaaggc    142440
     taaggggtgg aacgtggaga tttccgataa ggagctttac gcggattcct tgggtgagtc    142500
     tgcaccgacg gatacttacc ttggtgtttt gaagtacaac gctgatgcta tccgcgaggc    142560
     tttggctaag taattagcaa attttctcga ccgcgctaca acacgttaat gtgcatgttt    142620
     tcggtgtagc gcggttcttg tcgcacatct gactattttt ttaagaggcg ttatgtctgt    142680
     ccctttgcac gcgctgccac cggctttggt gatgcgcaat gtgtctgcgc gttatggttc    142740
     tactgttgct gtggaacgcg ctagtgttgt ggttcctgct ggcacggtga tgggttttat    142800
     tggccctaat ggtgcgggta agtcctcgtt gattaaggct gcgattgatc tgattgatcg    142860
     cgatggcgag gtggagtttt tcggcgagag tttggctgcg tgtcgtaaca gggtgggtta    142920
     tatgccgcag agtgcggatg tggattggga ttatccgatc acggttcgcc aggtggtgca    142980
     gatggggctg tttccacggg tggggtggtt taagcggttg tcgggggagc ataaggagct    143040
     tgtcgacgct tccctggcgc gtgttggtat cgcggatttg gctaagcgtc atatttctga    143100
     gttgtcgggt gggcagcgtc gtcgtgtgtt tgtggcgcgt attcttgccc agcagccgga    143160
     tatttatttg ttggatgagc cgtttgctgg tgtggatgct gccagtgaga aggtgattcg    143220
     tggtgtgttg catgagctgc gggatgcggg caagtcggtg gtgattgtgc accatgattt    143280
     gtctacggtt gaggagctgt gcgaccacgt gacgattatt aatcgtgagg tgttggcttc    143340
     tggtccggtg tctgaggtgt ttactcgtga gacggtgaac aaggcatttg gtttggggct    143400
     gctatgagcc tgattgagtt tttgtcggag ttttctttcc gtcgtgtggt gctgggaacc    143460
     atgttgattg gtttgtgttc gggtgccatg ggaacgtttt tgtatttgcg caggcagtcg    143520
     atgatgagtg atgtgattgg gcactctgcg actcctggtg tgatgggttc gtttttgttg    143580
     ttttctacgg ttccggtgtt ggcggggtcg cagttgcttg cgcagtgggg gattgatgcg    143640
     cgttcgatgc cggtgattac ggtgggggcg ttgattacgg ggttggcgtc ggcgttgttg    143700
     gcggacaagg tggctgcgac gacgcgcatt ggtattgatg ccactatggc ggtgatgttg    143760
     tcgctgtttt tgggcggcgg cctgattttg ctgcagatca ttcagagtgg gcgttataag    143820
     ggcaagggcg gcattgatga gttgatgttt ggtaatgctg ccacgcttac taatttggat    143880
     gtgcgcacgt tggctgtggt gtctgtggtg attttgggtg tgattgtggc gttgtggcgg    143940
     ccgtttacgc tgttggtttt tgatccggtg ttggcgcgga tgtcggggat gccgcggtgg    144000
     attaatggtg tgttgtttgt gattatcacg ctgggcatgg tgattggtgt gaaggcggtg    144060
     ggcctgatct tgatgattgc gtttgctgtg ttcccgccgg ctgctgcgcg tcagtggtcg    144120
     cgtacggcgt tgcagatggt ggttgcgtcg gctctgattg gtggggcgtc ggcggtgttg    144180
     ggcacctata tttcgatttc ggtgggtaag gtgcccacgg gcccggtgat tgtgttggtg    144240
     ttggctgcga ttgtgctggt gtcgatggtg ctgtcgccgc gtaggagtgg ggtgtcggca    144300
     tgacgtttgc ggtgtctgtt tcgttgttgg cgctggtggt ggcgcttacc gctgcgattc    144360
     ctggggtggt gttggtgttg cgtcgacaag cgatgctttc cgacgccctc tcccacgccg    144420
     ttttgccggg cattgcggtg ggcgcgttgt ggactactaa tccgaattcg cctattttgt    144480
     tgatcggtgc gacgttgagt ggtgtgctgg tcatggcgct cacggagtgg gtgcgtggcc    144540
     gcaagcgggt gactgaggat agtgctacgg gcctgatttt ccccgcgttt ttcgctatcg    144600
     gtgtgattct gatttccacg aagtttaatc gctcgtcgat ttctgagcac acggtgctcg    144660
     tgggtgatct caacatttct gccatgcagc atctggtggt gggaaccatt gattttggtc    144720
     cgaagagtgc gtggattatt ggcgcggtag gcttgctcac gttggccctg ttgttggtgg    144780
     ctaagcggcc gctggcgatt tcgactttcg atcccgtttt tgcgcgcacg gtgggtattc    144840
     gtacgcgctt gattaactat ctggtgatga cgatggtgtc gttgaccatt gtggtggtct    144900
     tcgatgctgc tggcgcggta ttggctgttg cgttgatgat tgtgcctgct gcgaccgcat    144960
     tgatgatcgc ttcttcggaa ggtgccatgt tgttggtcac gttggttgtg gctgcggtga    145020
     gttctcaggc ggggttctgg gtggcgtatc gtctcgacgc ggcgacctcg ccgacgatgg    145080
     cgtttgtcga cggcctcatc tttctcgcgg tgtggggtat tattcgtgcg cgtcgccggc    145140
     tgcggtgtta aaaactgcag ttctgctaac tgttgatggg tatctaagtg tgcgcttcct    145200
     agtgcacatg acaatcgttg cctatagtgg cggtcatggc acatcgacta atccgtaccg    145260
     caatcgcagc tgtggctgcc acaggtcttg tggcagcagc cggctgctcc accaccgact    145320
     ccggcaccag cgcttctgga acttcgagcg ccgccaagag cgacactctt aagatctttg    145380
     ctaccaccag ctacatcggc gacgcagtaa agaacatcgc ccctgatgca gacctcaccg    145440
     tcatggtggg ccctggtggc gatccacaca cctaccagcc ttccaccgct gaccttgagg    145500
     caatgcaaaa tgcggatgcc gtgatctggt caggccttgg catggaagcc aacatgattg    145560
     accagcttcg cgggcttggc gacaaacaaa tcgccgtagc cgagcagctt cctgagtccc    145620
     agctgttgcc atgggttgag gaagacgagc acgatcacga tcacggcgac gcccacgagc    145680
     acgggcacga gggtgaagat gcccacggcc accaccatga gtcgcagtgg gatcctcacg    145740
     tatggaactc caccgacaac tggaagctcg ttgttgatca gatcgttaag aagctctccg    145800
     ctgctgattc tgctaacgct gacacctaca aggccaatgg tgagaagtac aacaagcaga    145860
     tcgacgaggc caaggcttat gttcaggcca agattgacac gattccgcag gatcagcgca    145920
     ccctcgtctc gggtcacgac gctttccgtt actttggcaa gcagttcggc cttgaggtga    145980
     aggccaccga ctttgtcacc tctgatgctg agcgttctgc aaacgagctg gaagacttag    146040
     ccaccttcat cgtggagcac cacgtcccag tgatcttcca ggatgcttct gctaacccac    146100
     aggctgtgaa gtccttggag gagaacgttg ctaagaaggg cggcaaggtc aaggttgtgg    146160
     ataaggagct ctatagtgac tcccttggtg ccgacgcccc tgctgatacc tacatcggtg    146220
     ccctgaagta caacgcggat accatcgcgg aggctttctc ctcgacccgc taaaaaatcg    146280
     gtccggtggg ctgggacatc tcacgaagag attccagccc accggatgtt ggctagtact    146340
     acattctggc ttgcagtctg cggatgtggt cggctgcttc ttttccttcg taggcttcta    146400
     cgatgtcggc tactggtccg gcttggcgga tggtgccgtg gtcgacccag agtgcggagt    146460
     cgcatagttg gacgaggaag tcgttggagt gggaggcgaa cacgaggatg ccggagcgtt    146520
     tgactaggtc ggagaggcgt tcgcgtgctt ttgccatgaa ggcggcgtcg acggctccga    146580
     tgccttcgtc gagaagcagg atttcaggtt cgatggaggt gactactcca agagcgaggc    146640
     ggatgcgcat gccggtggag taggtgcgta gtggcatgga gaggtagtcg ccgagttcgg    146700
     taaaatcggc gatctcgtcc attttttgtt tcatttgttt gcgggtttgg ccgaggaaga    146760
     gcccgcggat gacgatgttt tcgtatccag agatttcggg gtccatgcct acgccgaggt    146820
     cgaacacggg ggcgacgcgg ccgcggacgt gtgcggagcc gcgggtgggt tcgtagattc    146880
     cggagaggag tcgcaggagt gtggatttgc cggcaccgtt gtggccgacg agtccgatgc    146940
     ggtcgccttc gcgcaggtgc aggttgacgt cgcgaagcgc ttcgacgaca acggtgttgt    147000
     ctttgttgcg tccgatggcg ccgcccgctg ctccgaggaa tgcttttttc atggagcgcg    147060
     atttggcgtc gaagatgggg aagtcaacgc aggcgttata ggtgtcgata gataccatgg    147120
     tgagttcttc tccttcttaa acccagtagc tgacgcggaa tcgccattgg cgcatggcaa    147180
     gcatggcgat gaaaagcccg atgacggtgc agcagcccac cacgatccag ttcagggggt    147240
     ggatgggggc gccgatcaag ggggcgcgga tgacttccat gtagtggtac agggggttga    147300
     gcatggccag tttggcgcgt tcggagacgg caccgccttg ggagtaaagc gtttcggtgg    147360
     tccacacgat gggggtgacg tagaacagga gctgggtgag tgcttcgagc agcggcgaga    147420
     agtcgcggta gcgggtggcg acgatgccga agaacatggt gacccatacg ccgttggcga    147480
     tcagcagggc gagggcgggg attccgagga ggatgtccca gccgagcggc cgtgggaaga    147540
     tcgccatgag gatgacccag atcaccatgt tgtgcatgag gaagagggtt tgtttccaga    147600
     ccaggcggta gacgtggacg gagagcgcgg agggcagctg tttgatcagg ccttcgttgg    147660
     cgatgaagac ttcggagcct tccttaatgc atcccgcgat gaagttccac atgattaatc    147720
     ccacagtgac gtgggggagg aattgggcga cggggatctt gaagagcacg gagtacagca    147780
     ggccgagggc gagtgccatc acaccggtgg cgatggtgat ccataggggg ccgagcacgg    147840
     agcgacggta gcgctgcttg atgtcctgcc aacccagttg gagccagagt tcccgctggg    147900
     agaagccccg aacgaggtct gcccaggcgg ctgcgagtgt cttggattgc gacggctcgt    147960
     cggcggtggt gtccgtgttg gtaatacggg ctaccatctc ttcgagtgtc tcgttgttat    148020
     gacgttcagc ttgttcctgc acaaatgtta agcctagctg gctttgtgcg gggattgaat    148080
     ctgacaggca tactaactag gttcaattat caaaactaga gggagttgag tgatggcgtt    148140
     tgatgtggcg cgcgtccgtg gtgcgtacac ctctattacc ggtgggtgga cgtatatgaa    148200
     tgctcagcag caggctcaga tccctgagcg ggtggctgct gctgtggcgc gtggctttcg    148260
     taattcgccg attgtggagg atgtggagcc ggcttttggt tctcatgcgc gggagcgaca    148320
     tgctgggctt tttgcttctg atgggtatga gcgttcggcg cgggtggcta ttgcagattt    148380
     gacgggtact tcggctgatg cggtgatcct tggccctaac ttggaggtgc tgttttctca    148440
     gtttgcggcg gcggtgtggc cgttggtgcg tcgtggttcg tcggtggtga tggcgcatgg    148500
     ttgttcgccg gcgatgacgg tgggcgcaaa gacgcggtgg gcgcagccgg atttgggtac    148560
     gggtgagatt ccggcgtggc agttcggttc gcttgtcgac ggctccacgc gcctggtggc    148620
     tcttcgcgcc gcggatcccc aggtgggcac gattaacccc atccgagaga tctctgagta    148680
     cgttcatggg gcttctcgcg catggctgct tgtcgacgcc tcctccttgg ccggtcatcg    148740
     tcccatcaca atggaggcat tgggtgcgga cattgtggct ctcgattgct ctgccttcgg    148800
     cggtccccag gttgctgcgc tggctttccg cgatgccacg atgttcccgc gtctcgacgc    148860
     cgacctgctc aacagcagtg tcgctccggg tcttgctgct ggtgtgtcgg ctgcggtgga    148920
     tcatattgcg gatttggatg agtcggtgcg tggtacgcgt cgtaaccgtc ttgtggatag    148980
     cattgagtcc gctggcctct atttgggccg cttgggtacc tatttggcgg attctttgga    149040
     ttcgttgcct aagacgcacg tgtttggtgt gactggcgag gccgccgcgg gttcagacgc    149100
     cgaccgcatc ccccatgtga ccttctgcat cgatggcgtg ccggctgacc tgatctatca    149160
     ccgcttactg agcaaccgca tcgtgggggc gttgtccgcc tcctcgccgc ttctcgatgc    149220
     catgggtgcc gaggacaccc acggcaccat cagtttggct ttggcgccgt ttaacaccac    149280
     tcacgacgtt gaccagctga tgcgagtggt cgcgagcttc gcctaaacct cgaggacgag    149340
     ctttccggtt acctccccat ttttgagcat ctcatgggcc cgctgggcct gctctagggg    149400
     gagcgtggcg tggatgtggt gccggatggt gccgtcggca agcagtggcc acacgttctc    149460
     gactgtcgac gccacaatgc gtgccttgtc ctcgcggtcg cgggcgcgca acgccgtcgc    149520
     agagatcgtg ccgcgcttgc tcagcagccg cccaatgttc agctcaccct tcacaccacc    149580
     ttgcattccg atggtcacct ggtggccgtc cattgccaat gcacgcacgt tttggtccag    149640
     atacttcgca cccataatgt ccaaaatgcg atcgcactta ttcttcagga cctctgcaaa    149700
     atcctcctcc cgataattaa tcagaatatc ggcgcccagc tcacgacacg tttccagctt    149760
     ctccttcgaa cccgccgtca ccgccaccgt ggcacccaca tgcttagcca actggatggc    149820
     aaaggtgccg atcccgcccg cgccaccatg aatcaaaaac atgtgctcgg gcttcaagcc    149880
     ggtgagcatc ccgatattcg accacaccgt ggccgcaacc tccaccacgg ccgccgcctc    149940
     agcgaagctg tagccctcag gaatcggcat gagctggccc tctggcaccg ccacatactc    150000
     ggcgtatccg ccgcccgcca gcagacaagc gaccttgtca ccgacgttgc ggctggtagt    150060
     gcctgcgtct acgatcacac cggcacactc gagcccaatg atctccgatt caccaggggg    150120
     aggcgggtag tggcctgctg cctgcaggag gtctgcgcgg ttgacgccgg ctgctttgac    150180
     ttggacgagt acttcgcctg gttgcagggt gggtgttggt gcatcgtgga ctgccaaggt    150240
     ggcgtcgtct tgaacgtaaa ttgccctcat acgcccccac tttaaagaat ttcggcaact    150300
     tcgggtatag tttttcgcgt tggatccgaa actttgtttt ttgggttctc acaactggag    150360
     atgtggcaga gcggccgaat gcactggtct tgaaaaccag cgatgggaaa ccatcccagg    150420
     gttcaaatcc ctgcgtctcc gcacaataac ccctagttct tgtggctagg ggttttctgc    150480
     tgcgctggtg ccctcttttg cgcctcctcg aactcaagac cacgaaaacc gcaggacgcg    150540
     attttctcgc cgaaatgctg tccttgggtt ttcgtggtct tgaattcgag ttctcggatt    150600
     cgtgctagcg caagcactac aactgcttag gcgaagctcg cgtcccatgc ggctagcaga    150660
     cgatcgcttt cttcttcgtt agttacggtg atgcgaactc cttcggggaa ggcgcgcacg    150720
     aggacgtcgt gagctgcgag tttttcggcg atttcgaagg gggtttcgct gcgtgattcg    150780
     gcggggatcc acacgaagtt tgcttgcgag tgtgcggcgc cgatgtggtc ggcgacgcgg    150840
     tcgcgtacgg ctactacttc ttcggtgtgt tccatgagtt cgtcgaggtt gttcagtgat    150900
     gcgagtgcgc cggcttggcc gacggcattg actccgaagg ggagggcgac tttgttgagg    150960
     gcgtcgataa gctcgtgtgg tccgaaggcg tagcccacgc ggacgccggc gagtccgaat    151020
     gctttggaga aggtgcgcag gcccacgagg ttggggaatt cgctgaggat ttcggtggcg    151080
     aagatggtgt cttcgtcgcg gacgtattcg gtgtaggcct cgtcaagcgc tacgacgaca    151140
     tccgctggca ccttcgccat gaactccaaa aacgcttctc gacgcaccac tgtgcccgaa    151200
     gggttattcg gattgcacac gaacaccagc ttcgtttttg gggtaattgc tgccgccatc    151260
     gcatcgagat cattaaatcc gtcgctggtt agcggcactg ccaccggtgt tgcgcccact    151320
     acctgcacga atatggggta tgcctcgaag ctgcgccacg ggaacaccac ctcatccccc    151380
     ggggtgcagg tgatctgcac aagctgctgg cacaacgcgg aggagccaca gcccacggca    151440
     atctgctccg ctgggacgcc gagatgctcc gaaagtgcac cgcgtaattc agtaacaccc    151500
     atgtctgggt agcgattcgc gccagctgcg gcctccgcca ttgcctgggc tgcggacggc    151560
     agcggacgat gagtgacctc gttactggat aacttgaggg cgtggtcgtt gcgcttgcca    151620
     ggaacgtacg tcgggatctg ggaaaggtct ttgcggatca tgccggcaat tgtagccccg    151680
     cgtgccgtag atagggggca ctgcctcgtg ttttgtacca gccgatgatg ttggataaaa    151740
     tgaacgacga ttctttttta ggatcgctgg agacgtgcca gagcggccga atggggctcc    151800
     ctgctaagga gttgacttgt ttgcgcaggt ccggaggttc aaatcctctc gtctccgctc    151860
     acttccactt cggtgggagc gtttcaccgg gcctggtgga acttgcgccc gtagctcaac    151920
     ggatagagca tctgactacg gatcagaagg ttgggggttc gaatccctcc gggcgcacaa    151980
     gttaaacccc agctcacaga atgtgtgggc tggggtttct tcgtgtttgc ggtgcgctgg    152040
     cgcccctttt cccgcctcct cgaactcaag aacacgaaaa ccgcaggacg cgattttttc    152100
     gccgaaatgc cgaccttggg ttttcgtatt ctcggattcg tgttcttgga ttcgagctgg    152160
     tgcacgccca ccccgcactc caacattgcg ggtgggtaaa cgtcggctta tgtcaccgat    152220
     ccttcccgtt tatgggggta tccgtgggcg aatctttgcg tgcaaagtgc ctattgatcg    152280
     cctttttggt gatggtggtc gcattcataa aggggtagtc gtcggcaatg atcgcacgtt    152340
     tcgggggtga tggttgtatt ttgttcgtgt aggcgaacct tggagtttgc acgcccctct    152400
     tattttctat tgaaggattt cttttgtgag tacaccgatt acacatgagt cttcgtctca    152460
     tgctcttgct gaggatgcag aggtccatgg gaagaatgag aaccgccggc agtttacggg    152520
     tttgttcgct ggtttgattc ttgccgtttt gatttatttg gtgttccctg agtcgtctgt    152580
     ggacatggtt cagggtgtgg atccggatgg ggagtatagc tataacgcgt tgcgtattac    152640
     tgctgctatt gcggtgttga tgggtgcgtg gtggatgacg gaggctattc cgttggctgc    152700
     gacggcgttg gtgccgttgg tggcgttccc tgttcttcag gtgattccgt ttgcgaagat    152760
     ttctgcgccg tatgcgtcgc cgacgatttt cctttttatg ggtggtttta ttttggcgtt    152820
     gggtatgcag cgttggaatt tgcatcgtcg gttggcgttg agtgtggtgt tgttggttgg    152880
     tacgaagcct aagcagttga ttgctggttt tatgctggct acgggctttt tgtcgatgtg    152940
     ggtgtctaat actgcgacgg ctgttgtgat gcttccgatt ggtgtttcgg tgttgcagct    153000
     gactgctgag tcggtgggtg gcatgaaggc gcagaagaag tttgcgactg cgttgatgtt    153060
     ggcgattgcg tattcggcgt cgattggttc tttgggcacg attattggta cgcctcctaa    153120
     tgcgttgatg gtggcgtata tggcggagaa tcatgacatc catattggtt ttggtacgtg    153180
     gatgctggtt ggtgtgccgt tggcgattgt ttatatggcg attgcttggt tggtgctggt    153240
     gtctgtgttt aagcctgagg tggattcgat tcctggtggc cgcgagatga ttaagtcgga    153300
     gttggccaag atggggtcga tgaagttcgg tgaggctgct actgcggtga tttttacggg    153360
     tgcggcgttg tcatgggtgt ttgttccgct gcttatcgac gttttccagt ggaaggttga    153420
     gattgcggat gcggctattg gtctgattgc ttcgatgttg ctgtttatga tccctgcgga    153480
     tcgtaagact ggtgtgcgtt tgacggattg gaagacggcg aatgagttgc cgtgggatgt    153540
     gttgttgctg ttcggcggcg gtttggcatt gtctaagatg ttctctgatt ctggcttgtc    153600
     cttgtggatt ggtgagatcg ccaagggcct ggtctcgctg ccgctgattt tgctgatcgc    153660
     tgcgattgcg gcgctggttt tgctgttgac ggagttcacg tcgaatactg cgacggctgc    153720
     gacgttcttg ccgatcatgg ccggtgtggc tgtgggtatc ggtctgaacg ctaatggtga    153780
     ccagaacatc ttgttgctga ccatcccagt ggcgctgtcg gctacctgtg cgttcatgct    153840
     gccggttgcg acgcctccga atgcgatcgc ttatggctcc ggccacgtgc gcattggcga    153900
     catggtcaag ggcggagtgt ggctcaatct gatcggcgtg gtgctcgtaa cccttgcgac    153960
     atacttcctt gccatcccag tattcaacat cgtcctctag tgcgctgacc tcacgatttg    154020
     ccagttcttg ttgtggcagt gtattgttct aacacgttgc accgcaacaa caagctgcgc    154080
     ccgtagctca acggatagag catctgacta cggatcagaa ggttgggggt tcgaatccct    154140
     ccgggcgcac aagtgaaacc ccagctcata gcatgtttga gctggggttt cttcatgatg    154200
     tgtgggttgt ctgactgttg gctgttgttg caggtggttg gtgctcgtac cgaacgcata    154260
     ccgaacatag gccgaacaga aaccgaacaa gagtcgaacg ggcaccgaac ggggtaattc    154320
     ccatagatca gtttctgcgt cccttgtagg taagatgatc acttatgggt gaactcgaca    154380
     cagctgaccg tttgttagaa aagagcaaag aagcatttgc tctggctgtg gagctttata    154440
     accgacccac cttgaagtat cacgctgaaa gttgctcgat cttcctttgt aatgcatggg    154500
     agctcatgct taagtcgtac atcatacgca agtatggaat tgacgaaatt tactacgacg    154560
     acggcgataa gacaatcgcc ttgactgact gcctcaagaa agtgtttacg aatgacaaag    154620
     acccgttacg catcaacatg gccgagttaa ttcgtttccg aaatactaat acgcacttca    154680
     ttaccgatga atacgagatt ttttacggac cgtttcttca aatgtctgtt aacaactatg    154740
     cagacaagct gtttgagctc cacggacagt cggtaagtga cctaatccca gaaaatcact    154800
     tgactcttgc ggtgaagcgg ggagctattg aaccggaagt aattcgtgca aagtacgagc    154860
     ctcatgtagc gaagaagcta ctatcgctga gcaaacaggc agccgacgct gctggagacg    154920
     gtaattccgg cagagtggct gcgatctatg aaaccaattt ccgtctcgta aaaaggcaag    154980
     ggatgcggat ctgaatgtct acgtctcggc tgacgcggag gatggcataa cgattgtcaa    155040
     ggacattcga gatagctcaa gctactaccc attcactgct aatggttgca tcgaagaagt    155100
     gaacaaacgt ctgaagaaag caaaagtgca gatccagttt cgtgattcga agaaaaacaa    155160
     attcacatcg catgactttc agctgtttat caaagcgtac gcgatgaagg gagatccgcg    155220
     ttttagtcat gatcgcaaag caagtaacga ggtgaatccg tcgtggacgt actcgcagca    155280
     agcgatcaag cacatcgctg atgaactaat caaggatcca gaaaagtgct tggatcgatt    155340
     gaaatttgct gtatctaaga aaaataatta gacaccagcc ctcggagcaa aggattctca    155400
     ggccgaagcc ctactcccat tcgggaaccc agctttatcc ttctcgggtt ggtgtcttgc    155460
     cccagagact acaggcatat gctcgtgtac acaaccgtat aagtgttccg aaagtgtgtt    155520
     tttaatgctc aagctaaaga aatttatcca tgaaaaacct tgcaattatt gtcctaatgc    155580
     ggtgtaaagt gggcgccagc taaccaatca ccttaaactg agcccgcctg cgctccgcct    155640
     ctgacgcctc atgaactgta gacgcttcct cggcacgttt cctctcactt tccatatgtg    155700
     cttccatcgc gccgggaatg gcatcaaggc cttcttccca aagatgtgca tagatatcca    155760
     gggtcatcgc agcactggag tggccgagca tgagttgtac tgttttaacg tcagctcctg    155820
     ctgcaatggc gatggatgcg gcagtgtggc gcagctcgta ggtgtcgagg tcgccaatcc    155880
     cagtccagat gcacaggttt ttccatacaa cacgccagcg tgaggtggtc catactttgc    155940
     ctcgttcatc tgggataagc caggaatcag gatcttttcc ttgagcgtag cgatcgagga    156000
     gtaacagaat ttcgccgccg atgggtacgt cgcggtggtt tcgtgttttt gtcgagtctt    156060
     cgtgtcctaa gtcgtcgacg tcgcggcgga tcatgagacg tccgcgtact gggtctaggt    156120
     ctttgacttt gagtcctttt gcttctcctg gtcttagacc ggtcatgatg aggacgcgta    156180
     ggaggagttt tgcttgttcg gtgggtgctt gtctgatgag ttcgtcgact tctgtgattt    156240
     tgaggtagcg gcgttctgat ttcttttgtt ttggtaggtc gccagttctg atggggtttt    156300
     ggtggatgac gcctagctcc actgcgaggt cgaggattcc gtggatgatg aggccgactt    156360
     tgcgcatggc tgattcgctg agtggtcgcg gtggttggct ggctggcacg cctttcattg    156420
     tggagagtgt ggggatccat gcgttgatga ctgagcgttg gatgtgtgcg caaggggttt    156480
     ggccccattg tggtcggatg tggacgttcc agtagctgag gtagtcgcgt ttggttttgt    156540
     ctgagatgtt tccttttgat gcgatccagg gttcccatag gtcggagagt gtgatgtcga    156600
     ctttgtcttt ggtgatccag gtgccgtctg cttttccgac ttctgcgcgg gctgcccaga    156660
     gttctgcctc gtcgcgggtc tcgaatgttt ttgttgcttc gcgcccgttc tcaatccaga    156720
     cggcttgcca gcgcttgccg acgccccatc gcgctgatcg gatacgtttc gttttggatg    156780
     tggtgttggg gtttcttttt gtccagaggt cacggacggt agccatgggg tagacttctt    156840
     tcttgcttag ttctttagaa ggggctgggc attgcccttc accgggtctt gcttgccggc    156900
     ggacaggtga agggcacttg gctgtctatt gcttatgcag agatgtcacg gtcgctagac    156960
     cctcgttcgt cgattgatgc tttttgatgt tgttggagag taagtcgatc gggtcgatgt    157020
     agacgttttc aagaagtacg tcgacaggct cgttgatgtt ccagccgcgg cctgcgattt    157080
     gcattcgtag gctgcggtag cgtttgtagt cgatgagttc gagttcgtgg gcacgccgga    157140
     cgattgcttg gatggagtag ccccattgag ctttgagctc ggcgtagtcc ttgagcgtta    157200
     gctctggagt aattacaggc gtgaggaggg cgcgtggcat gaggaagctg gcggcgaaaa    157260
     tattcgcttc cttttccatc tgggatttgt cggatcggag tgtgttcgcg tgaagtatca    157320
     agtgagcgag ttcgtgtgcg aggctgaacc gatagcggtc tccacttcgt tgttgattga    157380
     gcgcgatgat cctcaatgtc gagtcggtcg gcgttgaaac tccgtcaaag ttggtcccct    157440
     caacgacgta gtcaggcagt gaggtaacga ggattccgtg gttgtttaac actgtggtga    157500
     ggtttgggat cattgaatct tgatcaatcc caaagtgatc ccgggtttga gaggcgaatt    157560
     cttccagcat gcggaggctc agctcgcctt cgagatcggc aatgggaatc gtgggtaggt    157620
     ctgatgtcac gtcggggtac cgttcacgaa ggtaatgttc ggcgatggaa aaggctgcag    157680
     ctatcttgtc agcgtttgca cggccttcgc gtgctgagcg gaagagtaga tcgggtgctg    157740
     cgtagaagtg gatggatgcc tcgaaatatt cagcactgac tccggtttga aaccgtgcgg    157800
     tgttgatgag tttcgtgctg gggggtcggt tttctcgctc gacactgctc aaggtggatt    157860
     gggcgatgcc taattgctcg gcgaattctc cttgggatcg tccgaggagc aagcgtaggt    157920
     gtttcaggtt cgagctgagg gttggcatga gttggctttc tagcttccga aaacgaagcg    157980
     gggttcgtct gcgtgggtgg ggatgaacat tgcagttgtc agtgattcag gttttgtgag    158040
     tagtggaatt ttctcagaca acatggtggc ttcttcgaga gggccttcgt tgtcgaacat    158100
     ctggagcgag atccgtttga gcgcgtcggt tccaggctct gcatatttcc agaagaggac    158160
     gatgcgagat cgacgctcga tgagcggcct ttgtgatgat tcctcgttcg ttccatggcg    158220
     aaatccttcc ggcctgcgga aaacgagggt gacatcgtcg tcctcgaagc ggaggctgag    158280
     tggaaacatg gattcgtcga tcgtgagccc gccgagtccg ctttcgtgga attgcttgtg    158340
     aatggctacc accatgggat cccttgtcag gttgcggtac cggttgatgt agtcgccgta    158400
     ggggagcaag tcccgcatgc gccgtccatc ggccagcgcc tcccgtaggg catcatggtc    158460
     agcttcaaga ttgcggagta cccgcttcat tgtgaatagg ttttcgccgg tagtgtgggc    158520
     catgccatat tcctttctta taacagttcg agtgatattt taacaaaata tcgaaaatat    158580
     cacaccgatt gttacatatg agaaagtgat taaggcatta acatgccctc ttctccggct    158640
     gaatccttcc tcgctcatac atccccatcc acaaaacgag tagatgaggt gtaacaccca    158700
     actctgcagc catcgccgca gcagaaccct cacactcaag ccctacagcc tccacatcac    158760
     caacatccaa aagctgctgt gctgcccact catcagcctg ccgctccgcg ccgggagttg    158820
     agcagttatg cccgtagtgg gcatgtccta gttcgtgggc gatggcgcag cggcgggtga    158880
     ctgggtcgag gccaattttg ataaagattg tttgtgttgg tgggtgaaag caagcgttga    158940
     gggtgcttcc cagcttgctc gtctcgatca ctgtgatgcc catggtgtgg gcgagtgttt    159000
     cgagggctgc ttccacaggg ctcatgaagt gctcctaggt gtagttttct tcgagtgggt    159060
     cggtggcctt ttgcgctgca attggctctg ttccggcgtt gatgccgtcg aggatggcat    159120
     cgtagtcagg ctcagtgaca tgcgggggtg cggtggggga gttgttgccg cgttttgctt    159180
     tgcgacgggt gtccaactcg ctgattggtt tctccgccca gtcggcttgc cggctttcat    159240
     tcgtcggaga atctcggcga ctagatcttc atcactagcg tccatgattc cgctcgacgt    159300
     tgaaaatgct ttgagatcga actcggtcag cacatcgagc gcgagcagcg ctgggacgac    159360
     gctgacctgg tatgcgcgtg cgatcttcac tgccgtttca acggtaaccg tgccatcgcg    159420
     gcgttgacgg ctgagtgttg attggccgat gttcgctagc ttgccaatct ctctatctga    159480
