(data stored in ACNUC8465 zone)

EMBL: BX294133

ID   BX294133; SV 1; linear; genomic DNA; STD; PRO; 311050 BP.
XX
AC   BX294133;
XX
DT   30-JUN-2003 (Rel. 76, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 5)
XX
DE   Rhodopirellula baltica SH 1 complete genome; segment 1/24
XX
KW   complete genome.
XX
OS   Rhodopirellula baltica SH 1
OC   Bacteria; Planctomycetes; Planctomycetia; Planctomycetales;
OC   Planctomycetaceae; Rhodopirellula.
XX
RN   [1]
RP   1-311050
RX   DOI; 10.1073/pnas.1431443100.
RX   PUBMED; 12835416.
RA   Gloeckner F.O., Kube M., Bauer M., Teeling H., Lombardot T., Ludwig W.,
RA   Gade D., Beck A., Borzym K., Heitmann K., Rabus R., Schlesner H., Amann R.,
RA   Reinhardt R.;
RT   "Complete genome sequence of the marine planctomycete Pirellula sp. strain
RT   1";
RL   Proc. Natl. Acad. Sci. U.S.A. 100(14):8298-8303(2003).
XX
RN   [2]
RP   1-311050
RA   Kube M., Borzym K., Heitmann K., Klages S., Marquardt I., Lehrack S.,
RA   Beck A., Pawlik R., Reinhardt R., Gloeckner F.O., Bauer M., Teeling H.,
RA   Lombardot T., Ludwig W., Gade D., Rabus R., Schlesner H., Amann R.;
RT   ;
RL   Submitted (21-JAN-2003) to the INSDC.
RL   Max Planck Institute for Molecular Genetics, proScience Ihnestrasse 73,
RL   D-14195 Berlin,  Germany Max Planck Institute for Marine Microbiology
RL   Celsiusstrasse 1, D-28359 Bremen, Germany.
XX
DR   MD5; 45508301068df092d4fdaa6cfec03f97.
DR   ENA-CON; BX119912.
DR   BioSample; SAMEA3138332.
DR   RFAM; RF00005; tRNA.
XX
CC   This project was carried out by
CC   *Max Planck Institute for Molecular Genetics, Berlin, Germany;
CC   *Max Planck Institute for Marine Microbiology, Bremen, Germany;
CC   in the fremework of the REGX-project, http://www.regx.de
CC   -------------- Genome Center
CC        Center: Max Planck Institute for Molecular Genetics
CC        Center code: MPIMG
CC   -------------- Summary Statistics
CC        Sequencing vector: pUC19; 100% of reads
CC        Chemistry: Dye-terminator Big Dye; 100% of reads
CC        Assembly program: Phrap; version 0.990329
CC        Consensus quality: 7142841 bases at least Q40
CC        Consensus quality: 7145138 bases at least Q30
CC        Consensus quality: 7145484 bases at least Q20
CC        Quality coverage: 8.03
CC   --------------
CC   This sequence was finished as follows unless otherwise noted:
CC   all regions were double stranded, sequenced with an alternate
CC   chemistry, or coveredby high quality data (i.e., phred quality
CC   >= 30); an attempt was made to resolve all sequencing problems,
CC   such as compressions and repeats; allregions were covered by at
CC   least one plasmid Sequence; assembly was additionally confirmed
CC   by long range pcr and cosmid end sequences.
CC   --------------
CC   See http://www.micro-genomes.mpg.de/pirellula/ for more information
CC   including minimal tiling path from a set of  220 cosmids out of 908.
CC   See the misc_feature tag below for the boundaries of the MTP cosmids.
CC   -------------- Annotation
CC        Center: Max Planck Institute for Marine Microbiology
CC                Celsiusstrasse 1, D-28359 Bremen, Germany.
CC        Center Code: MPIMM
CC        Email: fog@mpi-bremen.de
CC        Phone: +49 (0)421 2028 938 Fax: +49 (0)421 2028 580
CC   --------------
CC   Three different programs (Glimmer, Critica and Orpheus) were used
CC   for ORF-prediction. A nonredundant list of ORFs was generated by
CC   suitable parsing of the results.
CC   Automated annotation was done with the software package Pedant Pro
CC   (http://www.biomax.de). All ORF predictions and annotations were
CC   manually corrected by considering all results of the different
CC   tools applied. See http://www.regx.de for more information and
CC   access to supplementary information.
CC   --------------
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..311050
FT                   /organism="Rhodopirellula baltica SH 1"
FT                   /strain="1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:243090"
FT   CDS_pept        complement(3..182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB2"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZF2"
FT                   /protein_id="CAD71330.1"
FT                   /translation="MSRLFFSALFAFSVSVFTVGCGGGGNEVIEDTRSPAEVQQEQEDY
FT                   EKQMEETMDSATNS"
FT   CDS_pept        39..260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB3"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZF1"
FT                   /protein_id="CAD71331.1"
FT                   /translation="MLFVIFLLLLHFGWRAGVFDHFVAAASATNSEDRNAERKQGGEKQ
FT                   SRHYYCSMDARNECEKLVRELILLRISP"
FT   CDS_pept        complement(399..1514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB5"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZF0"
FT                   /protein_id="CAD71332.1"
FT                   /translation="MTKRLPTRQRRLVLAVAAGLITPLAAASTAKAGFGWEWETGSPYY
FT                   EDDAWYDVSEWFDGNDYNPTDEAIGRWDNETYDRDEALTSSDSDNDIDWTNKDHGYYAD
FT                   TDSSDTWFYDYYDHGYSDYGDSNNDGNYEYTSNYYDYDNDGVYDAFASYTDTDGDGIYD
FT                   DATYISFSNSAEQNDSQKTAQKKADQQNASAKSQSFTGTITRAKKVKTPATTNVVVELQ
FT                   NQSEGKSMIADLGPADQLDRMPQLNDTLTVKGSPFKAGDTSVLLSRSIEHNGQQMQVER
FT                   SGREYSGTIESTKTVDVRGQQRQLAKIKTDDGKKMLVDLGRKQDLDTNITEGSQVTING
FT                   PAVQVKDRVMLLATKVTLDGDTIEISRMAQK"
FT   CDS_pept        1548..1706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB7"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZE9"
FT                   /protein_id="CAD71333.1"
FT                   /translation="MRSRSQSVVQETNGRKVDAKKDIGAARVAQPNRFGGKLSGVAAGR
FT                   GGKQKVQ"
FT   CDS_pept        complement(1733..5263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB8"
FT                   /product="helicase"
FT                   /function="DNA synthesis and replication; transcription"
FT                   /note="best DB hits: BLAST: pir:D83545; probable helicase
FT                   PA0799 [imported] - Pseudomonas; E=7e-95 embl:CAA67095.1;
FT                   (X98455) SNF [Bacillus cereus]; E=8e-94 pir:C72027; swisnf
FT                   family helicase_2 - Chlamydophila pneumoniae; E=4e-87 COG:
FT                   PA0799; COG0553 Superfamily II DNA/RNA helicases, SNF2
FT                   family; E=7e-96 PFAM: PF02803; Thiolase, C-terminal domain;
FT                   E=0.11 PF00176; SNF2 and others N-terminal domain;
FT                   E=3.9e-64 PF00271; Helicase conserved C-terminal doma;
FT                   E=1.2e-24"
FT                   /db_xref="GOA:Q7UZE8"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZE8"
FT                   /protein_id="CAD71334.1"
FT                   /translation="MDWIAEDQLGSLGLLMGEAVERLVDSHDQGFDSRAAMLTVKTPTL
FT                   TQGDNGVRFDFQVVGNREKQQTVALEIVPQVDEDDPGGVGELSSECQCGCVAFLRDNSC
FT                   PHTLAAAWWLQEQIARRNGNGQLIEFLGGLKADAVAAGKQFVDELLRRAKNSRPAPAED
FT                   AEPTRLQWRVRVNMASQTAPLTITPFEQKQRKGGKGWTKGREVRSFDLLDQNLLTDPLD
FT                   SKIASLTSVPTHGVHDDNYAIFEALRMLAGHENVAWDDQNALPVEVFCSQLLLTLQPVE
FT                   VEQSKKPKASKSQTDGEASKKKTAAKTTRKSSGKRSGKSADELLGNVTATMTMPESELD
FT                   SIEAPSADGLIPDDLIPDDEKVEVQFQPRLSVDGIDIDVQKCEIVVGGLSPVEPAIILA
FT                   DADEDRIVLCTLADPAAIGIIQFLLRGDYRDTLLDHATASRLALAAGSIDSLIRVELPP
FT                   QLAGPIVPAPCELVLQMRPRPGAGLKVSLRVYESRLRDSLIPGDAPELVPCLAETGPIR
FT                   LQRDLKAELESAEKIVQRFGLSRLSHESTMEWVALTDHAALDLLGRLHDAGDESPRIVW
FT                   PEGETFRVRGEITPKSLRIKIDDSPDWFGMTGTVTVDGVDVPLQDLLMAVREDRQLVRV
FT                   GDRRFAKISEAFRKRLTQLGDTLVSEKGQLRLAGAAVPLARDVLGDDVTLETTAAWHQA
FT                   IERLDSLQDWSPDRPEGLDATLRDYQLDGYRWLARLSRWGVGGVLADDMGLGKTVQTLG
FT                   ILVERGPVGPALVVAPTSVGENWVREAEKFTPALTGKLYRDCDRDEVIKTAGPNDLLIV
FT                   SYQLLQRDAKRFASRGWHTLVLDEAQFIKNSQTKTSQAIRTIQADWRLGLSGTPLENHL
FT                   GELWSLFRTLSPGLLGSWQRFRSRFAEPIERHSDADRRESLARLVRPFVLRRTKDKVLK
FT                   ELPPRTEITLRAELSAPERKLYEDARLAALAELTAGGGAPSHEGRRRIQTLSWLTRLRQ
FT                   LACHPSLVEPSWKGTSSKLQLFLSLVEELREGDHRALVFSQFVKHLSVVRAALDERGIS
FT                   YQYLDGATPSHERQRRVDAFQNGEGDLFLISLKAGGTGLNLTAADYVLHLDPWWNPAVE
FT                   DQATDRAHRIGQERAVTVYRLVAERTIEEQILQLHADKRELVAGILDGTDAAAKLQTQD
FT                   LIDLIKAEMG"
FT   CDS_pept        complement(5458..5850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB13"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZE7"
FT                   /protein_id="CAD71335.1"
FT                   /translation="MHLPHGNQRFKDRTKNYRETSETLLRTILATETVRLTPVARHPFP
FT                   RRSFELMETPESSDPQLSKDCPKIPSGTIPGNKVSCPSVIPKELPHTTCEQPPLSNRAG
FT                   NNRVDLKRGRVGWFGTRPVPLRRLSP"
FT   CDS_pept        5836..7386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB14"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZE6"
FT                   /protein_id="CAD71336.1"
FT                   /translation="MGQMHFDVPDAANEFFESTRWEDAYLCGIEGVPWQSRNSYSNGRF
FT                   TLTRGVDTSAKLFLTCPIPSIGYRQLSTCSLRCLDRSHRLFVELARGSCYRVRVQADVW
FT                   QRGGLVLSDRFDDFLTRGTKRFLDAAQCAPDDPSCVDAALEAIEALEHASNELGDLFST
FT                   QSVAYRRSRETRLSTMLAVGVLPPLPATEVTADMQSGRASNSIDEQATITRAFNAAAVR
FT                   ISWGEIETDSGRPNYEPTDEALTACAQMGLRVIGGPVIDYRKGLLPDWLTLLDDDFDKL
FT                   MSTMTSFVEKTVVQFRGRVNLWNAASGLNVAGPLGFDDEQVMRFSIGILQTIRRCDPNT
FT                   PVLMSLDQPCGEYLARDEQGISPLHFADALLRSGLGLAGIGLNFRFGFDDGDTHPRSAV
FT                   EFGQMIDRWGTLNAPLMVQLSVAGAPGKDAAARLPIQTRPLSPEINGEPDAWAKAQIEF
FT                   VQPLIETLLSKQIVHAVVWDGWSDQHPHMTPHAGVIDAKGRPRPMLAYLTKIREEMLI"
FT   CDS_pept        complement(7575..8069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB16"
FT                   /product="hypothetical protein-putative conserved
FT                   hypothetical protein"
FT                   /db_xref="InterPro:IPR011480"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZE5"
FT                   /protein_id="CAD71337.1"
FT                   /translation="MLWNKAGRPAGHARLSDVRPFTPPGTTWPTYLSQPDASARDTSEF
FT                   WRSHQRRPGHYLAPSRRFGTKRAVQPVTQDSAMSVHSPRQVQPGLHICPNPTRQRETRL
FT                   NSGEATNVGQVITWHPADALEQSEPSSRSRKTQRCPSIHPARYNLDYISVPTRRVSEGH
FT                   V"
FT   CDS_pept        complement(7757..8251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB17"
FT                   /product="hypothetical protein-putative conserved
FT                   hypothetical protein"
FT                   /db_xref="InterPro:IPR011480"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZE4"
FT                   /protein_id="CAD71338.1"
FT                   /translation="MLWNKASRPAGHARLSDVRPFTPPGTTWPTFLSQPDASAKDTSEY
FT                   WRSHQRRPGHYLAPSRCFGTKRAVQPVTQDSAMSVHSPRQVQPGLHICPNPTRQRETRL
FT                   NSGEATNVGQVITWHPADALEQSGPSSRSRKTQRCPSIHPARYNLAYIFVPTRRVSERH
FT                   V"
FT   CDS_pept        complement(7939..8433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB18"
FT                   /product="hypothetical protein-putative conserved
FT                   hypothetical protein"
FT                   /db_xref="InterPro:IPR011480"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZE3"
FT                   /protein_id="CAD71339.1"
FT                   /translation="MLWNRASRPAGHARLSDVRPFTQPGTTWPTSLSQPDASARDTSEF
FT                   WRSHQRRQGHYLAPSRCFGTKRAVQPVTQGSAMSVHSPRQVQPGLHFCPNPTRQRRTRL
FT                   NTGEATNVGQVITWHPADALEQSGPSSRSRKTQRCPSIHPARYNLAYIFVPTRRVSERH
FT                   V"
FT   CDS_pept        complement(8303..8542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB19"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR011480"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZE2"
FT                   /protein_id="CAD71340.1"
FT                   /translation="MDFQVRRNEIPTRPRGTRLNFGEATNVGQVITWHPADALEQSEPS
FT                   SRSRKTQRCSSIHPARYNLAYISVPTRRVSERHV"
FT   CDS_pept        complement(8570..10894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB20"
FT                   /product="similar to myosin heavy chain"
FT                   /function="cell cycle control and mitosis"
FT                   /note="PMID: 2506434 best DB hits: BLAST: pir:B32491;
FT                   myosin heavy chain 2, muscle - fruit fly (Drosophila;
FT                   E=3e-09 pir:A32491; myosin heavy chain 1, muscle - fruit
FT                   fly (Drosophila; E=3e-09 swissprot:P05661; MYSA_DROME
FT                   MYOSIN HEAVY CHAIN, MUSCLE; E=4e-09 COG: VNG0342G; COG1196
FT                   Chromosome segregation ATPases; E=5e-05 aefA; COG3264