     ggcattgcca acggtctttc gaatccagag ttcgatgcgt tccatgagct aataatgaca    159540
     cacccctgta gtaaatacaa cacattgcga agcattggcg cttgacagtg tgagctagaa    159600
     atgcttcact atgagttgta ggaacttcac tagaggggat gaacatggca aatgtaaaga    159660
     tcaaaatccg tgacggactc atcgaccgcc tccgaaacat gagcggaatc accagcgacg    159720
     aagccttcgc ccgaaccatc ggaaccagcc gaagcacact cgtcgacgtc aaaaccggcg    159780
     aacgcgaacc atccctcgca ttcgcaatcg gaatcgccca agccttcggc ctaggcctat    159840
     ccgaaatcgt cacctgggaa accgaaacca cagcagccta aacgcgccgg gaactaggcg    159900
     tcgaaaagca taagaaagga actactcatg gcttgggaaa ggatcggcga agatctgcat    159960
     ggtcgtcgaa aagtaattga cctcactgga gtgacaccga agcaacaacg tccacgccaa    160020
     gttaaggcac gccaagaact tgagcgagca atcgcacaat tgaaaagaga agaaaccggg    160080
     ttcagcgttt atgacgcagc gggcgtacca gaggaatggc taccgctgat cgcggtacgg    160140
     ctcaaagaag tcttttgtgc gttgctccgt ttccagcgcg aggtcaacgc cgtcgtagca    160200
     agcgacccag acttcgccac cgtccgcaag ctcgaaaacc tcaaaggggt cgaactgctc    160260
     cagcaacgga ccgccgggga aatcttggag actgccttgc tcttgtccga atgggcgccg    160320
     gtcgagtcgg tcgcggtagt gcgcggaatg attcaaacgc tcggtgatac ggaagtggac    160380
     agaagcgaca tctgaggtcg ccagcgtgta gcgctgacca ccataaacaa gaacaacttt    160440
     agacatatca gcagcataaa ggaaagaaaa tgcagagttt attcaggctc cgagtcaaag    160500
     gtaccccgct tgttgaactt cgggtcgtcc cattcgaaaa agataggttc accatcgtcc    160560
     atgctgacgt caaggaccct gtaaccgtac atgcggtcac catcgaagag atccataact    160620
     tgatgacgct ccttttccgt caaacgctca ggaatctcgg ggtcagcagg atcgggaaag    160680
     acgaactgga cgtcgtaatc aggcttgatc cacaggctcg ggaaactgga cgtccgaagg    160740
     ttaagcggta caccgccctc gttgagggta ttcacagcgt aggagatcca ggggaaagac    160800
     cagtacggca tctcgtattc gtaaccgttg atattcagcg tgaaagtttt attgctcata    160860
     cgaaaagagt aatccgcagg atcaaacacg acagcagatt ccaccgaaaa atgaagcatc    160920
     tttctgaaag gaggaagcga gatggaatta aaaccattta atttccgtgg acacaatgta    160980
     cgagtcttag ttgcagagaa cggggagccg ctgtgggtag gacgagatgt atgtgcagtt    161040
     ttagagatca aaaactctag ggatgcacta tctcgtatcg atccagaggg ggtcggcatt    161100
     gccgacaccc ttacaccagg aggtatacaa aagctcaaag tcgtaaatga atcaggatta    161160
     tacgaactcc ttttccagtc tcgcgtacct caagcaaaag aattccgccg gtgggtaacc    161220
     ggagaagtcc tgccagaaat ccgtcgccac ggcatgtacg cgacaaccgc aacggtagag    161280
     caaatgctcg ctgatccaac aacagcaatc aaacttctgg aacagattaa gcaagagcgc    161340
     gaccagcgcc gggcgctcga ggtgcaagct gcgattgata aaccaaaggt catgttcgct    161400
     gatgctgtcg cggaagctaa cactgacatc ttggtacgtg acttagcgaa gatcttgcgc    161460
     ggcaatggta ttgaggtcgg cggaaatcgt cttttcgcgt ggcttcgaaa gcacaaatac    161520
     ctcatggacg ggccaagcca cattaagcac acaccaacac aaaaagcgat ggaactcggg    161580
     ctgttcaaaa tcaaagaaac agtggtgacc agatccgacg gaagatcatc gatcaccgta    161640
     acaccgaagg ttacgggaaa agggcaacga tatttcgtcg agaggttcct cgatgggcgg    161700
     ttcgacatca atgacatcaa gacaaataaa aaccgacctg ttgcagcagg tcggaaatga    161760
     cactcaagga aaagcatcta tgggaaacac taccacgatc gaccgatggc tgtcgccatc    161820
     gcaagctgcg gaaatcattc catattccgc atggcaaatc cggaagttct gtcgacaggg    161880
     gatcctgccg cactccaaac gacctggatc aaagcagaac cgcatcatga tcaagcactc    161940
     agacctcgtc aatttcatcc agcaaggagc agcagcatga caatgcgcac ttataaaaac    162000
     ccataccccg acagcgaaga tgctgtcgaa atccgcttcg atcattgccg tgaagatatt    162060
     gcaaaagcag cacaagagta ctggcgagaa atgacagaag cagaactcga tgaccttcaa    162120
     gaagaaatca tgcgtgcgct tgccgtcagc gagtggcaaa acatctggct tacaagtgcc    162180
     gcattcatca cagttcttgc ctaccatttc cacgattaga ggaagaaaaa atgattcttt    162240
     tagtgctcat aaacatcgtc ttttcaatgc tcctgctttt caacctgact gatgcaaatc    162300
     gaaagattga ggacgcgacg aagcgcctag acatgctcaa tgaagatgtc gacgtgcaga    162360
     gcgtgaaaat ccttgatctc tatgggatcg cacagattcc accaatgcca gatgaagagg    162420
     cagcgtctcg aatcttcaca gaggtgcgga gatgaaccgg acagctttag aagaactgca    162480
     ccaagctctc atatcggagg cagaagcaat gcgcactggt gagtatttcc taggcgccgg    162540
     catcgttgat gcatatgcac atcagctacg ggaggcgatc gactctcatg acgaataacg    162600
     aaggaatgtg caagcactgt ggagcagccg tgctcttcgt taaagacgac cgatggcacg    162660
     tttttgatgc aaagccgtcg gaagaaggcg aatggcggat acggtcacga tgggcggcca    162720
     atgtcgcggc agaaaaaacg acagtgacgc gtttaacgga gtcgaaattg cgccgagcac    162780
     gcctcatggg agagccactt tttcgcccgc atttccagac atgccctgcg aacccccgcg    162840
     caaaaattct gcaggagaag cggagacatg gatgatgcat caatcgcaga tgagtggtgg    162900
     gagaacctac cagaacgaag aaaaatacaa atccatcact ggatcgtctc gcctaggcaa    162960
     atcaccatcc aggaactgcc cggtcagatt gcgctaatag aaggaacaga acaatgacta    163020
     aaacacagct agtgtgcgac aaaaaccaat tgaactgggg gctgaaagcg gcaaaagcaa    163080
     ttgctgggaa gagcccatat gacgttgttc agatgagagt ctcaccagac cgcgattatc    163140
     tgtatatctg cgcagttaat gccgaagcaa cgctggtcgc caaagtggag cttctcgtcg    163200
     cgaatatcag tagtgaagaa gatgagatca tcacgataga taaggcaaaa atcccagcat    163260
     tgatcctcgc gactgctgag accgggaaga aatcggaaga ctcgcggcct atggcaggga    163320
     tctgcattcg ggggaaagaa gttgatttca ccgacgaaaa tggggctggg cgcggagttg    163380
     atcttacgac gattcaccgg aacgattctg cagaaatcgg agatcctgtc cgcacaatca    163440
     ttagagtcaa acaatagctt gctgaaacat cgccttgcga tgtgacgcca tcgccagctc    163500
     agataacaga actagctcgg gcaacgcgat acctaggagg caatcccacg ctgagcatgc    163560
     gctcgtatat gcacgaggga actgaatcgc atcgacttgt ggctgaggcg acattctgga    163620
     ccttgtcagt actcaacgtc ccagaagcac tgctcgaaac cgaaaaagat aaagccaata    163680
     tcgtcgatgc agcaccaatc ggagggatct catgaaacat attgacgcag cgatctgtcg    163740
     ccaaaagaca gaaggcaaaa ccgcggggcc taactactgg gattcccaag gcccttgaga    163800
     atcaactgta gcaatgctgg aacgtcacaa aatagctaga aaaaagtgca tgacctgcac    163860
     acttctggcc gagtgtgaga agatgctttc cgattttgaa aaagaagaac tcagagtcga    163920
     cggagttgta gcagggagat actgcgatgt ctcacacaga aacggctcga gtatcgatgt    163980
     cttgcgacat tgcaagcact gcaatgtccg attgataccg cagggtggcc cacggggaaa    164040
     agaacccagc ggggctcgaa aacaccgggg agaagggctc tgtgcggttt gctatcccct    164100
     tttctcaaga aaacaacgct aaacacaatg actagcaaag gaaatagacc atggcatgga    164160
     gcagagtcgg cgacaacatc gccacacatc cgctcatgtc gaggctcctt acctcatgcg    164220
     aattcgacca ctcgctcaaa aatgaggcgt ttggtgcgct cgtccagctc acaactgtgt    164280
     cggctgcgca tctcactgac tacatcattg agtatgggct catggcgcaa atcgcacctg    164340
     gacgtgaaaa gcaactgatt gacgttcttg tagatgccgg aatgcttttt cgcgatgaag    164400
     ttgacgggcg caaggttcta cgaatcgtcg atgacaatga gctcctccac aatcgcagcc    164460
     gggatgaagt cgagatcgac cgccgtcgcg ccgctgataa gcgcaacccg gctttaatcc    164520
     ccgcagttcg ctaccgcgac ggcgaccaat gccgctggtg cggtcgcacc gtcgactggc    164580
     gtgatcgtaa aggtggtcgt gcggccacga ttgactcact taatgagcat cgggaatcaa    164640
     ccgtggatac gctggttgtc gcctgcaaga gctgcaactc aaaacgtggc gcaggtgaag    164700
     aacttcaact attgccaacc cctacgagag aaaaggtaca ttacacagac cacacaatcg    164760
     actggattaa tcgttccgag tgggctcagc atgagggcat tcatctcgag ccacgacaaa    164820
     cacacctgga catcggacag cagatcacaa caccggcagc gccgtcggag cagcagcagg    164880
     tgggtcaagc agcagcgcct ttggaggcag cagcgcgggc ccatcgagca gcgcctgatg    164940
     ttgaagcgcc attcgttagt gatccgcttg atgaggctcc agactgggtc aaacaatctc    165000
     ttgtcaacga tcacggacag gcagcagcgc ctttaatggc agcagcgccg cgtgaacatg    165060
     atcatgcacc ggcagcgccg tcggagcagc agcaggtggg tcaagcagca gcgcctttgg    165120
     aggcagcagc gcgggcccat cgagcagcgc ctgatgttga agcgccaccg caacaccacg    165180
     ttgataacga aacggtaaaa cctagcacgg atctagaaca aatcacagat cggtggggtg    165240
     acggatctag atctctcggg acgggacggg acgggaatgg acaggtaggg acggcaaggc    165300
     gtcgacgccg taggcgtaga ggtggacgtg gaactggaag gaataaagct catggatagt    165360
     tggaagttac attctttagg gaaagctctg tatgagttgg agaagttagg ccctttgctt    165420
     gatgatcttt tactcccttc tcagtgcggt tattctgaag gaaggggagg ttctgggcaa    165480
     gggtcgcgcc ctccattgag gattccaatt ctggatgtga agtgggagac ggagcggttg    165540
     ttgtcgtatt ggtcggctcg tcttgctgtg cggttgcagc ttgttcctcc gagggctcgg    165600
     agcgtggcga tatctgcggc gtggttgcag cgccatttga ttgagattga acctgatcca    165660
     gagtttgacc aagcagcaga gcagatcatt gagcaagcaa ggatcattga tgcgatgttc    165720
     actgaagatg caactccaga cgaagacatg gaaggaacat gccgtgagat cgcatcagcg    165780
     tgccggcgct tgggctatga gatttccaag accacagtgc atcgatgggc acgagaggaa    165840
     accatctcct cgaagacaat ggaagacggg cgagtcatcg tgtcactaca agaagtcatt    165900
     ggaaagctca cagcctgcga caatgaagaa gtcgtagaca gtgggacacc caatatagta    165960
     agctgacgct cgtatcatct gggtccagac cacaacaatg tggctgggcc ctttgtcatg    166020
     catcaacgat gcaacacgag gggaggacaa gacatggggt ttgactctag agctgcgaaa    166080
     aaactcaaag caatgttcaa acaacaatgc cgtgatgcag gtgccgtgtg ctggctctgc    166140
     ggacaaccca tcaactacga tgccccaccg aacagcagag actcattcga gccggatcac    166200
     ttctacccgc aggcaacgca cccagagctg gcagaagacc cagagaatct tcgaccatcg    166260
     cactgctcct gcaacagatc ccgtaaagac ggagtaccag cccccagcct cgggagccta    166320
     tccgagcaat ggtgagcaaa caccagctag ggagggggta tcaagatcac gggaacgaaa    166380
     tccacggacg ggtgaagggt gggtcagctg gcctctctcc ccgcagatac cccccttacc    166440
     tcgaccctca ataacacggt gaacccaacg atcggaggtt gaagtcattg gctactaatt    166500
     cgcgccgggt aggcgaactg gagcaagcat tttgtgattc gatcgctgcg ttggaggcag    166560
     acggcattgc ggtgccggaa aagtattcag cagtggtgat gctcggaaga ctctacgcat    166620
     tcaacattga cgaatccgtg aacaccgaca ccgagcaagc taccaaagcg ctgtacctag    166680
     gtccgcactt gatgggcgtc atgaagctgc ttggcacggc tccaacagag gcaagcgggg    166740
     aggataaatc cagcgcacca tccaacgttg tcgctgatcg aatgaaggtg ctcgaaatca    166800
     tgaaggagta caagaagcaa aatgggggct aaaggaaaaa cggaaccacg gtttttccct    166860
     ccaccgcttc gtgagctgac ttcagaaacg tcagcgggat tcgaggtcat cgaatttgca    166920
     aagcttcttg gcatcgagtt gtacccgttc cagaaatggg cgctgatcca tggcctagag    166980
     cttctcgaag atggttcatt ccgttggcga gtcgtcgtta ttgaggtcgc caggcaaaac    167040
     ggtaagacca tgctgatggt tgttctcggc ctctggagaa tcttccaata tggagcatct    167100
     cgcgtgcttt ctgccgcgca atcgctcagc gatgccgaag acacattgaa cgaagcattt    167160
     ctaatcgcag cgtggaaccc cgtgctgcga acattcctgc cagacaatcc gcgaagtgag    167220
     ggagaagatg acaaattcaa tggcgcgtgg cgaccccgcg caaacggcaa agcttcgatg    167280
     aagctggcat cagcacctgt ccctgggatc ttggacgttg caaaaaccat gccgatctgg    167340
     tcactagctg tcacatcgcg caaaggcgga cgctccaagt cagttgatct cgcgctcctc    167400
     gacgagctcc gcgaacatct cgactgggaa gcctggaacg ctatcgtccc aacatcaaga    167460
     aaccgcccac aatcacaagt ctggggattc tccaacgcag gagatcaatc aagtgtcgtc    167520
     ctacgatcac ttcgagaatc tgcgattagg cagatcgatg acggaaacac cacatcaaaa    167580
     acagcgtttt tctcatggtc agcagaccca gaagcaagca tcctagatcc agaagcccac    167640
     gcacaggcca acccatcaat ggggtactcc aacatcactg ccgaatcaat catggcagaa    167700
     gcagaagacg cactatccgg cgacaatgaa gccggattcc gcgccgaagc attatgccag    167760
     tggcagcaag tcatcacccc aggcaagatc ccaacgaaaa tctgggaatc tctcacagat    167820
     ccagaatccc accgagcaac agatgcaccc gtacacatcg ggatcgatgt cgcctccgat    167880
     ggacgattct cccacatcgc gatcgcatca caacgcgaag acgggctgtg gcacatcgag    167940
     atcatcgcgt ctcgcgccgg gtttaagtgg gtgcctgaat ggcttgggcg tcgaaaggca    168000
     gaggcatggt ttcctggcaa ggttggaatg cagatcaaag gttctgcatc agctagtttg    168060
     gctccattgg tggaagaagc tggtattgag gtcatcccgt ggcaaggaac atcgatgtct    168120
     gcatcggttc ttgggttcat cgatgaaatt cggaatcgag ggctcaggca cagatcacag    168180
     ccaatcctca atgtctctat tgaaggtgca attgatcgac gtctgggtga catttcgatc    168240
     tgggatcgtg tgaagtctgc gactgatgtt tctccaacag tggctgcgaa cattgcgtgg    168300
     tggatggcca cacgccctga cgatgaccaa tttgtttctg cttatgcaga tgaagactac    168360
     gacacagcta tcgattatga cggcgatgat tacgacgatg acgattactt gctcattgtc    168420
     taggaaggag gcatcgtggg atttctccag agaataggat tgctgccaca ggtgacaacg    168480
     acaccaacgc agcacgagct tttagcgccg cttcttgata catacatcgg tgtggtcaca    168540
     gagatgccaa cagaagagct gttcgcagaa cagcctcact tgcggacggt cacgacgttt    168600
     atcgcgcgag cgatttcatc aacatcgttg catgtgtatc gccgagattc agacggtggc    168660
     cggcatcgcg tccgcgactc ggatctggca aaactcatgc gcaggtcatc gaagactgag    168720
     ctcatgcagg acatgttgaa tggctccatc ttggatctgt gtctgtatga cgagtttatt    168780
     tgggtggcca tggaagatag cgattcaggg gagtgggaac tgcataggat cccaccgacg    168840
     tggatcaaac aacgcaagca ctcagatccg tggacgctgg aatggatggg gatcattgac    168900
     gcgaagactg ggcagcagat caagatccca gcagaacgca ttatccacgt gcatgggtac    168960
     aacccaacgt caacgtctcg cgggcttact ccagtcgttg cgcttcgcga gacgctgaag    169020
     gagcagctgg agtcagcggc atatcgtggg cagctctggc gcaacgggcc gcgtctaggt    169080
     ggcgtgatca cacggccaaa ggacgcgaag tgggattcaa catcgcgtaa gcggtttaag    169140
     gctgcatggc aatcgcaata ctctgggcgt ggttcaggtg ctggcggaac accgatcttg    169200
     gaagacggaa tgcagttcgt gccagcgcat ctgaaagcac aagacgaaca ggttgttgag    169260
     atgaccaagc tgtcattgca gacagtcgcg agcatctacc acgtcaatcc tgtcatggtc    169320
     gggcttcttg ataacgcgaa ttactcgaat gtgcgcgaat tccgacgatc actgtatggc    169380
     gactctctag ggcccatcat caaacaagtt gagggcgtga tcaatgaatt tttgcgaccc    169440
     atgattgacg atgatgatgc ggtgtacgtc gagttcaatc tcgatgaaaa gctacgagcc    169500
     agctttgagg aaaaagcggc agtgacatca actgcggtcg gtggcccatg gatgacaagg    169560
     aacgaagctc gtgcaatgaa caaccttccg gcaattgacg gtggagaaga tctgattact    169620
     cctttgaatg tcactacaga gaacagcgaa agcaataacg atgtgggatt ggaggaagaa    169680
     tcatgactat ccatgtcgtt ataggccctc cttgttctgg gaaatcaagc tttgttgagg    169740
     ctaatgctcc agctgggatt gggcgcttcg atttcgacaa cattgcggga actgttgcag    169800
     ggcaagacgt taaaaatgca tcaccgaatc cagttgccaa tgccgtgttg gcgatgcggc    169860
     gtgggctgat ggggtggctt cttgacgttg aacttgatcc accagagttt tggttgatta    169920
     acgcgcaacc atcgccagca ctgatagcag ctctgagtgc acgtggggca acgtttcatc    169980
     tttgtgaccc agggatggag gaatgcctcg cacgtgctgc cagagatggg cgccctcaat    170040
     ctgtcgaaga tcgcattcgg cagtggtacg acaatccacc tgagctacct acgaaaggag    170100
     ggcacgaagt gaaaacgaaa agctatgacg tttcgatcga cgagacacaa acagagggaa    170160
     caatcaccgc atacgccagc gtattcggaa acgttgactc ctacggtgac gttgtcattc    170220
     caggtgcttt cgaagagaca ctgggtgaat ggcagaagtc agggaataca atcccgctgt    170280
     tgtatgggca tgatttcaaa gatccgttct cgaacatcgg tggagtgaca tcggctgttg    170340
     aagatgcaca cgggctcaaa atcactgcgc agcttgacct cgacaatccc aaagcgaggc    170400
     aggtctacaa cctgttgaaa gcaaaacgac tctcacaaat gagttttgcc ttcgatgttg    170460
     ttgaaggctc gtggggagaa cgagaacagc aggaagttta cgagctgaaa aaggtcaagc    170520
     tctacgaggt ttctgtcgtt ccaatcggag cgaatcagga gacgagcatc attgatgtga    170580
     aagcagtggt agcggaagaa ctcgcgaata tgctcgattc acgtcaacta acaaaatcaa    170640
     tcagcaacaa gcctcctaaa cagggggctt ttgctctatc tgcgctcgat gcgcatctca    170700
     gcatattgga aaaggagaac cgatgaacct caaggaccta ctcgcacacc gcgagaatct    170760
     gatggacagc gcaaagcgag cacgcagtgc gatcaccgac gatatggacc cagcagacgc    170820
     agcgcaggcg gtggagaacg tcaagagcat cattagcgag atcgaatcta ctgacgaagc    170880
     tattgctgca cgtcgagggg tttctgatgt cacacagaag ctcaagggtc tgacgatcac    170940
     tgagcgtggc actgagaacg attctgcagc ttctcgttcc cttggagagc actttgttaa    171000
     ggctgcaggt gaccgactca agaaccaagc ggcaggtgcg catattgaat attcagttcc    171060
     tgaatatcag gtgaaggaag atgctcacag ctccccgaag gatcttgtcg agggatgggg    171120
     gaccttctac cagcgtggca tcatcaacca gcggcgtgag cggcttgttg ctgctgacct    171180
     gatgggcgca gcgaccgtga ctgcatcgac ggtgaagtac atcgtggaaa aggctaaccg    171240
     tattgcatcc ggtgctccgg caacagtcgc agaaggaaca aagaagccat atgtgaagta    171300
     tgccgacttc gatgttgtca ccgagtcact gtcgaaggtc gcagcactgg caaagttcac    171360
     cgacgagatg attgaggatt acgactttgt cgcaagctgg atcaacaaca acttggtcta    171420
     cgacctgtcc gttgtggaag aaaagcagct gatcaacggt gatggtcgtg gatcgaacat    171480
     caaggggctg ctgaaccgag aaggtatcca gacgcataaa tctgcaaagc aagcagattg    171540
     gtttaacgat ctgttcaaag ccaagaacaa ggtgtcgcag gcaaccaact tggaagcaga    171600
     cggcatcatg atcaacccag tcaactatga ggcgctgcgg ttgaccaagg acggcaatgg    171660
     ccagtacatc gcaggtggac ctttccaagg acagtatggc aacggcaaca tcctcattga    171720
     tccacctcta tggggaatca agacagttgt gtccaatgct gttccagcag gaaccgcaat    171780
     tgtcggagca ttccgacaag gagcaaccgt cttgcgcaag ggtggtgtcc gcgtcgattc    171840
     cgcgaacacg aacgccgatg acttcgagaa caatctcgtc acgctgcgcg cagaggaacg    171900
     tctcggcctg atggtgccac tcccagcagc attcgtgaag gtcactctcg aagaaactac    171960
     agaggaactc taatgcgacg cgaatacgaa gccacaacac catacgggca gaagctaacg    172020
     cttgaaatga gtgaagatta caagaacgct cattggcctg atgccgtgct actcgaagac    172080
     acttggcctg ctgcctcgtc gttcgaagca gcagagacca agaggaaaac gccaacacgg    172140
     aatcgagcac agaagccaga agccgacaag taacacacac ggaaaagggg aacaatgaat    172200
     gcgataaccc caacgccagg aatcgacaaa gaagcctttg accgcgcagc aaacgcggtc    172260
     cgcaggcttt gcggatggca cattttcccc atcatcgagg agaccatcac actggactct    172320
     ccaggcgata gtctccttgt ccttcccacg aaacacctcg tcgagatcat caacgtcacc    172380
     atcgacggaa ccacataccc actgagcgat ttccgaagca gcccagacgg gctactcgtc    172440
     aaacgccacg ggagattccc aagaggaata gcgatggtca ccgtcaccat gaaacacgga    172500
     tatgagaaac cgacagagat cctcggagtc atcaacgaca tggcacgccg agccaacgag    172560
     tcaaacctca cgcagctcaa cgtcggagga atctcagtcg gagcaacgaa ctcagccaca    172620
     ccacaatcat ctgaatggag aatcgtcgac gaactacgac taggaccact gccatgagca    172680
     tcatcttcaa ccagcgaatc gagattattc gcgccgggga aaagcggtct gtgtactcgt    172740
     ccgatgttat ggaggattgg gataatccag tggttctccc tgtggaggtt cccgtgtcga    172800
     ttcaaccggt ttcttcaaca gaatcagatg ccacagcgaa tcgcagctat gtgacgtcac    172860
     gattcaggtt gttttctccg cctgggatag acatcccaca gttgaaagcg aaagaccgtg    172920
     tgcgaattgg gttgcttgtc ttggatgtcg tgggagatcc ggcacggtgg ccgcatccat    172980
     taaaaccggc gactgtgcat catgtggaag cagatttgga ggtgcatcgt gggtaaatac    173040
     gacaagcaat tccaacagtt gaatcgcaac ccgaagattg cgcaggcgtt gaagaaccgt    173100
     gcggagaaga ctcgtgcagc tgctcagcgg atttctgatg cagaaggtgg gacagctcat    173160
     taccgcgtgg tgtcaggcgt gcgtccagga ggccgtgcgt atgcctatgt cgtttcggac    173220
     aatcgtgatg aggaattcgg aacggagaag acgaaacgaa tcggagcgct ccggagggca    173280
     gcacgtggtg gatgaaaaag ccgtgattat cagcaaacta tcgaagctgg ggtttccagt    173340
     gtattcagaa ttgccgcatg atttcgaaga aaagcatctg ccagtgctct gggttcagca    173400
     tgtggggcct gcagctagga ggcaggcgat caactctagg gggatcgatt acgttgacct    173460
     cgatattgat ctcttcgtct cactagatat gtggcacaca ggtgcagcaa tggaactagc    173520
     gcagacgata cgaacacata tgcatcgatt ccgcgagggc atgctcaaag tcctcgacac    173580
     agggagacct gaaccgcgcc ctgatttcaa ttccacaatt cgccggtgcg gactgaccat    173640
     cacggtcgct gtgccggctt aaccaatttt tccgtaagga gagtaagaac atgactgatt    173700
     ttgatattga tacatctgct gccaactacg ctgacgagct tgcattgctt ggagtgacag    173760
     gagcgatgag ctacgccccg aagggaacgc agatgccaga aacaatcgca cctttgaacc    173820
     caccatttgt ggattttggt tggctgtctg atgggggaat cacagagtct cagaacgagg    173880
     aacgaaacga ctggacacca ttccagtcaa ccaacccaat tcgtggacag gtaaccaaac    173940
     aggatttcca gttcaagacg gtcgtatggt cgatcagcgg ccttgccaat gcaatgtatt    174000
     acggtgtgcc tgaatctgac atgcgttttg accaagaaac aggcgtcacg acctttgaac    174060
     agggcaagga acttccacca gacttcaagt tcggcctcgt cgtggatatt gtcgatggcg    174120
     gaaaagctcg gcgacactgc atgccgaacg tctcggttgt tgagcgcggc gacatcgtct    174180
     acagcaagga cgatcttgtt ggctatgaaa tgacattccg cgccagctac gacccagtcg    174240
     ctggatatgc agtgcgtcgc atgttcaagg aaggctggaa gccaggacac gctgggacga    174300
     ctctcgccga cgaaaacaaa gacgcatcgc taggtgattg gtcgaacaca ctcgatgaat    174360
     ccgaagtcag aaaacagagc aagaccgtca ccctgccaaa aggtgcgacc ggtggcacgt    174420
     ttaccgtttc tatcaacggc aaagcttccg cagcgattaa ccacgatgca acaggcactg    174480
     ccatgaagtt ggtgcttaac aaagttgatg gcggggaatc tgccaaagtt acaggccgtg    174540
     caggcggccc atacaccatc acaggtgttg aaggagaaat cactgctgac ggcacaaacc    174600
     tcacaggtag tgacactcag gacatctcga ttaactaaca accatggctc tacgttttct    174660
     tggcagaccg gcgtagggcc atacccatag gtctgctaac ccaacttttc atcacatcta    174720
     cataggaggt ctgccatgac catcgatctc aacgccatgc tcgcaaagcg tgctgaagtc    174780
     ctcggagaag gaaacaagtt tgacgtcaaa ctcggcaaca agacgttcta cttcgtcgcc    174840
     cctgaacttg catcatctga gtggaatgat cgccaccaag cattcctcga agacatccga    174900
     gacgggctga tgacatcagc aacagcccgc gaagaattcc tcggactagc gctcgaagac    174960
     caagcagaag aattcgcaga ggcagccgat aacatcggcg ttgacccatt catcatcgca    175020
     cagatggcat tccaggagca cgccgaatac gtgggaaaaa cccaatccca gaagtcctta    175080
     aatcgcaccc agaggcgtgc gaagcagcgc taatcgcaga atacgggcac gactacgtag    175140
     cagctttctg gcgcgaagaa atcacaacca gaaagctgct cgtactcatt agccacctgc    175200
     cagaaaattc agcactccac aggagccagc agcgcgagac attcgacggg aacctgtgga    175260
     accaagaact ctccatgatg tgggagatca gcaacctcat caggatcacc aattttctgt    175320
     tagaacgcag ccaggctaaa aaccccaacc acgttaaagc cccaaagctg aaactctatc    175380
     cgtggtcacc agaccaagac atcaagcatt acggaaaggt ggacgaagag gatcaagtcg    175440
     acgccgtgaa cttcctcctg gggctttccc caccaccgca ataaggagga agaacaatgg    175500
     acagcgacgc aacatatgtg ccgattcttg cctcattcga cggcttcttt aaatccatcg    175560
     acaaaaatgc ggaaaaagct ggacaacaag cagcaaccac attcgcagaa tcgatggagc    175620
     gcaacctcca acgcgcagaa cgagccgcag aaaaagccgg aactgtcttc gaacgcgccc    175680
     acaaccgcgc agcagacgca gcagcaaaga cccaaatcgc agagctcaaa ctccttgaag    175740
     tcaaagaaaa acaaggcgcg aaagcctccg aggttgcagc agcagaagca aaagtagaaa    175800
     aagcgcgccg ggatcaggag gcagctgata aggctgtagc aaaggctgca aaatcgttgg    175860
     catctgcaca agatgatgtt gctaaggcaa cgcagcaagc cggcgatgcg atggaagtta    175920
     acgctgaaaa agctgggctg ttctcaaaga tgacaggtgg gcttggcgac aagcttgggg    175980
     cgttgcctgc gcttgctgcg ggtgctgttg cggggttcgc tggttttgtg gcgatcaagg    176040
     aaacgctgtt ggatgttggt tcagcatttg acagcgctta tgacacgatc cgtatcggca    176100
     cgggcgcatc gggtgaggca ttcgctggtt tgcagcagtc gatgcgcaat gtagcagcca    176160
     ataacatcgg aattggcgat gatatggagg ctgtgggaac tgcgcttgca gacattaaca    176220
     ctcgtctggg attgactggc gcaccgctgg aaaagatgac ggcgcagatg ctgcagttac    176280
     agcacatggg tgttgatgcg gacattaacg ctgtatccca agcgcttaac gggttcggta    176340
     ttgaagcaga tgcgatgcca gcagcgcttg attcgctgtt ccaagtctcg caggcgacag    176400
     gtttgaccat cacggagttg tcgaattctg cggtaaaagc tggccctcag cttcggcagt    176460
     ttggcttcag tatggctgat tcagcagcgc ttgtcggcca gctcgataaa gcaggcgtga    176520