FT                   Small-conductance mechanosensitive channel; E=9e-04 Ta0787;
FT                   COG1196 Chromosome segregation ATPases; E=0.002 PFAM:
FT                   PF00038; Intermediate filament protein; E=0.87"
FT                   /db_xref="GOA:Q7UZE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZE1"
FT                   /protein_id="CAD71341.1"
FT                   /translation="MVSTHRPAACYRPHGVWFLPRVLVCFVLVAAMNTWIGIPSFTALV
FT                   CMLAGILAGHLLWYRDRSRDVQAIKDAEKKYAKAKAAARSRKHHFLSMQGDIDSLQSSR
FT                   DEVKAESEQLRQWLKDQKQLTAEAETELGHLRTEHSRFELANKDAEEARQAATASLQQA
FT                   EKEIESLRSALADNETRFEESASKMRELAETANATGDELANREKQQEFLMQANEQLKKQ
FT                   NAELESQIEVTRGEVFAAEEALNAFRQQQTSLQNEQENTQSQVQQILADLNAANEEIDS
FT                   LSQANESLLQRVEEAVTQRDAAILQRDQFAAERENVSNEYDETGQRFAELQKEYENLRS
FT                   QHEIAIQTATRHEETVQLVREELETRNEEVSELKTARTQLESTLQENELKLQTLQSERE
FT                   ELAEELDERTLRIQEAIDSRVVAESALSELEERLSLTHAELNSKLEHTASQLASTELSL
FT                   TETQSQLTQTVEKLSTTESQLEQTRTELASVQTSWTESKAKLSESESRLSATAQKLSSV
FT                   ESQLEKAQTELASTASRLETTESSLASAIVQRDRHEKTLQEIHASTEQLRNEATQLEAT
FT                   IASKDDAISQLRNDLQVQQDSVSRHRAEIERLQSVRPEFEKLKQTVSERTNETTRLAQQ
FT                   VKNQQQRETQLQQEIDERNQQVQSLRRSQEQLESRISEQTSLVQRLTQELKSTKESLQT
FT                   ARQHEPRAVAMQSQVADLTVELKRVSSELDQSLDANAEMQERMRVLEGKLHESAAVMRD
FT                   LRRKRAHVPVLESNENQRRAA"
FT   CDS_pept        11131..13935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB24"
FT                   /product="similar to L-sorbosone dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="best DB hits: BLAST: pir:F75417; L-sorbosone
FT                   dehydrogenase - Deinococcus radiodurans; E=0.13
FT                   embl:CAB94635.1; (AL359215) putative secreted glycosyl
FT                   hydrolase.; E=0.26 PFAM: PF00034; Cytochrome c; E=0.35"
FT                   /db_xref="GOA:Q7UZE0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013427"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZE0"
FT                   /protein_id="CAD71342.1"
FT                   /translation="MAGSIGTVSRRFGVGERESKIFSALVGDRPGRRLIYGLLRAIARR
FT                   RGLRPRPPPLPIPPATASSMKSLCSSTSAGVFASSHAGNVLSRRVFAATSSVLRLGAFV
FT                   GVLGLSQLHLPNASAGLGVTPAEQFKVPEGFEVELLHEVAPESEGSWVSLTVDPKGRLI
FT                   ACDQSGGLFRIDMSSGEAKVEKLEIEFVGAQGLLCAFGSLYANVNAREFPCGLWRLTDT
FT                   DGDDQYDKKEHIIPLNGGSEHGPHALLVTPDGKRIIMVAGNNTNLPEEIAHSRVPKVWD
FT                   EDHLLGRMPDARGHNANRMAPGGFICSLNPDGSDVELIATGFRNPYDIALNRQGELFTY
FT                   DADMEWDVGTPWYRPTRINHVISGSEFGWRNGTGKWPAYYPDSFGSAVDIGPGSPTGIV
FT                   FGYGAKFPKKYENALFISDWSYGNIHAVHLTEDGSSYSGTYETFATAAPLPVTDLVIHP
FT                   DGALYFAIGGRGTQSGLYRIKYTGDIAAADAAEEVVAASDEAKQLRELRHSIEALHVDD
FT                   ADLSVSPEEAVKLAIENLSHDDRAIRFAARIALEHRSPSSWKKAALNEANAEAKILGVI
FT                   ALARTGEKADQADVVKALETIDLESLAASEKIDFLRAAGLVAMRLGEFTQTQRDALFGK
FT                   IKGQFPTGLDSLDRELAIMAIYLGDPESTASVVAALQNSPSQESQIHYAMALRAAKEGW
FT                   SNDLRRDYLAWFNEMATARGGMSFGGFLDNIKKVTVERLSDADKQSLADVLAKPKQTDE
FT                   APAGPPREFVKQWKVDDLVDLVSDENRRPDFENGKAMFAAATCYKCHRMGLQGGILGPD
FT                   LTSAGGKFSPRDMLVSIIEPSKVISDQYGSTQFLTEDGEVITGRVINMRNKVLNVMTNM
FT                   LDPSSLAEVDREAVIQTRESTVSMMPNGLLDTLNEEEIADLVAYLRAGGNAKHAIYTQP
FT                   VATR"
FT   CDS_pept        14053..14556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB27"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR011473"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZD9"
FT                   /protein_id="CAD71343.1"
FT                   /translation="MRGNAVPPRQLLRALEGDWRGACQTWFEPGKLADKSEVSGSIKPM
FT                   LEGRFLRHVYQSQIQGRPRHGEEWIAFNEVTENFEISWVDDFHMSGAIMISRGPLTVPE
FT                   GLSKRSAAFEVFGHYDVGKDHPRWGWKTRYAYDEESGLVITAYNVTPDGEEAKAIETVY
FT                   QRNS"
FT   CDS_pept        complement(14498..15148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB29"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="GOA:Q7UZD8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZD8"
FT                   /protein_id="CAD71344.1"
FT                   /translation="MGARGGSLDGDERQFKPPVSIWRVDLPRFDGRLIRDSVGLAAGLP
FT                   VGPTALPALVVVFRHFFATRQTRVLVRVRHHLKPSLRLSPQLAGNLLGMGLLRLGHLHL
FT                   DAPIRSGMHPVHADGVVVHELRRQTFSRQQHGQHLRINHVIKHIDDNKIGLHGMDPGGF
FT                   ALETRNVFTLEMRLADRRARNPLLVGAPIVCVGIFTSFVGKPFRSLWPLLRLA"
FT   tRNA            15141..15217
FT                   /product="Arg tRNA"
FT                   /note="Arg, tRNAscan-SE-score 85.59%"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(15460..15627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB33"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZD7"
FT                   /protein_id="CAD71346.1"
FT                   /translation="MPVDVPPVTHTITMNLELLRNSVGANDDEAEDAIDDAERFVPDWR
FT                   LKVRRTGSRT"
FT   CDS_pept        complement(15692..16483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB34"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZD6"
FT                   /protein_id="CAD71347.1"
FT                   /translation="MQPLPCIIGLDADELADIKQRYGGPMVCHELLPQMMVRDRQLFVQ
FT                   PASGARLLPISRMVFHGIFADDHDFITGLAIWAGECLPNAAAMMDCRLKLPCLARALRF
FT                   ASFADPPRGYSSPGLEYIASGPSVAKWGNWHCGENKERFDDSMVTENASIVEPFVSGEA
FT                   IRVVVIGDSAWQIRLEGDDWLKSIHHDTASLIDLDSALVDDTRAVARGFGLEIAANDYI
FT                   VDTNGVPHLLEVNHIPNVTRFPETWEGYSTFVLDWLTADCG"
FT   CDS_pept        complement(16591..17700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB35"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZD5"
FT                   /protein_id="CAD71348.1"
FT                   /translation="MDDITRAKILAAAEKLFDRDALYKLASSVSETQKRKSLRFWQDEM
FT                   LSELSKRVGVDITSKPHFIDVFKGTAEKYYTPLSPDGQAELDEAKQQLRDQVNKIGKKV
FT                   RKITRGGQETIPPGVPQEPLNDAAREIGFHVAFSLQELVESLLRHAEEDVRSKRNLHIC
FT                   CELIRARHLGANVPVPTLIELANDSVDAAIDDFDAGRTSLEGWYRPLSEGIFACAFLGM
FT                   NRKMARLCQWATPRKKPGYEGPLDNEIQELTLVTAGLFQGSLKPGFVRKLSRCSESRKT
FT                   RIRLLANMVQAIYDCDQDAFQISTQKAVQNYRKRKTPDPNLAILSKYLPVHINTAYYAG
FT                   LCHGMTRCGFPDSVAAYLCDIFDDSKLYN"
FT   CDS_pept        complement(17693..17839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB36"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZD4"
FT                   /protein_id="CAD71349.1"
FT                   /translation="MREFTSRNNQFMPWSDGRDLQQLQIWFPPPRRCFPFADANRMMLH
FT                   RYG"
FT   CDS_pept        complement(17846..18328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB37"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /db_xref="GOA:Q7UZD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZD3"
FT                   /protein_id="CAD71350.1"
FT                   /translation="MHTPTHLHWAVDAIAITWASLGFAALGLIVIGAFALTGTLLSLAT
FT                   DEDAYISLIAVPFVVTFAAVGAFVGCYFRSRYIGAAVCFVPLFLFASLLWLSDRFSDLG
FT                   EGEQVVTLYANGLYIGGLSMVPAFIRFPRVAQLIPLTLPHTLVCLVGMYFLYTFGL"
FT   CDS_pept        18331..18636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB38"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZD2"
FT                   /protein_id="CAD71351.1"
FT                   /translation="MRQSCQLMSMDSMRGAFGEVHFSRTKNLRSPWYEASRLLHAADQA
FT                   VTVLFRDVTINTSCTLTPQITETSHVDSDDRTTANDHPIRKHESAFTCSLLGSPIP"
FT   CDS_pept        complement(18668..19417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB39"
FT                   /product="transposase"
FT                   /function="retrotransposons, viral and plasmid proteins"
FT                   /note="PMID: 2820936 best DB hits: BLAST: pir:S46409;
FT                   hypothetical protein - Aeromonas salmonicida -----; E=2e-29
FT                   embl:CAA05973.1; (AJ003194) transposase [Lactobacillus
FT                   casei]; E=2e-27 swissprot:P37247; TRA4_BACFR TRANSPOSASE
FT                   FOR INSERTION SEQUENCE; E=2e-26 COG: NMB0225; COG2826
FT                   Transposase, IS30 family; E=3e-27 PFAM: PF00665; Integrase
FT                   core domain; E=2.4e-16"
FT                   /db_xref="GOA:Q7UZD1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZD1"
FT                   /protein_id="CAD71352.1"
FT                   /translation="MKKRKVFQRPLAKHRLSPPSCLELQIPTTHAGSVSYAHLKQQISH
FT                   QTIYKYLWSLDRNYPIRKVMRRSGRRNRKQKPGFIRKQATDRVSIHDRPKVASNRKRVG
FT                   DWELDLVVCKKSTGYLVTAVDRKTGYTLVGRCQKKLSRLVMDTIRSMFKKVPKEYIKTM
FT                   TFDNGTEFFYHPFLFTWFKVMVFFADPYCSGQRRTNENTNGLLRQYYPKGVDYGSISWQ
FT                   QVRKAAMLLNLRPRKRHGYQTPASLSQ"
FT   CDS_pept        complement(19461..19922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB40"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR025402"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZD0"
FT                   /protein_id="CAD71353.1"
FT                   /translation="MIDDSDSELVGDTVERILKLHGNQLDIYSIPKPHQIVLAVNQAHA
FT                   RISNGGFQFLLERKDADFDLCTLMPESHATIGAEQAHRAFSRFLRGTLWIRPTSAISRP
FT                   LNRLRLPLSMIKALLGFETADTLYFESSDETFRLLAEYVRANTGALPTG"
FT   CDS_pept        complement(20053..20550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB41"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZC9"
FT                   /protein_id="CAD71354.1"
FT                   /translation="MFAVPTAYSLMTQNSKRQSRLVRYQLRTLILIVAVAAVALAIARP
FT                   LFDWLDSTPLPQAVAQFNDQISDTVKVDSTLLDENAVLQAIQSTLSLGNTPEHVTTLLK
FT                   KIQSSHRLPRNTFFDHDVYYKGSTPGEPPIECLGVTLVLPSGPDERFRLPVIEIENGFL
FT                   VE"
FT   CDS_pept        complement(20627..20791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB43"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZC8"
FT                   /protein_id="CAD71355.1"
FT                   /translation="MCYVVRDGHGFTRGQVIWFDQEGGEPHEVIHESLLDFRRDWYDRM
FT                   LNDRLELTG"
FT   CDS_pept        complement(20825..21127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB44"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZC7"
FT                   /protein_id="CAD71356.1"
FT                   /translation="MASYQQLDDWLVANRLDYHRLLQPPATHSELAAAATVYCCTLPEE
FT                   FAELYRWHNGQQSGDFTELLLNLTFMTLRESMATHTMLTDMALSEGWPSEHWQPA"
FT   CDS_pept        complement(21151..21471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB45"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZC6"
FT                   /protein_id="CAD71357.1"
FT                   /translation="MQRTNSNGLTENRSRVIRLPRTAISTGDSFSRSVTAYQWAAVKTA
FT                   IDRPMIVSERISGTLPCTWATGTIDPVGMGTGEDKSPPQDSFSPLNRPEHPPTHDLTRY
FT                   NR"
FT   CDS_pept        complement(21455..22282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB46"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZC5"
FT                   /protein_id="CAD71358.1"
FT                   /translation="MTPLLFSRELGNDSMHRLHSPVRNASALIFAVVAFSTSINASEPK
FT                   PIEAWDRVVCIQSQVESKPDTGKLCSAFLVTADERLFLVTAGHASAETNLKSKLRYRDP
FT                   DGVTQWVSLKTFFRTSTNPWQRNEQSDFAIAELPSVDGAETYRSHLSALSISLDSICTE
FT                   TPPRTTEIVAVGFPLAIGAGDVISPVAVVGHIASRETNTANTWGHEPIVYCSPALAQGT
FT                   SGGPAFLNNQPDGELTVIGMHIGVVKDVSGAKLSKMVPANLIRDQISSHATDE"
FT   CDS_pept        complement(22495..23190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB50"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZC4"
FT                   /protein_id="CAD71359.1"
FT                   /translation="MATHASFASKMSCNPFAFKTHAMLHRNVASLICLMGIAQMTSLIG
FT                   CNHPTERELAAAKIQQVRENPTMPDNEAVQLLAEGYFRTDSVVVSPDDQTVKIVARPAD
FT                   LSSMVDIGQDLEDANKRAQRAVIFFALQNLNKLTRAVKDREVGDIQLTLEEAVIYQDRT
FT                   DWFPTYRLSLPPEKFDEFEALFEQIESAFGEADRDFNRAFDAGLIKLERVWDVELDAFD
FT                   QTQYERGER"
FT   CDS_pept        complement(23323..23670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB52"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="GOA:Q7UZC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZC3"
FT                   /protein_id="CAD71360.1"
FT                   /translation="MASIHAVIVTIHLVSAGFVYYRQLGSGISLLATGIAAGQLMSMIV
FT                   ISIGAAKLGFLESYRMARVGSILACIPLLTPFVWLGIPFGIWALRLLRDPEIRATFPDC
FT                   PALNERHGSRS"
FT   CDS_pept        complement(23873..24472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB54"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /db_xref="GOA:Q7UZC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZC2"
FT                   /protein_id="CAD71361.1"
FT                   /translation="MQLRSLSAVPAARMLKRLQRREPTTKPVKSRLLQTRIRRNRCQFQ
FT                   CFRMTQKQAKSAIVGPRQFQWQGSGWFGCVVGGSAWLVPMSAILALNGHPLLALVPLGC
FT                   CLLAILLGIALWHNRDRVRPFRALIGMLMLFSITTPFAWFTVSTNASPDSLELLNWPQS
FT                   IAITAMVAVICPTIAIWFCFLEYAHHGTSKRASQDA"
FT   CDS_pept        complement(24564..24833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB56"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZC1"
FT                   /protein_id="CAD71362.1"
FT                   /translation="MPQGRLENILAYQTGHDTAAMNLTTVTKDKIVATLDGVQIQFSTT
FT                   TDALLDSLPSISINETSSASYIHFGSKVDDLLNSYDRSEARIKA"
FT   CDS_pept        complement(24939..25208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB59"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="GOA:Q7UZC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZC0"
FT                   /protein_id="CAD71363.1"
FT                   /translation="MRERKNSSSTFVPNTRMTLSDSSPSRHPFGLAISRRRKVIAIISV
FT                   LLVTFIFYALHQTDRRRPTSSSTVPPNFASLPTATWFSDTGATF"
FT   CDS_pept        25165..25359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB60"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZB9"
FT                   /protein_id="CAD71364.1"
FT                   /translation="MFGTNVEDEFLRSRTRLLRQVRASLHLQPFQAAQPKNSLSPRSIE
FT                   SYRQLGFLVSLLRGEGRVF"
FT   CDS_pept        25378..25554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB61"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZB8"
FT                   /protein_id="CAD71365.1"
FT                   /translation="MSEPISRLWFHIATLANARRLSHSMTSSYPHSRRYSCVSDLSAAD
FT                   ESACKNACQIHQS"
FT   CDS_pept        25588..25983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB62"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZB7"
FT                   /protein_id="CAD71366.1"
FT                   /translation="MPLRRTKTPDGTRKTLRNVSFESLVACWLMQDGWQLYSPMVDHGH
FT                   KTDLLISDGPNFHRIQIKTFESKGKNQEINNCWSPCKIDYVVLIARNANWGLITPAFTE
FT                   KRRRINHKEHCKFEKNKQEFLRAFRQV"
FT   CDS_pept        26082..26336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB66"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZB6"
FT                   /protein_id="CAD71367.1"
FT                   /translation="MLGMEGLNLVDNVLSELFPGTSVRRASSNSLFEFPVQAFNGRERR
FT                   AFTGRSGHLSISQRGLKERVIAICFEVESSPPSRLPRFP"
FT   CDS_pept        26435..27682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB68"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /db_xref="GOA:Q7UZB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZB5"
FT                   /protein_id="CAD71368.1"
FT                   /translation="METTTTAGAFQTHRPPKRFSIVSYTRIFICSVFAFLSGIPLAGMA
FT                   HEGHEHGDSDASKESSAEFDPTAPTNKFQVNGKTYRWEHRPELGKQSKAMIDAAKGGLH
FT                   NNADRDLLTGEIVTAVAKHGLVTLDPELKEWTLVEGQDPAFAAGMNAHGTDCFVLDGES
FT                   YWAFASTNTQEVFVTKRGEVLAKLTQPKGDEFDNPTVNEYFKSGGRFTPCDVVFLPDAK
FT                   RLVVVIGYAPGDFALSAELVDGQWKWNGPAWGGREGSGGMLNTGHGVQVATENGKEIVE
FT                   IASRSHGRIFAFTPGGAQLRTPGAGKEYYIQLPKGSNPCNISSIGDSMFLPLLNALPTT
FT                   NGSAPVLVMDNGKPSGALVPATYETLQLMQHMHGFCPVEIDGKLYGVVLSWRRASENSN
FT                   GQPNDGQIAVFEAVQE"
FT   CDS_pept        27689..28141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB71"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /db_xref="GOA:Q7UZB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZB4"
FT                   /protein_id="CAD71369.1"
FT                   /translation="MAWAVSVRSPLHEVTDVMTNLPLALVWLLFLLFAIPLAGVAWNAR
FT                   QQSRAVAQVDLTPKTTYEGPVIDNGDGTRSQKITVSVVTSVSTSQTVQFGPFAVQVHAR
FT                   EWAANAVLMSIVLLGIGLIGLLHFPDDSPTTEWPMSSETISAPFDD"
FT   CDS_pept        28138..28674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB72"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZB3"
FT                   /protein_id="CAD71370.1"
FT                   /translation="MIRPLMKTGIIRRSSVDELVRSLTSSVYMQRRHFLSFSAFAAAAS
FT                   VTGCDSGEVTEPITASVERVATQVEEAVDETSTENLERYRVALRGYEIVSGMIGPRVFF
FT                   LPYPGMRILSVVIVATTVSAKLAVKYIDTELIQRQFEEELTDHERSLVEADGHVRFETE
FT                   SGVSETVMLGPSEYA"
FT   CDS_pept        28727..29023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB73"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="GOA:Q7UZB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZB2"
FT                   /protein_id="CAD71371.1"
FT                   /translation="MKAPRPTITLGFNVLLILYSAGTGFITFAFSDKAQNVPIQGLVLT
FT                   SLIDFVRYLIMMFISAWFIREFWNRLVADLFSIRFLAYREAITIVVLLGLFGL"
FT   CDS_pept        29164..29736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB76"
FT                   /product="hypothetical protein-signal peptide prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZB1"
FT                   /protein_id="CAD71372.1"
FT                   /translation="MFVGEFSHAPFRWYLRTRLARRSWACLTASAVASQQVSANGGDCL
FT                   CLFLRRDLAIARGPCVHVDLHHRILFVFPTWYTFQEAGEDKRDEGDGCRPFAIELDQSV
FT                   SIRSRSGCFRIRGVRVWANSALAAAVRTAESSSIPSMGGQLDRNHSACSVSSVLGLPFR
FT                   EQANTESKRCFRLIEREATRMFGEWAG"
FT   CDS_pept        29168..29692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB77"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="GOA:Q7UZB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZB0"
FT                   /protein_id="CAD71373.1"
FT                   /translation="MLENSAMHLSVGIFELVLPVVLGLVSLLLRWRHSKYQQTAVIAFA
FT                   CSCGATLLSPADLASTLIFTIAFFLCFQLGTRSKRPVKTNEMKETDVDHSRSSWINPFR
FT                   FGVVLVVFGSAAFAFGQIQLWQPPSGPLSHQVFRAWAANWIGTILLVLSAAFWGYHFAS
FT                   RQILNQNDASV"
FT   CDS_pept        29767..30276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB80"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZA9"
FT                   /protein_id="CAD71374.1"
FT                   /translation="MRFTLTQILTTVLVVALGLALVGSQFRHQRRIAALEHALYQTRKD
FT                   IAIAEYGSASCQLLEFHPHFYDDPSSLRFLNHEIARSILMHWEREAAIDAAVDTPGHSK
FT                   AFAKRALGLLECTTPDDFVRELRSRFSIYPDDELVSWFSRSPPGDLLNFKAFLRAALEL
FT                   NEPAGG"
FT   CDS_pept        30279..30440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB81"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZA8"
FT                   /protein_id="CAD71375.1"
FT                   /translation="MSVYQLTLLGQEWWHRFPACVLRNRRLEAYQLVDLVVYRVTTISR
FT                   WALAPVGV"
FT   CDS_pept        30494..31135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB82"
FT                   /product="conserved hypothetical protein-putative cysteine
FT                   protease"
FT                   /note="PMID: 10192928 best DB hits: BLAST: ddbj:BAB04609.1;
FT                   (AP001510) BH0890~unknown conserved protein in; E=2e-31
FT                   embl:CAB95973.1; (AL360034) hypothetical protein 2SCG4.02c;
FT                   E=2e-25 pir:A70710; hypothetical protein Rv0790c -
FT                   Mycobacterium; E=1e-05 COG: BH0890; COG1305
FT                   Transglutaminase-like enzymes, putative cysteine; E=2e-32
FT                   PFAM: PF01841; Transglutaminase-like superfam; E=0.42"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZA7"
FT                   /protein_id="CAD71376.1"
FT                   /translation="MFSNHSCRRDYIPRLFNEIDMSSSPNPDDYLGHCEDIDAGHPDIV
FT                   ECARKLTGASIKETAKNCFEFVRDSIQHTGDEQRNPVTCRASDVLRHGIGYCYAKSHLL
FT                   CALLRANQIPAGMCYQRLSIDGDGAPFCLHGLNAVHLPGHGWFRVDARGNKPGVNAQFD
FT                   PPHEQLAFGTDLEGERDLPEIWPTPHPDVVERLRRHDDWLELSNDLPDVG"
FT   CDS_pept        complement(31291..31473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB84"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZA6"
FT                   /protein_id="CAD71377.1"
FT                   /translation="MIGNLRSVVCFKTAHFGVAYRRKSGVAFQGISSDHQINRPKLNEL
FT                   IPNTGRGQCRNLVAT"
FT   CDS_pept        31507..32739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB85"
FT                   /product="conserved hypothetical protein"
FT                   /function="ABC transporters"
FT                   /note="PMID: 11823852 best DB hits: BLAST: pir:A83071;
FT                   hypothetical protein PA4591 [imported] - Pseudomonas;
FT                   E=0.044 swissprot:P50533; XCPE_XENLA CHROMOSOME ASSEMBLY
FT                   PROTEIN XCAP-E; E=0.26 gb:AAF73831.1; AF183959_2 (AF183959)
FT                   periplasmic linker protein; E=0.62 COG: PA4591; COG0845
FT                   Membrane-fusion protein; E=0.004"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZA5"
FT                   /protein_id="CAD71378.1"
FT                   /translation="MKCLLNRMTRAAVAAFCVCLGVNSVLALDDAPKDKETEKAAEPIK
FT                   VQGTFEATQSWELIHGLDQFGELEIKKILPHGTEIKEGQTVIWFDTESIDKKLSDAEND
FT                   IRLARIDAADEQFAFDQFVASQELDRQDAERARQSAKQTYDNYLQVDRDRKIKSAEFDL
FT                   EMSKASLENAAEELKQLQQMYDADDLTEESEEIVLKRAKRAVESAQFRLESTEIRSKRT
FT                   LEQSIPAEDAQTEATWERAQMTYEKTIRNLDSAKKKRDLERRKAAKALAEKESDFEELR
FT                   QQRKAIVIKSPGNGILLYGELNRGALNAKPSPIEAGSKVSTKQVIATVVQPKKMRVCLT
FT                   LSEADLVGIKTGDSCVIKPAIDPKAEVKGVIDSVATVPFMGTKFDATVKVVGQLPEAVK
FT                   PTMTASIELTK"
FT   CDS_pept        32765..34051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB87"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZA4"
FT                   /protein_id="CAD71379.1"
FT                   /translation="MNIKQADHPFGTTLSTPIVRSFSACCVWMMAICPLILSGASYAEE
FT                   LTAVEHFDVTRTPVPPEIDAPTESEIRDAIVRGVQFMLDDQNSNGSWGSPTRTKGLNIY
FT                   APVPGAHHAFRAATTSLGIAGLIDTLEHLPADASEQGLRTQVRESVERAETWLFRELPK
FT                   LRRADGSAMYNVWGHGYSIQALVRLHDWHKDDADRQASIVSLIQDQFEMLQRYESVDGG
FT                   WGYYDFRYQADQPTSSSTSFVNGAVLVALKEADSLGVTPPKRMVDRAVAALGRQQKPDF
FT                   SYLYSENLQYQPMREINRPGGSLGRSQCCNVAMRVWGDSKITDDVVKVWLCRLYLRNGW
FT                   LDIGRKRPVPHEAWMQVAGYFYFFGHYYAAVGMDLLPEEERAPYQSMLAKLMLDRQETD
FT                   GSWWDYPLYDYHQPYGTGFVLMTLDACMP"
FT   CDS_pept        34254..35666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoD"
FT                   /locus_tag="RB88"
FT                   /product="probable alkaline phosphatase D [Precursor]"
FT                   /function="regulation of phosphate utilization"
FT                   /EC_number="3.1.3.1"
FT                   /note="PMID: 8760916 best DB hits: BLAST: embl:CAC18240.1;
FT                   (AL451018) conserved hypothetical protein; E=2e-12
FT                   ddbj:BAB10478.1; (AB016888) gene_id:MDH9.6~similar to
FT                   unknown; E=2e-12 embl:CAB92825.1; (AL356892) hypothetical
FT                   protein [Streptomyces; E=6e-05"
FT                   /db_xref="GOA:Q7UZA3"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZA3"
FT                   /protein_id="CAD71380.1"
FT                   /translation="MKRMLSGILFAILLVAFVSYAKPPIPTPRETPVVGDMDHFFLESM
FT                   YGLKENDESLSRVVSSPEFRELIQKHDLKLLGGPMLGCVTDHSARIWVRTTEAASVQVV
FT                   MDGKASEVVTTSPQMDFTALLDLEGLQSATDYTYDVLVDGQSVFRDQKPTFQTYPSKDE
FT                   KSTFSVAFGGGARYNPPKEKIWDVIAGRSPEAILLLGDNVYIDQPKSRTKQRVHYYRRQ
FT                   LRPEFRRLTASTSVYAVYDDHDLGVDDSSGGPGRFKPTWKFESWKVFRENWNNPAYGGG
FT                   DELPGCWFDFSIGDVDFFMLDNRYYRSFEDGTMLGPEQKEWLLAKLKASDATFKVLASG
FT                   TLWTEHADKAGRDSWWGVKEERNEIFDFIETENIGGVILLSADRHRTDVYKIERPNSYD
FT                   LFEFETSKMTNDHTHPTKKEAVFSYNEGNFFGMLKFDLEKTDPEMTFECITMEDQKVYE
FT                   LTLKRSQLQAAE"
FT   CDS_pept        35663..36370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB89"
FT                   /product="hypothetical protein"
FT                   /note="best DB hits: PFAM: PF00975; Thioesterase domain;
FT                   E=0.51 PF00561; alpha/beta hydrolase fold; E=0.084"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZA2"
FT                   /protein_id="CAD71381.1"
FT                   /translation="MTGRNVADELPRLMLLSGLAADERIFVAQKLAFPQLSVPQWLAPF
FT                   KNEPLDDYAKRLASEIGPGPCVIGGASFGGIVAMHLARHLNPEAVILIGSVRSPSELPM
FT                   YARLARPLRCLTLWLPVREMQWAMKPLLCGPLRTAMPFVHGLLSQFLQSDPAVFRWSLH
FT                   QILNWKSAPACSFPIYHIHGARDWVMPAKNTLPDKIVPGAGHVLSLTHPQEVNEFIRFV
FT                   MKRVKLSCNPSSH"
FT   CDS_pept        complement(36400..38457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoD"
FT                   /locus_tag="RB92"
FT                   /product="probable alkaline phosphatase D [Precursor]"