     acgctgatgg tgtgctgtcg aagatgtcga aagcactgac aacgttcgcg gccgagggca    176580
     aggatgcacc aaaggcgttg aatgagacga tcacctcgat tgaacagctg gtcaaagctg    176640
     gtaattctca aggtgctatc aatcttgccg aaggaatctt tggggcaaag ggtgcagagc    176700
     agtttgttga tgctgtgcaa actggaaccc tttctgttga agatttcatg agtgcgacag    176760
     gcgcgacaaa tgacacaatt tctgggttag ctgctgaaac tgcgtctttt aaggagcatt    176820
     ggcatcagtt caagatgcaa gcgatgctgg ctatcgagcc tgtggcaaca gcagtgttta    176880
     acatgctgac tcctgccatc ctcaatctga aagatgggtt tacctcagct atcgagtttg    176940
     tcgagaacac ccttgtccca ggttttaaaa agatcccaga cgtactagca gtaacagcgc    177000
     agtggcttga tgataacagg aacaaactga ttgctcttgc agttgcagta tctccgattg    177060
     ttgttccttt cctcgtcggg ttggctgcga agtggactgc tgcaggtgtt gcagcaacag    177120
     tatcagcagc aaagcaagcg caagcgtggg tactgacgaa gattgaggca gctcaagcaa    177180
     gtgctgcaaa tatcgctgcg ctgtggacaa caggtgcggg atggatcaaa gcaggcgcgc    177240
     aagcaatact cggagctggt cagattgctg gtgcatggct actgactaaa gcacagtctg    177300
     gtgtatctat tgtggcgtcg atcgctgcgg tgggcattgg ctgggtcacg actggaatcc    177360
     aagctctcgc aggagcagcg caggtagcag cagcatgggt aatcgggctt ggtccaattg    177420
     cgtgggtcac tgcagcaatt gctgcggtgg gagctggact tgtgtggttc ttcactcaaa    177480
     cggagaccgg aaagcaagcg tggcagagct tcacctctgc gctacaagct gggtgggatc    177540
     tattttcctc agcattgcgt acaggctggg agatgctcaa aactgcagtg tttgatgcgt    177600
     ggacagtccg tgtggagacg cttaaaagcg tctgggaggc aacaaccggg gctatcggtg    177660
     ctggttggga atggctcaaa ggtgccctgt acagcggatg gatgtggatc tctggcaacg    177720
     ttatcgaagg gttcaaagct gggcttagcg gtctcagaga tttcttttcc tcggttgtca    177780
     atgggatcaa atcgacctgg gcgacgcttc gatcagcact ggcaaaacca gtgaacttca    177840
     tgattaacac tgtctataac ggtggcattc tcaaggcttg gaatgttatc gcggggctgt    177900
     tgccagggct gaaacaaggc aacccactcg caggaatccc agagcacgca acaggtggcc    177960
     gaattgcagg accaggaacc ggaacatcag acgatgttct gatgtggggc tcgaatggtg    178020
     agcacatgct cacagcgaag gaagtccaac gcgccggtgg acacaatgcg atctacttca    178080
     tgcgtgattt gatcgcaagc agaaccccat tcacgtggga cggcggaaga ttcatcgctg    178140
     aacaccgcaa gtctgtcaac gactacggct ccgaggtaaa acgccgagga atcggaaacg    178200
     ttgatgacaa cggactgttc tcaatgctgc caaagttcaa agacggcgga gcaatccgcc    178260
     caatgtggga actccaactc gaaaacggcc ataaggccgc aaaatcgaga aacggcaacc    178320
     catatacatg gggctacgag gactgctctg gttacatgtc tgccattgct gacgcgatcc    178380
     tccacggagg acgcggaaga cgagcatggg ccacgggttc cttcccaggt ggtcaaccat    178440
     gggcgccagg tctgggaaag ggctttagcg ttggtgtcca tgacaaccca ggaggcccag    178500
     gcggtggaca cactgcaggc accctcacag gcgtcgggcc atattcaacc gtcaacgtcg    178560
     aatcgggagg aagccatgga accgtcgcat acggtggacc agctattggc gcagaccatg    178620
     cgcaattcaa tggtgtgcgt ccaggcagat tccacctagc gatcggagca gacggagcat    178680
     tcgaaactgc aggaagcggc ggagtctcac cacaagcaca gcgaagcatg atcgctaaag    178740
     ccttcggtgg tgtcatcagc actgtcatgg accccatcgc cgcaaaactg ccaagcccac    178800
     caccggcatg gcaaacaatc ccacgaggcg catatgactc tgggaaagac gcacttgtca    178860
     aaggcgtcga caatgctgtc aactcgatcg aagattcact agcaaccgtc taccgaggaa    178920
     tctcaaagat cccgaatctg ctcaaagaaa agggaccgag aggaatcgaa aagaaagcaa    178980
     aaatctacga tagaggtggc attctcggac acggagaaat cgcaatcaac cacggagcac    179040
     cagagcgcat cctcccacca gcactgacag ccagcttcga caaattcacc acagttgtgc    179100
     cacaggtcgc agaccgattc ggcatcatcg cagacaaact tctcggaacg aaaatcaggg    179160
     aaaccccaac cgcgccggga agcttgaatg cacaagtgga tatggagaag ctgaatgatc    179220
     agctaagcgg ccttcatagc atggcagata aggttgttcc tgttctggag accgtcaatg    179280
     cgatgggcat tgaagggttg aaggggctca cccacatcac gggtgcatgg aaggaatacg    179340
     taagcgtaga aaattctgtg gctaaggctg cagaggattc gaaggctgcg aatgaagccc    179400
     tagcgacagc aaggaaagag cttgcagatc ttgagcgtga aatcgcgaag aagggaccga    179460
     atgccaaggg ccaagcagaa gattcaaaga agctagcaga ggctaggaag aaagtttctg    179520
     atgcggagtc gaaggctgta gattcttcat ctgcgctgga aaaggcgctg ggtgatgttg    179580
     ctgtcgggca aatcaagctt gcgttgtctg ttgtgagtgc tatcgctgag atcggcaagg    179640
     ctattgcggg agcattcact gctgtgtacg aggggcaatc acgtggctgg tcgctggtgt    179700
     cgcagatggc ggaagaagtt gagaagggcc gtcagaagct gtcggagatg cgcattgaaa    179760
     atgcgaattt gacgattcag cagattaagg cgatcaacga tcttcggatt gctcagtggg    179820
     atactcaccg tgcagcttta aacggtgcgt tgggtattgc gcaagcgcag gctgagttgg    179880
     ataagcggcg tcgagaaggg atcatgctgg gtgcttctgg tattgatgcg atggctcgtg    179940
     ccatggatcg gtacaggaaa acaggaatct tcgcgattga ggaagttacc tggtacaccg    180000
     aggagcaaaa acgcaagatt aaagctgctg agtggaaggt tcatgaggct cggatccaat    180060
     cagcaattga tcagcttgat gcacaaggca aagtagaact tgctggtcta gctgctgccg    180120
     aggcaacact gaagcagcac accgcagtac ggttgcttga actctcagcg cagaagttat    180180
     cggcgcaggc ggcatctttt tatggtgtca cggcccaggg cgctactgcg cttgagcgga    180240
     tgaaccaagg aaaggcactg caaggcaagg gtgctggttc gatttttggt ggaattttga    180300
     aaggcttggg aggcgcagcg ggaggcgctg ctgctggctt tgctcttggt ggccctgttg    180360
     gagcactcct tggtggcatc gccggcttgc tttttggcgg tgcaggtcag gtgatgaatg    180420
     gtatcgctga gatcaagcag ggccgtatgc aggaatccac gtacaaaaag tacgcggagg    180480
     aagaactaaa gaagcttcca ccggaggttc aaaaagagat tcattctgct ggagtcatgg    180540
     gtggtatcgc atcgttcttc ggtggcaatg gcgctatgat tgcttcgaca ccgtttgagg    180600
     cgatgaagat caagaaccag tttgcgacgt gggactacga gaagaaactg caatcgatgg    180660
     agcatgattc atcgatacag aagcagcttc tggcaacaca gcgagctcaa attgagcagc    180720
     gtcttgcagc tcaaaaggca gcgttggaag cagaaagaga tgccgctggt taccatgctg    180780
     cagcaggaga agcagataac gagggagtgc gccaagctta tgacgcgctc gcgcaggatt    180840
     ctgcgcgcag agctcgtgat ctcgctgaaa ccgcgcagcg tgggaaatcg cagctcgatg    180900
     aaatagtcgg tcgtctgaaa gatctagcag atcgatcagc ggcaaatatt atcaatcaag    180960
     gaatcaacca aactgtcgtg gtcaaactcg aaaaaaccgg caggctccat acagaccagg    181020
     acatagcgaa ggcgctggaa gaaacgctta acgcagtgaa aggtctagag gctcgtgtcg    181080
     agatggtcga ggctgcccgc gcaccgagtg cattggaagc agcgcactcg cagctttagg    181140
     aggtcataat gcaggtgatg ttttactcac catcaggtca aaagctcttt ggtgaaaatg    181200
     gatcacctgc attcctcctg aaagggggaa tcacagattt aaagggggca atagaagcac    181260
     gaacaaccgt gatcccagaa gtgccgggcc aagtctttga tggggtcacg attaagccgt    181320
     ttacgttcgg tgtgaccatg gttgtgtatc caacgaaaga aatgccaatg gagaaagcaa    181380
     tgcgcaagac caggcagatc ttctcggcat tcgattactc gacgtgcagg atcgatggaa    181440
     ctgggatacc tgtggggctg aaggtgcggc tggattcgat catctccgcg ccatcgcagg    181500
     acacagcgaa ggagattgca gaggaaatca cgatcacact cgctgctgac gaaggaatct    181560
     tttgggcaga tcgaaaagaa gccagcggaa agattgacat cgtcaattat ggtgactgtg    181620
     atctctggcc agaataccga tggcaaaaaa ccacgacgat cacattgcca agcggagcaa    181680
     agattaatct tcctgaaaca cccacgccac gagtcttgcg gacgacacga catcaagtgt    181740
     cgatcactga tctagatggg aaaccagacc gcgagctgct caaaaagctt ggaacagtgt    181800
     ggccggaagg cgtgccgagg aaagaaacga agacatacga gatcacccaa aacggttaca    181860
     tcatgtggcg tattgggtat ctagacccat gggggctgta aatggacgta tcgcagtggg    181920
     agcaattcgc aaagcaccga tctgctgtca tccgtgatta cggaatgtgg atcggactca    181980
     tggataacaa catggaaccc atcgtggaca tgccagcacc tgtcagcatc gatgccccta    182040
     tcaccagaat gaccccatca tcatgcaaag cagtattcaa gacgcgagtc gatgggcaca    182100
     ttcacccaat ggtggattac ctgattgccg aaaatctggc gaaagtcgac gagcaaggcc    182160
     aactcatcgc agcggcacaa gacgcagtat tcctagcgat cgaagtagca caggggatca    182220
     gaaacgtcta caaaggcgta ttcacagtcg cattgggaga ccaagaatca ccaacactgc    182280
     tcgaattcaa cggggtctgc gaaatccaat ggacgctcgg cgcactccca tgcccatcag    182340
     caccatattc atggaccggt aaatgggtcg atctcaatca ggactgggct ggaaaatggt    182400
     caaagactag gacgatggca gacatcaaag tcgcagaagt tgccgacgga ttcaccttgt    182460
     caggggctgc cgacaccaca atcggaaaac tcattagcca gtcactgcaa gcaatcaaca    182520
     cgatgttgaa atcgaaaggc cgaagcctgc cgatcgcagt caaaccagtt acatcgaatc    182580
     caacatcacc acagctagtg atccgtccaa cggacagatt catctgggac gaaatcagcg    182640
     acctggcttt agctgcaggc gtgaccgtga aatgcaaaac atggtggccc agcgacccac    182700
     cagtgccggg acttgacctg aaagaaccca tcgtcgtcat cgagatcact caggaggaat    182760
     gatggaccca gtaataaaac tcgtcgctca tgcacaagaa atgtccatga caatccccag    182820
     aagacaagcc tgcatggtct acggaaaact caacgtcaca ctcaaaaaag gagacgtaca    182880
     agaagaacga gacaagcgcg tcacagacgg ttacgtccac atcccagaag atatgcctca    182940
     aggccgattc gacttcgggt tcacccgaga agacgcagac gtcaacatcg gaacaggaca    183000
     atcaacctac gagttagctc tcgacacagc agcacgaaga atcacagggc aagtcctatt    183060
     cgagcaagac atcatcgcgc cggggtttgg tgattggcgg ccgctgattg atttttcgtg    183120
     tggggatctt gtcggtgttc gtatctgggg gaaagagctg gtgctgccgg tcacatcaat    183180
     tactcgcgaa acaacagggt ggcgtgcgca tgttggcggg cagctgatca atgatcgccg    183240
     caaaatcatt tctgagaatc gaaaaatcct tgctgacatt gaatcagagc gcagagagcg    183300
     aatgaacgag atcggagcaa tctcatctgt ggcgtctgca gcttcggttg cagcaaagga    183360
     cgctgacgcg aaggcggaga cagccgatgg gaaagccgag gatgcgctgg agaagtggag    183420
     acgacaaaaa gaccagctgg ataaagtcca gtcagatctg attgaaaaaa atacacagtg    183480
     gaaccgaatc caggatcgtg ggttgaatga gctagccgct cagcaggagg ctatgaagcg    183540
     ctacgttgat ctatcgaggc cttcctctgt cacagtatca acgtgggacc ccgtgtgggc    183600
     tggccccgtg caggtcagct acccgtccag aaatcaggta gagctctatc tcaaacactc    183660
     tccgtacatc atcggggcat ccgtactggg tatcgctcgc gtcaatgcac tcagcgggta    183720
     ctcattttct ttcaccgccg atatgaccgc tggacagaca ttcacgccgc aggtcggagg    183780
     attcgagtct tttaaccagg tgtcggtcac ggtgcatccg atcgtgaatt tcgcagcaat    183840
     tttgtccgaa gaacgcagaa agagaggcct acagtaatgc caaagctaaa aggctcgcta    183900
     aaaaacatca cagacaaacc aagcaccata cgagaagtcc tactccgcgc cacacacacc    183960
     cgcaccaacg ggaaaaccat caccacctcc gaacccgtac gcgtaaaagt ctccgaatca    184020
     ggcgacttca cagaaacact cgcgccggga gctgcggtgc tagtactcgt cggtgcggat    184080
     tttatggccc gtgagtcaat ccccctgctg gttgctgagg ggatgaccac cattgcggag    184140
     gcgatggaag cagctaggga tttcacccct gatgtgcacg accgccttgc ggagcttgcg    184200
     gcggaaacgc agaagaatct ggaggaagcc cgtggtgtta aagctgaggc tgatagcgcc    184260
     acggcccgta tgcgtgaggc tgcgcaggct ttgaaagatt ctgtggatgg ttcgattgcg    184320
     gaggctacgg tgggaatcaa gaaaagtgga tctgagcttc tagcttctat gcaggctttg    184380
     cagtctaagg ctgcttcttc tgaatctgag gctaaggagt cggcgcaggg ggcggaggct    184440
     tcccgttctg cggcgttagc gtctgcgtcg tctgcgtcct cgtctgctgg tgaggcggcg    184500
     gagtcgttgg cgggtttgcg tgcgaagatt gaagagtgga agccccacgg ggagcagttg    184560
     gctcagtggc agccgcagtt tgagtggctg aaagagaacg cggcgagcgg gttcactaag    184620
     atcgcggagt tgatgcagga tgcggcggct ggtgtgcgtg gtgagctttc gggtttggtg    184680
     gagcaagcta aaacggcgca aaccacagcc gggcagcact cgcttaaggc acaagccgca    184740
     gcaaaggatg cagaatccgt ggcgaaccgc gttgtggatg cagcgattgc gaagctcaaa    184800
     ggtaatgctc ctgccatgct agatacactc gaagagctgg cagagcgagt gatatcgggt    184860
     ggaacgttag agactgagat tctgcagaag ctgtctaaaa tggcggattc tgacaccgtg    184920
     aaaaaaattg tcgcccgcct agatggtctt acgattgcgg gtgtacaggg gctttcggca    184980
     gcgcttgcgg ataaggcggc ggcacgtcat aagcatggca cctcggatat taacggtctt    185040
     gatacagaac tcgcggggtt taaaggcgct ttggctgaaa aggccccgcg ccagcacggg    185100
     catactctac aagagatttc ggggctttca ggagctattt taaatgtgcg aaatgagctt    185160
     tcacaaaaag catcacaaca atacgtgaat agtgtggaga ctgaagctaa gcgccaatac    185220
     gggcgaatta aagatatttc ggtggtcaat tcccttcccg cttcccctga tgcaggcacg    185280
     atctatttgg taaaggagcg atagtgatat tctacggctc gtccaaaatt aaagaggtat    185340
     tctacggtga cacccgcatt aaagaggtct acgctggggc ggatttggtg tggaagcgga    185400
     tcacggacac ggtgaaattt gcgaatggcg gggctgtgga ttttcgcaaa gcagctccag    185460
     aaggatttaa gggatatctt tattcggata ctatccgtgc tgataaggac gggttttatg    185520
     atttccacac tactggcccg tcggggcggc tgtgtctgga tgatgggcat ggagaattcg    185580
     ctatcatccc gctgacacgc gggaatgatg gggtgcgtgt ttttgttcgg catacggata    185640
     tgatcacttt tagatttaat gaaaaaaata ttccgatcac gatcaccgcg aaaccgtcta    185700
     cagtgaacga tccccgcagg acggtggttc tgaattattc atccacggat cagatcgagg    185760
     atagcggttg gggcaccgca atcccttcag cccgcggccg tggtgtaaat ctgaagcctg    185820
     ggcgatactg gctgaccagc agcaagagcg tatatattaa tgataattgg gtaagggccc    185880
     ctgggggctg ggttgatttc cacagctccg caagatcgaa tattcggctt tattatcgtg    185940
     atgtgcgagc gtacctcgta cccggacaga aactgtaacc aaagcacccc acgtagggtg    186000
     cattttttat gccctcacca accgaggtgg gggcatttgt acttaaacga ggtgatgaat    186060
     gaataccgtc attgactttt ctgctggagt cccgccagca gtagaagtaa aagcagctgg    186120
     gcatataggt gtcatgcgct atattagccc accacggctg agctggatga ctgcaaaacc    186180
     agcaacccgc ccccagatcg accgctgtcg ttcagcaggg gtcgatgtcg gattcgtctg    186240
     gcaatacggt ggcgcagata accccgatac tatgcgcggt cgtaccggag ggcacgcaga    186300
     tgctaccagc gcccaagcca agctcattga gcttggatgc ccccaccacc cagtgttttt    186360
     cgctgtggac ttcgatatct cgcttgacca atggaacgcc acagcagtcc actatttcaa    186420
     agccgcatgt gaggtccttg gacgtgatcg cgtggggatt tatgggcatt ctcgtgtgat    186480
     ctcgtgggct gtggaagatc aggtaatcgc tgatcttggc ggagggaaac atcttgcgtg    186540
     gcaaaccccc gcatggtcaa tgggagagcg agccacagag gctgttcttt accaaggggc    186600
     agcaaacgtc aaaggtccag cgggcatcaa cattgatgtc aacgaagtgc tgcatcacga    186660
     atgggggcag cacccagtcg gtgaaacccg cctagagaaa tcacaggaaa tggagctggc    186720
     aatgaaacca aacccaaatc acaggggaga tcccttgttc ctccctgatg tgctcaaagc    186780
     atttggggtg aaagtccaag aatgggacgg ctggcgcgac cgagggcacg gtgatttcac    186840
     cgttattcag ggcgtttttg cacaccacac gggaacagac aaagacattc ctggatacat    186900
     tgctgatcac cctgagctgg gcttgtgctc ccagattcac ctcaaccgcg acggcacggc    186960
     agtaattgtc ggcgcaggaa tcgcctatca cgcagggcgc ggatcgtatc cgggatggcc    187020
     tacagacaac gcaaaccaag tggctatcgg tattgaggcg gcatctagcg gaactagccc    187080
     atggccgcca gcccagctcg atgcctacta ccgcacatgc gctgcgatcc tgtggtacct    187140
     aggtaaaccg gctaccccgc aaacactact ggggcataaa gagtattccg gtgcggctca    187200
     gggtaagtgg gatccaggcg gaatcgatat gaatgatttc cgccgcaatg tgcagcacta    187260
     catcgacaat ccaccatttc tagcagctga tgctgctcac atcacgaaag aagaagaccc    187320
     gatgatccaa tcattaatta atccggcgaa gaaattcgcc cagtccacac tcatttctat    187380
     cgtcgacgcg acctgctggc agattcttgt gctggctaag gccatcgcca aaaagcaggg    187440
     tcttgatcct gatcaaatcc ttgcggacgc tataaccgct gatcgagagg ggaaataatc    187500
     atggctaata ctgatattca aattgctgtt actcgtgcgc tggagtcgca gtcgtggtgg    187560
     ctgcgccgta aggattcttt gacctctggt gcaggccttg tcttgcattt cgctaacctg    187620
     atcgtcgctt tgctcggtga tgctaaccct tgggtgaacg tcgtcgtcgc tctggttatc    187680
     ggtgtcgcac agcttattat ccacgctgga acaaagggcg ctattacacc ttctatggtg    187740
     gcgcggatcg acaatgcggc cccaacaccg ccagtgtttg atttggatca ggcacgtgat    187800
     cagctagctg ctccatcgga gtgatcgcta tgcctattga gcatttgcct cctcgtgtcc    187860
     agccgactgc ccgccgtgtg cgggcttttt tgatgactga ttccacggcg ctactgctgc    187920
     ttgctgtggt gcaggctgcg atggggttgt attatctccc tggggttttg ggggatccgt    187980
     tgcggtggca gcggccggtg gaatcgatca tgccgattat tgcgtgggca tgggtccacc    188040
     tcgcggttgg tgggctatgc gccgttgctg cggtgactga taggtggcat gtggatatcg    188100
     ttgctctcgc tcttgcgacc ggtctcaatt tgtcgtgggc ttttagtctg cttgctgcgt    188160
     ctgtagagca caatcagtca gtgctatggc ttgttggagt tcttattctt gccatgacgg    188220
     tttcgctgat gtgggctgtg tggcgtggta agcgtgggga tattcctttt gctaaggaag    188280
     ggggagctgc atgagtgttg tagctgcttt tttaagtggt gtgggtgcgc ttgtcacggc    188340
     gttaggtggt gtgttgatcg gtgtggtgaa agccaggtcg gatacacata ctgcgaaagg    188400
     ttcgcgcatg gacgtgctgg aggcacgcat tgacaaaatg caggctgatt tagatgatga    188460
     gcgtgcgcgt cgccgtggtg tggaggtaga taatcaccgg ctgcgtatgg cattggtaac    188520
     cgcggtaaag catctagagc agctcatacg ctgggctgac ggtggtgcga agccacctag    188580
     gcctgatgat attgatctag atgagattaa aagcctgttg aaggcgtaaa aagatggccc    188640
     cctttggttg agatgatata cctaggctaa agggggctat ctttgcgtgt ggtacacctg    188700
     atctgggccc ggttcatgtt gtggtggtca acgctggggt aaccggcgtt gcgtatccag    188760
     tggctacact caggttgtaa tgattgggat gatgtacctg atctgagagc gattaaaaac    188820
     tcattgagga gtaggtcccg attggttttt gctagtgaag cttagctagc tttccccatg    188880
     taaccaatct atcaaaaaag ggcattgatt tcagagcacc cttataatta ggatagcttt    188940
     acctaattat tttatgagtc ctggtaaggg gatacgttgt gagcagaaaa ctgtttgcgt    189000
     caatcttaat aggggcgcta ctggggatag gggccccacc ttcagcccat gcaggcgctg    189060
     atgatgttgt tgattcttct aaatcttttg tgatggaaaa cttttcttcg taccacggga    189120
     ctaaacctgg ttatgtagat tccattcaaa aaggtataca aaagccaaaa tctggtacac    189180
     aaggaaatta tgacgatgat tggaaagggt tttatagtac cgacaataaa tacgacgctg    189240
     cgggatactc tgtagataat gaaaacccgc tctctggaaa agctggaggc gtggtcaaag    189300
     tgacgtatcc aggactgacg aaggttctcg cactaaaagt ggataatgcc gaaactatta    189360
     agaaagagtt aggtttaagt ctcactgaac cgttgatgga gcaagtcgga acggaagagt    189420
     ttatcaaaag gttcggtgat ggtgcttcgc gtgtagtgct cagccttccc ttcgctgagg    189480
     ggagttctag cgttgaatat attaataact gggaacaggc gaaagcgtta agcgtagaac    189540
     ttgagattaa ttttgaaacc cgtggaaaac gtggccaaga tgcgatgtat gagtatatgg    189600
     ctcaagcctg tgcaggaaat cgtgtcaggc gatcagtagg tagctcattg tcatgcataa    189660
     atcttgattg ggatgtcata agggataaaa ctaagacaaa gatagagtct ttgaaagagc    189720
     atggccctat caaaaataaa atgagcgaaa gtcccaataa aacagtatct gaggaaaaag    189780
     ctaaacaata cctagaagaa tttcatcaaa cggcattaga gcatcctgaa ttgtcagaac    189840
     ttaaaaccgt tactgggacc aatcctgtat tcgctggggc taactatgcg gcgtgggcag    189900
     taaacgttgc gcaagttatc gatagcgaaa cagctgataa tttggaaaag acaactgctg    189960
     ctctttcgat acttcctggt atcggtagcg taatgggcat tgcagacggt gccgttcacc    190020
     acaatacaga agagatagtg gcacaatcaa tagctttatc gtctttaatg gttgctcaag    190080
     ctattccatt ggtaggagag ctagttgata ttggtttcgc tgcatataat tttgtagaga    190140
     gtattatcaa tttatttcaa gtagttcata attcgtataa tcgtcccgcg tattctccgg    190200
     ggcataaaac acaaccattt cttcatgacg ggtatgctgt cagttggaac actgttgaag    190260
     attcgataat ccgaactggt tttcaagggg agagtgggca cgacataaaa attactgctg    190320
     aaaatacccc gcttccaatc gcgggtgtcc tactaccgac tattcctgga aagctggacg    190380
     ttaataagtc caagactcat atttccgtaa atggtcggaa aataaggatg cgttgcagag    190440
     ctatagacgg tgatgtaact ttttgtcgcc ctaaatctcc tgtttatgtt ggtaatggtg    190500
     tgcatgcgaa tcttcacgtg gcatttcaca gaagcagctc ggagaaaatt cattctaatg    190560
     aaatttcgtc ggattccata ggcgttcttg ggtaccagaa aacagtagat cacaccaagg    190620
     ttaattctaa gctatcgcta ttttttgaaa tcaaaagctg aaaggtagtg gggtcgtgtg    190680
     ccggtaagcc gaacggttcc ggaatggcgc tatagtatgc acaggtagag cagaattcga    190740
     atctgactac ggatcagaag gttgggggtt cgaatccctc cgggcgcaca agtaaaaccc    190800
     cagctcacag aatgtgtggg ctggggtttc tttgcgtgct tggtgcgcgc tggcgcccct    190860
     tttcccgccc gccccttttc ccgcctcctc gaactcaaga acacgaaaac cgcaggaagc    190920
     gaaaatctcc tgaaagtgcc gcccttgggt tttcgtgttc ttgagttcga gttcgcggat    190980
     tttggaggct aatcgggtac gggatgaggc gccccgctga caacactatc ggtgggagaa    191040
     ctgaagataa gacccaaagt gagtagtttg tgccaaaact ttttggccgc ttcggcattt    191100
     ccgcaggttg gagatataag aaatggttta atttggcacg aactactcac ttgccctcaa    191160
     aagtgtctca cccggaagaa ttcctcgctc aactggtgtg gatgcgctaa gttttcctta    191220
     tgaacagcgt tcacttccgc cgccacacaa gccgcacccg ccgtatcagt atttttcttg    191280
     ctgcgtgcct actcgccacg ggatgcatca cgggatgcac catcagcacg ccgaacactc    191340
     cggtttcgga aagcgactcc agcacttcta gttcgcagag ctcccaagat gttgagctga    191400
     cggtggatgc tgcgtcggga atggtgtcta cgaatagtcc gcagttgcct attcacgtgc    191460
     agtggccggt gttggaggga catgagaagc tctcggaggc aattgcggtg tgggctgagg    191520
     gggaggctcg cgagtttatt ggggagtatg ggccacgtga ggtgaatcct tcggagttga    191580
     atggttcggg ggagcaggtg cgtgatggtg atgtggttgc gatgcggttg actcttgagg    191640
     agtttggtgg ggctaatgcg gcgtcgatga gtcgtatgtt ttttagttcg ggggatcggg    191700
     tttggcaggg ccctgatgtg attgcgcagg ataggcgtgt cgacgccgcc cgcgcggttc    191760
     ttgatcagtt gggtgaccgg gtggcgtctg gtgtgtcggc ggatgaggtt gcggggattc    191820
     cgaatttgtt tggggatgtg ttggttgagg gggatgtggt gcatgtgcgg ttgccgcagg    191880
     cgagtgtgtt ggcgtcgtcg gaggggattg tggaggttga tattcctgcg gagggtctgt    191940
     tgtcgcagaa cggtaagcgg ttattgccgc cggcgccggt tccgccccca atgccacagt    192000
     tgccgcaagt gcaatctaga ggggcagagc cagtggattg ttcagtttta aaatgtgtgg    192060
     cgttgacgtt tgatgatggc cctggtcctt atacgtcgca gattttggat acgttggatt    192120
     cgcatggggt aaaggcgacg ttttttgaga ttgcgacggc gattccgcgg ttccctgagg    192180
     tggtgcgtcg gcaggtggcg tcggggatgg aagtcggtag ccatacggtg acgcatcgtc    192240
     agttgccgtt gttgccgttg gcggagcagc agcaggaggc ggatggtgct agtgatcggt    192300
     tggcggaggc gggtgcgccg cggccggtga tgatgcgtcc gccgtatggt gcgtggaatc    192360
     aggatacgaa gcgtttgggg tattcgttga ttttgtggaa tgtggattct gaggattgga    192420
     agaatcggga tgcgcaggtg actacgaata acatcatggc tcaggtgcgc ccggggtcga    192480
     ttgtgttgat gcatgatatt catccgtcga cggctgaggc gttgccgggg attattgacc    192540
     gcttaaagga gcagggttac acgctggtga cggtgtcgca gctgttgggg cagactgttc    192600
     ctggtgaggt gtattacggt cggtaattta ctgcccaggc taagtgatgg agggcttctg    192660
     tcagggtggt atcgtcgtgg gatccaaatc ctatgacgat accgttgctc aggtcggaat    192720
     cggggtgttg gctccagtag ttggagagcc cctcgacgat gattccgcgt tggcggcagc    192780
     gctggaggat gtctgcttcg gggcgggtgc aggtgagtac ggcgtggagg ccgccgacga    192840
     tgggggagag tgtggtgccg gggatggatc cgagggtgga gatgacggtg tcgcggcggc    192900
     ggcggtaggt gcggcggagg ttttgggtgc ggcgccgtaa agcaccggtg ctgaggtatt    192960
     gagcgagcgc ttcttgggtg atgccgctgg cggtattgcc aaatattgtg cgcaattcaa    193020
     ttaaatgtgg cactaggtgg ggtggggcca ctatgtatcc gcaggagact tgtggagaga    193080
     taaccgaaga aaatgtgccg agaagtgcag tgcgttgtgg ggcaagggca aaaagggcgg    193140
     gtagtggttg gcctatgtgg cgtagttcgg aatcaaagtc gtcttcgatg atcagtcctg    193200
     cggtgcggtt ggcccaagta gtgagttggg tgcgtcgata agcgggcagt gagccgccgt    193260
     gggggtattg gtggctgggg gtgaccaaga ttgcatcgag gtcggggaga tcgtgggtaa    193320
     ttaggccgtc gttgtctgtg ggaaggggga cggtggtgga gccgagtgct tccggcactc    193380
     gccttaagct ggggtaaccc ggtgactcca ctccaacgcg taagtcctgt ccgagcgcgt    193440
     ggaggatcag ggagaagcct tcgcgggcgc cggcggtgat gatgatgtgg tcggggcttg    193500
     ctactacggc gcgcatgcgg cggaggtggt ctgctacttg ttcgcgtagg tgaagtagcc    193560