FT                   /function="regulation of phosphate utilization"
FT                   /EC_number="3.1.3.1"
FT                   /note="PMID: 8760916 best DB hits: BLAST: pir:F83157;
FT                   hypothetical protein PA3910 [imported] - Pseudomonas;
FT                   E=6e-05 ddbj:BAA06483.1; (D30808) unknown [Bacillus
FT                   subtilis]; E=1e-04 swissprot:P42251; PPBD_BACSU ALKALINE
FT                   PHOSPHATASE D PRECURSOR; E=1e-04"
FT                   /db_xref="GOA:Q7UZA1"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZA1"
FT                   /protein_id="CAD71382.1"
FT                   /translation="MIQLDTLAFHPAIQLTRLSQYIMPPHRICPIVLCFSCMLLMIAVP
FT                   TASHANDVVGPLVGSIDSTSAQLLYRAGASEQPLQLSVLQEGDVVQRITSIGGEQDDYV
FT                   AKFSVTNLQPDTVYHYQIDDADTQATLIKPDGQHFFRTTNPKREGHRVSVGFVSCVDIE
FT                   PNGIWKEMQTLDLDMVCLMGDTPYIDSTDLAKVRSRHRQFLQMSDLAELSGNTSTVGTW
FT                   DDHDFGRNNGNGRNLSKGKADTRRGFVNYRAHSQYGNATEGVYHKSDLGMMEVFFLDPR
FT                   YFSQTEPSPVDASQPTCFGSEQWTWLLTELRDSKAPFKVLAFGAIWEDKKNKETDDMFT
FT                   YWYERDALLDIIRNENISGVVLLGGDIHVARHLIHPQRTGYDLNDFVISPGHKRTITEL
FT                   DVFHPSLEWSLVEGWQFLTLTADGTTDEPLLTAEFRQPDGIVNRKVELPLTSLTANEEK
FT                   HPNRRAHWSFDENMKNDSTLGHRIDAVAENGARIDNNGLSGGALRLDRSKQQYIRIPRS
FT                   FLDDNSPHHTVSLWFKPTSLPKHGTSERHFLFESTAEGEVSAKTAWHLSLGMRSSESPD
FT                   QINLQLYTHTLQPAKQPEAAPEAKSQGGFDSLVARESLLGRWNQITLTFDSKTLKLSLN
FT                   EQQIAKHTLPVSGPASEFGGLVIGGHREGTGRNFDGWIDEVSVWQGQTGQ"
FT   CDS_pept        complement(38470..39441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB93"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /db_xref="GOA:Q7UZA0"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZA0"
FT                   /protein_id="CAD71383.1"
FT                   /translation="MLNCVDHLPPEALAMFALFRLSALLLFIGLPLFMGQPASVLAQSP
FT                   HSDDAATTSILRQENLVAWCIVPFDAAKRTPAERAQMLLDLGIRRCAYDWRAEHVPTFE
FT                   QEILEYREHGIEFFAFWGGHPEAYRLFEKHDLHPQIWMMPPNIKNGTQERRVQQTVQQM
FT                   VPAARETQRLGCKLSLYNHGGWAGEPENLVSMCRLLREQGFDHVGITYNFHHGHDHIDN
FT                   WKQSFNSMRPFLHCLNMNGMVDNANPKILGIGKGQHEVDMIRVVMESDCQGPIGILDHR
FT                   SELDAKESLNENIEGVRWVRHELQLPGSGGAKPKSPAPLTTP"
FT   CDS_pept        complement(39617..40090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB95"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="GOA:Q7UZ99"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ99"
FT                   /protein_id="CAD71384.1"
FT                   /translation="MPQTGIAHPPAFRSRTRRPGRFTKVFHQPPTEASCMNFLRVFLLF
FT                   STVLIYSMTLIASLSDGINWPSVATNDLIAFNWRSQFDTDFLIYLLLGATWITWREGFT
FT                   AKGHYYAFLSVFLGGMFSFPYLLLATFKADGDPRKVLLGIHFTRSCDEVDCDR"
FT   CDS_pept        complement(40275..40571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB98"
FT                   /product="similar to 50S ribosomal protein L37ae"
FT                   /note="PMID: 9679194 PMID: 2546769 best DB hits: BLAST:
FT                   pir:E75218; lsu ribosomal protein l37ae (rpl37ae) PAB7067
FT                   -; E=0.14 swissprot:O74106; R37A_PYRHO 50S RIBOSOMAL
FT                   PROTEIN L37AE -----; E=0.30"
FT                   /db_xref="GOA:Q7UZ98"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ98"
FT                   /protein_id="CAD71385.1"
FT                   /translation="MVHRMPKSTRSVSLWPRRLLWYSGWLVWLPVSGYGISTGNLLLAF
FT                   AIGPTLFLASLFFSMQKLVCPKCGQKIRTVNTTIFNCMKCGAAFTPSESKRDT"
FT   CDS_pept        complement(40726..41097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB100"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="GOA:Q7UZ97"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ97"
FT                   /protein_id="CAD71386.1"
FT                   /translation="MDEIPSLQLGRCRKNLSVGRRSLSAMATANEHDDRDPLWVSTLHW
FT                   LLIAFGVAAPWFLHFTVAWWAAFLAMLAFMVVYSWLFVPEGSICMGIPFMLPFATSLVL
FT                   LLLQSVLLLRWCVERFSGG"
FT   CDS_pept        complement(41251..44415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB101"
FT                   /product="probable acylaminoacyl-peptidase"
FT                   /function="proteolysis"
FT                   /EC_number="3.4.19.1"
FT                   /note="PMID: 2691504 best DB hits: BLAST: pir:H75007;
FT                   probable acylaminoacyl-peptidase (EC 3.4.19.1) PAB1300;
FT                   E=6e-18 pir:G82543; conserved hypothetical protein XF2551
FT                   [imported] - Xylella; E=1e-16 pir:C71137; hypothetical
FT                   protein PH0863 - Pyrococcus horikoshii; E=7e-16 COG:
FT                   PAB1300; COG1506 Dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidases; E=5e-19 VNG2302G;
FT                   COG1506 Dipeptidyl; E=2e-08 APE1832; COG1506 Dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidases; E=3e-08 PFAM:
FT                   PF01748; Domain of unknown function DUF3; E=0.37 PF00326;
FT                   Prolyl oligopeptidase family; E=0.042"
FT                   /db_xref="GOA:Q7UZ96"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ96"
FT                   /protein_id="CAD71387.1"
FT                   /translation="MLSVFDLGRRIGPQASLFAVVFLAVCSSLHSQDITRRVLEHSDYD
FT                   HWNTLTGTGISNNGNWIIYTVQSGEIDGEGTLHIQHAETAREYIVERGTGARFTHDSRF
FT                   VIYRVPPEKKKIKKLREQKTAADEMPQTSLQILELDSGEFLTLQGVRSFGIPEENSDWV
FT                   ACLMEKSTDDNEMKKTESDDREVYEVTPGGLQRPTKKLKLKSREEINRQRGRIESLVQS
FT                   KNSKEAQKSQPTKEKADEDDNQDHEPKEKSTGTALKLIHLDTEVLRTFPFVRSFQFSKR
FT                   GERLAFVTSVEALEPNKSSPSQEGKGTSDKQQDDKERGPVDGVHTIELDSLRLRTIISG
FT                   IGEYKNLTFSEDGSQLAFIGNRDDYDSESPSWALYQWKANSKKANRLVSEGDPGLPTGW
FT                   WLSPQSNQSFSEDGRRLYFETAPVPDEVQKQRLAKAEGRELEDESNDHAKLDIWHWQDP
FT                   QLQPQQLLEAERERKRRYRAAFILKTNRVVQLEDSEIPSLRIDLRSPSNIAVGNTNVPY
FT                   RKTLSWEVPGFQDVYLVNLNSGHRERVLEKVRWNAAISPQGKHIVWFDAENGKWFAKAT
FT                   KGKNTETIEISKGIKHPLYDELDDRPTLPSAYGTAGWLDNDQAFLVYDSHDIWQLDPTG
FT                   KTKPICVTLGEGRKNDVRFRYLRLDSERRFIDRSETMILSAFRRDTKASGFYALDPPSN
FT                   KDDAEENILRPLIMLDENLSGLNKAEDSDQVVFIRSTFRRFPDLWTSTIGFEKIQRVSD
FT                   ANPQQEEVSWGTAELTHWKAQDGQELDGILMKPDGFDPSKQYPMIVYFYERKSDSLHSH
FT                   YPPAAGRSIICFSFYVSRGYLVFIPDIPYKTGKPGQSAANSILPGVDHLVAQGFVDEDR
FT                   IGMQGHSWGGYQTVYLVTQTDRFACAEAGAPVSNMTSAYGGIRWSSGMSRMFQYERTQS
FT                   RIGEDLWSAREKYIANSPLFFADKINTPLLILHNDEDGAVPWYQGIELFVALRRLEKPA
FT                   WMLNYNGDPHWVMGDHNRRDFTIRMQQFFDHYLQDAPEPEWMAVGVPGVDKGKRFGLEL
FT                   LEPIED"
FT   misc_feature    41855^41856
FT                   /note="cosmid pircos-a3a12/ cosmid pircos-a1d04 joining
FT                   point"
FT   CDS_pept        complement(44265..44834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB104"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="GOA:Q7UZ95"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ95"
FT                   /protein_id="CAD71388.1"
FT                   /translation="MPNRNSRRTSSKQWRATISYKVRRHSYGPSVQPSDPKLDKRFKLR
FT                   ERHFDSTHAFKQPFKKPFDLSRSVKRCTVPTMSSFETATVGTFTAVPDGLAVKLTQNSE
FT                   LVRRSDTPTTTNRSFHLPKPRLSLNARFTLLPGTLLCFLFLILDVALAPRHHCSPSSSL
FT                   LFAAVFIRKTSHGECWNIATTTIGTH"
FT   CDS_pept        44735..45886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB105"
FT                   /product="probable cysteine proteinase"
FT                   /function="proteolysis"
FT                   /EC_number="3.4.22.-"
FT                   /note="PMID: 9389475 PMID: 7548211 best DB hits: BLAST:
FT                   gb:AAB89309.1; (AE000969) cysteine proteinase, putative;
FT                   E=8e-04 gb:AAG54838.1; AE005229_1 (AE005229) putative RTX
FT                   family exoprotein; E=0.19 gb:AAD56325.1; AC009326_12
FT                   (AC009326) unknown protein [Arabidopsis; E=0.84"
FT                   /db_xref="GOA:Q7UZ94"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ94"
FT                   /protein_id="CAD71389.1"
FT                   /translation="MVERMDHMNAAGPCTRWLLAIVWMMCAANCGLAQHRVFVTSDRLT
FT                   LGTERLRSASVRIGDIDRDGDLDVVVANGRHWPQQNELVINQGRAKFSIIRWLGEDQRT
FT                   SYACEFADFDGDGDLDIASGNDMAKGQVFLNDGSGQFRLHGEYGDVSSLRSLLAHDIDQ
FT                   DGDIDLIATCRGRPNRIYVNDGEANFNSGPSFGRNTDSTIDVAAGDLNGDGHMDLVLAN
FT                   RDHQPNEILLGDAELQFSRSVPFGIGDEQSRAVAVADLNTDGHLDWVVANIGRANQVFF
FT                   GDGAGGVAGSAEFGASDSQTYALVIADMNNDEVLDIVVGNLNQPGSVFFRREHEMNFDE
FT                   VPFGEASASYGLDVGDLDGDGYVDIVVANSDDMNRIFLNRPSQ"
FT   CDS_pept        45883..47262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB107"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID: 8921874 best DB hits: BLAST: pir:A58519;
FT                   hypothetical 345 protein - Streptomyces coelicolor; E=0.14
FT                   pir:H69064; serinethreonine protein kinase related protein
FT                   -; E=0.20 gb:AAG31169.1; (AF314961) unknown [Salmonella
FT                   typhimurium]; E=0.64 PFAM: PF01011; PQQ enzyme repeat;
FT                   E=0.2"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR025666"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ93"
FT                   /protein_id="CAD71390.1"
FT                   /translation="MMNRLQWTSPARFVTVFWIAFIPAMDASAQSTTDWPSFRGPGNRG
FT                   VAAGASILTEWNAHPEAEQTDGVAWATDVPGLGHSSPVVSGDRVFLLTAVPDDGETELN
FT                   IAAGGNIDAAKDSGAYSWIVLCYDKTTGKELWQHTAHHGEPKATRHSKATHANSSVCVS
FT                   GDRVVACFGSEGLYCYDLDGNQIWERDLGVVDVSKYGIGWGYASSPAIHGDRVAVICDD
FT                   PDHPFVTVLQLSDGEEIWRSDRTEVCERSWGSPLIHEADGVTQMVINGWPWIVSYDFGT
FT                   GEELWRLEGGGDNPIPTPFVSNGWIYITNAHGGKAPIYVIEPDARGTLSLDSEEESSAI
FT                   VWSVERGGSYMSTPVVAGDYLYLGNSNGVVRCFHAETGEKAFQERLGKEAGVIASLVTA
FT                   DGNVYCASENGTVYVLKSGPELDVVAENPMGEPCFATPAISGDKLFIRTTKRLVAIGTT
FT                   E"
FT   CDS_pept        complement(47345..49093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB110"
FT                   /product="iduronate-2-sulfatase"
FT                   /function="sulfatase; C-compound, carbohydrate catabolism"
FT                   /EC_number="3.1.6.13"
FT                   /note="PMID: 8244397 PMID: 8325651 best DB hits: BLAST:
FT                   gb:AAA16877.1; (L13329) iduronate-2-sulfatase [Homo
FT                   sapiens]; E=3e-58 gb:AAB33747.1; iduronate-2-sulfatase, IDS
FT                   {EC 3.1.6.13} [human,; E=1e-57 gb:AAA37880.1; (L07921)
FT                   iduronate sulfatase [Mus musculus]; E=1e-54 COG: PA0031;
FT                   COG3119 Arylsulfatase A and related enzymes; E=2e-36
FT                   BS_yqgS; COG1368 Phosphoglycerol transferase and related
FT                   proteins,; E=1e-06 PAB0793; COG2194 Predicted
FT                   membrane-associated, metal-dependent; E=1e-06 PFAM:
FT                   PF00884; Sulfatase; E=1.7e-28"
FT                   /db_xref="GOA:Q7UZ92"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR032506"
FT                   /db_xref="InterPro:IPR035874"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ92"
FT                   /protein_id="CAD71391.1"
FT                   /translation="MKRLHVSAILSFMIAASFPIECWSEQRPNVLFIAVDDLRPSIGCY
FT                   GDPQAITPNIDRLASRSVQFNRAYCQVAVCNPSRASLMTGLRPDNLAVWTLPIHFREAM
FT                   PEAVTIPQWFRRYGYTAVSHGKIYHNPTPDPQSWSEPIRDLPRLPAFYPDGTREQMKKF
FT                   DNELPDRDWRKNNLRGPSTAAPELADDQLLDGARTNMAIEDLRRLGKSDAPFFLAMGYI
FT                   RPHLAWVAPKKYWDMHDPSKLPVRTGEQIPKNSPPYAMHNNSEMTHYVDRMNLPKPWDD
FT                   DTVPTEDARHLMHAYYACVSYIDAQIGRLLSALKEEGLADNTIVVLWSDHGWKLGEHRG
FT                   WGKMTNYEIDAHVPLLITGPGVKCLGQQTDQLAELLDLFPTLCEMAGIDVPDFVDGSSL
FT                   VPILNDVDAKVHDGAVNQYYRRHEGRQYMGYSIRTSDYRLVEWRDFFSGEVAAKELYDH
FT                   RNDDSENESIVDSTEPKVIDELTSLLLETHPRKSLVMTPTVHSKPQSDGASGTISFENH
FT                   TEGLVKVHPITSAGRRGRSRRLQAGDKRTIRAKIGSVFVVESHDGTIHQIHSLSGPTET
FT                   VSIQPE"
FT   CDS_pept        complement(49329..50216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB112"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="GOA:Q7UZ91"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ91"
FT                   /protein_id="CAD71392.1"
FT                   /translation="MNDPSIERDQVDGVLLSWFFVWSIFLSISLVGFAGLGDPESMSDE
FT                   SQFLFACTFGGLAATWTAMGTWTALIHVETEADARQQVQRWRMLTGCFLLLNAIAMVFA