     cttggggtgg ggtgtgcgcg ggtggttggg tgcaggcgat ccgccatgct gcgcgccagg    193620
     aggagttggc gagggtggtg gtgtctggaa gccctggggt gaggtcgata gctggcggtt    193680
     ctgggggtgg cgtaggggag tgtgcagggg gtggtgtggg ggtgaggtcg gggttaatgc    193740
     atgtgccgga gccgcgcgcg gcgatgagga agccttcggc gagtagttgt tcataggcag    193800
     tgactgcgct acctcgggat atgtctagtt gggtgctcag tgcgcgggtg ctggggacgt    193860
     ggtcgccggg tttgagcagg ccacgaccta cgagggtgcg gatgtggtcg gctatttggg    193920
     tggggatggg gtcggtgctg gtgcggttga gagttatggg gaggttggtc acgaggtcgg    193980
     ggcgcataga ggtattgtga tgtgcaaaag tggtctattg caacatgctt aatttggatc    194040
     tagtgttagt ccacttttat aggcttggat gttcactatg actcaagaaa cttttactgc    194100
     aactacacgt gtgaagcgcg gcctggccga catgctcaag ggcggtgtga tcatggacgt    194160
     ggtcacccca gaacaggctc gcattgctga ggatgccggc gcttctgctg tgatggcgtt    194220
     ggagcgtgta cctgcggata ttcgtgcgca gggtggtgtg gctcgtatgt cggatcctga    194280
     tttgatcgag ggcattgtta atgctgtgtc gatcccggtg atggctaagg ctcgtattgg    194340
     ccactttgtg gaggctcaga ttttggagtc tttgggtgtg gactttatcg acgagtccga    194400
     ggtgctgtcg cctgcggatt atgtgaacca cattgataag tggaacttcg atgtgccttt    194460
     cgtgtgcggt gctaccaact tgggtgaggc gttacgacgc atcaccgagg gcgctgccat    194520
     gatccgctct aagggtgagg ccggcactgg cgacgtttcc gaggctgtga agcacctgcg    194580
     caccatccgt ggtgagatca accgtttgcg cagcatggat gaggatcagc tctatgttgc    194640
     tgctaaggag attcaggctc cttatgacct tgtccgcgaa gttgctgcaa ccggtaagct    194700
     gcctgtcacc ctctttgttg ctggtggcgt ggccacgcct gccgacgctg ccttggtgat    194760
     gcagatgggt gccgagggcg tgttcgtggg atcgggcatt ttcaagtccg gtaaccctgc    194820
     tgcgcgtgct gctgcgatcg tgaaggccac caccatgtat gacgatcctg ctgctatcgc    194880
     agaggtgtct cgcggcctag gcgaggcaat ggtcggcatt aacgttgccg atgttcctgc    194940
     acctcaccgc ttggctgagc gcggatggta atcggagtac tcaccctcca gggtgggttt    195000
     gcagaacaca ttgcgatcct agagtccttg ggtgtggagc accgtcgggt gcgcgtgccc    195060
     aatgacctgc tggggctcga cggcctgatt atcccaggtg gcgagtccac tgtgatggat    195120
     aagctggcac gtgctttcga ccttgcggag cccctgcgtg ctgcgatcaa caatggtctg    195180
     ccggtgtttg ctacctgtgc tgggttgatt tacttgggca cggtggaaaa tccggcgaag    195240
     ggccagcaga cgttgggctg cttggacgtg gtggtgcgcc gtaatgcttt tggccgccag    195300
     gtggattcct ttgacgcggt agttgacgtg gaaggaatcg acgcgaatgt ggcctttatc    195360
     cgcgcccccg aggttatttc ctgcggggcg ggggttacgg tgaccgcgcg tgttggcgac    195420
     catgtggtgg gcgtgcgcca gggcaagatc cacgcctatg cgttccaccc agaatccgct    195480
     ggtgaggtcc gcttgcacca ggcgtggctc gccagcatct agttgctgcg ctgtgtcaag    195540
     ttgctgcgct gtgctttgcg actgttcttg cgtagccacc aagcaagcag gatcagcacg    195600
     agcgcggctg cggcgacgat ggcccacatc caccattgcc ataccactgt ggactcttca    195660
     aagacctttt cttctgagcg gtccatgggc acttggtgtc cgcgaaccag taggtggtgg    195720
     gtgttaatgc cgtagagggt gttcctatgt ttttatcaag cggcgggttg actgtgtgtg    195780
     atcaaaactg tgggggcgct ttgtcgtatg actaaggggc cggtgagtgt gaactcatcg    195840
     gcctgcagtt tttgctttat gccgctacag cgcgggcggg gatttcgcgg aaaaactcct    195900
     tatttttcag catggcgaaa atgacgttgc acctgcgcca agccaagcaa atcaccgcgg    195960
     cattgtggcg ttttcctccc gcacgttttc gttcgtagta ctgccgcgaa tcgacgatcc    196020
     tgatcgcctt gtaaccggtg cgattccggc gtaagcggct agatgacctg cactatcgaa    196080
     gtctgaacca tccccgattg tcagtaggat ctgcgtcgcg gtcttgatgc tgaccctggg    196140
     catgctcatc aagacctcgc aaagagggaa gtcatcaagc atgctttcta cctgctcagc    196200
     gatggtgcca cgttgatcct tgagtgcttt gatatcggca gctagttgtg ggatcactag    196260
     cccagccatc gcttcctaaa actgtggcgg tttgagcttt tcaggggcgc gaatattgca    196320
     tctaccagcg ctgttggaac tttgcgggtg tgtttgacta tccagttcag cactcggtga    196380
     tacccggctc gtttgaggcc ttggggtccc ttgtagtgaa tcagtagatc aagcacaggt    196440
     gtacgtgtca gcgtgctgcc agcgaaaacc cgttcaagac ttgggtagat ctgagccaga    196500
     acactgcgca gtcggttgat cgttcgggtg cagtcacgca caatgtcatc atcgaagcca    196560
     gacaacatct tcagcgcgga gagaacttca ttgttccggt ctactgcacg aagggtgtgt    196620
     ggcatcgtcc gcgcggtatc gacgatgatg aagacgtctc gtttgtccgt ttttgcacgt    196680
     ccggggtaga gatcggcggc tttgcgcatg gctaaaccag ggtaagtatc cgacctgaca    196740
     accacggtcg cgggcgactg caatgggcag tgtgacgata gtgtttggct ggtctacgac    196800
     gactaaaacg gccccatgct gttgcagggc gtcgaatagt ttggcgaggt cggattccac    196860
     ctgcggtagt ggtttgttaa agagtttgtt gccttctcgg tcgagtgcgc aggcatgatg    196920
     ctcggtcttg ccgacgtcta ggccgaggaa tatgtcgatg tagtgttcct gagacattgt    196980
     ggctcctgga aacgattgag tatgtgtgtt ctagtcgctg gtgtcatgac attcgctggg    197040
     agcacccacg ttacaaagag acctagaggc aaactccggc cgtgtcccta tcagctgtca    197100
     tcgaacgttc tggctctctg tggcagcacc cccggatcat gaaaactaca gggtagataa    197160
     gccatactgg ggccagtgac tatcccgatt atcggggata ctcacaaggt aacgggcgcg    197220
     gcgaaggctg gcgcggtggc cagggtgact gcggcggtgg cggtgaggcg gcgggtagta    197280
     gaagcctgag aggaggatga gctcatgatg ttaatcaacg caccaggcaa aagcccgtta    197340
     actctccgtg gtgcccccag cgccggaggt tgtggggccc tcctcgcctt cctgcttgcg    197400
     gaagttcttc caccaccagc ggatcagcag cagcacgatg atcgccgcgg cagcgaggat    197460
     ggcccacatc caccactgcc aggtagtgcc ctgcccgtcg aaggcggact ctccctgcgg    197520
     atccatcggc acgcgctcgg cggtgatgat cagccggtgg gtgttgatgc catagggggt    197580
     gcaggtgatg agcgtgacct ggtccttatt cgacgtgcgg cgcagcaggc tggtcttatc    197640
     cggggtgacg acctcgatgt tccggacctc gtacttaagc ttctcgcccg ccgcggcgac    197700
     gtagaccggg tcgcccttct tgatctggat gaggttgtcc cacagggtgg cgttctgcag    197760
     gccggtatgg gcagaaagcg cggagagtcg gccctctggt ggggcgggcg ggataacgcc    197820
     atcctcgccg agctcgccgg gtgcgccaac aggcaggtcc gtgccgtaaa ggtggccgac    197880
     cccgcgggcc agcacgcggt cggaggtgcc gtggaagatt ggcagatcgg atttgatgga    197940
     gggcagcaca atgcggccca tggcctcagt ctcgttcagg gcggagaggt aattcaggta    198000
     gcgctgatac gccgaggagc tctcgtcgtc ggagctggtc cacgcatcgc cggggtcgat    198060
     atccccgaga ttggcgttgt attgctgcgc ctcctcccag gccttattga ggacctctgg    198120
     gggcacgccc ttttccagct gcgagtaggc ctcggcggcg cgggactgct ggtagttatt    198180
     ccactgggtg gcgagcactg ggtatagcag tacgcccagg ccggcgagga tgaggacgac    198240
     ggcaatgatc gcgttggtgt tcagcttctt gtcttggcgg ggcggggttg cgtccgccgt    198300
     gttcggcgtt gggggttggt ctgtcatagg ccttaacttc tactgagggg ttggggctcg    198360
     ctccggtgga atgtggagag ttggagtcta ttcttcactg cgaggttaca aaaggcttaa    198420
     tttttgctgc gagatgctta tcgctgccta ccctaaagtg ggggagtgtg cgcgcgaagg    198480
     gttaatggat aaagaggtgt gcatcaatgc agcaaagggc cggtttttgg ggttgcgtct    198540
     gccggagtta tttgggggta gtgatatgcg tctcaatcgt tcttgcaggc ggagaaatat    198600
     gaaacttgca gcttggtgta tgttaattca gtgcgattca cgaggtggga atcacgcggc    198660
     tgaagtccga gaaattggtg acattacaaa gattgcgatc tgtcaacaat gcgacttcga    198720
     atgcgcggga ccatcagcga actttaaggt aacgcgactc caggggctgc gcaccttaaa    198780
     agcagctaat cggagtgaat cgctgaacgt cgaggggtgc tacgcgctcc agtcactact    198840
     gatgtaaagg aattcactcc agtgaagaaa aactctctga ccattcgttc ggtcactttc    198900
     gccgccgttg ctggcctctc cttgggtatc tctgccccgg gtgccgtcgc tattgcagag    198960
     gaaggcaccc aggttcagca gacccagagg gccaatattg acttcgaacg aaagggctcg    199020
     ctgaccctcc acaagaagaa gggtgctgag tcggaaaaga gagctaccgg caaggagatg    199080
     gacgatgttg ctggtgagcc actaaatggc gttactttca agattacgaa gctgaacttc    199140
     gatctgcaga atggcgactg ggccaaattc ccaaagaccg ctgctgatgc caaggggcac    199200
     gaaactagta ccacgaagga agttgaaact tccggaaatg gtacagccgt gtttgataac    199260
     cttgatctag gcatctacct cgttgaggag accaaggctc cggacggcat cgtcaccggt    199320
     gcaccgttca tcgtctccat cccgatggtc aatgaggctt ctgacgcctg gaactacaac    199380
     gtcgttgcat acccgaagaa caccgaaacc aagaccgaga agaccgtcaa ggatgccgac    199440
     cagaacatcc aggacgccta cacttacacc atcaaagccg acgcgccgac ctggggcaag    199500
     gacaagaaac tgaccgcctt ccgcttcgag gacgagctgg ataaacgcct ggacttccag    199560
     aaggttaccg aggtcaaggc tggcgacacc gttctgggta ccagcgacta cacggtcaac    199620
     gacccggcta cggatggcaa taagctcgtc gttacgctga ccgacgaggg cctgaagaag    199680
     gtcaagtcgg gcgacaagat gtccttgacc ttcgaggtca agcgcaagga ggttggcaac    199740
     accactgagc tgaagaaccg tgctgacgtc atcttcaaca acccgaatac cgacaaagag    199800
     gtcaagaaca agaccaatga ggttgtcacc tatcatggca agctgaaggt tgttaagaag    199860
     gacggcaagg aagcaggcaa ggtcctgaaa ggtgccgaat tcgagctcta ccagtgcacc    199920
     tcggcagctg tcctgggcaa gggcccgctg actgtggacg gtgtcaaaaa gtggacgacc    199980
     ggcgatgatg gtactttcac catcgatggc ctgcacgtca ccgacttcga ggacggcaag    200040
     gaggctgctc cggcaaccaa gaagttctgc ctgaaggaga ccaaggctcc ggctggttac    200100
     gcgctgccgg atccgaacgt cactgagatt gagttcactc gcgccaaaat ctcggaaaag    200160
     gacaaattcg agggtgacga tgaggtcacc ctcgtatccg agattaaaaa catcaagcag    200220
     ggcaccccga agctgccgat gactggtggt gccggtgttg gaatcctggc cgcaattggt    200280
     gccgccatcg tggcagccgg tgcatggttc gcacgccgcg gcgctaagaa ctaatagccc    200340
     gctgaatcgg taaaactttc gcccagcgga caaccccgcc ggcagaggtt tcacccaaag    200400
     cacagccaag cagaaccagc cccaggagta ccccgtggat cacaccctca gcactgacgt    200460
     cgaaccggag aaggaaccgc gccgtgccaa cagcgccaaa accagccccg tgctggccgc    200520
     ggtgctcgtg atccttgggg tgctcgtgat gctgtacccg gtgacgtcca ccctgtggaa    200580
     taaccaccta gccacgaagg ccgcgcagga atacgcaaaa ctcgaaaaga atgccccaca    200640
     agaggtgaag aatacccagt gggagcgtgc ccacgagtac aacgagaacc gaacaaccgg    200700
     ccccatcttt gacccctggc tcgcccgctt cgacgagaac aactcggact accaagaata    200760
     cctggaccaa ctcgacgcga acgacgcgat ggcgcgcctc atcttcccca agatcaaggc    200820
     agacctgccg attttccacg ggacagataa cgacactttg caaaaaggct tggggcacct    200880
     cttcggctcc gacctgccgg tcggcggtaa gggcatgcac tcggtgatca ccggccacac    200940
     gggcctagcg aactcgacca tgttcgacca cctcaacaag gcggagaagg gtgatacctt    201000
     ctatgtccag gtttccggcg agaagctgaa gtatgtggtc gaccagatca aggttgtgct    201060
     ccccaccgaa accgaggatc tccgcccaga gcagggcaag gactacatca ccctgatcac    201120
     ctgcactccc tacgggatca acacgcaccg cctgatggtg cgcggccacc aggtcccgct    201180
     ggccccggaa gatcacgagg ttttcgacaa gaaccacggt gccgggtggc agtggtggat    201240
     gtacacgcta ctcgcggcag cagctgtcgt gctgctcctg ctgctgcggt ggctactgaa    201300
     gaacaagcgg gatggcgaat cccaagaaac gacagagatg atgaatgacg aaggggctgg    201360
     agcagatgac tagccacgca cgcgcggtac ggaccagccg cagacttgtg gcggccatcg    201420
     cccttagcgc tggcctgctc ggcggcgcat atggtgccgt cggggttgcc gacgcagcca    201480
     aggtagccgg gctcagtgat cagcccgggg tatcccgcga ctacggaacc gacacgctga    201540
     gcatcacgct ttccccgggc aatggggacc cggtcaaccc tgccacgggc aaggtcgcgg    201600
     gcgtgaccat caaactgcag cggctgcagg gcatcgaccc ggagaacgcc gcggatcagg    201660
     cgaaggtccg caacaccagc gcagacaaga tcgctggctg gccgaccgac cgcacgatca    201720
     aagccgtgac caacgaggcc ggccaggtcc gattccaggg gctcgagaag ggcatctacc    201780
     tagtcacctc ccaagcaccg gctggtgccg cggcgggaga gtaccgggag attagcccct    201840
     tcctggtggc ggttcctttc catactgttg ctgataaccc ccggccggtg gaaggcgtga    201900
     tcgtggcgaa gacgaactcc acggttccgc cgaccacccc accgtggacc ccgccgacga    201960
     cgccgtccac cccgccccca gggcacaccc cgccgctacg ggagaccccc gggtcgggcg    202020
     atgagaaaga acgcgaacag ggcgacttgg cgctgactgg tgtgcagatc atcggtctcg    202080
     tcctcgccgc ggtggcgctg atgggcgccg ggctgttgat gctgttgatt acgaagaagc    202140
     gaaagcaaga ggggtagcga gaatgaaaac taagttcatg ggtgtagcgg ccgcgctgac    202200
     cgccgcgctt gcgctggttt tcggcgtcgc tgccccaggc gcgctgccca gccttccggt    202260
     ggcgacggcg caggcgcagg atcgttcgtt cacggtgact agtcagcaaa ggtatgaaca    202320
     aaaaggcacc cgttttattc cgaattacaa gatccctgcc gaccagctca gcggtggcac    202380
     catcaccttg ggcgcaggca cggttgtcac tctggaatcc agcatcaggt tttatctcgc    202440
     tccaaacgat gcagacttca cggtgtatta cacgggaact gatggtaatt ggtacgagac    202500
     caaggcaact tataagaagg tcagcgtcaa aaagtacgag gtaaccctgc cggaaattac    202560
     catcggtggc gccgcggaaa ttgagtttaa gggcgtgcat cgcggaccgc cgaacacggt    202620
     gatctccgca aagtttgacg tcgtcggtgg caccacgcag ccagagccag agcctgaccc    202680
     tgccccggag ccacagcctg caccggaacc ggagccgggt acgtccgtga atcccgcagc    202740
     gccaactgca gttgatccag ccaccgctcc ctcgtgtgta gaaaagggct acatcaacat    202800
     tccagacacg aagggtgtcg actacttcat tggtggcgag ctaaagcacg ctgggcagca    202860
     cttctacgag ggccaaaagg ccagcgttaa ggttacggcg aagccgcaga acggatacca    202920
     gttcgctgcc ggtgcgaaga ccgagtggtc tttcgacttc agcggggagg tgaaagactg    202980
     ttcagattct tctgaagacc ccaagccagc ggctgtcgaa gggcgtcact ttgatgccat    203040
     cggccacgag tttgcagttg aagctgaccc agtagatccg acgaagccca atgcctttac    203100
     ggctaaggtg actgcggaat ctcacatgaa gtacgcaacc gtgcgtatcg agactgacgc    203160
     gactttcttg gatccgcaga agtacaacct cactctggat cagattgagc caggtgtgac    203220
     cttgcagaaa cgcaacgtca atattggcaa cggctttatc accatggacg ttgttccggt    203280
     aaaggatggt aagccggttg actctgccgt tgtaccgaag gatgcggtat tcacctttac    203340
     taataatctc tcggagaaca agaatttgaa gatcgctctt gatgtgtatg gcgcgaataa    203400
     gagcacacca aaaccaccag atattatctc tccgccggat ggagctcagt gggttcacgg    203460
     acgtgtccct aacccgccga tgccaaagcg ttgtggtctg cgcattgctg tagtggccga    203520
     cctttcaact tcgctgaaat acgctgattc aaatggcttc gacgagtcga aaaaagcagc    203580
     aaatgcgttg attgattcgc tggctggaac tcctgcagag ctcggtatct acaattttgc    203640
     tggtggagcg ccacggaacc cagccgggtc tacgtatggt cagaatcctc cttatatctc    203700
     gttgcagtct gatgatgggg ttagtcgagc aaagagcatt gtctctaact ggaacggcaa    203760
     cggttctact aactgggaag ctggtcttaa gcaagtcgct gcgggaaact atgacgtggt    203820
     gtacttcatc actgatggta tgccgaccta ttcatctaag gctcctcagc tggggctggg    203880
     cggcgagttc gtccaagagt ccgccctgaa ccaagcaatc gatgcagcta atgagctgaa    203940
     ggccgcagga acgcgtgttg ttccgattat ggtcgacctg accgtaggtg gaaagaatgc    204000
     tcagcacaca actgttactc aggatctcgt attgaaaaat gtgcgtttct ggaagcgtgg    204060
     cacaagcaat tcggagcccg gactttattt ccagttcacg aataaatacg tggatgcggc    204120
     aagctacgtg ggcgatgaca ctaccgcgaa cttcgagatt gcgtataaga atggtggttt    204180
     caaggtttgg gagcgaacct cgcgaggccg gaatatcgac gttacgcgtg atcaatccaa    204240
     gtggacctac ggtccgcgag aggtcaagac catgggtgag gatatttctg gtaccggcga    204300
     caccatccga gttgagcagt actcacagct agctgcgcag atgaagaaga tcggtgaaga    204360
     acttgcttta cgttgtaacg gtgtagtgaa ggtcaagaag aggattgtcg atgaaaacgg    204420
     cagggctatt gaagacggtg tcccaggctg ggagttcacc ctttctgccg gtggccagga    204480
     catcatcgac ccaggtaacg gcgatcgcgt tcggaagtcg ctgaaggcaa cgtcctcggc    204540
     caatgaggac cgtggtaccg cttcctggaa catcatgagc gaacaagagc agcaactgac    204600
     tcttgtagag acacagcagc cgggtttcaa cctctataag aggaatgaca agaatgctgt    204660
     gtgtaccgaa actcgtgacg gggtaatgaa acctattgag gtcacaaatg acggtgagtt    204720
     cggtttcaag gtcaagatga gagcgaaaga taagaagctg tcttcggttt cctgcgtagt    204780
     tgataactac aagcagccgg aaactccgcc gggcaagctg accttcaaga aggctcagta    204840
     caacggcgat aagatcgagg agattcctgg gctgggtggc gcgaccttcg agatctaccc    204900
     gtccaaggga gaccagccgg actacagcgc tgaagcgctc tacaccatca agcccggtca    204960
     ggagtctatc gaagtgaaga cgaccggtac gttcttcctc gttgaaacga aggcgcctaa    205020
     agggctcaac ctgctggccc agccggtcaa gttcgagatt tcagtggatg agacgactaa    205080
     gaaatataag atttctgtgg gcagcaccag cagcggacaa gtccaagcga agggcgaagg    205140
     cgataagatg atcctgacgg ttgcggacac cactgccggt gagctcccga agaccggcgg    205200
     gtacggtgtg ggcctcgtgg ggctcattgg tgtcgcgctc gcaggcgcgg gcttcctgct    205260
     cggtcgccgc aagaccgcct aagcggtaaa accaggcagg ggagtggcgc gtgcatcgcg    205320
     ccacccgacc taggtagtag gcacataaag aaggggcgag ctcagcacat aacgctgagc    205380
     tcgccccttc ttccttgggc tgcgtgccac ggtcacgatc tcgatgccaa gaaccgctat    205440
     ccccggtggg cacgaatcgc tgcgtcacgc cagaagcaga ggcaagcgtt cagaggggat    205500
     ggacaccggt tgagggcaag caaagaaaac ccagagcgcg gggtccgcac cctgggttca    205560
     acctaggccg cttagcgctg gttcagaacg cgcatcacag cagcgattac tgcactgatc    205620
     acgctgatcg caccgagcgc aatcagcagc ttgcgcagga tagaaccgct cgccgagccc    205680
     atatcggagc cgtccgaacc gctccgatcc tgatcgccgt cgccaatgtt atcgcctgtc    205740
     accatcgttg ccgtcaccgg cgctcgggtg tcctcaacct cgatctcgtg ggccttgacc    205800
     tccatggtga gcgcttcgga ggtagaaggt ttcaaaacag ccgtgaccac accctcgtca    205860
     ttaacgagct cctggccgcc gaagaccgcg cgtacctggt gctcaccgcg ggtcgggaag    205920
     cggggttgcg tccaggtcca ccgagtcatc ctcgagggtc agcctagttc cggtctccac    205980
     ctcgcctgcg ctcagaacct caaacggttc ggcctctgcc tcagccttgc tgaagatccg    206040
     gccatccact tcgcgctccc gaacctccgc ggtgatcttc tgtagaccag cctggtcgaa    206100
     gacgtactcc acgctcgcgt tgccctcagc gtcggtctgc gcggtgccca cgcgaacccc    206160
     attggcgcga aagattacct tggcgccctc cgggaaaccg gcggacacct cgtagcgagc    206220
     gctcagcgtc cgcttctcgc cgaccaaggc cggttcgacc gcgcccagct gcaagggtcg    206280
     tcttcgacac cggagcgacc ttcggctcaa gcctgtcctc ggcgccggag acctcctagg    206340
     tgtcgttctc gaagtcctcg acgacggcgc ttagctgcag cgtggccgcc tcatctggga    206400
     cgatggtctg cagttccgcc acgccgttgg aggtcttcgc gtggccgatt tcctcgtcgc    206460
     cgttgaagaa caccccccgg atcatttttt taacagggac aggaataagc cataccgaag    206520
     ccagcgacta gttccactgt cctttcggac ggcgggaacg gacataaaca tagcccgccc    206580
     actcgggtgg acaggctatg aatcttcggt gtcctggggt ggaactgcta acaacgtaat    206640
     gggctagttc acgtcctcga aggggttgcc cacttagtaa tgcgctaagt gggcaacccc    206700
     cttttggagc caatctcact aaaactgttt ccgagatgct tacccaaaat ggagactgtt    206760
     agaaaggata atgatagtgg ttctcaaaaa cttaatggtc ttttgcaagc gttgtatttc    206820
     tgattctaag cgctcaatcc gttccttata gtacgctaag tcaaaatcat cggattctat    206880
     tgtctcaaaa gtgctctttt taaaccacgc gtaaatcgaa tttggcgaag cgccaatttt    206940
     ctcacttatg gcgacagcag ccgcccaccg tgagcactta tattcctcgc gatgggatat    207000
     catcatccgg actgcagctt ctctgaatgc tggtgaatat gtccttacca ttttagtttt    207060
     cctttcttga ataaaagcag cagactacca gccccttgct tgggggctaa gcatgtttgt    207120
     gatggctcgg atcgataaga agagggttat ccatttttcc ggagagttca agggtttctc    207180
     gacacccttc gtagtatgca gatttccctc tagaattgcg gtgtactttc ctgccggaac    207240
     gccatctttc aacagcgtga tttgactatt aaggtcgctg gggtaggtgt tagggtatca    207300
     accgctgaag taccagtagg aaatctcaaa aaatgttacc tccacaacaa cgtcatcatc    207360
     tttgtaggag atgcacatga agctatatgc cttgacgtac tttttgtact ccacattaga    207420
     tgtggcaatt gcgcaggatt gagtacgtgt gttttctgcc gccagtgatg ttggaacaac    207480
     agggggcaac aagaaacgtt agaactacct ttttgatggg gtggctcctt cttttatcgc    207540
     ggccaaaatc cctaccagtg cgagaagatc attaaatgtg tgcagatctc gtaccgcggt    207600
     acgtcctcgg ctatcggtcc aagcaatgtg tccagggtta tggaatcgtt ccgcggttgg    207660
     gtcttggctt atgcgccgtc tccagccgtt gaggggtgcc ccagttacgg atcaactctt    207720
     catcacttag ggtgaagtta tatggtcgcc cctgtgatat ggcatgatcg atggctgtac    207780
     cgatagcagg ttcaaagtga gtggcctcac caagcatgag agcgcctagt agtaataacc    207840
     gtgccgctga acgcgtgaaa gttgcttggc ggtcgcccag ttgaacagtc aagtaatccg    207900
     agcccgctag gtgctgttgg accgcccacg cactattgcg gtaccgcgta gctgagctga    207960
     aattatcgct ggttcccaca ggccagcgga ttatcgatgt aataccacta ggttgtgcgc    208020
     tcgcgggtgg gatggcaaac aggaaaaggg caaatgcttt cgctgcggca gtaaggcagc    208080
     actggatgtt gtagttgtat gtaaccttca ttctcatata tccatatgaa taataacctg    208140
     cagtttggtc aataagatat tttattgaat atctactggc aaacagattc ttttatgggg    208200
     aaaagtaaaa atgcaagagt atgcgacatt tagtaatgaa gatcacataa atttagaata    208260
     tttcgatccg cgcccccaac ccttcagcct gcttgagctg ggcaatccaa ccgtccgaac    208320
     cgggatggaa acgaaaaacg ggccgattgg aaatcttggt agggccaaca gactcagaag    208380
     cattaccccc agaacgtgct tcgaagcgca cacgggagcg atagccggcg tcgataagct    208440
     cctcaaggtt ggggtgcgcc tccgtgaggt gcgcgcgagc gtcgttaagc aacgtaagag    208500
     cctcatcaag agccccaagc aacgcctggg cgttcgtctc acacatagcc cgcaccagcg    208560
     acggggcaga acctgccacc cgcgtcgaat cgcggaaact acccgccgcc aacgaaagcg    208620
     ccaacgcgcc accattatcg cccacaatcg ccaaagcctc cgcaaacaca tgcggcaaat    208680
     gcgaaatacg agccaccgcc gcatcatggg cctccacacg cgcaggaatc acctccgcac    208740
     ccaccgtgcc cgccatattc accacatcag tccacaaacc cacccactcg gcatccgcct    208800
     ccggggcaaa atcatacgta accacccacg gggcacgcac aaacaactca gggtacgaag    208860
     cctcccaacc actattcgcc gtccccgcca tcggatgacc ccccacataa cgcgactgca    208920
     aaccccgcga ctttacaagg tcatacaccg cctccttcac gctcaccaca tccgtaaacc    208980
     cacaactcgg cgcatgctcc tgcaacgcat ccaacaacga cgcaatagca ggcatcggcg    209040
     tagccaacac aatcaacgca ttttcagcct cagcacgctc tagagtctga ataagactag    209100
     agctcacatc aaacccctcc tttgttgcga tacgcgcagc agaaggcgaa cgattaaaac    209160
     caaacgccgg aacacctttg tgccgcaatg cacgcagcag cgaaccccca atcaaaccaa    209220
     ggccaaggac acagacagga cgagaaacct cattgatagt cacctgacaa gtcttacata    209280
     cccgactacg gttatgcggt atgaagtcta attttgctgt gaccgtagcc cgcgtcaacg    209340
     ccacatggca agtacgcgcc ttcaacgacg attactcctc gctgaagcgc tccattgacg    209400
     ccgtacgaac actcggagcc gaaggcgcag catttgccat gctcagcata gaagacgact    209460
     acttcgtgct cgtccgcccc acaccccaag gcgtaaaact cctcatctcc gacgccaccg    209520
     ccgccaccga agacgacttc gccgccgaca tcctcgacga actcgacgcc gaccaacccg    209580
     accccgaaga caccccctat gcggagggag acttcgacat cctcgccgac ctcggcctca    209640
     gcgaacaaat catgagcatc atcaccgacg aaaccgactg gtgggcctcc gaacaactcc    209700
     aacgcatagc cgaagaactc ggattcgacg acgaactcga acaagcccta tgacactgcc    209760
     cccgcagcac agcgtggtac gagccgaagc catgatgcgc gaagccatca ccctcgcaca    209820
     caccacaccg cctgccgaca tccccgtcgg agccatcatc tacggccccg acggcaccat    209880
     cctcggccgc ggcaccaacc gccgcgaaac cgaccacaac cccctcggcc acgccgaaat    209940
     catggccatc acccaagcct gcacccagcg tggcgacggc tggcgcctta ccgactgcac    210000
     cctcgcagtt accctcgaac cctgcaccat gtgcgccgga gccctcgtcg gctcccgaat    210060
     cggacacatc atctttggag cctacgaacc caaaaccggc gcctgcggct ccgccttcga    210120
     cgtagtccgc gaccccgccg tcctccacac cgtgcaagtc cgcggcggca tcctcgaagc    210180
     cgaatgcgcc gaactcatga caaacttctt cggaggactg cgcaccgaag catgagcgag    210240
     gctggtttgc gttgctgctg cgatattcgc tattctggtt cgcggtagcg tgtccgagcg    210300
     gccgaaggtg ttcgcctcga aagcgaatgt tgggtaaccc ccaaccgcgg gttcaaatcc    210360
     cgccgctacc gccaagtgca aaaccccagt tcttgattga gctggggttt tgttgttgct    210420
     tagcgggtgg gcgatgagcc aagtgagtag tttgtgccaa aactttttgg ccttcgcgac    210480
     gtttccgcag gtcggaaata ttagaaacgg tttaatttgg cacgaactac tcactaggcc    210540
     gagaaatgct gcccagaacc atccggatca tgcgcctaga gtgaaaagtg tatgatcgtc    210600
     caaaacgaaa gaaacgaaag ttgaagggcg gtaagcaata tgtctctttc ggagcgcacc    210660
     tattttcctc ccgcagagga aggagaactc tcaaaggttg agagctttct tgctgtttac    210720
     aaagaccgtc atggtacaga ggctcggcct cagtttttct tgtctggttc aaacgaaggg    210780
     gagcaaattc ctctccccaa ggaactctac gagattcttg tgcgaaccgt tgaagctctc    210840
     gctagcggaa aagcagtgac tatccacccc aacgatccac tggtcactac tcaacaagcg    210900
     gctgagttgt taggggtatc gcgtccaaca gttgtgaaac tcatcgagga cggaaaacta    210960
     gaggccacca aagttacacg tcatcgccga attaaattag aagatgtgct ccggtatcaa    211020
     gagcgccaaa caattgagca gctcgatttt cttgcgagca ctacaagtga tgcaccagcc    211080
     ttgaccgaat ctgagtatgt ttcagtaaga aaaatgcttg cgaataagcg caaggaaagc    211140
     cgtatcggct aatgttcgcc gcagttctag atacgtgtgt gctctggcca tcgttacagc    211200
     gtgacataat cttgaccttg gctgcccacc aaagtaatcg tgccaccacg atcagagtcc    211260
     cgaagaatac taggccgatt ccaaaggttg ccgaggtttc cacgtagctt tcgggcaagg    211320
     cgtagaccac tgcgccgggg catagtgcct cgaaataaga cacgttttct ttgcacatgg    211380
     cctcatccta gagggcaagt gagtagtttg tgccaaaact ttttggcctt cgcggcgttt    211440
     ccgcaggtcg gaaatattag aaatggttta atttggcacg aactactcat tccgcccgcg    211500
     gagcctcgcg aaccccgcga acccgcggag cccccaaaac cagcaaatcc taatcaaggt    211560
     ctacactgga agactatttc tcgttccctt gtggtttaag gagatcatcg tcgtggccgc    211620
     ctttttgtat cgtgttggcg cgtggtcgtt tcgggccaag tggtttgtga ttgtcacgtg    211680
     gcttgttgtg cttgcggctg taggcggtgc tgccgctgcg tttcaagcgg gctttaatga    211740
     tctatttacg atcaataaca ctccggcgaa gacggcgacg gagatttatc tggaaaactt    211800
     ccctgaacag cgcaatccgt tgaagagtac gggtgtgaat atcgtgttta aagcgccgga    211860
     ggggcacacg ctggctgagc cggagaacaa ggctgccatg gatagtgtgg tgcaggcgat    211920
     ccaagataat cttgagggcc tgactaatac gcagcgtttt ggtaatcctg tggaattgaa    211980
     tccgaagttg cagcagggtg ttatcgattt gatgacgcag cgtggtgtgc cggaggaaaa    212040
     cgcgcgtgcc gacgcagcca atttgagcct gattaccccc gatgagacga tcgggtacac    212100
     caccttcgat attgatgtgc ctatgcctgc ggacgtcagc gatgcgcagc gccaggcgat    212160
     caccgatgcc atgaacttag gccgcgagaa gggcctgaca gttgaggccg gtggtgctgg    212220
     ttttggtgat ccgatcgtga ttgaagaaac ttcagagatc attggtgtgg ccatcgcggc    212280
     gatcattttg atcttcacat ttggttcctt ggtggccgct ggactcccac tgctcattgc    212340
     tgttatcggt gtaggtattg gttcgctatc gatcacgctg gctacggcat gggtatcgct    212400
     gaataacgtc accccagtgc tggcggtgat gttgggcctg gcggtgggta tcgactactc    212460
     actgtttatc atgttccgct accgccgcga gctgctgcac ctagacaagg aacaagccgc    212520
     cggcatggcg gtgggcactg cgggatctgc ggtggtgttc gcgggcctga cggtgatcat    212580
     cgcgctggtt gctttggcag tggctaatat tccattcctg acttacatgg ggcttgctgc    212640
     agcgttcacg gtgttcattg cggtgctgat cgcactgacg atggtgccgg cgctgttggg    212700
     ggcgttgggg gataaggcct ttgcggtgcg gttgcgccgg aagcggcgga cgtcgccagc    212760
     ccgtacgttg gggcgcaagt ggggggagtt ggtgcaccgc gcgccgggtg tggtgattgc    212820
     ggtgagcgtc gtaacgctgg gtgcattgac gctgcctgcg ctgcaattgc acttgtcgtt    212880
     accctccgat acgcaggcga gttatagctc tacgcagcgc aaacaggctg agatcatggc    212940
     ggaggggttt ggccctggta ttaattcgcc atttttggtg gtggcggatg cgcattcggt    213000
     ggatgagaac gcggagattt tggagccgct gatccgcgcg cagaatccgg cgccggggga    213060
     gcgcaagcag gcggcagcga atgcggcgta tcagtacatt attcagaagt attcggttac    213120
     tccggatgtg aagcatgtgc agatcgtggg attgtcgaag gacggcttgg cggcgcagtt    213180
     gttgcttacg ccggagtcgt cgccagaaga cgatgtgacc aagcagctta tcgacgccct    213240
     cctgatcaaa caggacgagg tgaacaacgc gaccggtatt cgttccggta ttacgggcct    213300
     gatccccgtg cagcaggatg tgaccaaccg tctggcgggc gtgatgccgc tataccttgg    213360
     catagtggtg ggccttgcgg tgttattgct gatgatcgtg ttccgcagca tttgggtgcc    213420
     ggtggtcgct ggcgtgggct ttttgctctc tgtgggcgcg gcgttcggcg tgactgtgct    213480
     gttttggcaa gagggtctgt gggggcttgt ggacactccc agcccgatca ttgcgtttat    213540
     gccgatcttc cttattggcg tgtgctttgg ccttgctatg gactatcagg tgttcttggt    213600
     atccgcgatg cgggagcgtt tcgtgcatgg gcgtatcgac gccaccagcc gctacaacgc    213660
     catcgaagaa tcgatcgtag agggcttcgc ctcaagtgtt cgtgtggtca ctgctgccgc    213720
     gctgatcatg attgcggtgt ttgtggcctt cattgggcag ccgattccgt ttattaaaat    213780
     cttcggtttt gccttgggcg ctggggtact tttcgacgcc ttctttatcc gcatggcgtt    213840
     cgttccggca gcaatgttcc ttcttggacg gcaaacgtgg tacatgccac attggctgga    213900
     taaagtgctg cctcgtctcg atgtagaggg cacgtcgctg gagcgttaac cgagatcgca    213960
     ggcgctgtgg catgggctgt aggtagctga gaactagccc gccaagccat cggtgcccgc    214020
     atgaggggca agatcttttc ctcgtcacaa gtggaatgat tgagcagacc cctctaacac    214080
     ccgcagaggc tgaatggcta cattcgataa actttcatgg ctcttccggt tttagagtgc    214140
     attgattgtg tgtcgggggt tcgggcgtgg ctctgtgtgg agtgggacgt tttcacaacc    214200
     atggcttggt tgggattggc tggcaggtta tccccgttca cccccgaaaa gacggcactt    214260
     cacaccaaat ccagccaaac ggccggtttg gaagcgattt ggtgtgaagc cctgagaaaa    214320
     atccttcgaa atacccccgt ttagtggtgc ttccggtttt ggagtgcatt gattgtgtct    214380
     cggatgttgg cggcgcttgt tggtagtagt tccaggtctg ttgtaatggc gcgtagtcgt    214440
     cgttgaagtc aaaatagttc ctcaagccgc ccgcagaacc tgcgggccga gaataggatg    214500
     agcaagatac ggaagatcac aagagctctg tggctatgaa acgtagcgca agcaccaact    214560
     actgtttgtt cccccaaagt gcctgtccac gtgcaacaag ctagaatttc tctctatgac    214620
     tgacacgact tttgagcttc gtaccgagct ggacgacgcg ccaggccgcc acggccgaac    214680
     tggtgtaatc catacccctc atggtgacat caacacgccg gcgttcatcc ctgtggccac    214740
     caaggcgacg gtgaaaaccc tcaccccaca gcaaattcgt gacactggcg cccaggcgat    214800
     cctctccaac gcctaccacc tctacttgca gccgggcccc gatattgtcg atgaagccgg    214860
     cggtgtatcc aagttcgaga actggcacgg ccccacctac accgactccg gcggattcca    214920
     ggtgatgagc cttggtgttg gctttaaaaa ggtgctcgct atggataccg cggggcttgt    214980
     agaaggcgac atccgcgcgc ctaaaaaaga tcgctacgcg caggttgatg aagacggcgt    215040
     ggacttccgc agcgttatcg acggctcccg ccaccgcttc accccagaag tcagcatgca    215100
     aatccagcac cggctgggcg ccgacatcat cttcgctttc gacgagctga ccaccctcgt    215160
     ggacacccgc cagtaccaag aaagctccgt cgaacgcacc caccgctggg cacgccgctg    215220
     cctcatcgaa cacgaccgcc tcacccgcga gcgcgaagga aaaccactgc aatccctgtg    215280
     gggcgttgtc caaggcgccc agtacgagga tctgcgcaga caagcagtcc gtggcctgct    215340
     tgacctagac aaagaggcag aagataacgg acgacgcggc ttcggtggct tcggcatcgg    215400
     tggcgcatta gaaaaggaaa acctaggaac catcgtaggc tgggtctgcg acgaaatccc    215460
     gcagcacaaa ccacgccacc tactgggaat cagcgaacca gacgacctct ttaccgccat    215520
     cgaagcaggt gccgacacct tcgactgtgt tgcgccgacg cgcctcggcc gtcgcggcgg    215580
     cgtgtacacc ctcgacgggc gcgtgaacct caccgcagcc cgcttcaaac gcgacttccg    215640
     tcaagtagac gaggagttcg gcggccctat cgccgagtac tcccgcgcct acattcacca    215700
     cctgttcaag gccaaggaat tcctcggtgg aacattgtgc acaatgcata acgtggcctt    215760
     tatgatccag ctggtagaca acattcgcag cgctatcaac aacggcgact ttgaagccta    215820
     ccgcgatgaa ttcctcggcc gctactacgc aagcaaagga ggcccagcag cagctgggcg    215880
     ctccggaggg atgatctacg gggtttagcg cataagcatg ggtacttttc agggagcagg    215940
     gcgctatgcg ccaagtccaa gcggggatct tcactttggc aacgtgcgca ccgctgtgtt    216000
     ggcgtggctg tttgcccgcc acactggtcg tcgcttcctt attcgcgtag aagatgtgga    216060
     cacgcagcgt tcgtccctgg aatctgccgc ccgtcagctg gaggacctgc atgcgctggg    216120
     catggattgg gacgccgccc ctacctatca gcacaacaac tttgaccgct atgagcaggc    216180
     gttacgcaac cttccgcatt atgagtgcta ctgctcgcgt aaggacatcc aagaggcctc    216240
     ccgcgcgccg cacaccatcc cgggccagta ccccggcacg tgccgaaatt taactgaggt    216300
     gcagcgggag gagcgtcgtc aagcattagc caagcagggg agggtgccgg cgctgcgttt    216360
     gcgtgccgac gttcccacgt ggcacgtccg cgactactat gcgggggacg tgctgggcga    216420
     cgtagacgac atgatcctgc gccgcggcgg ccagcaacct gactgggcgt acaaccttgc    216480
     cgttgtggtc gacgatgccg ccgacggtat cgaccaagtg gttcgcggca acgacctgct    216540
     cacctctgcg ccgcgccagg cctaccttgc gcacctactc ggcgtgccgg ccccaaccta    216600
     tgtgcatgtg ccgctggtgc tcaacgcggc ggggcagcgc ctagccaagc gcgatggtgc    216660
     cgtgaccatg cgcgagatgc ccgacattct gccgcgcgtt gccgaatctc tagggctaag    216720
     cgcgcgtact ctgcctggca tgctcgaaga attcgatccc gataggttct cgcaacaacc    216780
     atggattttt gcaatccata aggaggtata agtctcatat aagtgtggag tatgcatgca    216840
     tacacataca ttagaggggt cttttatttt gtaaccaagg agaaaatccg atggaagatt    216900
     gggttcccac ccttagtgct ggccccttat tggggatcgc cgccgcggcg attgcactca    216960
     ttttggtcct cgtcattgtg ttcaagctcc acgctttcct cacactgatc atcgtttccg    217020
     cagctaccgg actcgccgcc ggcatcccac tggagggcat cgtgcccacc atgaccaaag    217080
     gcttcggaag tacactcgcc tcagttgccc tcctcgtcgg cctcggagca atgctcggcc    217140
     ggcttgtcga aacctccggc ggtgcaaaaa gcctcgccga aaccctcgtc gcccgcttcg    217200
     gtgaacaacg cgcccccttc gccctcggcg tagcctccct gctgatgggt ttccccatct    217260
     tcttcgacgc cggcctgatc gtcatgctgc ccgtcatctt cgccgtggca cgccgactca    217320
     acggccccgt cctggcctac ggcatccccg ccgccggcgc gttctccgtc atgcacatct    217380
     acctgccacc gcacccaggg ccaatctcag ctgcagaatt ctacagcgca gacatcggcc    217440
     tcgtcatgct cctcggccta atcatcgcga tccctacctg gctgatctcc ggcctctggc    217500
     tcggtaaaac cctcggccgc cgctacccac tgccagttcc tgacatccta gccggtggcc    217560
     cccaagcaac cgacgtgaaa aaccccgcca caccagggct tatcgtctcc ctcttgttgc    217620
     ttcctatgct gctcatcttc ggcaacacca gcatgggcct tgccacctcc gcaggctggg    217680
     tagacaagag ctcgagcctc gtgcgcgccc tacaattcgt gggcagcacc cccattgcct    217740
     tgctgatctc aaccctcgtg gcgctgtact tcctcggcat tcgtcgcggc cagcccaaag    217800
     ctgacctaga aaagcttctc gacggtgccc tcggacccat ctgctccgtc gtattgatca    217860
     ccggtgccgg tggcatgttc ggtggcgtac tgcgcacctc cggcatcggc gacgccctag    217920
     ccgactccat gtccgacctc ggtgtccccg tcgtcctcgg ctgttggctc gtcgccgcca    217980
     tcctgcgcct cgcccaaggc tcggccaccg tggcactgac caccgccgca gcactgatgg    218040
     cacccgccgt cgccgccggc ggctacagcg aattccaaat cgcactcatg gtgctggcct    218100
     ccgcagccgg ctccgttttc gcaggccacg tcaacgactc tggcttctgg ctcgtcggcc    218160
     gcctcatggg tatggacgtt gccacgaccc tgcgcacctg gacactcaac caagcgctcg    218220
     ttggagccgt gggctttgta ttcgtcctcg tcttctacgg agtcagcttt gccttctaac    218280
     tacgctcgct gagccaccta gctgcggcat cagcaatctg agcaggggag tcggtcacat    218340
     caaaaacgtg gccgacttcg tcattttcca aaggctgcaa cgtagcaaac tgcgaatcca    218400
     gcaacgacgc cggcataaaa tgcccctcgc gatgattcat acgctccaac aacacctcgc    218460
     gggaaccata cacgtgcaca aacaccacct cagggcattc ccgacgcaac acatcacggt    218520
     agctacgctt caacgcacta caaccaatca cacccccagc cagctgagcc gccaaccatt    218580
     cgcccacctg cgccaaccac ggccagcggt cgtcgtcgtt aagcggaata ctactcgcca    218640
     tcttctcaat attggcctgc gaatgaagat catcaccatc gcgatactcc acccccaacc    218700
     gctcagccaa caacgtgccc accgtcgtct tacccgaccc agacacaccc atcacaacaa    218760
     ccttcacagc cgtgctcaca gcgcaacgac cacctttcca gaaacctgag aatcagcagc    218820
     cgtatcaaac gcctcaacca catcatccac agcactaaaa ttagtcattt ctaaagtata    218880
     tgtttggtgg gggagcgctg cggtgtgaga ttggttcgga cttgcctgct tgtatccgcc    218940
     ttctcgaact cgagaacacg aaaacccaag gacggcattt cggcgcgaaa atcgcgtcct    219000
     gcggtttttg tattcgtgag ttcgaggagg cgaaaatgtg cgcggaaacc acagcaaccg    219060
     agcaaccgca gcgcatccaa accccagaaa acaaaaacaa ccggcgttct cagtagagaa    219120
     caccggttgg tgtttgcgga ggatgtggga tttgaaccca cgagggtcgt gaaacccgca    219180
     cgcgttccag gcgtgtgaca taggccgcta gtcgaatcct ccagcgtatg cacgggcatg    219240
     ccgtgttact tcgcaaacaa tacacacgct tccgtggatc aagcaaatcc gcaggaagat    219300
     ggggagtggg tggtggtgga attgctccgc ggtgggggtt ccgttaggct aggggcagga    219360
     cttcgcatgg cgcgtatccc atgaactccc ccagggcagg aatgcagcaa gggtcagtgg    219420
     gctctagcgg gtgtgcggag tcccctttat atttttgggg gtgtcagggt ggtttggggg    219480
     tactcattga gcggtccctt gtctaaagtc gttggggtat gaggtgggcg tcgttaagcg    219540
     gtgcccacgg gaccacggac cgtaaggatg cttatgtctt tgaaggatta tgatgccgct    219600
     cgtctcgcgc aggtgcgtga ggaagtcacc gcgaagtatg cggagttgaa ggctaagaat    219660
     ctgtccttgg atctcactcg cggtaagcct tctgcggagc agctggattt gtccaatgat    219720
     ctgttgtcgt tgccgggtgg ggatttccgc acgaaagatg gtgtggattg tcgtaactat    219780
     ggtggcctgc tgggtattgc ggatattcgt gagctgtggg ctgaggcgtt gggtctgcct    219840
     gctgatctgg tggtggcgca ggatggttcc agcttgaaca tcatgtttga tctgatttct    219900
     tggtcgtaca cgtggggtaa taatgattcg tcacgcccgt ggtcggcgga ggagaaggtc    219960
     aagtggttgt gccctgtgcc gggttatgat cgtcatttca ctatcacgga gcattttggt    220020
     tttgagatga tcaatgttcc gatgacggat gagggtccgg atatgggtgt ggtccgtgag    220080
     ttggtgaagg atccgcaggt gaagggtatg tggacggtgc cggtgtttgg taatcccacg    220140
     ggtgtgacgt tctctgagca gacgtgtcgt gagcttgcgg agatgtctac cgcggcccct    220200
     gatttccgta ttgtttggga taatgcttat gcgttgcaca cgcttagcga cgagttccca    220260
     attgtgcaca atgttattga atttgcgcag gctgcgggca atccgaaccg cttctggttc    220320
     atgagctcta cctccaagat cacccacgct ggttccggtg tgtccttctt cgcttcctcc    220380
     aaggagaaca ttgagtggta tgccagccac gctaatgtgc gcggtatcgg cccgaacaag    220440
     ctcaaccagc tggcgcatgc tcagttcttt ggtgatgtgg cgggtcttaa ggcgcatatg    220500
     cttaagcatg cggcgtcgtt ggctccgaag tttgagcgtg tgctcgagat tctcgactcg    220560
     cgtctcagtg agtacggtgt ggctaagtgg acgagcccta ctggcggcta cttcatttct    220620
     gtggatgtgg ttcctggtac ggcatcgcgc gtggtggagc tggccaagga ggctggtatt    220680
     gcgttgactg gtgctggttc ttccttcccg ctgcacaacg accctaacaa tgagaacatc    220740
     cgcttggcgc cgtcgttgcc acctgtggca gagcttgagg tggctatgga tggttttgct    220800
     acctgtgttc tcatggcagc ccttgaggtg taatgcatga attttgacga gacggccgtg    220860
     tggcttgatg gtgtattccc tggtgagctc acgattcatt ctgcacccgc ggagagtttt    220920
     cgagtaggca cggctgatct cggcgacgat atgctcgcca ccactctcga tttcgcgcgt    220980
     gtggacaccg gcttggaggc gggtggccgc gacgtgcgca gtgagatatt cacggttgca    221040
     cacgcggggg tgggtactga gaagttcgtg gagttgttgc gtacgcttgg caccttgctt    221100
     tacgacgcct ccggctcgct gcccgcacaa cccggccagt tggtccctgc cgtggggatt    221160
     gaacccttcg atggcaccga catcaccgtg cggcatggtc tttttgtggt tccttatgtg    221220
     tggggtgggg aagtgcccca atgtgatgaa ccggatcggc tgacggtgat gctccagctg    221280
     gtgatgctca cccaagagga gttcgattac gcggtcacct atggcattcc ggaactccag    221340
     tcggagattg cgcggtcggg aatcgatcta ctggattgga gtcggtaggc tagggcacgt    221400
     ggctttatat cggaagtatc gaccagcgtc gttcgcagag gtcgtggggc aagaacaggt    221460
     aactcaacca ctatcggtgg cattggacag tggccgaatc aaccacgcct accttttctc    221520
     gggtccacgt ggctgcggaa agacgtcgtc ggcacgcatt atggcgcgct ccctgaactg    221580
     cgtcgaaggc cccacctcca ctccttgtgg caaatgcaac tcttgtattt cgcttgcccc    221640
     caacgggccc ggcaacctcg atgttaccga gctcgacgcg gcaagtaacc gcagcgtaga    221700
     tgacatgcgc gagctccgtg accgcgccat gtacgccccc gccgaatcgc gctatcgcat    221760
     tttcattatc gacgaagcgc acatgattac tcgcgacggc gccaacgccc tactcaaaat    221820
     cgtcgaagag ccaccggcgc acctcatctt tattttcgct accaccgagc cggagaaaat    221880
     ccttcccaca atccgctcgc gtacccacca ctatcccttc cgcctgctga ccccgcaatc    221940
     catgcgtggc ctgctggaac gcaccgtggc tagcgaacac gtcgcggtgg aagactccgt    222000
     ctacccactc gtgatccgcg ccggcggcgg ctccccgcgc gacaccctct ccatcctcga    222060
     ccagctcatc gccggcgcag gccccgacgg cctcgactac aacctcgccc gcatgctgct    222120
     cggcgccacc gatgacaccc tcatcgacac caccatcgac gccctcgccg gcaacgacaa    222180
     cgccgccctg ttccaagtcg tcgacgatgc catcgaagcc ggcctcgacc cccgccgctt    222240
     cgccaccgac ctcctcgacc gcttccgcga cctcatggtt ctccaatcgg tccccgacgc    222300
     cctcaccctc gggcttgtcg acgcccccac cgaccgcggt gacatcctcc gcgaccaagc    222360
     cacacaccta cccgcgggcg aagccgcccg actagcagca ctggtcaacg acggcctccg    222420
     cggacttaaa ggagcaacct cgccacgcct gctcctcgaa atcctctgcg caaaaatgct    222480
     cctgcccagc gcacaacccg cagcaactgc cactgcacct gctgccgctg cgccggcccc    222540
     tgcgcccacc gagatccccg ctaaatacga gcgccgttcc gtccgcttgg ctagggaagc    222600
     agccgcacgc aagaacgccg aagcacctgc tcccgagcct gctcctgaac cgaaacccga    222660
     accaaagccg gagcctcgtg atgggtttgc cactattcaa gagaagtggg caacgatcag    222720
     cgatgtgatc ttcaaagcca actccgtggc aggcattttg cttagccaag ccaccttgct    222780
     gggcttgcgt gacgattcca ctcttgtgat cggtcacaac accggtgcgc tggcgcatcg    222840
     gatcaacgac ccacagcatg caggctccat cgttactgca attaagcagg aaactgatct    222900
     cgatgtgacc attgagtgcg tagtaggtac ggaccccaaa gctgctggtt ttagcgaacc    222960
     agaaaacaaa aaggtgtgga acccagagcc caagccggaa cccaagcccg agcccaagcc    223020
     ggaaccaaaa ccggagccgg aaccggctcc tgccagcgat aatgtctggg gcgcacctgc    223080
     gccgctcggt ggtggacaac cagctacgcc tccgccaccg ccggtagagc gatttagtcc    223140
     tgccaaggcg accgcaccac aacctccagc tgcgccgcaa cctgtgcaag aagctccgaa    223200
     accccgctgg cagcaggccg ctgaacgtgg catgcgcaag atggaggagc gcgccaagcg    223260
     gccgtcgttc tccgatggtg tgccgctgcc gcccgagccg gaggaaccgg atgtgccgcc    223320
     ggacctctac ggctaccccg cagatgaggg gataccggaa cctcagaccc ctcaggctac    223380
     gtctaactat gtagtggacc atgatgagga agaggagatg gttagggaag cggcacaggg    223440
     cgtgggtaat cgtgaccatc gcgatgctat gaccgttgcc gtggacattc tctccgaaga    223500
     gctaggtgct cgacagcttt aggtacacta ttcgaatgac cgccgtcgca cagcaggtgt    223560
     ggcggatact aaaaacaatg cgaaaggcag ttgaatgact cagccggata tgtcccagat    223620
     ccttgcacag gcacagcaga tgcaggctaa gctgcaggaa gctcagcgtg agatccttgc    223680
     taccaccgtc accggtaccg ctggcaatgg tcttgtgagc attgacatgc agggcaacgg    223740
     catggtttct tccgtcacca tcgaccctaa ggttgttgac gctgacgatg tagaaaccct    223800
     ccaggacctg cttgttggtg cattcgcaga ggctcatgaa aagctcggca cccttgcaga    223860
     gcagaagatg ggcccgctgt ctcagggctt cgacggcctt ggtgggatgt tctaagagtt    223920
     gttcgaagga cctctccaag acctgatcga cgagttttct cggctccctg gtgtggggcc    223980
     gaagtcggct cagcgcattg ctttccacct gctccatgtg gaaccagcag acattacgcg    224040
     tctgcaagat gcgctgggtg ctattcgtga cggtgttact ttctgccgca tttgctgcaa    224100
     tatctctcgc gaagaggtct gccgcatttg tgcggactct tcacgcgacc gcagcaccat    224160
     ctgtgtggtg gaagaaccca aagacattca ggttattgaa cgaaccggcg agtacacagg    224220
     tcgctaccat gtgctcggcg gctcgcttga cccccttgcc aacattggcc cccgtgagct    224280
     caacatttcg caattattgc agcgtatcgg cggcgtgttg ccagaccgcg aacttgcgga    224340
     ctccaccccc gagacaccgc tttacgacgc ctccccagaa gtgcgcgagg ttatcctcgc    224400
     caccgacccc aacaccgaag gcgaagccac agcctcctac ctagcgcggc tgctgcgcga    224460
     cttcccagac cttgtggtgt cacgccttgc ctctggcatg ccactcggcg gcgacttgga    224520
     gttcgttgac gaacttacac tgtcgcgtgc gctgagcggc agactgacgc tgtaggaaac    224580
     ctacgctagg cgctccttgc gcagctggtc gacgaccggc aggtccaagg gggcaagatc    224640
     agcaagggca atgcccatcg cttttgccag cagcaggtcc gcaagctgcg ggttgcgggc    224700
     caaagctggg ccatgcatat aggtgcacac cacattgccc tgcacagcgc cttcataaga    224760
     cacctgttca tcagataccg aggcggtagt aataccgtgc agatccgtgt tgcctacacc    224820
     tcgagttaca gcacccagcg gttgggcatc agggcctaag atggtggcgc ccatgtggtt    224880
     ttcaaaacca gtcagcggtt cggtgagctc tgcagtaaag cccgctgcgg taggagtgga    224940
     ctgaagttcc ccgatggtgc gtttggctag ggacgcagtg gtggcgtcga taagccctac    225000
     gccctcgacg atctttccgg aggcgcggaa ggaacgcccc aacacctgca gacctgcgca    225060
     aatgcccaaa attgggcggc cggaatcagc ggcacggcgc agaccccggt cattgttgag    225120
     gtgttctgct gccaagatct gggcggtgtc ttcgccgccg ccgaggcagt agagatcgag    225180
     accctcggga acggcttcgc cgaggcgaac cgtgtggatc tccgcggaga taccacgcag    225240
     gcgggcgcgc tggcgcagga cgagggcgtt gccgtcgtca ccgtaggtgc ccaacacgtc    225300
     cggcaggatt aaaccgatgg ttaattcgct catgttaagc ctccttggtt gcggcggtga    225360
     tggcgcgctt gagatcgcgg aatgcggtgt agttggctag gacttcgacg cgccccgccg    225420
     ggcaggcctt gatggcggcg agggggtcgc gcacgagctc gtggtccacg gaggcgtaag    225480
     tcaggcgcac ggagaggtct gtaccgcgct cgccggcagc cttgacggaa agctcttcga    225540
     gctcctcgaa tttgacgtcc caaagccagg agaggtcctc gccatcagcg acttggccgt    225600
     tcacggcgat cacaaggccc tcggcggtgc gatccaccat ggagagcgct tcttgccagc    225660
     cggctgggtt cttggccaac agcaggtgaa tttggtgctc gccgagggtg atggtggagt    225720
     agcggcccgc cacatcgtcc accgtttcga cggcacgcac agcatcatca agcggcacat    225780
     tgaagcaggt cacggccgca gcgatggctt gggtagcgtt gccacggttg gcgttgcccg    225840
     gcagtgctag ggatagcggg acgggttcgg catgccctgg ggtgagaatg ccgtcagggg    225900
     tgatggtcca cgcgggggtg gggcgttgga aggtttcgcc gttcgggagt ggcttggtgg    225960
     cgtaccagtg gtcgtcttgg cggacgatgt ggctgccggt gcgtgggcag gacacggagt    226020
     cgccggtcca cccggcacca gctgataccc agactacgtt gggggcgtcg taagccacgg    226080
     aggtgactag cacgtcgtcg cagttggcga tcacggtcat gtcggggtgt gcggttacgc    226140
     agtcgcgcag ggcacgttcg atcttgttga tctcaccgac gcggtcaagc tggtcgcggg    226200
     tgaggttgag caggatcagg cactgcgggt ggaggcggtc ggctgccgag ggaacatgca    226260
     gctcatcgac ctcaaggacc acgtggcttg ccgattgccc cgccatcaga gcggagataa    226320
     tgccggcgtc catgttgtcg ccaccttcgt tggtggccac ggtgtgctgg gcgcggacgg    226380
     cgctggccag catgcgcgtg gtggtggact tgccattcgt tcctgttacg agcgcggtcg    226440
     gacgcgtttt agccaacgac tgcatgatgt tcgggtcgat tttttctgca atcagaccac    226500
     caatcatgcc gccggagcca cggccggtcg cccgcgaagc cgtagtggcc acagcggccg    226560
     cgccgattgc aaggcgagtg cgcaaattaa aactcatggc gcctaagtct agtccactta    226620
     ggtctctgct ggcttgcccg gcttgacgtg ttcaaccgca cgcagaaatt cttcgtccgt    226680
     catcagcgga atccctttgc gatcgccgtg cattgccttg ccggtaagat cttcacgttt    226740
     attgcacaca accaaactgg aggcgcgggt aattttctca ttgtaggcca gctctgtgcg    226800
     cacgatcgcc tgaatgatcc ggtcgggatc catagtgatc tcaggtgcca ccacaacttc    226860
     catgccctgc accagcccgc gctctttggt gtagacgcca gggttttccc acacgcgcgg    226920
     cacctccatt gcatccacgc ggacgttgga tcgttgcaga ccaaagcggt ccgcgcgcag    226980
     gtccgccggg cttgtcgacg acacagcccc ttgggcgtgt tccacaaaga acatccgcgc    227040
     caccaacagt gtgtcttccc gtgtgagctg tgcggtgtcc gcctgcgcgc gcgccacact    227100
     cgcacgagca tcaggtgctt ctaggcccag ttgcgttgcg acgttcctaa tgcggatgtc    227160
     tgcaaacgtt aatcctaggc ggcgtgcagt agcgagcgta tccacaatcg tgactggctt    227220
     ggggatgtgc cccacccgct gcctgcgccg attgcgttgc cgactgcgac tgcggttagc    227280
     gcgggcagca ttgctcattg cgcgtttcga ctcagaaaca atgaaccccc acaccagctc    227340
     tgcattgtgt accagcaagg tgcggccatc gataagcctg tcaagagcct taagaatctg    227400
     cgaatagcgc ttaccctctt gaatctgctc aggcgaaagg ccgtgcaggt ggaaggggcc    227460
     agggtttgat tctgggttga gcactgcgaa gaagtggtcg acttcctcgc cctgctctgt    227520
     gaaagtaacg gcatcaatgg taacgaggcg gctcgtcgat gggtgaatac cggaagcctg    227580
     caccgataat gccacataag gagccttttc gatctctgct tttcgagccg ctgcctgctc    227640