FT                   LQSMPSFAAQLFLLASISCLGPFLIWQWFRRPIHRGPTPPTGQRNIRQILGIAVTIAAG
FT                   NVLFKIASVWLSLFGATVTMVLGIAASWTLLALTLLGRQWAWIYGLLPLFLALPFVVLF
FT                   IMDVEENNADERALIVTGNFAGFYLFSLVYLLLLRSSEHRWFRITSDVKAPAADPSHAL
FT                   TQSTSMNTERVLSQ"
FT   CDS_pept        complement(50213..51139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB115"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /note="best DB hits: PFAM: PF00114; Pilin (bacterial
FT                   filament); E=0.038"
FT                   /db_xref="GOA:Q7UZ90"
FT                   /db_xref="InterPro:IPR011453"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ90"
FT                   /protein_id="CAD71393.1"
FT                   /translation="MNNRHRPIKLTIAGRQSRDRRRNRAFSNGFTLVELLVVIAIIGVL
FT                   VGLSAPALQSIREKSRRAACQSNLIPIGLAIQSYHDRWMHFPVGTVLAPDDGITGPIAS
FT                   TAEGNHHNWLGRLMDLLDQPVVANRIDRSVSVYDEANQPVMQLRLPVFRCPSSERDPDN
FT                   ASNYVGLHHPTEKAIDESDHGVFILNVAITRDDVTDGLANTAFVSEKLLPLDDLGWLSG
FT                   TRATLRNVGGGIETSLDRFAKPVASAVGSVGSRHPTGAHFLFGSGEVRFHASETDPRIL
FT                   EQIVDRRDGQLPMHFQSIETLREQSLK"
FT   CDS_pept        complement(51136..51525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB117"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ89"
FT                   /protein_id="CAD71394.1"
FT                   /translation="MIPAPSFDPCRPCRRRRAPRRGLAALVLVLALALLVGTFAIVIGK
FT                   TAANSRKHERDQQMIVLLESAIHTAQTLGDELASGLRLPVDDKANVWIDVKLIDSNDQS
FT                   KQIEATLVRNDRSGMSIRRQLRGNS"
FT   CDS_pept        complement(51522..52031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB118"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="GOA:Q7UZ88"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ88"
FT                   /protein_id="CAD71395.1"
FT                   /translation="MENGARRMIRRNGYTLIEMLITLSIVIAMLGGTLGLVRLVRTSSK
FT                   HASDAAIHRQEIRRLANDLRRDVASAGTIEVIESSLILKSADDSQITYELAPSAWISRD
FT                   AESADAQPIASDRYLIDERSQVNFRLQPISDEDPETEPSLVELTITLPDRPDQPIQILA
FT                   APRMLN"
FT   CDS_pept        complement(52007..52390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB120"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ87"
FT                   /protein_id="CAD71396.1"
FT                   /translation="MRAAPSYRSRHKTRQGFTLLETMAGFAFLAVATGFAVQMHHSGRS
FT                   FARHSMDRLERQLAVENVGQQFLLVPYEDIERVAAQRGPESDVQIQIDSFETDSQSGLH
FT                   LVIQSTIDSQTLQHHVWRMEPAE"
FT   CDS_pept        complement(52395..53687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB123"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /function="protein secretion systems"
FT                   /note="PMID: 1738317"
FT                   /db_xref="GOA:Q7UZ86"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ86"
FT                   /protein_id="CAD71397.1"
FT                   /translation="MVLEMGHSLPFILGSIACGLFAATLRTIKWNLITQPVPRFRPFTI
FT                   RVFAFLEWVLWSTSIIALASSAPHPITFVLLAMMIGSLFVARRWTYREEAESLNRWMRL
FT                   AAGTRASVPVLAESLANGSSSRIAFQGKTFSARLMRGESLVKAVRRSKLPITADTLAAI
FT                   QHPQATTTPPNSFDDETLRSHVRQQQSIDGGTPVSAPIVAEQLIYLIATLFLAWGLGYL
FT                   MRDFLFKRFEKIADEFFNLKSNIHDLLQTIMSIYEGVMILVFIWFVMAILIRWQPAWLI
FT                   RWIPWFGKDSIARWRCEILRSLSIGMRSEHAESELLRLASQSSRNHWIRKRCRKASQLI
FT                   ENGTTFPVALRSSQIITAKEQSWLTSAANNHHLPSAIDQMVDNISRRRSLTWKVRMSWL
FT                   IPLGIVAVGIYVIAHIVTVFLFLTKLTTSIS"
FT   CDS_pept        complement(53678..54571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB125"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="GOA:Q7UZ85"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ85"
FT                   /protein_id="CAD71398.1"
FT                   /translation="MDSDDCDHHRFVADGDITAPECYWGVRLMTSPTISDQAEAEMWSV
FT                   IRDDARSSLSRATTVSFIYLIAALAVGAFLLSAVAELSEDAVYYVGWEEKEVLITWMRS
FT                   LIWVYAGIAVAASVIWILVQLSLRGSLPVVIATIVSKIPGLGRAIQTIALANFCQSIYR
FT                   SVVNSKTYGDAFRAASDETRFTPLRLWIDRSAARLDSGQSWENALLRPPIKDHPLAAVI
FT                   AIGQSQLSREETIHMWHRAASDSHWLLQTRSQRTVRHLFRVGLIGSLFTAGLAILATNT
FT                   NIVLMIEGLTFTGWWF"
FT   CDS_pept        complement(54487..55539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB127"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="GOA:Q7UZ84"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ84"
FT                   /protein_id="CAD71399.1"
FT                   /translation="MTSNPTPTPASSTKSFQLNDESLAMLLEEVSAMAASGRSLVSGLA
FT                   GLNDVALGRLGRAAEFVRARVKHGQSPSVAMASLSLPYQTPIRIAMQIMAETGSTAAIH
FT                   ETARLIRQREDQRRQVWLAAINPILNMLVAAVVAFFVLPWILISIAESQHIASPFAPSV
FT                   EQIAQTFVQHYLFAALIVIVILACFAAWMNWGIRRSIRHAQPSRHLATFCRWLAIQIEI
FT                   PNANIDTARAIDSAAEVAVSDTPALWRTVATNVRAGATSEQLLDFPPDTPAPVKECVVD
FT                   LVTGKRDADLIAHDLRKLSELHDERANRQQSWWLQNVPHWIAWIVMIAIIIVLLRTAIS
FT                   PLLNAIGEFV"
FT   CDS_pept        complement(55536..56747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspE"
FT                   /locus_tag="RB128"
FT                   /product="general secretion pathway protein E"
FT                   /function="type II protein secretion system"
FT                   /note="PMID: 1588814 best DB hits: BLAST: pir:C75333;
FT                   general secretion pathway protein E - Deinococcus; E=1e-44
FT                   swissprot:P37093; GSPE_VIBCH GENERAL SECRETION PATHWAY
FT                   PROTEIN E; E=6e-44 pir:C83313; probable type II secretion
FT                   protein PA2677 [imported] -; E=3e-43 COG: DR1964; COG2804
FT                   Predicted ATPases involved in pili biogenesis, PilB;
FT                   E=1e-45 PFAM: PF00437; Bacterial type II secretion s;
FT                   E=5.5e-12 PF00448; SRP54-type protein, GTPase do; E=0.15
FT                   PF00437; Bacterial type II secretion s; E=5.5e-52"
FT                   /db_xref="GOA:Q7UZ83"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ83"
FT                   /protein_id="CAD71400.1"
FT                   /translation="MPRIFAGELSSVISPASRLSPADPNFAIEVIQSCLTSAIQCGASD
FT                   VHIQPRMESWEISFRIDGVLQPVESFPRSDESDPVARLMALAGLPSYRMGVPQEGPLRW
FT                   RSGDAERNGSDLEREMRLGVFPTVHGNRAAIRIMEERESVRQLHELGLGACTLDRLQTI
FT                   CDARDGWLLVAGPAGSGKTTTLYACLSHIAGGEFRRSVLSIEDPIESVIDSISQSQLQS
FT                   GSGLTLASAMRAAVRQDAEVLLVSEIRDVETAEAVLAASMTGHLCFSSIHAGTVGGTLR
FT                   RLVQMNLPTFAIQSGLRGVMCQRLLRRRCDACDAGPKASRDCSCCHGTGYAGRVPVSQI
FT                   VDLNHSQCGPAIFDALAKQLPALELDRILEAAGIESLRHQAERLIEERVTDQEEVFRVL
FT                   GRTS"
FT   CDS_pept        complement(56777..56890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB129"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ82"
FT                   /protein_id="CAD71401.1"
FT                   /translation="MIASCHPRTDRKWDRLPACCLVRNFLRSTHTSLGGIR"
FT   CDS_pept        56878..58119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB130"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /db_xref="InterPro:IPR011453"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ81"
FT                   /protein_id="CAD71402.1"
FT                   /translation="MKRSQRRNGFTLLELLVVTGVIGILIGLLLPAVQAAREAARRMSC
FT                   SNNLGQIALGVTQYHDAFGHLPPHGTGTFNNANDPLTTNQFRLSYLVSITPFVGKVPLW
FT                   EAISEGYVGQPPEGDHSDVDYDFLPYDEVDYGVMGGGDVQHRYEPMGPSPSIAAYTPWE
FT                   NEVGMYRCPSDPGLGSPSLGRTNYAACLGDAIEGLDEGLWIHDGTAWSASGKLQMEATG
FT                   RGMFVPRKITSYSDVKDGLSATILLGEICTDLGDNDIRTFPSLNNGWGGGVLDDVAICR
FT                   TQIDSTRPMFWEAGKVQLPTNPGHGRGARWADASSLMTGFNTTLRPNAEICFGGNATTI
FT                   GTLTMSSRHQGGGHIAMADGSIKFITDSIDAGWGAGTVILNGEGERAPGSPSPFGLWGA
FT                   LGTRDQSEMFDYEY"
FT   CDS_pept        complement(58394..58615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB132"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ80"
FT                   /protein_id="CAD71403.1"
FT                   /translation="MNAGTPLRFGPAYEGNPASQPVAQWSSTETYANSRWRPPCYGRVK
FT                   PLFSVVCVLAFRELPELHFVSVRPTKAT"
FT   CDS_pept        complement(58617..59468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB133"
FT                   /product="predicted metalloprotease"
FT                   /function="proteolysis"
FT                   /note="PMID: 10984043 best DB hits: BLAST: pir:G83056;
FT                   conserved hypothetical protein PA4717 [imported] -; E=1e-59
FT                   pir:B65023; hypothetical protein b2475 - Escherichia coli
FT                   (strain; E=4e-59 gb:AAK04057.1; (AE006233) unknown
FT                   [Pasteurella multocida]; E=8e-57 COG: PA4717; COG2321
FT                   Predicted metalloprotease; E=1e-60"
FT                   /db_xref="GOA:Q7UZ79"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ79"
FT                   /protein_id="CAD71404.1"
FT                   /translation="MRWRGRRQSDNVEDRRTSGGGAVVGGGIGVIVIAIIIGLLGGNPQ
FT                   QFLQQAAQQPAPGGAGGEVELTPQEIEAGEFVSTVFADTEDVWTDLFAQAGRDYKKPTL
FT                   VLFKDQVNSGCGMASSGTGPFYCPADEKVYLDTSFFGQLARQLGAPGDFAQAYVVAHEV
FT                   GHHVQNLLGYTDQLDQIRQRVPEVEYNKYSVRLELQADFFAGVMLHHAEKKYRIIEDGD
FT                   IEEAMTAARAIGDDTLQKRSRGYVQPETFNHGTSEQRLRWFTKGLKTGDLNQGDTFQAD
FT                   QL"
FT   CDS_pept        complement(59440..59604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB135"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ78"
FT                   /protein_id="CAD71405.1"
FT                   /translation="MAHFPAVAVPFPMLFSPEQLCDNSRASPIGPTPFSFQKRIKQQVR
FT                   HALAWTTTK"
FT   CDS_pept        59847..60875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB136"
FT                   /product="conserved hypothetical protein-putative
FT                   aminomethyltransferase"
FT                   /note="PMID: 10493123 best DB hits: BLAST: pir:H75528;
FT                   conserved hypothetical protein - Deinococcus radiodurans;
FT                   E=4e-06 pir:S76507; hypothetical protein - Synechocystis
FT                   sp. (strain PCC; E=7e-06 pir:D81837; hypothetical protein
FT                   NMA1464 [imported] - Neisseria; E=1e-05 COG: DR0358;
FT                   COG0354 Predicted aminomethyltransferase related to GcvT;
FT                   E=4e-07"
FT                   /db_xref="GOA:Q7UZ77"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ77"
FT                   /protein_id="CAD71406.1"
FT                   /translation="MPSSLSLIRLPALSIVDLVGADATAILHNLTTNDVKKLTADGPQH
FT                   AGLETFITNVRGKCLGHVVVFATQDGYRMIGAPGIVATADNSGTVRQSQAIAEHADRYT
FT                   IREDATPVIRDEELAAWMVIDGDAEPVQTTPLPNMTNQDGVDSYQLPWVKSGTLFLLPI
FT                   DTAAEHPSRIADRLGVNAESLAMGDENDFHVHRVAAGFPWFGIDLTDAHLPQEADRETQ
FT                   TISFTKGCYLGQETVARLDALGQVQKKLVRWKLSGLPAGAEPAADDKLRALDAPEDAKP
FT                   VGRITSVGRIDDQGEGLAMGYARRSHFEAGEKLAGMISAGDVGDVAYTAEVLPPVLGDS
FT                   PE"
FT   CDS_pept        60872..61516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB138"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q7UZ76"
FT                   /db_xref="InterPro:IPR011517"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ76"
FT                   /protein_id="CAD71407.1"
FT                   /translation="MNDLTLEEFADLLELVRQGDDDATAVLWERYFQPLVRLAGTRLPK
FT                   NLRRSGDEEDIALSAFHSFIAGVRREKFPDLSGPDNLWGLLITLTSRKVNAHLRRQTRQ
FT                   KRGGGQVRGESVFLDASGDSGRAGLEQFAGRGESDNTPPDLRLELAEACERLLDDLPDE
FT                   QLREIAVMRMDGFLVDEIATKLGVSKRAVERRLQLIRKTWTEAAESVPDQT"
FT   CDS_pept        61578..64541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB140"
FT                   /product="serine/threonine protein kinase"
FT                   /function="unspecified kinase or ATP dependent regulatory
FT                   protein; unspecified signal transduction; cellular
FT                   communication/signal transduction"
FT                   /EC_number="2.7.1.-"
FT                   /note="best DB hits: BLAST: swissprot:P71584; PKNB_MYCTU
FT                   PUTATIVE SERINETHREONINE-PROTEIN; E=2e-31 pir:T36717;
FT                   probable serinethreonine protein kinase - Streptomyces;
FT                   E=5e-31 swissprot:P54744; PKNB_MYCLE PUTATIVE
FT                   SERINETHREONINE-PROTEIN; E=9e-31 COG: Rv0014c_1; COG0515
FT                   Serine/threonine protein kinases; E=3e-32 PFAM: PF00069;
FT                   Protein kinase domain; E=6.9e-49 PF00515; TPR Domain;
FT                   E=0.72"