     ggcggcgcgc tgtgcccgcg ccttatcgcg ctcttcttgg tccttattag tcatggggaa    227700
     cagtctagct ggcggtcttg tgggcaggga aacattcaaa tcctagaggt taaacccttg    227760
     gtcgcgggcg atcgcgaagg tgtgattgcg tttatcggag tcggctccgg cagcaggatt    227820
     ttttgcgagc acctgacggg tgaaactatc tacgcgccgg ttggcatccc gaagatcgta    227880
     gtaggtggtc atctcttggt cgtagtcact aagcgcttcc agccacgagt cgggcgcatg    227940
     gtaaccattt tccattgtgc gcaatggggt ggccatacgt ggtttaagtt gcggctcttg    228000
     attaggccag cccagtgtca tgcccacaac tgggaaagtg agctcaggta gttgcagcag    228060
     ttcgatcaca gccgcagcat cgttgtggac gttgccgagg aagttcacac ctaagcccat    228120
     cgattcggca gcgatgcaca cgttttgtgc cgtgaggcag gcatcggtga acccctggac    228180
     aaagttgcgg gctgtcgcag caccggcagg gtccgcgcct agctcttgga ggatgcctgc    228240
     gttgcggtgg caatcgacaa taaacagcag gtagatgggg gcacggccaa catattcctg    228300
     ggcgccgatt tcggctaagc gtacccgcaa ctgggggtca gttacacgga taatgctggt    228360
     gctttgcatt cccaacgagg tggcagtccg ccccgccacc gcaaacagct gctccatgat    228420
     ctcctccgat acttgctcgg tgctgaactc acggatagtg cggtggttaa gctgggtgcg    228480
     aatcgtctcg ttcatgcttg ccttcatgcc tgctttagtg cctgctttca tgtccgccaa    228540
     gtgtaagtag ttatttaact cagcgcacgg ttgaccgcag aagtaattgc cttcagggaa    228600
     gcgtaggtga tggaacctgc gatgcccacg ccccagaact tcttgccgtt aacctccgcc    228660
     aaaatgtagg cggcagcttc ggcatcgtca cctgcggtac gggcatgctg ctcatattcc    228720
     tgcacctcaa catcaatgcc caaggactcc agcgcgttgg catatgcggc gattgggccg    228780
     ttaccgtggc cttcgatagt cgtctcagaa ccattaacga tcaggcgggc gtgaatgcga    228840
     gcctcatcgt tttcagtttc cgcagcatta acgctcatag agacttgctc cacagggctg    228900
     gtgctatcca agtattcgcg ggcgaaaatg tcccacatgt tcttggaatt cacctcgccg    228960
     ccctcggcat cggtgacttc ctgcacgatc gaagaaaact cgacctgcat aggacgaggc    229020
     agcgccaaac cgtgatcggt cttcataatg taagcaacac cacccttgcc ggactgcgag    229080
     ttcacacgga tcactgcctc gtagttgcgg cccacatcct tcgggtcgat cggcaggtat    229140
     ggaacctccc aagtttctcc acgcagctcg tcccaggaga cttcggtgtg ggtcgcgccg    229200
     gggtgtactc gggatgccat ggcatccagg cccttgttaa cggcatcttg gtgggagcca    229260
     gagaatgctg tgaatactag gtcgccacca taggggtggc gttctgggac gcgcagctgg    229320
     ttgcagtatt caacggtgcg acggatttga tcgatgtccg agaaatcaat ttgtgggtcc    229380
     acgccttggg tgaacatgtt caggccaagg gtgaccaagc agacgttgcc ggtgcgttcg    229440
     ccattgccga acaggcagcc ctcgattcgg tccgcgccag cgaggtagcc cagttctgct    229500
     gctgcgacac cggtgccgcg atcgttgtgg gggtgcagag acaagatgat gctgtcgcgt    229560
     cggttgaggt tgcggtgcat ccattcaatg ccatcggcgt aaacgtttgg ggtgatcatc    229620
     tcaactgttg aaggcaggtt gatgatgata gggttttctg gggttgggtc catgaccgcg    229680
     acgacggcat cgacgacttc cttggcgtat gtcaattcgg ttccggtgta ggactcgggg    229740
     gagtactccc agcgccaatt ggtatcgggg tagtccactg cgatcgattt gatcagctcg    229800
     gcagcatcgg tagccaactt tttaattgct gctttgtctt tgcggaatac tacgtctcgc    229860
     tgcaggatcg atgtggagtt gtagaagtgc acgatcacgt ttttcgcgcc ctcgcatgct    229920
     tcgaatgtgc gacggatcag gtgttcacgt gcttgtacga ggacctggat ggtgacatcg    229980
     ttcggaatca tattgttctc aatgatttcg cgaacaaagt cgaagtcggt ttgcgaggcg    230040
     gatgggaagc cgacttcgat ttccttgtaa cccatgttga ccagcaggtt aaacatgcgg    230100
     cgcttgcgct cagggctcat tgggtcgatg agtgcttggt tgccatcacg aaggtctact    230160
     gcgcaccact gtggcgcctt agtgatgcgt ttttgcggcc aagtgcggtc ggggagatcg    230220
     atgttttcta cttcgacgtg aaacggctgg tatcgattta ctgccatgga ggaattgcgc    230280
     tgagtgttcc atggagcctg acctggtgct ttatcaccac gtggggtgac aatggctgca    230340
     ggggcggaga tgaaagtatc tggggaggtc attggtagtt tccttcacgt gggttcttgt    230400
     tgcagccggc tacactagaa ctccgcgacg gggagccggc tgtgtgtaag ggacgttaag    230460
     cctgtgaccc gccgcggcga agaaggagaa gattcgcgcg attcatgtga agtagcatac    230520
     atgaatcccg tctcatgcgc taggtatccc actatgtgga acatgttgtg gggtgtgtcg    230580
     tggttggggg tggagtgggg taaaaatgta catatgattg acgcccgcga ttgcctagca    230640
     cttgatgctg ccaaacttta ttacgtaaca ggtttgggtc aggcacaggt cgctaaggag    230700
     ctggggattt ctcgtcctac agtatccaag ctgctatcgc atgctcgtga taaaggtttt    230760
     gtcaccatct ccctgaatga ccctcgcgag gttgcaggtg ggtacgtcga aaagctttgt    230820
     gctcgctatg ggcttgccga tgtccgcgtc gtacaatccc ctgcaatggg gcgggggctg    230880
     actggcgagc tgggtaatgc cggtgcagcg ctgctggaag aggttgtaaa ggacggtatg    230940
     acggtgggtg tgtcgtgggg tgacacgatg ctggccgttt ctgagcatct gcgtaccttg    231000
     cccttggtgg atgtaaaggt ggtgcaactt aaaggcgggc actcgcatac tgcacgcaac    231060
     actaacgaca tggtgacgct gacgcgcttc tcgcgagctc tgaatgcgga aatgatgatg    231120
     ttgccgctgc ctgtcattct tgatagcaaa gaagctaaag agctggtagt aaaagatcga    231180
     catattgcgt ccatgctgaa cctgggggcg cattgtgacg ttgctgtgtt tacagttggg    231240
     gcggtaaagt cggaaagttt gctgcttaac ttggggtatt tgtcgcctag tgagcaggct    231300
     cgcttgatgg agcatgcggt aggtgatgtg tgctcgcgct tttatgatgc tcaaggcgag    231360
     gttgcggacc ctgatattga tgctcgcaca gtgggaatat cgctggcaga tttgaagaag    231420
     cggcctgtac gggtgctggt agcgggcggt ttggagaagg cgccggcgat tgaagctgcc    231480
     ttgcgtaccg gtgtggcgac ccatgtggtg attgatcatg ctacggcgca gcgcgtggta    231540
     gagatggcgt agtgaagatg tggcgctgtt aatgcggtcg aatactagtg ccatttttat    231600
     ttccccctgt gtttgattgg ctgattttga gtgtagtcat agtgctataa catgcgctag    231660
     cccctactgc tacccctttt tgttcgaatg ctctttcgga tgtcaagtcc ctgcgataca    231720
     ctcgcaacca ccatgaacaa ccagggggct acacatcatg aacaccacag gggagaccac    231780
     acaaccgttc tacagtcact gcgacatgaa cgacccactt tgccgcgccg aacgactacg    231840
     catccaattc gactactacc gctggcacag cctacaaccc gatgacaacg acgacgttga    231900
     cacctacacc gcagacatcg ccacccgcat cggcaaaacc caacgctacg tctgcgacca    231960
     cctcgacgcc atctactacc tcacccaact cccacaactc cacactgtct accaacaact    232020
     ctggcacctc gacgacaccc ggcttatcac catcaccaga atcatctccg cactacctac    232080
     cacctactat gacgccatcg acacccacct gacacgctgg ctcacaccca cccaaccagc    232140
     acaaaccatc cccagtacca gggccattac ccgattccta cgcaaaacca tcacccacct    232200
     cggctttcat ctcgacaaca cccgaaaacc agaacaatac gtctacatct acgacgccgg    232260
     acacggactc gcaggcatcg acgccctcat ccacgccggt gtcgcagaac tactcgagac    232320
     caccttgcgt agcatcaaaa agacccatag ctgcgacgac tccacagccc tgcaactact    232380
     gttagaagat aaaaccagtg tggtgatcaa cctctatgac accggcacgg ggatcaccta    232440
     caccccgcag ggaacagctc tgcctcaggt gcctgagcat cttgttattc gtgtgctcgg    232500
     tgacgctgat gtggcggtgt cgactggtta tcggtttaca gaggcaatgc gcaggtttat    232560
     tcaaggccgt gatggggtgt gtcgtttccc tggttgtggg gtgccggcgc agtggtgcga    232620
     tattgaccat gttgaagaat atgatctcgg tggggttacc ggtgcggtta acgctcagtg    232680
     tttatgtcgg catcatcaca atgtgaaaac gtctcgtcgg gtcgattgtg agattggtgc    232740
     cggtggtgtg gtgacgtggc agatcggtga tcgtagggtg gttaccacac cggaaggggt    232800
     gctagcgggg caaacgttta ggcaacgcag agaaaagaaa atcaaaaaag cggcataggg    232860
     gatgagggat gcgcgcgcgg ggttgctcgc gcgtggattc cgcatgccta aatttagtaa    232920
     ccgcccagtg gactatgacg gctcttctgg ttttggagtg cattgatttt gtgtcggatg    232980
     ttggcggcgt ggatcaggca ccacaaaatg tagtggtcga ggttacagaa gcctagggcg    233040
     atgccgcgta ggaattctag gcaggccgtt gatagcttcg acgggcccgt gggatacttt    233100
     gtggtcgaag taggcgaggg gtgtccttgc ggcgcttgtt catggctttc ttggctgctt    233160
     gcttgttggt agtaggtcta ggtctgttgt agcggcgcgt agtcgtcgtc gaagtcaaac    233220
     agtttttcaa gccgcccacg gagcttgtca ccggctaggc gtacaacgtg gaacgggtct    233280
     atgacttagg tagcgttgaa aatgacttcg ccagcggcgg tggcatagcc ttggaagccg    233340
     tccatgttga tgatggtgac ctgattatgg aacttcgctg tgattattca gccatgttcg    233400
     caaacgcgtt agcgcttctt tctggaacaa cgtcaaaaag ccgggcgggg cggatgacgt    233460
     ttccgtcgcg tcatgtgtgt cggttgtgcg accagtgatg ctcatcaaca ccgatgaccg    233520
     tgacccccgt tgaggtagtg cttgtcgttg tagatcacgt cgcggacagc ggctaaggtc    233580
     aaggtgttgc aggatccagt gggtcacctt gttagtggtt tttggattgt cgggtgcgca    233640
     ggcaaggccc gtgtggaagg tcttctgcaa gcagcgcttg ttagtgcacc ggtagcgtgg    233700
     aaggcgcaca tgaaggcgtg ttgggtggtc gatgatgggt agatcgacta ggctgcggat    233760
     gacgtggtcg cgcaatactc taggctgccc gcacgtgggg cattcattga tgggctcggc    233820
     ttcgatgacg atggcatttg ggttgggctg cacagtaggt ccttggttgt ggatggatgg    233880
     tttagatacc cttttcctgc aaagccaagg accccaatat cttgtgccac gcccgaaccc    233940
     ctcggcgagc taatcaatgc actctaaaac cggaagagcc accaaacggg ggtatttcga    234000
     aggattttgc acagaacttc acaccaaatc gcaagaaaac cggccgtttg agcagatttg    234060
     gtgtgaagtg ccgtcttttt cgggggtgag cgggggtggc gcgcccacca acgcccacca    234120
     gcgcccacca acgccagcca atcctagcca agccatggtt atggaaaacg tcctactccg    234180
     cgtagttcca tgcccgaacc ccagcgaact aatcaatgca ctctaaaacc ggaagagcca    234240
     ctatgacata ggccatagaa caaatgtaaa agtggccgtt gacatttgta actactcggg    234300
     cttaacctca cagtatcaga taattcacga gcgaggagat gtacgttatg gctgaaaagt    234360
     caaccccaca catcaatccc aagggcgtcg atatcgcaga aactgttctg ctgcctggcg    234420
     acccactgcg tgcaaagttt atcgcagaca cctacctaga agacgttgtg cagttcaatt    234480
     cggtgcgcaa catgctcggc ttcaccggta cctaccaagg aaccccagtt tctgtgatgg    234540
     gttccggcat gggtatgcct tctatcggca tctactccta cgagctcatt aacttctttg    234600
     atgcccgcaa cgtcattcgc gtgggctcca tcggcgctat gcagaaagat attgacctct    234660
     acgagatcat cgttgcagca tctgcatcca ccgactccaa cttccttgag cagtacaact    234720
     tgcctggcac ctacgcccca actgcatcgt ggaccctgct gagggcgttc atggatgagg    234780
     cagaccgcaa gggtaagaag gttcacgtcg gcaacatttt gtcctccgat gttttctaca    234840
     acgctgataa taccgtgaat gagcgttggg ctcgcatggg tgtgctcggt gtagagatgg    234900
     aatcggcagc actgtactcc atcgccgcat acgctggcgc aaatgctctg ggcgtattta    234960
     ccgtgtcgga caacctgttc accggagcac gcaccacggc tgaagagcgc gaaagcgcct    235020
     tcaccgacat gatggaactc gcactaccat tggcacgcgc atgacaacgc acaacgcaac    235080
     cttgaagcct actgatccga aggcagcagt gccggtcctg ctgttcagct tcgttttctg    235140
     tttgattgtg gacaatggtt ttaagactat gaccggcccg atggcagagg gcttgggcat    235200
     tgaccccaac acagcctcgc tgcaggcctc gcttgcaggt gtgatcatag gcattggtgc    235260
     ggttgtttat gctgcactcg ctgacgcgat ctcgatccgc aaactcatgc tcatcggcat    235320
     cggcctagtg gttgtaggat ccgtcatcgg attcgtgttc tccggctcgt ggccacttgt    235380
     tcttgcaggt cgcctcattc agaccggtgg cctcgctgca gcggaaacgc tgtacgtgat    235440
     ctacgtgacc aagcacctcg cagcggaaga ccaaaagacc tacctcggct tttctaccgc    235500
     cgcattccag tccggcttgc tggtaggcgc actgacctct ggtgctatct ctacctacat    235560
     cggctggcgc gtgatgttct tggtcccact gattttgatc gtggcagtgc catttatcct    235620
     caagaccgtt ccagaagaag aagcctcctc gtcgcacctc gatgttgttg gtctattcct    235680
     gatcgctatc tttgctacct cggttatcca gtacatgcag gccttcaagc tgttctggtt    235740
     ggcattcatg ctggtcagca tcgtgatttt cgtttggtac gtacgcaacg ccaagaaccc    235800
     agtggtcaac ccagagttct tcaaaaatgg tcgctacgta tgggcaatcc tgctcgtact    235860
     gatcgtttac tccacccagc tcggctacat cgtgctgctg ccattcgcag ctaaagagtt    235920
     ccacggacta gaccaagctc aggcatcgta tctgatgatc ccaggctata tctgtgcagt    235980
     cctgatcggc attttctccg gaaagatcgg caagctgatg acgtcgcgac gcacgatctt    236040
     caccgcactg ggcatgatca tcgtcgccct cgtggtcggc gcgctcgcta tccaggtgca    236100
     cgttgccgtg gcaattgcct cgatcatcct gttcgcatcc ggattcgcac tgctctacgc    236160
     accgctggtg aacactgcgc tcgccaacat cctgccggag aaatccggtg tggccattgg    236220
     cttctacaac ctgaccatca acattggtgt cccactcggt atcgcctaca ccttcaagct    236280
     gatgaacctc agtatcggaa ccaacgccgt gatctggatt cttgccgcga tcgccgtcgt    236340
     cggagccgtg atgtacttca ttgctgaccg cgcgctcttt agccgcgaaa aggccgcagg    236400
     catcgattcc gtagcaaacc actaaaacat ccacccactt ttcaaggaga ctcaccaaaa    236460
     tgactactcg caacgacgta gcccagatga tcgaccacac cctgctcaag ccagaggcaa    236520
     ccaccgacga cttcaaggca ctcatcgccg acgccgttcg cctcggcacc tactcggtat    236580
     gcgtatcccc atccgcactc ccagttgagg ttccagaaaa cctccacgta gcaactgttg    236640
     tgggcttccc atccggcgcc gtcaagccag agatcaaggc tgctgaagct gcccgcactg    236700
     ttgccgatgg tgcagaagaa gtcgacatgg tgatcaacat cgccctcgcc aaggaaggca    236760
     agttcgacga gctcgaggcc gaaatcaagg ctgttcgcga cgccgtccca gcaccaggaa    236820
     tcctcaaggt catcctcgaa accgcagcac tgactgacga cgaaatcgtc gcagcatgta    236880
     aggcctccga aaacgctggc gcagactttg tcaagacctc caccggcttc catccagcag    236940
     gtggcgcaag cgttcacgca gtggaaatca tgcacgcaac cgtgggcggc cgcctcggaa    237000
     tcaaagcctc cggcggcatc cgcaccgcca aggatgccct cgccatgatc gaagcaggcg    237060
     ctacccgctt gggtctgtct gcctccgcag ccattcttga agaactagga gagtagaaca    237120
     atcatgagct acgcagagct agagcgcaca gcccgcgagt gggcggatca cgatcccgac    237180
     cctcgcacca aagaaaccat cgagggctgg cttaaaactc acgacgaaga atccctccag    237240
     caggcattca acggaccgct gacttttggc accgccggcc tgcgagcacg agtgggcgca    237300
     ggtgaatccc agctcagcct ggcagtcatc ctgcgcacca cctacggcct agtcgactgg    237360
     gtaaaaaccc agctcggcgc agatgccacc cctacgatcg tgatcggctg cgacgcccgc    237420
     cacggatccc tagagttcca ccaagccgca gcggaggtag tctccgcagc cggcggacgc    237480
     gccctgctgc taccagctaa aaaccccacc ccactgaccg cctttagtgt gaagaagttt    237540
     ggtgccgatg ccggcatcat ggtcaccgcc tcgcacaacc caccagccga caacggctac    237600
     aaggtctacc tcggtggacg catcgcccaa ggcccagccg aaggcgtgca actgatcagc    237660
     ccagctgaca aagaaatctc cgaggcaatc gcagcagcac cgtacgcaga cgaaatccca    237720
     cgcaccaccg acaacatcga acatgttgac ccacgcgagg actacctcac ccgcgcactg    237780
     accctcgcag acaagaagag cgacatcctc atcgccctga ctgccatgca tggtgtcggc    237840
     gcagccttgg gcgaaaaggt gctcaccgct gccggattca acgtctccct cgtcccagaa    237900
     caagccgagc cagacccaga tttccctacg gtgtccttcc cgaacccaga ggaaaaaggt    237960
     gccctcgacc tggcgaaagc acacgccaac accatcggtg cagatgtcat catcgcctac    238020
     gatcctgacg cggaccgctg tgccgtcgcc accccagacg ctaacgccga aggcggatgg    238080
     cgccagctca gcggcgacga gacaggtgcg gtgctaggtg cataccgtgc gagcgtcgca    238140
     aagccaggct ccatggccaa ctccatcgtc tccggccgcc tgctctccaa gatcgccgaa    238200
     gccgcagggc gtacccacgc caccacgctc accggattca aatggatcgc acgcacccct    238260
     gaactcgtat tcggctatga ggaagccatc ggattctgct gcgacccaga agcagtcgcc    238320
     gacaaagatg gtgtctccgc ctccgtggtc gtagcaagcc tcgtcagtgc cctcaaagcc    238380
     gaaggccgca ccctcgatga cgccctcgac gacctagccc gcgaacacgg cctctaccag    238440
     accgcgccgc tgaccttccg cgtcgacgac ctctccatca tcgcccgcgc catgagcacc    238500
     ctacgcgcac aaccgccaac ggaactcgca ggtgcaaccg tcaccgaggt caccgacctc    238560
     aacgacccaa ccctgccatg gggcgcaacc gacggcatga tgtttatcac cgaccacaac    238620
     gaccgcatca tctgccgccc atccggcacc gagccaaaac tcaagtgcta cctcgaagtg    238680
     gttatgcctg tcaccggcga caccatccca cgcgccgaag ccgcccaacg cctcgacgct    238740
     atcgccaccg cactgcgcac ccacctcgga atgtaggcga gaaacaacct ccgcgttcag    238800
     ccttgctaca ttagtgacaa gtatgaacaa ggtactcaca gcactagccc tcgtagccgc    238860
     aaccaccgcg ttgcggctcg gggcttttgc catagcagga gcaaccgccg gaatccccaa    238920
     cgccatcacc accgcagcgc tgaaatggga cgccgaccaa tacctcacca tcgcccgcga    238980
     cggctacctc gccaaccccg aaaccagcgt cgcattcttc ccagggctgc ccatggccat    239040
     gcgcatgctc agtgtgatta cccacctgcc gctagaagca tcggggctga tcattgttac    239100
     gatcgccacg gctgccctcg ccctagcagt catgcggctc gccgaactta tgggaatcgc    239160
     cacgccgagc ggacgtatcg tcgcaacgct tgtggtgctt ttagcgccca tgtccggcac    239220
     cttcaccatg gtttataccg aggccccctt catggcgcta agcttctggg caatcgtcgc    239280
     catgatgcaa gaacgctggc ggcaagcaac cctcctcgtc gcgcttgcag ggctcgtacg    239340
     cctcaccgga atcgacctcg tagccacctt cgccatcgtc ttgctgctgg cctccaaacg    239400
     ccacctgccc ctcgccgtaa tcgcacccct gcccaccgcc agctacctcg cctgggcctc    239460
     ttgggtcacc cgcgacgccg gcggctactt tggcatccaa gaaaaaggct ggggctcggg    239520
     tttcgacggc ggaatcagca ccatcaactg gatcgtccat agcctccacg aacccatccg    239580
     cctcggctac atactcagct ccgccagcat ggtcatcgcc gtcatcgcac tagtggttgc    239640
     ttatccacgt ctcccgctcg caccctggct cttctcgcta tttattggcc tcaacgtgct    239700
     gctcagcggc ggaatcatgc actcccgccc gcggctcctg ctacccatgg tcctgctcgc    239760
     tctgccattt atccgcacct ggcctgcggt aattctgtgg tcgctaggag gacttgccat    239820
     ctcggcctac atgatcgtgg tattcccctg ggcgatctaa attagcttcc caccccgcgc    239880
     cacgacaacg caaaagtaga caccaccatg gtgaccaacg cggccgccat aaaagcccag    239940
     ttcaagccat acacttggaa ctgctcaccc aacacggcat agcccaaagc aaaagccaca    240000
     atcggctcca caatggtcat cgccggcagg gaatttttta gcggcccagc attaaacgcg    240060
     tactgctgaa tcacagtgcc caaaatcgca ccaaacagta gggaatagcc ctgccaagaa    240120
     aacacaagag tggtgatacc gccgtgagtc atgatgtcca ccgtggcctt ggaaagaaca    240180
     gctacgtagc catacacgcc gccagtgata gcccctagga ccagggcgcg agtattaaga    240240
     gcgaggctgc cggaaacaaa ccacagcgtc agcaagataa cagcgccgat cccgagggag    240300
     ataagccaac gatccatagg gggctgggga tcaccagcgg ccggtttgcc cagcacaacg    240360
     aggacggcga cggccaccgt gagcgcgccc gcccagccca tctcgtcgcg gctggggcgg    240420
     cggccgtcgt aacgcgcgga cagcggaagc gtgaacataa gcgacagcac aaggattggt    240480
     tgaaccacca aaagggtgcc aaaaccgaga gccaccacct ggagcgcgta gccgagcagg    240540
     gcggtgaggc taccgaccca ccagcggaaa cgggtgaccg cttcgaggag gggagagccg    240600
     tcggtttcct cggctatgcg gtgccggacc acggtgcccc atgcgatggt gagggccgag    240660
     gcgagggcga acgccatggc gaggaaattg ctgtacatcg gggtttagcc tatacggttt    240720
     gtgcagcatc attgctttac gacgctccct ctgcactatt cacccccgaa ttatatgcag    240780
     tgatcaaaat tgactgtagt atagaaattc gtaatttcat ggtcttgaac gagggacgca    240840
     cacgctggtt aacgcagcgt tgtggcgttc cgggaagggc gtagccccgt ggcacttgta    240900
     gtacagaaat atggaggttc ttcgctagaa agcgcggaac ggatccgacg tgtcgctgaa    240960
     cggatcgtgg ccactaagaa gcaggggcac gacgtagtcg tcgtgtgctc tgccatgggg    241020
     gataccaccg atgagctgct cgaccttgca gcacaggtga atccagttcc gccagcacgc    241080
     gagatggata tgttgttgac ggctggcgag cgtatctcga atgcgttggt ggccatggcc    241140
     attgagtcct tcggggcgaa agcgcagtcg tttacaggtt cacaagctgg tgtaatcacc    241200
     acggagcgcc acggaaacgc gcgcatcgtg gacgtcaccc cagggcgtgt acgtgaagcc    241260
     ttggacgagg gcaagatctg tctcgtcgcc ggattccaag gcgtgaaccg cgaatcaaag    241320
     gacgtgacca cgctgggtcg tggcggttcc gataccaccg cagtggcgtt ggcagcggcg    241380
     cttaatgctg atgtgtgcga gatctactcg gacgtagatg gcgtgtacac ggcggacccc    241440
     cgcattgttc ctaacgcaca gaagttggaa aagctgtgtt tcgaggaaat gctggagctt    241500
     gccgcaagcg gttccaagat tttggtattg cgcagtgttg agtacgcccg cgcgtttggc    241560
     gtgccgctgc gtgttcgttc gtcttatagc aatgatcccg gcacattggt cgccggctcg    241620
     atggaggata tccctgtgga agaagcagta ctaactggtg tagcgaccga caactctgaa    241680
     gctaagatca cggttctggg tatcccagat tccccaggca gcgcatcggc agtgttccgc    241740
     gcgcttgccg acgccgaaat caacatcgac acggtgctgc aaaacatctc ctccctcgag    241800
     gacaaccgca ccgacattac cttcacctgc ccgcgtgccg acggtcccca cgccatggaa    241860
     ctgctccgca acctgcaggc aaagaacgac tggcagaacg tgctttacga cgaccagatc    241920
     ggcaaggttt ccctcgtggg cgccggtatg aaatcccacc caggggtcac cgcagagttc    241980
     tgcgaagcac tgcgcgacgc cggtgtgaac atcgaattga tctccacctc cgaaatccgc    242040
     atctcagtac tgatccgcga atcggacgtc gatgtggcag cccgtgccat ccacgagaag    242100
     ttcgagctcg gtggcgaaac cgaagcaatt gtctacgctg gtaccggacg gtaagcgagg    242160
     agttttaaga aaaccgtgtg ataaaagacc tctcgctaat agtgtgcaag aggtcttttg    242220
     atgtgattgt gtaattttgc atgggtctca ccctaaagtg aggtaaaggt ggatgtgaaa    242280
     attcatgcaa gaatctctaa aacgtgacta aagcttaact attatttctg ctattctcag    242340
     tttttaatgg ccgtgaggtc atggtgacca atggtcaaat ccggtgttgc atatcgaaac    242400
     gattatgcgg catggccctc gaggctttga cttagtcatg tgacgctcat tttgcttaaa    242460
     aagcctcagg tgccttgtaa aaaattaaga aagagtgaag atggttgatt cgcgttttta    242520
     tgaacccctt gggttcagac gctccccaat ccgcaggctg atcaccctgc taatggtggt    242580
     cgttgtttgc gtaggtctag tggtttcccc tcgtgttcct tctgctggtg cggcagagtg    242640
     taagggggag attagtaatg tgcagtggaa gaacgacaca aatatcaaag atggagtatt    242700
     tgttggtagc tatgggcagg gggcagacgt tcagttcgac tggaaagttg atccaggcgc    242760
     gaaagctggc gatcaattca ctttgaaact ccctaacgag ctttctcgat tggggaataa    242820
     agatctaacg cttactgctc ctagtggaga agaagtagcc aagggaacgt gggatgacgt    242880
     agcaaaaacg tggactttta cgctcactga ttatgcgaat agtcatggtg atatttcagg    242940
     tagtgctttt ttcacagttc agtgggatag atcagttgca caatcaaata cccagtatcc    243000
     attaactttt tcaggatgta aaggggccgg aacccttaat ggaaaaacgc ctgaagaagg    243060
     tgtagggggt actgctcaag caacatcaaa gacgggcctc tatgactcca aaactgattc    243120
     tgcacgatgg aacatctatg tcgaaacagc ggatactgat atctataccc ccgttgttgt    243180
     caaagatatt ggaaataccc agctgctgtt taggtgttct gatgtcaagg tttttgatcg    243240
     caccccttac cctcatacga agatccgcga tacacccatt gatccaaatc gatggaagtg    243300
     cgaggaaaaa gatggcggaa taattgtcag catggtgcct gatgagcacg gaaggtatct    243360
     gacagctgga caatcgctga ccatcgggtt tgagacacct atcaatgatg atacttctcg    243420
     ctttattacg aataaggcga ttgttgaaat cagtcctaat aaaatcgaga atgtggaata    243480
     ctcggtagac cgcggcgacg ctggtggggt gggccaaggt ttccaaggca agatcaagat    243540
     tcaaaaggaa gtagtcgggg aaactgcacc tgtacaggga aacaaatttg atttcgagta    243600
     taaatgtggt gaaacaacgc agaatatttc cgttgctgcc ggacaaacct cggatatctt    243660
     tacccaacgc tcttcttcta catgctctat taccgaaaag aacgttgctg aaggcgttac    243720
     agtcgacttt gaagtaatag atgaagaaac gggtaaacca gcctacgttg ttccgatcga    243780
     caatggcgta acggtaaagt tcaacaagaa cagttccacg acgctaaacg taaaggtcac    243840
     aaacacctac cccaataagc cagaagctaa gaagggcaag tttgttatca agaagacggt    243900
     taacggcctt gatgctggcc agaaagataa agccttcaag ttcaattaca cctgtaaagc    243960
     gccagatggt gatgcctaca cggagcctca gctagcagag gtaactgcag gaagaacctg    244020
     gcaatcggga aactatcctg agggaacaat ctgtacgata gaggaagacc ttgagagtgc    244080
     aaaggttcct ggttactcac tgatttctgc ccaacctaag ggagatgtca cgatcaaagc    244140
     cgagggcact gaaggctccc cagtagagtt cgctgcaacc aactcttata ccaaggatct    244200
     tggtagcttc tccgtccaga agaagatcga ggcatcggct gaggcaatgc cgctgctcaa    244260
     agatcaagaa tttggcttta agtacacctg tggagctgac aaaggcgagt ttaagctcaa    244320
     aaacggcgaa acaaagaagg ttgaaaggat tgctactggc acaaaatgca ccgtcgagga    244380
     gtcggatgcc aaggtgccaa acggctttat gtggactggg aagatcgagg gcacagatct    244440
     tgatcctaac gacttcacga ttgtgaagga taaaacccta gcctttactg ccaccaacac    244500
     ctataagcaa cagtatggtg gcttcacact gtccaagaac gttaccggtg acgcaaccaa    244560
     cctagaagaa ttgcagaagc gttcttacac gtttaactac acctgcaccg caccaactgg    244620
     cactgtccta aaagacaagg ttgagatcac tgaggaaacc ccgaaggcaa tcggcaacat    244680
     tccagcagcc tctacctgta aggtcacgga agtcgaggcc cctgctaaag acactgactg    244740
     gactgttgac ttaagcgtta atggaacgtg ggtaggagaa accgcggagt ttaaggttcc    244800
     tgctgaaggt gagccgtcga taagcattct tgcaaagaac aactaccgcc agcacaaggg    244860
     aagcttcacg attgaaaaga ttgtggatgc atcggaaggt atcgtcacgc cgaaggaatt    244920
     tacgttcacg tggcagtgcg gcgaggataa aggagctgag accgtccggg ttaccaatgg    244980
     caagggccgt gtagaaattg accgcgcatt cccagtgggc accaaatgtt cagtgaaaga    245040
     gctggaggcc gaggctgaag acgcaaggct cattacaagc tgggaaaacc aggaattcac    245100
     gatcgacaaa gataagcaac acgtgattgt ttctgcgacg aatacctaca ggtacgcaga    245160
     aagcaaggtc aagattgtga agaagcttga aggtccggca aaggataagg caaaagacaa    245220
     gacctttact ttcgattaca gctgcgttgt taataacgag gctattgaag gttctgtgaa    245280
     catcactggt gagggtgcaa ctgagattcc tgagtccttc cctgcaggta ccaagtgcac    245340
     cattactgag cgggatgcaa gtatctctgg aaccacgtgg acacatcgga ttgcagagga    245400
     tggtcagatc accattcaga gtccggctaa ggtgtatcaa gtcggtgtaa ccaatgctta    245460
     ctccaagcct ggtttccctt ggttcatccc gctgattccg cttgtgatca ttccgttcct    245520
     accgttgttc ccgcatccaa ctcctgcacc gcagccagct ccacagccga caccgcagaa    245580
     accgtcggaa cagcagcctt cccccaaggc tcctgaaaag aagccacaga aggagaagaa    245640
     ggttctggca cgcactggcg ctaacgtatg gatgtttatt gttatcgctg tactccttgt    245700
     gctgttggga gcattcctcc gcaggcgcgg taacaactca tagggttgtt tagcttgtaa    245760
     ataagcggcc atcctattca taaggaggcg aaggggaaac ctttcgcctc ctttggtatt    245820
     tgcaaatgtc tagacggcat gttgtatggg atgagggagt caaatgcaac gggtatcgtg    245880
     gtgctgactg gatcttctct tacgttatag aagagtttat agtgcgcgtt tttgtgtgta    245940
     ggctactgta ttcagtagag gtgtcgcaca atgaaatgca atacccttcg gagcgaaaga    246000
     aagggaaatt tgaccatgac cactgttgca gttgtcgggg ccaccggcca agtcggccgc    246060
     gtaatgcgtt cgatcttgga agagcgtgac ttcccactgg acaccatccg attcttcgcc    246120
     tctgcgcgtt ccgccggaac caccttgccc tacaagggtc aagaaataga ggttgaagac    246180
     ctagctctgc aaatcgaaga aagcctcgcg ggtatcgaca tcgcgttgtt ctccgcaggc    246240
     ggtagcacct ccaagcagta cgcacccctg ttcgccgcag ctggcgcaac cgtggtggac    246300
     aactcctctg cgtggcgcaa agacgacgag gtgccactga tcgtttctga ggtcaaccca    246360
     gacgcaaaga acgacgtggt caagggcatt atcgcgaacc cgaactgcac caccatggca    246420
     atcatgcctg tggtcaaggc gcttcacgac gccgctggcg tgaccaagct gcatgtctcc    246480
     tcctaccagg cggtatccgg ctccgggctc gccggtgtag aaaccctgat caagcaggtt    246540
     gctgagatcg gtgaccgcgc cgtagagctc gttcacgacg gctccctgct cgcaccggaa    246600
     gacatgggcc cttacgtggc acccatcgcg ttcaacgccc tgccattcgc tggcaacctt    246660
     gtggaagacg gcactgagga aaccgacgaa gaacagaagc tgcgcaacga gtcccgcaag    246720
     atcctcggcc tgccagacct gaaggttgcc ggtacttgtg ttcgtgtgcc tgtctttacc    246780
     ggtcacacca tggtggtgca cgctgagttc aacaacgcca tcaccccaga acaggcacgc    246840
     gaggtgcttg gaaacgctgc aggtgttgac gttgtggacg ttccaacgcc actggctgct    246900
     gcgggcgtag acaactccct tgtgggccgt atccgtcagg atcagaccgt agacgacaac    246960
     aagggcctcg tctttgttgt ctccggcgac aatctacgca agggcgctgc actcaacgcc    247020
     atccagattg ctgagctttt ggtctaatag cggttagccc gctgcctcgt tggtgtcggt    247080
     ttccgtggct gcggctgcga cgatatcagc gcgggcgcgg gccacgcggg aacgaatcgt    247140
     gccgatgcga acgtcggcaa ttttggcggc ctcctcgtag gagaagccca agacttgggt    247200
     gaggatcagg gcttctcggc gctccgcggg gagggcgtcg ataagcatgc gaacgtcgac    247260
     ccactccgcc cacagactcg acgtggtgcc gtcgcattgt tccacctcgg cggcggattt    247320
     gcgggggcgg gccatgtcgt ggcggatgtt atctacccac acgcgtcggg cgagggagag    247380
     cagccatgtg cgcgcggagg agcgggccgc aaagcggggg agtgcgctca tgacgcgtag    247440
     gtaggtctct tgggtgagat cgtcggcgat gtcggtgcct ccgaggtggg ccaacagcct    247500
     ccatacgtcg gtttgggtgg cgcgtatgaa ggcggtcaaa gcggcgcgat cgccacggcc    247560
     agccttgagg gctagggctg tgacgtaatc atcatcacgc tcggagggtt tcatgttcat    247620
     gaactctagc actccacctt tagttgtagg taatacctaa caaaaaaagt tcattgctag    247680
     ggtttgcttt ttaatgtaag ctattaatcg actcacattt gataggaaac ccttaaggag    247740
     ggacatcgtg accagcccag tcgatccaat cctgaacaag ggcgagcgca ccgaagcagc    247800
     tcctcacacc acccgcgccg gcgggcagcc cgtcgccagc gaaaacatct ccatcaccgc    247860
     aggcccacaa ggcgccaacg tactcaacga cctgcacctg atcgaaaaac tcgcacactt    247920
     taaccgcgag cgcgtcccag agcgcaatcc acacgccaaa ggtcacggcg cattcggcga    247980
     actccacatc accgaagacg tatcccagta caccaaggcc aagctcttcc aaaaaggcac    248040
     cgtcaccccc atggccgtgc gcttttctac cgtcgccggt gaaaaaggct ccccagacac    248100
     ctggcgcgac gtccacggct tcgcactgcg cttttacacc caagacggca actacgacat    248160
     cgtaggaaac aacaccccaa ccttcttcct acgcgacgcc atgaagttcc ccgacttcat    248220
     ccactcccag aagcgcctcg gctccagcgg cctgcgcgat gctgacatgc aatgggactt    248280
     ctggacccgc accccagaat ccgcacacca agtcacctac ctcatgggcg accgcggcac    248340
     accaaaaacc agccgccacc aggacggatt tggctctcac acctaccagt ggatcaacga    248400
     agacggccag ccagtgtggg tgaagtacca ctttaagacc cgccagggct gggaaacctt    248460
     caccgacgca gaggcccaag aaatggccgg caagaacgcc gactaccagc gcgaagacct    248520
     ctacaatgcc atcgagcgcg gcgacttccc catctgggac gtcaaagtcc agatcatgcc    248580
     attcgacgag gccgaaacct accgctggaa ccccttcgac ctgaccaaga cctggtccca    248640
     gaaggactac ccgcttatcg acgtcggcta cttcgtgctc aaccgcaacc cacagaactt    248700
     cttcgcccag atcgaacagc tggccctcga cccagccaac ctcgtcccag gcgttggact    248760
     ctccccagac cgcatgctca tggcccgtgc cttcgcctac gcagacgcac aacgctaccg    248820
     cattggcccg aactaccagc agctgcccat caaccagcca gtggtaccgg tgaacaccta    248880
     ccagcacgaa ggccccatgg cctaccactt caacccagct gacgcgccgg tgcacacacc    248940
     aaaccgcttt ggcaagggtg ccggctacct cgacgacggt caaacctcgt cctccggtgc    249000
     gacctacggt caggcgcagg atctctacgt caacccagat ccacacggca ccgacctgac    249060
     tcgcgcagcc tatgtcaagc acgcagacga tgacgacttc atgcaagccg gaatcctcta    249120
     ccgcgaggtc tatgacgacg cagccaagga acgcttcgtg gacaacgtga ccaatgccat    249180
     ggcaggggta tccccagaaa ccgaggagcg cgtctactgg tactggaccc aagtagacga    249240
     aaacctcggt gcgaaaatcc gtgaggcatt cgccgctaag aagtagcagg cagcacccac    249300
     attttctcgg ggtcgcagtg gatgaggact tcgtcgccaa gcgcggcgaa ggcaagctcg    249360
     tcgtcaggcg aacaatgcaa cacaatgcga ccccgagtcg tctcgatagc cacttcgtga    249420
     tgatccccca tataaatgtt gcggatcacc tgccccgtag cccccatcaa atggcgggcc    249480
     tgctggccag tcggggtggc cgtggcgctc gtgggataac ccaccatcac catcgcgtcg    249540
     ccagaacgaa gatcggggtg tgcctcgacc tccatactcg tgcccaaagc tgtgatcgct    249600
     gccgttgcgg tgccgaaaga ggagtgagac acagtgcccg tcgtaggcac aaaaatcgaa    249660
     gccccaaggt gacgcgcaat atccaaacac gcaggctgct cccgcatatc ctgaggtgaa    249720
     gcatcctgaa caatccgccc atgggaaaga aaaataatcc gatcggcaat agaaaacgcc    249780
     tcgttaatgt catgagtgac ataaaacgtg gtgcacccca gccggcggtg cgtccgtaaa    249840
     atctggctct ttagctgctc agaagaatac gtatccacat gcgctagcgg ctcatcgaaa    249900
     aacatcaact ttggctgctt aatcagcgcg cgagcaagag caaccttctg ctgctggcca    249960
     gtcgacaact ggtgcggata gcgcaacgcc aaatggtcaa tgccaaggct caacatggcc    250020
     acatgcgcac cagcatcgcc cgcaaaccgg atattatcct ccaccgtcat atgcggaaac    250080
     aacgacggct gatccatcat catcgcaatc ggacgctgat gcggcggacg gcccgccaac    250140
     gactcaccat cgacctccac aacaccttgc gcagggatca aaccagccaa cgcccgcaac    250200
     aacgtcgact taccggcccc agaacgccca agaaccacaa tgagctcacc aggatccgcc    250260
     tccaaagaaa catcatccaa aaggcgcgcc ccgcggctgg tcacactaag accctgaata    250320
     tgtattaacg ccatgatgcc acctgtttcc tagcgaaggc agccaaaccc acgccattaa    250380
     tactcacaac gatcgcccca gcaagggaca cgataaaaag agacacagtc atgctgatgt    250440
     acagcgccgc cgggtaattg gcggcgtcga gaagcgtgaa aagccgcaac atcaaaaggg    250500
     gagtatccgg cgaactcacc cacaacaacg gcaccgctag taccgacgca ttagaaaaca    250560
     ccatcaaaaa gcccaaaatc accacattcg tcgaacgcgg caacacaatc gacgccaccg    250620
     cccgcagtgg gccaacaccc tgcaacaacg acaccatata ctccgaacgc gacatcaacg    250680
     gaccgatata aaccatcaaa aaatacgtca tagccagcga actcggcaga cacgccaaca    250740
     acaccaaact taacgacgcc cacggcccgt acactcccgg atgattcaac gcaatctgca    250800
     aaccacaacc aatcgcagcc cccggcgaca acgccaacaa cgcaaacaca gcatcaatac    250860
     cacgccggcc caaccaaccc caccgcaggc cacacgaacg ccgcgccccc aacgcaaccg    250920
     ccgacaacaa caacgaacac aacaacacca aaaacgccaa ccccaccgta ttgaccaccg    250980
     cattgcccat cggcgtctca gaaccatgca caaaaccacg aaaggccgcc accagcacaa    251040
     ataatcccgc aactgcaccc aagaagcaca acaccgcctg cggggcacgc acttgcgcac    251100
     ccaccgcacg atgtggctgg ccggaagaat tgccagcaaa atgaagcaac tccaccaacg    251160
     ccggattact acgcaacagc cgtgcataca ccagccccgc aacgaccacc gcaccagcca    251220
     ccggcaacgt aagcgccagc gcagtccccg cctgatcgcc ttggaaccac acccgtgttg    251280
     ccgctaacga cgcccgcggc gccatcacat tcggcgttac cggatccgac aacgccgcac    251340
     taaaaataaa cactgcaagc gcaggggcaa acaacaccaa ccgcggctga tacaccgcgc    251400
     gaaacaacgc ccacccatga aggcccgcca cccgagccgc atccacctca cgcgacgaca    251460
     ccgagcgcaa cgccgtgcgc tgcacaaaat atgccaacgg ggtaaacgcc accgtgaacg    251520
     tgaacaacaa cggcccaagg cccgaaaaat tacactgcga gcacaggtga atacccgtgc    251580
     gtcccatgat cgtcttccaa ccagcaccga taacaaaatg cgggatggtg agctggaaca    251640
     gcaggatgac gtcgagaagc aatactactg tacgagaaaa ctgcgctgcc gccaacgcac    251700
     ccaccgtgcc aatacccacc gccaacaaag ttgcacacaa tgcaattgtg ctgctgagga    251760
     tgatcggtgc gaccgccgca gtgcccgtcc ctgccgcttt caacaacatg gcataaggaa    251820
     tgcccaccgc caccgcggcg atcgccacca ccgaaaaaat ccacaaccca gttctcatgc    251880
     ccgctgctcc gaaaaccaac tcatccaccg atcacgctca gaatcggcaa ccgccggatc    251940
     caccgcaaca atgccatgcg aatccttcaa acgcgtagaa atattgccca caaccaaatc    252000
     gcttgtgggg atctgcggta atcccacccg ccgcgccgac gtctgccccg acggcgacaa    252060
     caaccaattc atcacctcat acgccgccga cttattatgc ccctgcgcca ccacaccacc    252120
     agaagcaatc tcaaacgacg taccctccgc aggataagaa atctccacat cacgaccata    252180
     acgcgtcgtc ttattctgac aatacggctc ataagaaatc gccaccgcag cctcaccatg    252240
     cgccaccaca tcactcggcg cattacccga acgcgtaaac cgatccacat ttcccacaat    252300
     cgccgcaatc tcatcctgcg acaaccccgc ggcctgcata ctcaacaaca ttgcataccc    252360
     cgtaccagac gacaccggcg acggagccga cacccaaccc cgcaactcag gacgcatcaa    252420
     atccgaccac gtacgcggaa ccggcacccc caactccgcc aacgcatcac gatcactaca    252480
     cacactcaac accgacgcat acaccccaaa ccactgattc tgcggatcct taaacgaccc    252540
     cggaatcgca tccgccgccg gcaaatccac cgcctgcaac aaccccaatc gtgcagccaa    252600
     ccgataattc tccgaaggcc ccccaaccca cacatcaaac tcatgcgagc ccgtacgcag    252660
     ccgcctcaac gcctcctgcg taggcaaact cacataacga acattcaacc ccaactcacg    252720
     agcaatatca cgcttccact gctcacacac cgtcacatca ttcgaacaca tgatagtcac    252780
     agcagtcttc gccggaaaca acgtccgata caccgtagcc accgacacca tcgccacaac    252840
     acagacagca agtaaccgta accattttga taacactatg gttctccttc gcgtccacgc    252900
     tcaacgataa caaaagcgct ggggaattcc tccccagcgc ttctcctagt caggaactaa    252960
     acaccctgct cgagcttcaa agcacgctcc tgcatcaact tcttctcctc gcgccagatc    253020
     acctggaaaa taaccagaat caaaaccgta aagaccaaga acacaatgaa cgtgacattc    253080
     caaccagcga acttaaccaa gaagcccaca ccagtcgaag ccaaggttgc acccagcagg    253140
     taaccgaaca agcccgtgaa gccagcagcg gtaccagcca cgttacgagg tgaaagatcc    253200
     aatgcctgca aaccgatcaa gccaacagga ccgtagataa aaccaccaat aaaggcaacg    253260
     aaaataacca tcaaccagaa cggcgtaccc acaggagcca accagtatgc agcgatagac    253320
     aaaccagcgc ccaaggtgaa caacgaaata gcagcagaac gattgccctt aaacacattg    253380
     tccgacaacc aaccgcacaa aaccgtgcca ataaagccag ccaactcgaa agcagcaaaa    253440
     ccaatcagac cgctaccaat gctcatgtgg tgctgctcag acaagtacgt ggtaatccag    253500
     tgcaaaacac cataacgcaa ggcataaaca aacacattcg caatggccaa cagcataatg    253560
     atgcggctgt gcaaaatatg cttgaacacc aaatccttcg tcgaaatctt ctcgcccgta    253620
     tcctccgcaa ccttcgcagg atcgttgcgg tagtcgtcga taggcggcaa accaacagac    253680
     tgaggattat cacgaataag caagaacgca accaacgcga caaccaaagc aaccaacgca    253740
     ggaagccagt aagcagcacg ccaattctcg cccgtcatgc tcaaaccaat accgaccaac    253800
     actggcaaac caaaagcacc caagttgtga gaagtgttcc acaacgaacc cttccaaccg    253860
     cgctcactag tagagaacca ctgcaccaca atacggccac aaggagggta acccatgcct    253920
     tggaaccaac cattaaggaa catcaccgta gcgaacacgc ccacgctggc cgaaacccac    253980
     ggcacaaacg caactaccaa gttcatcagc gccgacagtg ccaagcccag cggcaagaaa    254040
     tagcgagcat tagaacgatc cgacaccatg gcactaaaga acttagacag gccatagctg    254100
     accaacacag cattaccaat aatgccgatc gccggcttat caatcgcacc actttcatca    254160
     ataagcaacg gggcaatcgc cgaaatatta ttacggatca aataaaaacc cgcatagccc    254220
     aagaaaatac ccatgaacac ctgcagacgc atccgtgggt aggtgcgatc cacctgctcc    254280
     gccgacagcg gggcagcagg gccgggggct tgcaaccaag caaacatacg aggcactcct    254340
     ttgtgcacaa tcacttttat caactaattg cgattgtgct ccgcgctcgg taaccatagt    254400
     gaccatagcg gtaacaattg gtaacagtgc tgttaccaac cacaaccgag gggaatcact    254460
     cgtactgaaa gacgtacccc tgaccccgga ccgcaaggat agaatcagca ggtaaacccg    254520
     cattttctaa cttcttgcgc aagcgatacg ccgtcgactt caccatattt cggccaccct    254580
     gagtcgccgt cgtatcccac acctcattca acaaacgctt cacactcacc acctcattcg    254640
     ggtgtgaaac caacgcctgc aacagcttcc cctccgtagc agtcgtatcc accctacgac    254700
     caccaatcac caccgcatgc gtcgccggat tcaccgacac ctcacccaca ataatctccc    254760
     gcaactccgg ctgcacaacc ccaccactac gacgcaccac cgcctgcgcc cgcaacacca    254820
     actccttcgg cgaaaacggc ttagccacat aatcatccgc gcccgcctca agcccctcca    254880
     cccgattatc cgtatcacca agcgcagtca acataatcac cggagtccca gcaacatccc    254940
     ccgcagcacg aatccgctca cacaacgcat accccgaagc gtcaggaagc atcacatcca    255000
     aaatcaccaa atcacaccga tactcgttga gtaactgcca cccccgctgc gctgaggaag    255060
     ccgacaacac ctcccagccc tccaactcca aagcataaga aataatctga accatctgcg    255120
     gctcatcatc aacaacaaga acacgaagcc tatgcatagt aagtcctagg aagagtaatc    255180
     aacaccgacg ttccatgatc cgcaatagaa tccaccaaca ccgaaccacg atgcaactgc    255240
     acaatcttct gcgtaatcgc catccccaac cccgcaccag acggaaccgc agctgtgctc    255300
     tgggtctgtg tatggccctg tgcatgggcc tggccgaact gggcaaaggg cacaaacata    255360
     tcccgacgct gacgcgacgt catccccggc ccataatccg ccaccgtcac aatcacccca    255420
     gtagcgctct cctcaacccc caccacaata tcgctatccg agcccgcata acgtgccgca    255480
     ttattcaaca cattccacaa cgcatgccgc aacaactgcg catccccatc aatcaccaac    255540
     ggatcgccag gatcatccac cacaatcgga acctcgctca tcgcccgcag ctcctgcgcc    255600
     gtactacgca ccaacccccg cacatcgcac ggcgacacct gcaacttcac cgaaccacta    255660
     ttgagctttg cctgcaacaa aaacgactcc gccacctcaa tcgcacgcgt cgaattcgcc    255720
     ccaatagtag ccacgagccg ctcacacttg tgcggatcgg actcctggcc cagcaactcc    255780
     gcagccccct taatcaacga caacggcgtg cgaatctcat gagccaaaat ctgctcatcc    255840
     gttatcgtcg acccctgatc gcagccgcgc cggcgcacca ccgcagccgt aaccaacgac    255900
     gcagcacacg cagacccaca cgcagtgaga accagagcag caaacatact agataacact    255960
     accgtggctc acccgaaatg ttttggttaa aggaaatgag caatttttgt accctaaggc    256020
     cgatttttga aaggccatcc tgcggttttg caggcttagg gtacaaaaat tgctcacgac    256080
     ggggccactg ccggcccgct acctatgact cctgggaaac ctcatgcaaa gcacggccca    256140
     tcacaaagct ggcaaccgcc aacaccaccc acagcgccac gatcgccacg atcgcacgca    256200
     ccaagtggtt gatctcaaag ctgccagcac caatatcgtg caacaaggta gcaataacga    256260
     tcaaaggaag agccacgctc gtggctgggc caagaagatt agccctcgtc aatgcatcgg    256320
     gggcgtgcca caaggcggtg gcactgacca cgaacagcag tcccgcgatg ataatcagga    256380
     cagaagcaat ggagtcgtac aacattagcg gcgtcctttc gaaataatgc gcgcaacgga    256440
     catcgtcggc aatgcgccgc ccacaagacc agcaagcaac acaacctcgt acgcaatgga    256500
     ggtagggtta cgtagcgacc aaatcaagta gaacgcgatc atgccataaa agcacatatc    256560
     ggaaataaca gcgcgagtga gctcgtcttt ggtcttgagc atcaacacaa tggcagataa    256620
     cagcgacgca gcagtaagcg ccaagccgat ataaatcgaa atctcaagca ttactgctcc    256680
     ttccggatag caagatgtgc agggtgctca atacgaacat tggccacctt atgaggaata    256740
     tccttgaccg aaggtgccaa atgctcctcc atcgtggcaa tatccgccaa cacatccgca    256800
     ggattatggc catacacggc gtgcactaac aaggtgccgt cttcacgcag accaatcgac    256860
     atagtgccag gggtaatcgt gatcgacgca gcaagcgccg tgatctgcca ctccttggtc    256920
     acccgcagcg ggtaatacac cacgcacggt tccatgctct tatacccatg gaacatgtct    256980
     ttaatcagca caccagtggc aacaaagatc tgcccgatca gccacacaac atacaacgga    257040
     gcatgcataa ttatttgcct ccctgaagat cagtggcaag gccaatgggg ttatccccca    257100
     agaccgcctg ggtataggcc ggcacatcca acaagtcgcc agcagccgca cgagtagcgc    257160
     ccaccaaagg acccgcgaac acgaacatcg ctaacgacgt gaccgccaac accgccgcag    257220
     gggccaagcg atgccacggc acccgcatag cctcagggac gcgctcacgg ttcatcaccg    257280
     caccccagaa cacctcacgc cacaaccgca gcatggacaa gaacgcacca aagcttgcaa    257340
     tcacaatcac ggcgattacc aaccaggcct gccacgtagc ctgatgagcc acaccgacca    257400
     cgatgaacac cttgccccac aggccagaaa atggtgggaa accaaccacg gagaacgcgc    257460
     cgaccacgaa cacagcagca acccacgggt cgcgccgggc aatgccggtg agcttggaga    257520
     gcaggtcagt gccataggtt tcttcaatag cgccggcact caaaatcaac gaaccaacag    257580
     tgatcatgtg gtgcagggcg tagaagatgc ccgcagccaa agcagcctgt tcgttgccgg    257640
     aggtaaacgc cagcatgacc aagatgaatg gcatgccgtt gaccatctgg taagccagaa    257700
     cgcgacgcat cgagttttca gccaaaccgg caaaagcgcc gaccaacatg gacagaatac    257760
     agatcacggt gatcaaccag atccagcgct gctcgaggtc gaaaatcacc acgtagatgc    257820
     ggaacagcat gtacacggcc accttggtgt gcaggccaga gaacaagccc atcacgcttg    257880
     ccgacgtcgc cgggtaggaa cgtggcaacc atgtgtgaac agggaacacg ccagctttga    257940
     caatcagcgc gatgaccaca atgcccatca ccacagacac cggaccattg ccgcgagctg    258000
     cccccgcgag cgccgcaatg ttgacagcac ccacagtgcc gtacagcacc gacaccgcca    258060
     tgaccagaat tgtcgacgta gccaagttga ccagtacgaa cgtccgccca gccgacagac    258120
     gcgcccacgt acccgtcata gccatcaagc cataagaagg caacagcatg acctcaatga    258180
     acacgaagaa gttaaacaga tcagcggtga gcaatgcgcc catcacaccg gtcaacaaca    258240
     tcagcgacag cggagcatag aagcgagcac gagtctcacc cacagccacc gcaaaccagt    258300
     tggaggcaaa cgccacgatc gaagtagtca cgatcatgat ggcactgaac tgatccgcca    258360
     caaaggggat agccacgcca ccgacgtaca aaccaatcga gtgcgcaatc gtgccatgcg    258420
     ttgcggtata agcaaacagc cacgcaccag ctagacccgt tagcaccggc accacaacgg    258480
     cgaagccgtc acgtacaaca cgccacggtg ccatgacagt gagcgccacc gtgagcagtg    258540
     ggaggcccac aaacagtgga agtacaaaat ccattagtga gtctcctcct ggcgggttgc    258600
     agcacgctta gcggcatgct ccagatcctc cacggcttcc gcattcgtcg tcgagcggcc    258660
     gagggtctgc aatggcgagg tttcgtcggc gacttcctcc gcgagggtgt cgtcggaacg    258720
     ccccaagccc gaaagcgtga gcatatacgt ggtcgttgcc atagcgatca cgatggccgt    258780
     caacacgaat gcctgcggca cggggtccga agattcgctg atgtcggtaa gggaggggaa    258840
     tgcctcgcca cgccacctag gaacaccagc gttcaaaatg atcaagttca cggcatggct    258900
     aatcagcgtc atgccaatca caatgcgcaa cataccgcgc tgcaacacca tataagtgcc    258960
     ggcagcggca agaactgcga tggaaagaga aagaatcatg gcttaggcct ccttcggctg    259020
     cgaggcttgt gctgaggatt tagtttcagg ccagtcgaga tcgtcgtcag cctgagcctc    259080
     caccttcgca ggggagacca gcggggactc gtcgcgagta aagttcaagc gatcataatc    259140
     cataccaggg cgcaaatagc tacccagcgc attaatcgcc atcgacaaca tacccagcac    259200
     cgctaggtac acgcccaagt cgaagatcat cgccgtggtc cagtgctcgc cagcccaatg    259260
     gccatgcaaa gcgtaaagga acgagccatg ggtaagaccc aagaaaccag acaccagcgc    259320
     caaaataata ccaatcgacg tcagataaat aggcgtctta aaagtgaaaa tgtgctggtc    259380
     acgggcatga gataggtagc tgagcatcaa cgcgccaccg gccaccagtg ccgcaataaa    259440
     gccgccgccg ggagaattgt gaccacgcat gaaaatagca aaactcaaaa tacccaaaat    259500
     cgggatgagc acgcgcagca gctgacgcaa cggaatcgaa ttcacatgcg acaaaccaaa    259560
     cggagccggg tgggtgccat gcgcaaatgg gtaacgcggc atcgacgtca ccaccgcagc    259620
     aatcaccaca gcggccatac ccagcaccga cagctcgccc atggtatcga aagcacggaa    259680
     ctccaccaga atggtgttca caacgttatc gccgccagtg atctccgggc cattgttgag    259740
     ataccagatc gccagctcag ggcgctcacg gcgacccaaa acgaaccagc acatcaagaa    259800
     cgtcaccacg ccgacagcca cagccatcac cgcagcaaaa gccttacgac gccccttgct    259860
     cgggtggaaa ttatccggct gctgacgaat caccatcatc atgatgacca ccgtcaacgc    259920
     ctccaccata aactgcgtca aagccacatc aggcgaaccc aacatcaaca tctgaacagt    259980
     cacaccaacg ccgaccacac caatcatgat caccgcagtc aaacgacgct tcgtacgcag    260040
     caacaacgcc gcagccaaaa caataatcgc caacggcaac gcatcagccc aacgatcggc    260100
     tccgtcgata cgcggtgcca acggcacccc atcaataccg cccgaagcaa cacccttgac    260160
     cgtcaccgtg ccacccagca ccaccagcaa cataaacacg tacgccaagt gacgcgtcgg    260220
     gctcaacgaa tccgccatcg aacccacaca acgaccaaac gcagcaatgc cacgaaccga    260280
     caagttcaac aactcattac cactacgcgg tgcaagctta cgatccgcca acgaatccca    260340
     aatccactga cgcttgacca aaccaagcac accaaaaacc aacaccaaca tcgagataac    260400
     aaacggaata gtcaccccat gccaaaccgc caaatgagta tgcggatcat ccgcaacctc    260460
     actcaccgca gcagaaaccg gagcatccaa ccggctcaca aacaacgcag ccggaataga    260520
     caacacacca ggaagcgcag ccggcagcca caacgacacc ggagcctcct tgcaatccga    260580
     catctcacgg gaaccgtcga taaagccatc gaccaccaaa cgcaccgaat acgtaaacgt    260640
     aaacaacgcg cccacacccg cagcgaccat caagaccaca acaccagcgt taccaatcgg    260700
     agcatgcaag aacgcctcca gcatgccctc cttcgaaaca aaaccaaaca acggaggaac    260760
     cgcagccata gaagccgcag caatcgccat cgcaccaaac gtaaacggca actggcgcca    260820
     cgacgaaccc aaacgagtca aatcacgcgt accagcctga tgatccacca cgccaaccag    260880
     catgaacaac gacgacttaa acaacgcatg cgccaacgta tgcaccacag cagccgccaa    260940
     cgcgaacgga gtacccacac caatagtggc cacaatccaa cccaaatgcg acaccgtcga    261000
     atacgccgtg agcttcttca tatccgtctt ctggatagca aagaacgacg ccatcacagc    261060
     agtgaacata cccaccacaa tgagcaacca gttccacacc gcaacatcgc taaacaccgc    261120
     actgaaacgc aacagcacat aaatgccagc cttcaccaca gcagccgcgt gcaagaacgc    261180
     cgacaccggg gtagcagcag ccattgcctc cggaagccag aaatggaacg ggaactgcgc    261240
     cgacttagta aacgcagaca ccgccaccaa cacagcaacc acaccagtca acgcaggctt    261300
     ttccgcccag aaaccagcat ggataatcgc atcaatattg gtgctgccag cctgattcga    261360
     cgcaatcgcc atagcaacca gcaacgtcag gccaccaatg aacgtcaaga tcaacgtgcg    261420
     ctgcgaaccc agctcaccgc ccttgccgcc cgaacgcgcg atcaacataa acgacgcaag    261480
     agacaccagc tcccacgcga taaacaacag cacagcatca ttagcaaaaa cgagcaacag    261540
     aatcgacgcc ataaacgccg tcataatcgt gtaaaagctc gtattgcccg cattgttgtg    261600
     cagataagaa gcggaatagg caaaaacgac agagccgatg cccagagcca acagtgcaaa    261660
     gaacgagctg agggcgtcgg cacgcaatgc gaacgacaca tcaacgccat cgcccacaaa    261720