FT                   /db_xref="GOA:Q7UZ75"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ75"
FT                   /protein_id="CAD71408.1"
FT                   /translation="MNLSDLPARELARLDAVCLEYESSLRQVADGEPAPSDLTSIQSLV
FT                   ERHGGEHADLLRSELEAIRAEIDGDLGIHGDSGELTQVLAASNDTPSREAAALDTPAVD
FT                   AMKMDDSLRSTPSAEARVKKALAKVASDGSSDSLPPLGTEIGPYRLDGVLGRGGMGVVY
FT                   RATDTRLERSVAVKMLSIDGHPNLVERFQREAKAVASLTHPNIVELFDVGVHEGMPYAV
FT                   MEHLRGETLMRRMESRRTDVAPITTQMVRYWGRQLAEALATSHASGVIHRDLKPENVML
FT                   VGRRSGSPTPSPANSNTISGHSIAMQSSNETSLPSVKLFDFGLSRVGRAVFGPGESDPE
FT                   SQHEDAGNDEANEAKTRAGMILGTPGYMAPEQARGETVTPAADVFSLGCVLFEAFYGRP
FT                   AFTGKSPASRYAAVLEKTPLPDPGRRRDDIALADLIMAMMRKVPAERPTAATVVAALSS
FT                   GGAILPANDGETLATPMDGASMTQPIRIAGGVSRRRFVEMIGGSFAGALVGMSGLSGNW
FT                   AKLNRIRSIGVLSFTPATQVETKNEVDPQPARGRMLQRGELLAGLVANELSRLEGLSVP
FT                   KYVPMTASFPDQYRDAASRLEVDALVTGTFTEATGAQPGFMDVNIQIICAESGTQIWGK
FT                   VIRTSGGDNLIEQNHLARQVASAINRSLLENPHESRPRDPGAFTCLLKGRTQADPDSID
FT                   GMRSALKCFDSALSEDPNYAPAHAGKGLTSLTLAGRVADEEAQELIIQAQRSIESALEL
FT                   DTTNVEARLASAMLMYQRLGDLKPARDILLALSKEANNSWQVFHQLGWVQLMLYEEMAG
FT                   VVSLRRAASLHSTSKLLQSDLARAQWFVANKRRAIDEATGVMPKTDGNQVGPESFTRGL
FT                   LIDLYEHSSDLKLAADLDPGLNWSESDGADRYWELREARLETLPYGPYGPTLNETILQL
FT                   RRTDVVTREPAEQRLARLLQTRSPMLPLLLIKHPQFDSIRTLPAAGEAFPVLRPGVV"
FT   CDS_pept        complement(64669..66924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB142"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /note="best DB hits: PFAM: PF00364; Biotin-requiring
FT                   enzyme; E=0.031 PF00529; HlyD family secretion protein;
FT                   E=0.78"
FT                   /db_xref="GOA:Q7UZ74"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ74"
FT                   /protein_id="CAD71409.1"
FT                   /translation="MDCFSSPVEFAASLVGRVTMQRDPGTIDWQQQPIRIAADVKVWPV
FT                   RETGEPIYRIEIPATHQFFRVGLSEYTFLSALDGHRTIAQACGLVTAKMGRAAPSSSQC
FT                   ESIARWLIDHRLAHFADAPPPRRERSHHGTPADNSPPKSIWTRWNPFWIKMPVPGASGL
FT                   LQHISRGLGFLFSTPILIVGTLLITAALVALASRQSEFIAGASSIFDPSNWVWLLFTAI
FT                   GLKLIHEVGHAIACHRAGGSVREAGLVWVLMTPLAYVDVSSCWRLPSRWSRIGVAAAGM
FT                   FIEGIVASIAIAGWILNEDDMIRWWCHHVILTAGLSTILFNANVLMRFDGYFMLSDLMD
FT                   VPNLATEANQSVRQFLRRWFLGDASWHSTHTGWRRSAVFVYGWSAVAWRVLVCVSLAIA
FT                   ASTMLGGAGIVLSVLGLWMWWGKPLVQFLQSMRNLWQTEPFQVCRGVVLGAIAISVFGW
FT                   MLFSMPIPSSVRVPVVVQYDPDSAIRVGAEGFLVALNVNGGDQVEAGDLIATIENRELK
FT                   QRVAELEIAQKQNDIRLRKAIESREESERLILLDNRQAIIDKLATLQTQSDQLNVVANR
FT                   TGVVIANDLRSKLNTYVHEGDVLMIVAADTDKEVLAVINQSQVDDVRKQIGQPVRLVAP
FT                   GRQTFWATLDQLQPRASDRVPNASLAATHGGPLVVRVDDASDDSSNDDRLGEEMIDNMR
FT                   LLQPHFRGVLKLPHKEAQRLPAGLRLEAHFGWHQASIAKRARLWFQDALARASQENR"
FT   CDS_pept        complement(66870..68273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB144"
FT                   /product="probable membrane-fusion protein"
FT                   /note="best DB hits: BLAST: pir:T31342; ragD protein -
FT                   Bradyrhizobium japonicum ----- embl:; E=1e-05 pir:B83186;
FT                   probable RND efflux membrane fusion protein precursor;
FT                   E=2e-04 gb:AAK03081.1; (AE006139) unknown [Pasteurella
FT                   multocida]; E=0.001 COG: PA3677; COG0845 Membrane-fusion
FT                   protein; E=2e-05 PA2836; COG1566 Multidrug resistance
FT                   efflux pump; E=0.001 VC0165; COG0845 Membrane-fusion
FT                   protein; E=0.002 PFAM: PF00364; Biotin-requiring enzyme;
FT                   E=0.021"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ73"
FT                   /protein_id="CAD71410.1"
FT                   /translation="MFTASSLSPDATGRDSHHELLQRAETLAAAIELQSALDACQEFDE
FT                   AASIATRSLSEWLQAEGAILCWRNRPASGLKCISDHAHGGGTFATDHPRETLAAAEEAC
FT                   LRDGLSKVAATEVASSPGTMAMRQWLKTIGSNNLLACPLADSSGNSLGVLLIVAPRERS
FT                   ASATLDAFAPLLSCKLQSIHRLQPTGVEASLVRGIRSFRATWQRATVCVLSTIILLMFL
FT                   PAHHNIRTDVQLQPVQRRFIAVPFDGPLQECMVRPGDTVTEGQLLAKINPRELEYELAG
FT                   LRALHGQADQERRGSMASHDFGKSQIAALEADRLKTQTELLNHRKDNLEIRSPIDGVIV
FT                   SGDWKQSEGAPLTRGETLFEIAPVGSMKVEIAIPEENFAHVQPGMLTRVHTHAMPDRVM
FT                   HGAITRVHPAATIRDSENVFLAEVTVDDQDGLLRPGMKGRATIYGNKRPIGWIVFHRPW
FT                   NLLLRWLGV"
FT   CDS_pept        complement(68277..69164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB146"
FT                   /product="probable cation efflux system"
FT                   /function="detoxification by export; drug transporters; ion
FT                   transporters"
FT                   /note="PMID: 8203018 best DB hits: BLAST: pir:C70415;
FT                   cation efflux system (czcB-like) - Aquifex aeolicus;
FT                   E=2e-10 pir:B82357; conserved hypothetical protein VC0165
FT                   [imported] -; E=3e-10 ddbj:BAA34299.1; (AB015853) MexX
FT                   [Pseudomonas aeruginosa]; E=5e-08 COG: aq_1331; COG0845
FT                   Membrane-fusion protein; E=2e-11 emrA; COG1566 Multidrug
FT                   resistance efflux pump; E=0.003 PA3402; COG0845
FT                   Membrane-fusion protein; E=0.003 PFAM: PF00364;
FT                   Biotin-requiring enzyme; E=0.0052 PF00529; HlyD family
FT                   secretion protein; E=6.1e-07"
FT                   /db_xref="GOA:Q7UZ72"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ72"
FT                   /protein_id="CAD71411.1"
FT                   /translation="MMNRHWITKLCVIVSLQCLCLPGIASADEYEAFTEPYRRIQVSSS
FT                   EMGVITELKAREGAEVREGQVLAQLDDALLRKTLDVSRAAKDAIGGKTAAEAEVVIREQ
FT                   QVQSYRRLFTQGNATPRELERAENDHRQALARLQSVTEELSVRALEYQRVICQLEQRRI
FT                   LAPSDGVVVALAKEVGEFVSPTDPILLQLVQLDRLKAVFSVPLRRIDSLSEGQSVVVRV
FT                   GGSRATVFGTLEYISPVATAESGTVRVRVVLPNEKRTIRSGVVCWLDLEASARTNQSKA
FT                   RISDAPVILSPALR"
FT   CDS_pept        complement(69161..71212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="RB148"
FT                   /product="preprotein translocase SecA subunit"
FT                   /function="protein targeting, sorting and translocation;
FT                   protein secretion systems"
FT                   /note="PMID: 2542029 best DB hits: BLAST: pir:F82760;
FT                   preprotein translocase SecA subunit XF0806 [imported] -;
FT                   E=3e-73 ddbj:BAB07325.1; (AP001519) preprotein translocase
FT                   subunit; E=1e-72 swissprot:P28366; SECA_BACSU PREPROTEIN
FT                   TRANSLOCASE SECA SUBUNIT; E=7e-69 COG: XF0806; COG0653
FT                   Preprotein translocase subunit SecA (ATPase, RNA; E=3e-74
FT                   PFAM: PF01043; SecA protein, amino terminal reg; E=1e-16
FT                   PF00271; Helicase conserved C-terminal do; E=0.12"
FT                   /db_xref="GOA:Q7UZ71"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ71"
FT                   /protein_id="CAD71412.1"
FT                   /translation="MELTMSLLQSNSGWRSHFASATRFASLTQLGRFTDRPAVDIETVL
FT                   QSACDQISNRSANSKQDLQDRWQTLRYKLLEATSDQTRDSSNQLDAIWRECLADALILA
FT                   ADAIRATHDIELFEVQLRAGLIVSSGWISRRGGVAEMQTGEGKTYALFVSSLIAALPGR
FT                   GVHIATPNAYLAQRDHEQLRETWSLLGVKSSCLPEDSSADAAHAAYRADVTYGPGHAFG
FT                   FDYLRDQLAMDTAARQRPGSTLLRRLNSESSTPRLQRGLAVALVDEIDHVLIDDALSPL
FT                   LLSGTLPGEADDAAVHRHALKTATSLHGEEDFLATGQQIELTDTGLNRAYEAVEDWSDA
FT                   SLRRPWHEYVELALQATHLLRRDIDYVIEDESVRIVDQSTGRIYEDRTWSGGLQQAIEA
FT                   KEELPIQRESESLAKITRQRFYRSYDYLAGVTGTAGDCREELKSVYGLNVQTVQPRLPS
FT                   KRIVHPTHVTLTAKQKFAAIANEARRIADSGRCVLVGTLDIETSHRVAEEVRRQGLSCE
FT                   LLNGLQNAEEAEIIAQAGQPHAITVATNLAGRGTDIRLNPEVAAKGGLHVIVAEHHRSS
FT                   RVDRQLIGRCARCGDPGSSRHFLSAEDNLVSQSAPWVGRAIRRAIAAEQIESLSVESQI
FT                   ASIQTRQAKRAAAARRQLLEADERDCGLVRKAQSNHDPAPHLQALDAG"
FT   CDS_pept        complement(71197..73215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB149"
FT                   /product="probable outer membrane channel protein"
FT                   /function="transport facilitation"
FT                   /note="PMID: 9852029 best DB hits: BLAST: gb:AAD12177.1;
FT                   (AF029405) outer membrane channel protein; E=0.001
FT                   gb:AAD30205.1; (AF094824) IbeB [Escherichia coli]; E=0.039
FT                   swissprot:Q51487; OPRM_PSEAE OUTER MEMBRANE PROTEIN OPRM
FT                   PRECURSOR; E=0.049 COG: PA0427; COG1538 Outer membrane
FT                   protein; E=0.005 PFAM: PF02321; Outer membrane efflux
FT                   protein; E=0.0013"
FT                   /db_xref="GOA:Q7UZ70"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ70"
FT                   /protein_id="CAD71413.1"
FT                   /translation="MKQIVKPTTAIIDGLRSRKLRRTVRTLTSSRRRWVRSIILAGILV
FT                   GPSHLALWAETPGHADGHSPHSVSTTYRSHEAVHLPIPNAISSGPYAHQVDRYRDRVLE
FT                   NELIAEADGNCWFKDSPALSSGSSIAGQISQLDPQVVWWDEDVTQPLGLAEQHTSVDAS
FT                   GLAQTALIASPYVRSLLTEPQISMTDIVIADAQFDPLTFLDANYTDTNDPVGSELTTGD
FT                   QSERFRDNLFASSAGVRKKLTGGGNLEVVQRGGFQNNNSTFLTPNPQGTSRLELNFSQP
FT                   LLRDHGKAVNRTRVILAKIDAQITNSEVREEIQTHLVDVTTAYWELYQARAEWLQRNRL
FT                   LASAQEMQTVLQARGAVDSQQRQILRANVAVAKRRADLVRIETRIRNAQSKLRLLTGDR
FT                   QFAQFAQYEMVPVERPLMQSIELSTRDATLTALDNRPDIVQSLQQMHAVSTRVGAARNQ
FT                   VLPRLDLLLSSYVSGLDSGTNTFGAIGRQFSEGGPTYSAGLIFERPWGNRANQARLRRN
FT                   RWEWTRSYAEFQQTTEAAMTEVEIAVRETQTLFNELIAKQQSTMAAAREVDYLRQRWTH
FT                   LPDPNENAILLIENLLDAQERLADEERSLVRSQVAHALSWVTLRKAMGVLLVCNVADVS
FT                   PVPSNVSVFLPDETEPFGGMIESEELILPTPEEWNSP"
FT   CDS_pept        73100..73390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB150"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ69"
FT                   /protein_id="CAD71414.1"
FT                   /translation="MIDRTHRRLDEVSVRTVRRSLRERKPSMMAVVGFTICFINSIGQV
FT                   GSEGRFLLQSRHGAFGRSTGLSQRISRKEAFSPHDRNRAPNERCKPHRFSS"
FT   CDS_pept        73233..73403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB152"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ68"
FT                   /protein_id="CAD71415.1"
FT                   /translation="MDLKEGSFCNPDTGHLGDRPDSVSESAAKRHSARTTGTERRMSVA
FT                   SRTDSPADKEN"
FT   CDS_pept        73499..81046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB154"
FT                   /product="lipoprotein receptor-related protein"
FT                   /function="intercellular communication"
FT                   /note="PMID: 6091915 best DB hits: BLAST: pir:S75200; fat
FT                   protein - Synechocystis sp. (strain PCC 6803) -----;
FT                   E=7e-24 ddbj:BAA88688.1; (AB011533) MEGF7 [Rattus
FT                   norvegicus]; E=3e-18 ddbj:BAA32468.1; (AB011540) MEGF7
FT                   [Homo sapiens]; E=2e-17 COG: sll0656_1; COG3204
FT                   Uncharacterized BCR; E=5e-14 PFAM: PF00058; Low-density
FT                   lipoprotein receptor; E=6.3e-06 PF00028; Cadherin domain;
FT                   E=0.036 PF00801; PKD domain; E=0.073"
FT                   /db_xref="GOA:Q7UZ67"
FT                   /db_xref="InterPro:IPR000033"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ67"
FT                   /protein_id="CAD71416.1"
FT                   /translation="MPRRRCPLFERRCARYLMSKFANHWWQRCCLRVDHVATLAQQSVR
FT                   ARRPVALGKRLPKIGTLEPMVLFSATPIDPAMMDASAGEGAATATVMEIPLDSEAESQQ
FT                   SNTASSVQNPDQQSASVASEIIIIDALTPDLEALLEDLRLHREGSEVIVLDANRDGVTQ
FT                   ITEILESRTNVRALQIISHSEHASVRLGNLWLGAENLDAYAGDIASWQHALTSDADILF
FT                   YGCDLATDANGRTLVDSIAALTGADVAASDDDTGHARYGADWDLEYATGVIDADIVVSE
FT                   SFQETWGHKLATITVTTWLDESNNNGETSLREAITQANAGAGGDTIVFSASLDTPTVFQ
FT                   LTRQQTEDDANSYGDFDILKDLTIVGHGMNITIIDADDLSRIFDVHGGTLTLSDVTLQG
FT                   GNASGDMGGAIRVEAPSAGLNLQRALLTSNTATEGGAIGNKGTIELTDVAIIGNGGVNG
FT                   YATNTGGGITNRGAATLNRVTLSGNVATAGGAIFVENSATSLSLTNVTVSGNTGANAGG
FT                   GLYTKVNAEIIHSTFTLNTSNIGGGIFVEAGTTTVANTIVSGNTATSSNPDVHGAFTSN
FT                   GGNLIGDVGSASGFGGQDFIGVAANLGALASNGGYVQTHALQAGSAAIDQAIAENAVAI
FT                   DARQFSTLDGLPDVGAFQRQGGVINRLFWIDHDLGTVQSAALDGTNVQTLVSGLSNPEE
FT                   LYVDSVNQHLYFSEAGENRIRRVNFDGTGLVNVLTGLVAPQGMEVDLVGGKIYWVEDGA
FT                   GSHNEVKRADLDGSNVETLATITAFLNLTIPDDIELDLVNGHVYWSDELTLEINRMDLD
FT                   GSNRVTVISSDKGVRGIAIDSVNNKLYYAVGAYSNGEIRRADLDGSNRETLIDSGLDGP
FT                   NGIEVDPASGKIYWADSGLPQISMADLDGSNVTNLGIAGLQQPHGLGLGAQDTNTSPMH
FT                   IGFRPSDVVENTDTSAGVSVGTLSTLDIDEDETFTYTVTGGADAAKFTIGGGNSDELIL
FT                   TDGVLDYENQSSYTVVVNVEDSAGNNTTQTITIRVANQAEIDGLWFTTDNDVSESGVAG
FT                   LTNWGEDQVIQISDPGLTLDGNGGTTSGTASTVGFRLENFISDTNVGISGMHAVWSGLS
FT                   VGSGANSFELLAGDLIFSIDKSGIDFSSETEPDKEFDREDVIVFRASTPGDYSSGDFFF
FT                   LLDDPLDGDDIRGISLVESEGGVTVGDTTLAQGTFLFSHSGGSEHDRVITYHADTVGES
FT                   NTSGTETVLIEGSDGGNLGFTEKIVGLHLVESSTTIGGVAVTAGDLLISVHAGSEANTT
FT                   IGGVTGTNQDVFRLTMTSTRIGGSNSVANVELLFDGSDIGLDQLDDQEINSLTFAVGTS
FT                   PNTPIGAISDADADPDSVDEDAEIGDAVGIQAFATDSDGEAVTYSLISDPDSKFAIDSN
FT                   TGIVTLAATLDYDTATEHSFTVRATSADSSFTEETFTVQVIEANEAPSLTVTSVLGSIA
FT                   ENADLTGGVHVANVTLTDDGIGTNTYSLTGDDANLFELRDSDTKLYLKDGVSLDFDTNS
FT                   VLDVTVSVDDNTVGGTPDDSASFSMTVTDVNTAPVVSLSQSGTSLAESTATGSRIKMAD
FT                   INVTDDGTGTNVLSLSGDDANLFEIVGTELFWKGDAPLDFETQPSLDVTVNVDDSTLGS
FT                   GIDSSTDFTLTVTDVNEAPSVSLANIVTTISEGQDLSSGMKVADIVVDDDDLGLETYSL
FT                   SGDDSALFRIDGTEVWLINNATLDFDTNSVLDVTVSVDDNTVGGTPDDSASFSMTVTDV
FT                   NSAPVVSLSQSGTSLAESTATGSRIKMADINVTDDGTGTNVLSLSGDDANLFEIVGTEL
FT                   FWKGDAPLDFETQPSLDVTVNVDDSTLGSGIDSSTDFTLTVTDVNEAPSVSLANIVTTI
FT                   SEGQDLSSGMKVADIVVDDDNLGLETYSLSGDDSALFRIDGTEVWLINNATLDFDTNSV
FT                   LDVTVSVDDNTVGGTPDDSASFSMTVTDVNSAPVVSLSQSGTSLAESTATGSRIKMADI
FT                   NVTDDVTGTNVLSLSGDDANLFEIVGTELFWKGDAPLDFETQPSLDVTVNVDDSTLGSG
FT                   IDSSTDFTLTVTDVNEAPSFSIVDPITLVAEDEDLSGGLKVADLDVTDDALGAETFSLS
FT                   GDDAALFEVIGTELWLRAGITLDAITNSNLDVTIDLDDASLGGGSEDTKSLQIQVTTTN
FT                   TPPTLSDWQDNSLAGQTVTVPASVFDGLSNDVDGQILTAHLSAGPLVGNLNMQADGSFV
FT                   FTPPPGFIGSISFEWTAFDGRQHSAAATVTLTFLPVPVVPTSPAPTPPEDTSGSNSDAT
FT                   DGDSKDSNSDSDSGDNSEDSSNDSDSESANEGDSAEVLVGMPNAATTNPDGNAQQSGQS
FT                   GGAEEASTELERMNASVNEARLAQEAAERELQIERNQLGLTQAGGRVQRLDLDFDFGSD
FT                   GVAMTSIDYALMTQPGEMWDQLDSYQQRVNSQINGDLIVVGTAGAAASSVTVGVVAWAL
FT                   RSGLLLSGLIAHMPAWSAVDPLLIMQGFSGNGDGETLEELMDRHDKAMTDE"
FT   misc_feature    77126^77127
FT                   /note="cosmid pircos-a1d04/ cosmid pircos-b1h08 joining
FT                   point"
FT   CDS_pept        81043..84024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB159"
FT                   /product="sensory transduction histidine kinase"
FT                   /function="two-component signal transduction"
FT                   /note="PMID: 11406410 best DB hits: BLAST: pir:S75136;
FT                   sensory transduction histidine kinase slr2104 -; E=2e-69
FT                   pir:S75130; sensory transduction histidine kinase slr2098
FT                   -; E=4e-63 pir:E83443; probable sensorresponse regulator
FT                   hybrid PA1611; E=8e-62 COG: VC1349_2; COG0642 Sensory
FT                   transduction histidine kinases; E=2e-53 PFAM: PF00989; PAS
FT                   domain; E=5.9e-05 PF00512; His Kinase A (phosphoacceptor);
FT                   E=4.2e-24 PF02518; Histidine kinase-, DNA gyrase B;
FT                   E=4.1e-43"
FT                   /db_xref="GOA:Q7UZ66"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ66"
FT                   /protein_id="CAD71417.1"
FT                   /translation="MISLYQRIPIRIRISLGLVGLMAGSLLVASAAGFFPNEQEEILHG
FT                   RARLCETLAISGTAMASHGQVDSLRVTMESVVHRDPQILSIGLVSSEGQLLVSAGEHTE
FT                   FWDDSLEDDVNQMKVPVFRYGKQWGEMQFAFASTGGLFGLNYWAPAWLLIVLIPACLIQ
FT                   FSFFLKKTLESLDPSGAVPTHVENALDTITVGLVLLNSKGRILFTNRRLNQLLSQESAD
FT                   LMGKKIDDLEWQMIADTGAVLPWEEAKQNDDSVMDRILQFDNNGRMLTFSVNCTPIAGQ
FT                   GYLVTFEDITLIEENKVALAKARDAAENANAAKSDFLANMSHEIRTPLNAVLGFTDVLR
FT                   RGLVSNGDEAVDHLNMIHRSGAHLLELINDILDLSKIESGHLQTETIDTSLDDIVTDVA
FT                   NTLKVKADEQNLALKVDFRTAIPRTIQSDPTRLRQVITNLVGNAIKFTESGSVSIVTSL
FT                   LKTPSNALEGYDPIIRVDIIDTGIGMTPDQQAKIFDSFVQADSSTTRKFGGTGLGLSIS
FT                   RRLAEAMGGSLTVHSEVGIGSTFRVELPTSIASLQDMVSPEELARLAQEKSAGSVSSEL
FT                   LRLPGKRVLVVDDGEANRRLIELVLKRAGATVMSAENGQEALDMIAEGNESGYPYELVL
FT                   MDMQMPVLDGYSATRLLREREDTTPVIALTGNAMRGDREKCMDAGCDDFLTKPVNLDEL
FT                   LEMVSQYLGEVDPGTLLNTKTMANETSSAASLSSAGILPSMQTPVSAASASLSSSGSPA
FT                   AASSGLPSSAIVPTLPMDDEDFRAIAGDFVSRLHTRLDGIEQAIQESKFDFVHGEAHWL
FT                   KGAGGTVGLDVFTEPARTLEQAAKDGSPDIAQSILNDIRELHGRVAIPGMDLSKESNQS
FT                   DSLSPAIASVDPATIINPIHCALPLDDPDFHAIVSDFIVRLDQRLVDMRNELRDQRFDA
FT                   LELSAHWLKGAGGTVGYGDLTQPSRDLIDAALAANPADCETYLSQIESVRARMILPEPL
FT                   PQSV"
FT   CDS_pept        complement(84027..84284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB160"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ65"
FT                   /protein_id="CAD71418.1"
FT                   /translation="MEVLEAFIKCGPKGAVSKRAVSRTFQKHASRYDAQRGPAPIDGDC
FT                   FLPPERPERLCRSHRSRKPRQQKPLFDDSRIAFLDSTFTR"
FT   CDS_pept        84262..85518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB161"
FT                   /product="response regulator"
FT                   /function="two-component signal transduction"
FT                   /note="PMID: 7699720 best DB hits: BLAST: pir:G82211;
FT                   response regulator VC1348 [imported] - Vibrio cholerae;
FT                   E=4e-59 embl:CAB89843.1; (AJ251547) response regulator
FT                   [Xanthomonas; E=2e-56 pir:S75132; sensory transduction
FT                   system regulatory protein slr2100 -; E=1e-55 COG: VC1348_2;
FT                   COG2206 HD-GYP domain; E=1e-42 PFAM: PF00072; Response
FT                   regulator receiver doma; E=1.1e-29 PF01966; HD domain;
FT                   E=0.003"
FT                   /db_xref="GOA:Q7UZ64"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ64"
FT                   /protein_id="CAD71419.1"
FT                   /translation="MNASNTSTDTAVFSAPVVPGSHGVLPQGNSAKPVAALPGKIMIVD
FT                   DEIANVLVVKKYLERAGYRDFETTTDSTSAFRILETSMPDVLLLDINMPNVDGIQVLER
FT                   VRQDPRFKHLPVLILTANTDERIKLVCLELGATDFLLKPVDPMDLTPRVRNSLQSKSFQ
FT                   DRLQHHAAELELKVEQRTRELEASRREVIYCLARAAEMRDNDTGNHVIRVGRFAGIIAA
FT                   GMGLPDWFVRDIEMAAQLHDVGKIAIPDAILLKPGKLEPEEFDVIQNHVKFGHQIIQPH
FT                   TSTDARRMRTHVELGADMLSNGSALMRLAASIAQTHHEKFDGSGYPLGLAGSDIPLEGR
FT                   ITAVADVFDALSAERPYKKAMPREKCFSILEEGRGSHFDPDVLDAFFDCTKEIVRVQLD
FT                   YMDHCEPTPAPAAPSESNE"
FT   CDS_pept        complement(85677..86603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB162"
FT                   /product="SAM dependent methyltransferase"
FT                   /note="best DB hits: BLAST: pir:F81675; conserved
FT                   hypothetical protein TC0684 [imported] -; E=7e-30
FT                   pir:D72066; sam dependent methyltransferase -
FT                   Chlamydophila; E=1e-27 pir:G71519; probable sam dependent
FT                   methyltransferase - Chlamydia; E=3e-27 COG: CPn0531;
FT                   COG1092 Predicted SAM-dependent methyltransferases;
FT                   E=1e-28"
FT                   /db_xref="GOA:Q7UZ63"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ63"
FT                   /protein_id="CAD71420.1"
FT                   /translation="MNFPDPSRSTESDASHKPGGRTDDQYELVDFGGGRKLELVAGRLI
FT                   DRPSPAADGLAAKQRARWKVVASRFDEKEKRWNHRAEWKPGRCVECGGFRMPVAPTPYG
FT                   HIGVFPEQQANWDWLRTHSLPEASADNRPKALNLFAYTGASTMAMVSAGFAVAHVDAAK
FT                   QNVQSARAAAEANGWNDPPIRFLVDDAVKFTAREVRRENRYHTIVMDPPAYGHGPSGKA
FT                   WRLARDVWPLIDDSLKLLEPDAFRLLITGHSPDVDQDDVQAYLVDRIPQTVQPAGTLRF
FT                   DTGRLRLPDQFGRKLDAGFFVRVWNEG"
FT   tRNA            86868..86941
FT                   /product="Val tRNA"
FT                   /note="Val, tRNAscan-SE-score 78.76%"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        87060..87560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB164"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ62"
FT                   /protein_id="CAD71421.1"
FT                   /translation="MELNRMPRQKAKLPKYLYHVSGQARVYLDGRYFYLGTYDSPKSHA
FT                   RYFALCKLYQDNGCKMPEDYETHPDEDAAITVRCVTADYLRYAAQKYASSKKRYDRHKR
FT                   LCDFVDEEYGDLPAADFGPRRLSLLRELLVASKNLRGRHNTRAYINDQVRWPGFWGPRV
FT                   LFF"
FT   CDS_pept        complement(87557..88726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB165"
FT                   /product="transposase"
FT                   /function="retrotransposons, viral and plasmid proteins;
FT                   recombination and DNA repair"
FT                   /note="best DB hits: BLAST: gb:AAB58155.1; (U82621)
FT                   hypothetical protein [Shigella flexneri]; E=2e-33
FT                   gb:AAF09022.1; (AF139596) unknown [Shigella flexneri];
FT                   E=2e-33 gb:AAG55688.1; AE005307_6 (AE005307) unknown in
FT                   IS600 [Escherichia; E=2e-33 COG: tra5_g4; COG2801 Putative
FT                   transposase; E=2e-27 PFAM: PF01527; Transposase; E=4.8e-13
FT                   PF00665; Integrase core domain; E=3e-39"
FT                   /db_xref="GOA:Q7UZ61"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ61"
FT                   /protein_id="CAD71422.1"
FT                   /translation="MPRKTKPSANPERRTYTDEFKRDAVAMLLDGHSATSIVERLGISG
FT                   TNLLYRWKKQQVESAGPVGEVLDSRVAELEAELRRVERETRCFKKSFDHFRPKRVSQLY
FT                   SAAASIIRDGTASQRAVGEILGFSRSAFQRFQSEPSSRREQSDMDVLPMVITTFHRHRR
FT                   RYGARRIAADLKLQGVAIGRERVAKLLRIAGLSALQPKSFKPRTTESRHTLGYNENLLL
FT                   KQPEPTSVNRLWVGDITYIPIVRTGFAYMATLMDRFSRRIIGWSLEMDMTESLVIKTLQ
FT                   KAIRSRQPSRNLIHHTDRGGQYASKKYRAIIQRSSMRQSMSRAGDCYDNAFMESCFGTI
FT                   KTELQMTEYESYREALSELTEFIAYYNTSRLHSSLGYLSPTRFESTVPC"
FT   CDS_pept        88683..88847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB166"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ60"
FT                   /protein_id="CAD71423.1"
FT                   /translation="MRRSGLAEGLVFRGIWGSLSSFQFKDSRGPQNPGHLTVTISYGAV
FT                   TSSPIRTYT"
FT   CDS_pept        88901..89317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB168"
FT                   /product="transposase"
FT                   /function="retrotransposons, viral and plasmid proteins;
FT                   recombination and DNA repair"
FT                   /note="PMID: 8041625 best DB hits: BLAST: gb:AAB07489.2;
FT                   (U66426) transposase [Acidithiobacillus; E=1e-21
FT                   gb:AAF60967.1; AF188737_2 (AF188737) transposase
FT                   [Escherichia; E=1e-20 pir:A47041; probable transposase -
FT                   Alcaligenes eutrophus insertion; E=1e-09 PFAM: PF01610;
FT                   Transposase; E=3.9e-09"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ59"
FT                   /protein_id="CAD71424.1"
FT                   /translation="MHDTEVFQQILGLRSPWTVADVKLDLEAGQLDVHVEHADGEKFCC
FT                   PECDRQLACYDHVSERRWRHLDTMQYRTILHAKPPRVKCPEHGVKQVNLPWAEKNSRFT
FT                   VFFERFAIDVLLATQTVWNCPRKVDSGPAHVRLL"
FT   CDS_pept        89333..89623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB170"
FT                   /product="probable transposase"
FT                   /function="retrotransposons, viral and plasmid proteins;
FT                   recombination and DNA repair"
FT                   /note="PMID: 2824781 best DB hits: BLAST: gb:AAG58100.1;
FT                   AE005527_3 (AE005527) unknown protein encoded by; E=0.002
FT                   gb:AAG53987.1; AF327445_1 (AF327445) putative transposase
FT                   A; E=0.003 gb:AAF28119.1; AF153317_15 (AF153317) InsA
FT                   [Shigella; E=0.007 COG: PA1937; COG2963 Transposase;
FT                   E=0.004 PFAM: PF01381; Helix-turn-helix; E=0.53 PF01527;
FT                   Transposase; E=6.1e-18"
FT                   /db_xref="GOA:Q7TTA5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA5"
FT                   /protein_id="CAD71425.1"
FT                   /translation="MDKRRTFSREYKLAAVKKVIEQGLSYTAVAKDLGIGDSLIRKWKK
FT                   SFDEDGTFQAEVVGSQSIEAELRRLREENRQLKMERDILKKATAFFAKESH"