     atccggaacc cacgtatatt ccaacgtcaa aggagttcca gcaatgatgc caggcagctc    261780
     tttacacaac agaacggcgg cgaccacaaa caaggccgcc agaggccacc ccgcctttcg    261840
     gtcgcaaatc cgaactgtaa caggcgcaag cgcaaccgca caggccgcca gcgcgagaac    261900
     aattatcagg gtcacagatt actcacaccc aaggattcgg ggaaacatac agttctgact    261960
     aaagatagtc aacgtttcca acgttaccag tgttgagcgt gaacttaatg gtcgaaaaac    262020
     tttaaccggc ttttcggtga gtcaaaaacc acagacctat acctattaat taagttggac    262080
     aactatgagc cgaaaaattg tccgacgagc cctcgcagga gccctgtttt tcgtgccgct    262140
     cattgccggc accgtctacg ccacaacaca agacgtagac cccgcggcca cctggtccgc    262200
     agcacaagaa acccaacaag gagcccccgc agtccaagag gacccctcac tcgtcgacat    262260
     ccggcgcgca gccggcgaag caggctccca agccagcctc ctaaaaaacg gcaccaccca    262320
     gcttgtcgac ggcaccaccg ccctcaacaa cggcgcagcc caactcggcg acggtaccaa    262380
     agccgcccaa aacggcgcag cccaactcgc cgacggcatg gtcaaactcc aagcagccac    262440
     cggacaaatg ggcaacggcg ccaccgaaat cgccaacggc atcgaccaag cagtcggaca    262500
     attccaaaac gtcgaagtca tccgcggaca actactcacc gccatcaacc tcgccatgag    262560
     cgaccccaaa ctcgccgacg tcaaacccga cctcgaagac ttcaaacgcc aagtagaaac    262620
     cttcaaagtc gacgacaaca tcaccagcca aatggacaag cttcgcgacg gctcccgcga    262680
     actcgccaac caactagcag taccaggcta cagcttccac gacggaatct actccgccac    262740
     caaaggctca aaagacctct cagcaggact caacgacctc tccggcggcg tagaccaagc    262800
     actgaccggt gtccgcgacc tcgacaacgg cgccaaaaaa atcgacgcca tggccaaaga    262860
     aaaccaaacc cgcgtaggca acatccaacg cgcactcccc atcaccaaag ccggcacccc    262920
     cgaagcacaa gaacaaggcg tcacccgcac acttgcacca ctgtacgcat tcctgatcgc    262980
     agcaggactc atgctcgcag ccaccgccta ccttcgcgac cgcatctggg gaaccatcgc    263040
     ctttatcacc ctcacacttc tcggcggagg actggtctac ctactaggaa ccgaaatcac    263100
     cgcaggggta gcagccgcag ccgccggtgt cagtgccctc gccgttgctg gagcagcact    263160
     gctcggcacc cttttgacca gcatcttcgg ggagcgcacc ggccgtggcc tcagcgccct    263220
     tgtgaccatt gcccaagtcg cagtcgttgg tttcgtatgg aactccgccg ccaactccgc    263280
     cttgagcagc gccgcaaaag cactggtcaa cttcatgccg ctgcactatc ccaccttggc    263340
     gctcagctcc atcggtaacg ctggcgatac cacgaccaca gcactcggcg tgggcgtgac    263400
     cgcagcctgc gcagtgtgtg cggcggccgg cgtgatgatt ctgcgcaaaa aagaggagca    263460
     aacgctgcca acggcggagt aactttgtaa cttagtaact tttcgcgacc acgaactcaa    263520
     gagttcgaaa acccaaggaa gagctgacgt gggtgagatc agcgtccttg ggtttttgtg    263580
     ttcgtgaatt cgaggaggcg gagaagcgag gggatgaaag tccccgagtt cagtgactcc    263640
     cagtcaaaat gcgccaccac atagccggca ttttgaagtt cgcggtcgcg ttttcgctcc    263700
     ttgagcactg ccctcgattc gtcgtcatgg aacttgatgt ctccatcgat ttctatgaca    263760
     acccttccga cgagaaagtc ggcacgacga ttattgatct gcacctgctg ctcgaacgtg    263820
     atttttgctt cgatgagctg cgcctttgcc cacgactcgg cgacactttc cgacttggaa    263880
     tcagccactt gcaatacccg acggaattta cgcacccctg gaattcgtcc aaactcttcc    263940
     aattcctgtt ccaacaaaaa cggctgagca tcctcttgac gcaaatagga ttccacagcg    264000
     acaagcccct ctgcgaacgt tccccatcgg cagagatctc caatagaacg ttccatcgtg    264060
     gtgaagcgaa tccccttatg ctccgtgatt ttgtttgacg ggattcgcgc agagcggtaa    264120
     tgaatccacc tctttgtgtt gcgtggagca gtttttgtac ctggtagcac cacgaccact    264180
     ggttcttcat atcctagaat tcctagtctc cacaggcgga ctgcagaccg gccgcaaatc    264240
     acgccagtac gtgctcgctt gccgacggcc agaattcgtg cccaatcgcg agtccacgga    264300
     ttgagtgctt cccattcttc cgaatctgcc caaagttcag catgaatatt gaagtgttta    264360
     tgttgttgat tcgtgatcca ttgtgcgtac tcggtatgag acatacgcag cgtatcgatt    264420
     actcgaattt tgtcccccca gacgttcata cctacacgct aatggcagac tggtgttttt    264480
     gccaccacaa attcgtgacc tcgaactcaa gagttcgaaa acccaaggcg ggtgtcgacg    264540
     ggggtgaact agccgtcttg cggtttttgt gttcttgaac tcgaggaggc ggtttgcagg    264600
     gcggggtggg gcggtgcgag ctacagaaag acaaattaac cggtgctctc agctgagaac    264660
     accggttaat ttgagttggt cgggataaca ggatttgaac ctgcgacctc ctcgtcccga    264720
     acgaggcgcg ctaccaagct gcgccatatc ccgaggacac ttggcgtgtc tttgaccaac    264780
     tgtagtcctt tggcacagca agttcaaaag ccctagtgaa caggggttat agagttcttt    264840
     ctgtcacacg gatcagggtg gctgatggct tgcagaaaat ccgcactggc gcaaacttgg    264900
     aggttcccag cccattggaa acgtgcatcc acatggaacc aaaacggtgg agtccttgga    264960
     cacgcgggcg gtcgatacca cagttggtca cgagggctcg tgaacccggt aggcagatct    265020
     ggccgccgtg ggtgtgccca gatagcgaga gcatgtatcc gtcttgctca aacttcttta    265080
     acacgcgtgg ttcaggggag tgggtgagcg cgatgctgag atctgcgtcg gggttgggtg    265140
     caccggcgat gtcgtcgtag ttgtcgaggt cgtggtgggg gtcgtcgaca cccgtgatgg    265200
     ctaggcgtag gaagtccact ttgaattcgt ggcgctgttg gttagcgtcg cgccagccgt    265260
     gttcgatgaa cgctgcgcgc atgcctttcc atgggagttc tacgcgactg ggggtgcgtt    265320
     ttttgccgag gaggtaaacg aatgggttga ccatacgggg tgcaaagtag tcgttggtgc    265380
     caaagacgaa cactcctggc cgcttgagca gtggtgagag tgcttgcatg acggcgggga    265440
     cggctttggc gtcgctaaga ttgtcgccgg tgttgaccac taggtcgggg ttgagtttgt    265500
     cgagttgtgc gacccagcgt tgcttggttg tttgggtggg caccatgtgc aggtcagaga    265560
     tgtgcaggat gctgaagtgg gggttgccgc gaaggattcc tggttccaag atgggcaggt    265620
     cgatggtttt gagctcaaag ttggagcatt cgcggtagcc ccacgcaagc gttgctgctc    265680
     cggtggcggc ggtagctgcg gtgagtccta gcagtgtttt taaaagtcgc acccatatca    265740
     ctctaccttc cgagtaggct gggcaaccat gagtgaattg aaaaacaaaa ttagggcgga    265800
     tctgaccacg gctatgaagg ctcgtgagaa ggagcgcacg ggtacgttgc gtatgttgtt    265860
     ggctgcgatt cagacggagg agacgtctgg ttctaagcat gagctgactg atgaggatgt    265920
     gctcaaggtt attgctcgcg agattaagaa gcgtcgtgag tctgcggagg tgtatgcgga    265980
     ggctgggcgt tcggagttgg cggacgctga gacgaacgag gcgaacattt tggctgagta    266040
     ccagccacag cagcttgacg acgacgagtt ggcggcgctg gttgccgagg ccgttgctca    266100
     ggtaaaggca gagctcggtg agggtgtttc catgaagcag atgggccagg ttatgaagct    266160
     ggccactgcg caggctgcag gtcgtgccga tggcaagcgc ctatccacgg ctgttcgtgc    266220
     ggcgcttgcc taatctgcta gaaaccgggc aggagctgtt ggagctggtg agctagatcg    266280
     tcaaggtcgt tctggctcac cccggttcct gggacgacct cctcggtggg gttggggcgt    266340
     cgagttgttg aggggggcgt ggtgcgtggg cgggtgccgt cggaaatgaa aagttcgatc    266400
     gtgccgcctg gtttgagggg gacgggggcg atcacgttga ccacggagcc tttggggatg    266460
     ccgtctcctg gggcggaggt catggtgact ttatagcctt tggcgctgag ttctttgcgc    266520
     actgattcgc cctcgcggcc gacataggag gtgccgaagg atcccgagac acctcgattg    266580
     aacttggggt cgtagcttgg caggtttcca ctggcagcga ggccggagct ttgtgctgcg    266640
     gtgaaccatg tgcgtgcggg ttcgtcacca ccgaagaggg tgccctcgcc gcactgtacg    266700
     acaggggagg tgcacagtgg ggtgacagtg gtgccgtcgt tgtagatgta ggacgctgca    266760
     gcgaagttgg agttaaatcc gaggaaggca gcagaggagt gcgattcggt ggtgccggtt    266820
     ttcgctgctg ttggggcgct aaatcctagg gatttggcag cttgtgcgcc ggttcctttg    266880
     atggtgtctt ggcttagccc tgcgctgagt gcttgggcga tttctgggtc gatggcttgt    266940
     tcgcaggctg ggcggtcgag gaatacctcg ttgcctttgg cgtcggtaac ggtggtgatg    267000
     gggcttggtt cgcaccacat gccgtcggag gcgagagagg ctgcaacgtt ggacagttcg    267060
     agggggttta cggcggtggg gccgagggtg taagagccga ggttgtgctc tttgacgtag    267120
     tcggcgatcg agttgtcttt gttgaaggtg ccggggttgg cgtagctgcg tagtccgagt    267180
     ttgacggagg tgtctactac gtctttaacg ccgactttct caatcatttg cacgaatggt    267240
     gtgttcgggg agaacgcgag ggcgtcgcgt agcgacattt gtggtgcgta gctgccggag    267300
     ttttctacac agtaggtgcc ggcgccgcag ccctcggcac cgccgtcgcc catgcctttg    267360
     gcctcgtagc gtggtggaac ttggagttgg gtgtccagac cgtagccctg ctggagggcg    267420
     accgcggcgg taaagatctt gaacactgag ccagcaccgt tgcctaccag ggaggtgggt    267480
     tgcggaagga cggtttggcc ggcgtcgagg tcgaggccgt agtcgcgtga cgacgtcatc    267540
     gcgaggatct tacgactgtc ttttccaggc tcgacaatgt tcatcacatt ggcaacaccg    267600
     aaggtgtgcg aattgacctg acctgctgcg gcggcgtgcg cggcctgctg tacgtcgggg    267660
     tccaatgtgg tgttgatggt gtaggaccct tgggtgagct ggtcggtgct caagcctttt    267720
     tcgctgaggt atttcagcac gtagtcgcag aagaatccgt tgtcaccagc agtgatgcat    267780
     ccattgggta gtccctgtgg ttgctcgagc acgccgaggg gttcggcttt ggccgctgcg    267840
     acgtcctcgg gggtggcgta gccgttggcc gccatagtat cgagcactac gttgcgtcga    267900
     tccatcaccg cgtcggggtt ggtgtaggga tccaagtagg acgaggactg cacaatgcct    267960
     gcgaacatgg ccgactgcgc aaggctgagc tctggtgcac ctttgccaaa ataggtgcgg    268020
     gctgcggcct cgacgccgaa ggcaccgttg cctaggtgga cgaggttgag gtagcgggtg    268080
     agtatgtcgt ctttgcttaa tgtggaatcg atggtgctag ccatgcgcat ttcgcgcagc    268140
     ttgcggggaa tcgatgtctc cgttgcggct gcctgctcct cgggattgtc ggacttgacc    268200
     aagaggagga agttcttcac gtactgctgg tcgatggtgg aggctccttg tgcgacacca    268260
     ccggcgaaga tattggtcac aatggcgcgg aggttgccct gaatatccac acctttgtgt    268320
     tcgtagaagc ggcggtcctc gatggagacg atggcgtctt tcatggactg cgggatggct    268380
     tcggaaggga tttcgaacct gcgctgctta tacacccatg cgatggggtt gttgcggttg    268440
     tccaaaatcg tagaaacgcc aggtgcagaa ccatccgtga ggtcttggag gttggactgc    268500
     attgtgtcgt ttgtacggtc gacggccacg ccagcaatag cggccacagg ggtgagcgcg    268560
     agtgcacata ccacgccgcc ggcgaccgtt gctaggacga tatctttcag ggaattccac    268620
     attgacactc ccttacccta gctaaggact gcccgtgggg gaagtggaaa actcccctca    268680
     aagtgtgact cattcgactt agaaggtttg ctgtgaatac actaacagct gtagttattg    268740
     tgcacgttgt aagacgatgc agaaagccac gctgatgtgg ctctcatttg gttcccgatt    268800
     aatgtcagga ggagttcatc atgacagctt cgttgatgaa cacaggcaag aaaaacccct    268860
     ttcgagatac tcagcagggg gagtatggga acggagatcg aaacgactgg gtaatgcaag    268920
     caagctgtcg caacggcgat cctgatgccc tctttgtgcg tggtgcggag cagcgtcgtg    268980
     cagcagcaat ttgccgccaa tgccctgtga tgattcagtg ccgtgccgat gccctagata    269040
     ataaggtcga atttggtgtg tggggcggcc tcaccgaacg tcagcgtcgt gccattttgc    269100
     gcaagaatcc tcatgtagat agctgggagc agttcttcgc ccaaggtggc gaacttctcg    269160
     gcatgtaggg cgtgtgtgcg ctcacaagat ttcggtacag tggcatgcat gactaaatgg    269220
     gaatactcga ccgtgccact gttaacgcac gcaaccaagc agattctgga tacctggggt    269280
     gaagacggct gggagctcgt cagcgttgta ccaggcccaa accctgaaaa cgttgtcgcc    269340
     tacatgaagc gcccggtgga ataacatggg ggcgtcgata agcgaaaaac tcgcagaact    269400
     taacatcatg cttccttccg ttgcagcgcc cgttgcggct tatgtgcctg cggtcaaggt    269460
     ggggaaccaa gtatggacct ccggccagct gccctttatt gatggccagc tgcccgcaac    269520
     cggaaaagtg ggcgcgaccg ttaccgctga gcaggcggca tcctatgcgc gcaccgcggc    269580
     attgaatgcg ctcgctgctg ttgatgcact cgtgggcatt gataatgtca cgcgcattct    269640
     caaagtcact ggctttgtcg cctctgctac tgattttggc ggccagccag cagtcgtgaa    269700
     cggcgcatcc aacctcattg gtgagatctt tggcgaggcc ggtgcgcatg cgcgtagcgc    269760
     ggtcggcgtt gcggagctgc cacttgatgc ccccgttgag ctggaaatta tcgtcgaggt    269820
     agccaactaa ccttcgattt gtggttgggg tttcggtcgt gtgtgccggc tggagtagct    269880
     atgctaaagg ctatggagca tcctgcttac agtcagctgc ggccggttac cccgtccgca    269940
     ggagttgtcc tttgcccaaa ccctggttac agctcgcttg aaggcaccaa ctcgtgggtc    270000
     gttcgagccg agggggatcg gtgcagtatt gtcatcgatc ctgggcctgc tgatgaaggg    270060
     cacctcaatg tccttcatgg caaagccgaa accgtgggac ttgttctttt gacgcaccgt    270120
     catcacgatc acgctgatgg cgctgagcga ttccgacaac tcacgggagc ggctatccga    270180
     gcgcagcaag caccgtattg ccatggggga gatgtgctgc gtgacggcga aatcattgct    270240
     atcgacgggg taaccccgca gctagaagtc gtatttacgc cagggcatac cagtgactcg    270300
     gtgtgtttct ttgtgtggag tggtgttccg cacgaatcca accttgaggg gattattact    270360
     ggtgacacca ttgctggtcg ccacaccacc atgatctctg agaccgatgg tgacctcggc    270420
     cagtatttga acacgctggc cctgttggag aaacgcggta aagggattgc gctattgcct    270480
     ggacatggcc ccgatggtga cgacgtggca agctttgcac actggtatat cgagcgacgt    270540
     atgcagcgcc ttgagcagat caaggaagcg attgcgcagc gcggcgcaga tgtgcctatc    270600
     aaagagctta tcgacgcagt ctatgacgac gtggaccccg ttttgcgcgg tgccgctgag    270660
     cagtccaccc gagtagcgct gcgctacctc gcacaacagc aataaaatcg cacaacacga    270720
     aaggcagggg caatgcccct gcctttgttt ttactgtctt gtggcttagc gagcgcgctt    270780
     tgctaggtgc tcggtgtcta caatcaacac ggacttgcct tcaaggcgaa tccagttgcg    270840
     gtgtgcgaag gtagccagag ctttgttgac agtttcgcgg ctagcgccaa ccagctgggc    270900
     gatctcttcc tgggtgaggt cgtggttcac acgcagggca ccgccttctt gcgtgccaaa    270960
     gcggttagcc agctgcagaa gagttttagc tacacgacca ggaacgtcgg tgaagatgag    271020
     gtctgcaagg gagttgttgg tgcggcgcag gcgacgcgcc aacacacgca gcagctgctc    271080
     ggagatctct gggtgctcgg cgatccactg gcgcagcatc tcagagttca ttgttgctgc    271140
     gtgtacttcg gtcacacaga cggccgagga ggtacgtggg cctgggtcga agatggacag    271200
     ctcgccgaac atgtcggatg gtcccattac ggtgagtagg ttttcgcggc cgtccatgga    271260
     gtggcgggcc agcttaactt tgccggatgt gatgatgtac aggcggtcac cgggctcgcc    271320
     ttcttcgaag atcgttgcac cgcgtgggaa gcggacgctt tccagatctt cgatcagatt    271380
     gtttacggca ataggatcta cgccttgaaa aatgccagcg cgggacagga tgtcctgtac    271440
     accttccacg tcaatactcc tctgataagc cgcctagcag cctctccggt ctggttgcta    271500
     acgcggcgcc tagctgagcc tcaacctttt ggtagaaacg gagagatttg tgggttgtga    271560
     ctcattcggt tgtttcctag atcaccatac tatgtgttga gtcacttttg cacctcccaa    271620
     gttgaattat cacactcggt gtgaactggg gggagtgtgg gggtgaatca aaagccgcga    271680
     actatgcgaa agtttgatgt gcatagtttt tgcgtggcta cggttacccc cgaacgtgtc    271740
     gtttctatga tgtgtcctat attgcttttt tcgcacaatg cgatggctaa cacatctact    271800
     tctggggagt cggctcctgt ggcgacatga tcgccttttc caaacgatcc atccacaaca    271860
     aaaaagcccc caacacaagc gggaccacaa cagcgagcgc aagaatcata ggcatagcct    271920
     agcgcactac caactcacgt taaggtagag gacatgagta gacctgacct cgcccagcag    271980
     cccaccgcac tggcggtcaa gcgtcgcgca cgcgccatca atcgggaact ggccaaagcg    272040
     tatcccgacg cccactgtga gctggacttt aacaatccac tcgaactcac cgtcgccacg    272100
     gtgctcagcg cccaatgcac cgacgtacgc gtcaatcaaa tcaccccagc actatttgcc    272160
     aaatatccca ccgcagaggc ctacgcgagc gccaacgaag ccgaactgca agaaatgatc    272220
     cgacccaccg gtttttataa agcaaaggcc gcacatctta tcggtatggg gcaaaaactg    272280
     gtcacagact tcagcggtga gatcccacgt gatctagaaa gccttgtcag cctgccagga    272340
     gtaggaagaa aaaccgccca tgtagtgcgc ggtaacgcct ttgacatccc tgggttgacc    272400
     gtcgatacgc acttcggacg actcgtgcga cgcctagggc ttactaccca gaccaacccc    272460
     gtgaaagtcg aacacgagat agccgatctg atcgagaaaa aagaatggac catgttctca    272520
     catcggatca tcttccatgg acgtcgcgta tgccattccc gcaccgctgc atgtggagct    272580
     tgcttccttg cgccgcgctg cccaagctac ggggaagcag gacccacaga tccactgcgc    272640
     gcagaaactc ttgtcaccgg agacaaccgc gaacacctac ttcagatggc aggtattgga    272700
     aatgcgtaaa acaatcgtgg tgtctgccct tgtcttcgtc gcagtctttg ccgccctcat    272760
     cagcatgatc gtgggaaata acaatgaacc cacgcccgag aacctccaag aggaaaccca    272820
     aaacgtagca tcgcgcccag actgcgaggt cagcactgtt gccggcgtac agctcgactg    272880
     cctcggcggt aatgcccata tgtccgacgg gaatccaaaa ataaccgtgg tcaatgtgtg    272940
     ggcatggtgg tgcgagccat gccgagccga gctacccctt tttgatacgt tggcgcaacg    273000
     tcaccccgaa ctacgcgtga tcggtgtgca tgccgacacc aatgccgcca acggcgctgc    273060
     actgctcaac gacctcggcg tttctctgcc ctcgctgcaa gataatcaca atgcattcgc    273120
     cggtacctta gggctcccca acgtggtacc catcaccgtt atcatgaacg cggatggcag    273180
     caaagaagca gtgatgccgc gcgcgtttag cacctatgaa gaactagaaa ccgcagtgat    273240
     ggccaaggtg cacaaaggat gaccgtggat tttccgcaac cagatgcccc agggcacaac    273300
     atcgacctgc ggccagaatt cgccccgcgg tggctctcgc ccctagtaag cgatgtggcc    273360
     aacggcgtta tctgcgatcg actacgccgt gttctcgccc caccgcaacg cacggaaact    273420
     accaaacaag cagccgtgct catgctgctc gcaggagatc ccctcgcaca caccgtgcct    273480
     aacgacgcca ccgtgcttct cacacaccgt tcaccaacga tgcgatcgca ctccggccaa    273540
     attgcctttc ccggtggccg gatggacccc accgaccata atgtggtcga ttgcgcactg    273600
     cgggaagcgt gggaagaaac cggtgtggac cgcatgaacg tgacacccct tgttaccttt    273660
     cccatgttgc atatccgtgc taccggatac cccgtgcatc ccgtactggg ctattggcac    273720
     aggccgagtc gcgttggggt ggtaagcccc aacgaagctg acgctgttgc cgcaatcccc    273780
     attgcggaat tagctgatcc cagcaaccgg cttaccgtgg aatttgaccg ttggtctggt    273840
     cccgcgtttc ggatcaacga ctttattatt tggggtttta ccggtggact cttagatgca    273900
     atgctttatc aagcgggatg ggaacagccg tgggattcgc acaagcacta cgatctatac    273960
     gacacccttg ctcgttcccg gaacaacgag cgtttgacgt aatgcaggaa ggcacgacac    274020
     gacagtgaca cccggaatga cagtcgacgc tgccatcgtg atcgcgttag tgatcgcaat    274080
     ttttaccggc tggcggcaag gcgcagtatc ctccgtgctt tcaacccttg gcgttgtagc    274140
     agggcttatc tgtggcgcag cagcagctcc ctttgtgatg ggactgaccg agcatgtagc    274200
     cctgcggttt ttgctagccc taggaaccgt gattttgttg gttggcgtgg gcaacctcgt    274260
     cggcggaata ttaggagccc aacttcggga tcatttcttg tggaagaaaa ccatgtggat    274320
     agattccgcg attggttccg tgtttcagac cctagctacg ctgttggtgg cgtggctggt    274380
     atcaattccg ctggccacag ggctaagcgg tggcatatcg caggggatta aaaactctga    274440
     gatcttaggg tttgtggacc acggcgcacc ttcgcagttg tctgcgctgc cgtcgaaaat    274500
     ctcggcgatg ctcaatgaga gcggcctgcc gccgctggtg tcgccattta tggaaaagca    274560
     gcactccagc caagtggaag cgcccgctat caaggtggcg gacactgcgc tggtagaacg    274620
     cctgcggccc tcggtgatcc acgtgctggg cgagtcggaa gaatgtagcc gacgcctgat    274680
     gggatctggc tttgttgtcg acgccaccca cgtgatgact aacgcccacg tggtagccgg    274740
     aacccagcgc gttagcctcg acaccgtggt gggtatggtc gacgccaccg tggtgtatta    274800
     caacccacag ctcgacatcg ctgtgctcga agcggagggg cttaacctgc ccgcactaca    274860
     gtgggcgccc gaacctgcag aaactggtgc agacgctatc gtgatgggct tcccagaatc    274920
     cggccccttt gaggcagcgc cggcacgtat cagcgaccgc attatcatcg caggccccga    274980
     catctacgct aacggccgcg tagagcgcga atcctacacc gcacgtggaa gtatccgcca    275040
     aggcaactct ggcggcccca tggtggatgc tgagggcaac gtcatcggtg tggttttcgg    275100
     cgcttccgtt gatgccacag atattggcta tgccctcacc gccaaagaag tgctcaatat    275160
     ggtaggcgat accagtgcgc tgcacacccc cgtggccacg cagcagtgcg tggtgaacta    275220
     aagaagtttg agcacttggg caacaaaagc tgctgggtct tctagatgcg gacgcattcg    275280
     cgtgctgggg atactgaacg tgtcaaagtc cccagtgcag cgtgatgcgg cacgtcgggc    275340
     gaggtagcgg gcgtaggggg tggcgtcgac aagcacgtgc gttggggccg tgacatgctg    275400
     cgatgcccac ttcagcggcg gcacattgac cacatagcgt gaggttttgg ctaccgcggg    275460
     gaaagtggag tcaatggaca tggcgaggcg acgcagcgct agtgtgtccg cgaatttagg    275520
     gcttgcttgg aagcttaacg acgtccaccg ccgtaggtcg cgctcaaccc acatatcctt    275580
     cagacgccac aggcgcttac tgaggactcg ggggagtcga aacattgtgg tcatactgac    275640
     cggataggta aaaagccacg gtctgccgat gatggcgcgg cgcatatcaa gggggtgaat    275700
     cgcgcccatg gtggtcaacg aggcgacgtg gcgcgggtag ttcgcagcaa gcagccacgc    275760
     aatcgcggca ccggaactgc aggcgatcac gtgcgcggac tcgtggccca aagtacggat    275820
     cgagccggcg atgtcgccgg ttgcgaggta gtgatcgtag cccgtaggcg gcttgtcgga    275880
     gaggccgtag ccacggaaat caatggcggc aacatgaaaa cccgccgccg caaggggggc    275940
     gaggcattct ttgaaatcga accagccgcc gaaggaatcg tggagcagca ctatcagggg    276000
     attggtgggg tcgccagcag ttgccgcatg caggcgtacg ccacgggtat ggagcatgat    276060
     atggctaaat ggcccttcga gttccacaac gtgtggcgag atcggcaccg gtggaacctt    276120
     aggggagtgg ttgctgcgcc taaaaaacgc cgccatatcg gggtagctcc ttctaaataa    276180
     cataacaacg ccccgaaaac ggaggcgttg ttagatcaat gagcgtgggg ctttaactgt    276240
     gcactagctg tagaggccgc gattgcttgc ctcgagcttt gcctgagcct tacctgggac    276300
     aagctttttc agctcgttaa cggagttgat cgtctccttt ggcttgctga tcttcttgac    276360
     cttcttaaaa ccaaccagcg caagcacgcc ggcgagaacc agcatgaaca ggaacacgat    276420
     caagaaggca gcccagcggt cgatccacaa gttgagcagc tcggcaagga agaagaaaaa    276480
     gaagaaagag ctgtacaaag cgatggtgcc ggcaacgccg aacatgccgc cgccaatcac    276540
     acctttttta gcttcaacgg caagctcagt cttagcgagc tcgacctccg cgcggaacaa    276600
     ggaggacatt tgggcggtgg catcgctcac caaggaacca atggatccct tgttggtggc    276660
     atctacatcg gtcagcggaa ttgcgttgac cttcgcctcg aacgcgtcat tgccctcggt    276720
     gaaaaagccc ttgtcgttgc tcacgggtcg gtccctccag atcattgatt taaaacagtt    276780
     atccccaatg ttgccacgaa tttgcgccga gggtgaattt tgtgggccaa ttgttgccgt    276840
     ttcgtagtct tagcgaggat catgggcagc tatgaatggt ttgctcgacc gagaagacat    276900
     ccgcaccctg ctcgccgaag ccgagtcgac aatcgctgct gtacaccgtc gaccagtaag    276960
     tttgcgccga agtgacctca ccagtgctga aggcgtgctc agaggtgcgc gcagcagcgc    277020
     tcagttgacg ccacagatca gtgagcaaca ccatatcagc gcctacagcg tgctggcccc    277080
     cgaccatatt gcgcgcagct ccacgacttt tgtgcgtgca cccctccaac tgctcgcgcg    277140
     tatcgacgtc ctcagcggtg gcaccggaag accagaacag ggaagtgctg cgttgcaatc    277200
     cttagcgggc tttatttcag cacgaccaca ttcgggactt ggcccagccg tggttcatgg    277260
     tgagatcctt gcccatgccc cttttggccc acgctctgcg atcgtcgcac gcgtggcttc    277320
     ccgagtcctt gcctacggtc tgggttttga tccgcgtggg ctctgcgttc ccgaacccta    277380
     cctacgtagg caccacgagg actatcacag gtgtgctgac cactgggctg acagtgccga    277440
     tgcagccgca gactttgtcg ctttacatct gcgtgcctgg atcgcgggtg cagctgaggc    277500
     ggagtctatc gctgcggccg tttagagact tccaccacat cacagagcca accacggctg    277560
     ctacaccagc tgctacgccg gtggatattt ggagatcacg tttagtgggt ttgctaaaaa    277620
     gggccaccgg atttttaaac gtatggattt cccaatcgcg atcaagagcg acctttttga    277680
     gggcgcggtc gggattgacg gctcgcgggt tgcccacggc ctcaagcata gggaggtcgg    277740
     tgatggaatc ggagtaggcg aagctgcggt ccagttgata gccgcgcttg tcggtgagat    277800
     caaggatggc ttgtgcttta gctgcacctt tgcaatagaa cggaacctcg ccggtgaatt    277860
     tgccgtctac aacggtgagt tctgttgcca ctacttggtc gacgccgagc tctgcggcga    277920
     ttgcttctac gaggatccga gcggatgcgg agatgattac tacgtcgtgg ccggtttctt    277980
     gatgcatgtg aatgaggtcg cgagcttcgg catagatggc gggggcgaca acactctgga    278040
     gagtgtcgtt ggcgatctcg cgtacttgtt cttcgctcca gccggtaatg agatgggcga    278100
     gctggttttt ggtgtgatcc atttgttcgc tggagtagcc agaaaacatg taggttgctt    278160
     tggccatgga catctggagg gcctcggcgg gggtgatgag gcctgagtgc atgaactccc    278220
     gcccgtaggc caacgcggag gacgtggcaa tgatggtttt atcaagatcg aagaaggctg    278280
     cgatgcgggg ctggtggata tccagctggg gtgcattcat aaaggtcagg gcctccttgg    278340
     ggttgctgtg tccagtgttt gtggccacca gtgtatgtgc tgttgtgtca gggcggtagg    278400
     tggggtttcg ttacttggcc taagaggctg tgtgggggtg ttttagaccc acccatgagg    278460
     aggtgaaaaa tcgaagattg ctcatttggg tggtctatgc cataatgtaa ctgcaaggcc    278520
     ccgatataca gtgtggcctg ccccggcccg cccccctgtg gccgggtggc ggttcgcgca    278580
     cacccccccg agcgcgaacc gcccttaatt gttttatggg gtgttttccc ccaaagtatc    278640
     ctgtagcttc tggtggcttt ggccgatatg cggaagttat ccacaggaac actcattttg    278700
     tgatccaact cacctgttgg tggtgggtta tccacaggct ttacggagac gttctgcgc