FT   CDS_pept        89626..90504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB171"
FT                   /product="putative transposase"
FT                   /function="retrotransposons, viral and plasmid proteins;
FT                   recombination and DNA repair"
FT                   /note="best DB hits: BLAST: gb:AAA88919.1; (U13013) ORFB
FT                   [Leptospira interrogans]; E=3e-47 gb:AAA88916.1; (U13012)
FT                   ORFB [Leptospira interrogans]; E=1e-46 gb:AAC05649.1;
FT                   (AF038931) probable transposase-related protein; E=1e-45
FT                   COG: DRB0019.2; COG2801 Putative transposase; E=1e-35 PFAM:
FT                   PF00665; Integrase core domain; E=4.8e-40"
FT                   /db_xref="GOA:Q7TT98"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TT98"
FT                   /protein_id="CAD71426.1"
FT                   /translation="MKFIGECRDRWPIAVLCRTLEVTRAAYYRFAGRGPTATEIKQTQI
FT                   IQAVKEIRLEKHHDAYGSPRMQRAIVKRGVVCCRNTVAKCMRHAGIQANRRTKFRISTT
FT                   DSNHDQPIASNLLGQNFTTEAINRVWLTDITYIPTQEGSTYLCAFVDLHSRKIVSWKTS
FT                   RNMDSELVVGAFDQALTFRKPNAGLIVHSDRGSQFASDHFRRRLAASGLVQSMSRRGNC
FT                   YDNAPMESFFKSYKTEEAQQIYDTHEHATRGVSDYIERFYNPHRLHSSLGYLSPIDFEQ
FT                   AIKEPSLVSES"
FT   CDS_pept        90494..91441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB172"
FT                   /product="probable transposase"
FT                   /function="retrotransposons, viral and plasmid proteins;
FT                   recombination and DNA repair"
FT                   /note="PMID: 10601203 best DB hits: BLAST: gb:AAF60967.1;
FT                   AF188737_2 (AF188737) transposase [Escherichia; E=6e-41
FT                   gb:AAB07489.2; (U66426) transposase [Acidithiobacillus;
FT                   E=1e-30 pir:A47041; probable transposase - Alcaligenes
FT                   eutrophus insertion; E=4e-26 PFAM: PF01610; Transposase;
FT                   E=4.2e-28"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ58"
FT                   /protein_id="CAD71427.1"
FT                   /translation="MSPDSQDSPFTFPLRPVHCQLFVGNSSQGAAGILRTSWDETWHIV
FT                   KKAFARGKARKTDTVVQRIGIDEKAFRKGQNYITLIYDLDRSTVEAISDGNDTEAGNAC
FT                   FSQLSQSQRDGVEAIAMDMSAAYVKAAKASIPLAETKIVHDRFHVMKLATEAVDKVRRG
FT                   EHRKLDAEGDKRLSRTRYLWLSSQENLSEHQRERFDAVYTQQLETGKAWAYKEMLRDLW
FT                   HHDDSASATVYFRDWYKRVIHTKLTPLKKVAKTIAERLANVVSYCTHRITNAVAEGMNS
FT                   KIMSIKRRVGGYRNRENFKTAVYFYCGGLNLYPH"
FT   CDS_pept        91448..91585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB174"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ57"
FT                   /protein_id="CAD71428.1"
FT                   /translation="MDLQFLDALQFENDGALHQQIDPIATIQRHVFVANRLRLLELKQN
FT                   "
FT   CDS_pept        91582..91956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB175"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ56"
FT                   /protein_id="CAD71429.1"
FT                   /translation="MNSYGAHGQGIAHRQTPATQAPIRDALQSRIRSLGETVYRIPFSP
FT                   PLNPPPSMLEPPTWMNRLSNYRSKSSNHEGLEEHERAARTDRSLRSQPRFQFECDRPQT
FT                   RSLSHFAIKIPNKPIRPQQT"
FT   CDS_pept        complement(92068..92493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB177"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /note="PMID: 12024217"
FT                   /db_xref="GOA:Q7UZ55"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ55"
FT                   /protein_id="CAD71430.1"
FT                   /translation="MAMDHDNQDAEQLRLLSIFHYIVAGMLALFSMFPVIHLAIGVGIV
FT                   TGAFDGTGTGETPPAFMGWLFIVLPLVFIAVGLTMASCIALAGRKLMQRNGHLYCLVVA
FT                   GIECCFFPFGTVLGVLTILVLTRPMVRQAFGVADSGI"
FT   CDS_pept        complement(92655..93002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB180"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="GOA:Q7UZ54"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ54"
FT                   /protein_id="CAD71431.1"
FT                   /translation="MSNPYQTPSEEVRKEASDAPVWHWFAASLFFLSAAVISSPGVVFG
FT                   VAGAFRPNSGGRQYATYDPEVFLFGITIMPATAQWLAFAVAPALVVISIGLIWRGILVR
FT                   RRYRATTSSDQ"
FT   CDS_pept        complement(93120..93563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB182"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="GOA:Q7UZ53"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ53"
FT                   /protein_id="CAD71432.1"
FT                   /translation="MVTARHRWRTDCPIESLQSELPVSKLTFKSYGLGMVNPYAAPEVD
FT                   VDVEAETTERPTTAFLIGFRNGTLWSLIVLVLVVPAFYIEFAIPFTQRETSDLSADGMS
FT                   WATTAWLWFAACGTGLTFITLPWAITAGFVKWASERRGSDTTR"
FT   CDS_pept        complement(93532..95316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB183"
FT                   /product="conserved hypothetical protein-putative outer
FT                   membrane protein"
FT                   /function="cellular communication/signal transduction"
FT                   /note="PMID: 12093901 best DB hits: BLAST: gb:AAD51069.1;
FT                   AF175716_1 (AF175716) immunoreactive 52kD antigen; E=0.045
FT                   pir:S75812; hypothetical protein slr1270 - Synechocystis
FT                   sp. (strain; E=0.17 PFAM: PF02321; Outer membrane efflux
FT                   protein; E=0.18"
FT                   /db_xref="GOA:Q7UZ52"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ52"
FT                   /protein_id="CAD71433.1"
FT                   /translation="MSRSLLYTLIALSSTVPAIGCVAQMNQASVQSPPSSSAVTARSAA
FT                   LDLHAETAREKSSVDESKIRPVAHRDPVAHRDVVQPIADQASAAESVLTLDGKRDRLQP
FT                   LEEKAVASNSDHSLAAYESAPVLEVQESGLEGLPPEPVVVDSMDHSSDLAMVPPHTVQM
FT                   NLPTALAMIDSQHPAVGLAQWRTREAYAALDQANVLWLPSIQAGFSFHRHDGNYQSSNG
FT                   DIVDVNRNSFQYGLGAGATGAGTTNTRPGLVAQFHMADAIFQPKIAEKAAWARGHAASS
FT                   VLNQQLLQAATAYTELLEAYQDARVLEESRERVRELAGITSDFAAAGQGMLADADRMQT
FT                   ELRLIDSRLVGGQERVAVASARLAQAISMHSGETLLPMDVTVVPLELMAAGADKASLIS
FT                   TGLASRPELKESQSLVAAACEAYKREKYAPFVPSVLLGYSTGGFGGGLGNDLNDVDGRY
FT                   DFDAVVTWELRNFGLGERAARNRTSARVQQARYEKLRVMDQVAAEISESASQIEFRRQQ
FT                   VDLTQQAIATAERSYESNLERIKDGEGLPIEVLQAVQALESARRAYLQAVTAYNQAQFR
FT                   LQWALGWPVGDGQASMAY"
FT   CDS_pept        94207..94812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB185"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ51"
FT                   /protein_id="CAD71434.1"
FT                   /translation="MHADGLSEPCRRDRDPFLSSHQSAVDQSEFRLHAIRIGKHALSGG
FT                   REIGCDPCQFSHSFTRLFQHASVLVSLQQFRVSGRGLQQLLIQNTRGSVPTSPGSFLCD
FT                   LWLEDCIGHVELSDQPRACVGGSGTGGTGSQSVLERVSIDINDVSVAGLVVAIVAMEAE
FT                   SGLDGWQPQNVGLIQRRISFTRSPLGQSDRGVLRVNHR"
FT   CDS_pept        complement(95367..95474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB187"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ50"
FT                   /protein_id="CAD71435.1"
FT                   /translation="MRSRLDLTNPRHSIVTIWMIICRSALVETDAFGTS"
FT   CDS_pept        95487..96941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB188"
FT                   /product="probable membrane-fusion protein"
FT                   /note="best DB hits: BLAST: pir:T31342; ragD protein -
FT                   Bradyrhizobium japonicum ----- embl:; E=2e-20 pir:A83330;
FT                   probable RND efflux membrane fusion protein precursor;
FT                   E=2e-12 pir:D83099; probable RND efflux membrane fusion
FT                   protein precursor; E=2e-12 COG: PA2528; COG0845
FT                   Membrane-fusion protein; E=2e-13 PFAM: PF00364;
FT                   Biotin-requiring enzyme; E=0.18 PF00529; HlyD family
FT                   secretion protein; E=0.05"
FT                   /db_xref="GOA:Q7UZ49"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ49"
FT                   /protein_id="CAD71436.1"
FT                   /translation="MRELDYIDRLANRARSDRFFRFLQLFQRSQGRQSSSLNMLFAIPP
FT                   RLFPPLATVAALCLLAGCSDANRVAKKTQPQQATPVKTVSVTPTEVTRTSVQPATVHAY
FT                   YRAELRSQASGYVESFTADIGEYVESGTVLAKISVPERQQQRRVMEAKIRRSESQEKQA
FT                   ESQVELAQASKKSAEAKLAQAKSEVDAVEASVAAANAEFNRTEDLVSRGSLQNRMLDEA
FT                   RMKRDSESARKQAVQSAVASAQADVEVASARVESARADLETARAETDVVRRELDELDAW
FT                   IDYAEIKAPFSGIITERNIEPGDLVRAANEVGLGKPLFVISQIDRVRVQIPVPENHAPL
FT                   VSPGDEVSLTFPSFASEPSITAQVTRRSGSLDAQTRTMMVEVEMDNPDGKLIPGMFGQA
FT                   TIQLATQDAANMLPAQAIRFDESGNAFVYVVAGDDTISIREISTGMDDGNFIEVLTGVE
FT                   PGQSVVDAHLSRFIDGQKVAVVGAAH"
FT   CDS_pept        96941..100087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB191"
FT                   /product="cation efflux system, AcrB/AcrD/AcrF family"
FT                   /function="ion transporters; detoxificaton"
FT                   /note="PMID: 8407802 best DB hits: BLAST: pir:S76433;
FT                   cation efflux system protein czcA-2 - Synechocystis sp.;
FT                   E=2e-86 ddbj:BAB07535.1; (AP001520) cation efflux system
FT                   [Bacillus; E=1e-82 pir:F82263; probable multidrug
FT                   resistance protein VC0914 [imported] -; E=1e-76 COG:
FT                   sll0142; COG0841 Cation/multidrug efflux pump; E=1e-87
FT                   PFAM: PF00873; AcrB/AcrD/AcrF family; E=4.7e-88"
FT                   /db_xref="GOA:Q7UZ48"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ48"
FT                   /protein_id="CAD71437.1"
FT                   /translation="MSLIQFSLRNRFAVLAASIALCVLGATVIPGITIDILPDFKKPVV
FT                   VSFFSYPGLPTLDMEKSVTSRVERALTLAGKIEHQESRTVPGAAVIKVFFQPGADPSSA
FT                   MNDIVNLEASDMFHLPPGIEWPFTLRSEPSNLPVVLAAISGEGLSESELYSIGYYAVRN
FT                   KMGGLKGVQIPHPFGGKFRQMMVYVDPVKLQAYHISATDVVDALKKSNLVLAGGTATMG
FT                   GTDYQIHPRNTLPDIEEIAAIPIAVRDDRPIFIRDVATVKDDAALQYNIVRVNGNRSVY
FT                   CPLLREPGENTIAVVDRIYDGIADEIPKMKERGDIPEATDVTLVSDQSIYIRKAMSNLL
FT                   SQIGLGSVLVALVVMIFLRRLLPTVIIVSTILLAILIGALGFAFSGQTINVMTLGGIAL
FT                   AIGTVVDAGIVVVENVIRHGRMGKSPMEAAREGTQEVSGAILAGTITTLAVFLPAIFLT
FT                   GMIKYLFAPLSLAATLTIGASYILALTVVPAMCATFVRERVQAKASGKQASDEQPTSTK
FT                   PSGLYGRVLSTAMHAPALSAIVIIIGVGASFLLLPKIGTELFPNVDSGSFEIRLKTVPG
FT                   TALPKTEELVAKIEDTIKEVIPSESIDTIISNIGLPVGKGAGFSTVLSSNSGPDTAYLI
FT                   VNLKQENRRVGTQEYIDTLREQLNAKFPLEQFMFVSGGIVNMALNEGVPTPISVQISAG
FT                   TLQQCRDAAERIVREISPIEGTRDVQIAQSLDYPQFDVQVDRTRAKYLGLDQEKVAQTV
FT                   LTALGSSVGYSPTIWIDPKSGVDFFMGVQYASNQFQSLDELRNMPLSLDTPDGPITIPL
FT                   SNIATVNRVTIPGEIAHYNISRVNDIHVNVAGRDLGSVAADIDAVIADMEFENGVSVAL
FT                   RGPIEKMRGGMNMLGTGLAVATLLVYLVLMAQFRSFLDPLIIMLSVPLGIGGVLISLYL
FT                   TDTYLNIQSMMGTLMMIGVVVNNSILLVEFANQRLAAGVSPHEAALSAAQVRLRPILMT
FT                   SLTLVASMLPLSFQLAPGNEAMIPLARALLGGMVVSTLLTLILVPCVYMLLHRKQTVPV
FT                   "
FT   CDS_pept        complement(100084..100254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB192"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ47"
FT                   /protein_id="CAD71438.1"
FT                   /translation="MKSSFDRKFSSVTNVRNAYHRHDSVVSVVFCCAVEWRISLQFVVS
FT                   AITDWKPIPMV"
FT   CDS_pept        complement(100235..100909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB193"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ46"
FT                   /protein_id="CAD71439.1"
FT                   /translation="MSRSIQFGRIALLGLFALTASVVFSSTASAFGPACCFCQAGRCVV
FT                   EVEKEEVDVTCFDVECETICIPPLRFPWECGPLKKCGKVRTIKKLVTDKKKETVCTYDW
FT                   SAIACCPDCRHRARGIFGCGKGCNDGCCAAGNCDSGCDVGGCDIGCCASNEAAASLPPA
FT                   AFANNAGETIQLDQQESVALASAISRAEPDAEGWVTITNPNKTSLQAEDDLIETSVEVL
FT                   VR"
FT   CDS_pept        complement(101008..102708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprO"
FT                   /locus_tag="RB195"
FT                   /product="probable polyphosphate-selective porin O"
FT                   /function="anion transporters (Cl(-), SO4(2-), PO4(3-),
FT                   etc.); phosphate transport"
FT                   /note="PMID: 3017428 best DB hits: BLAST: pir:D82740;
FT                   polyphosphate-selective porin O XF0975 [imported] -;
FT                   E=2e-09 pir:A82820; porin O precursor XF0321 [imported] -
FT                   Xylella fastidiosa; E=1e-04 swissprot:P05695; PORP_PSEAE
FT                   PORIN P PRECURSOR (OUTER MEMBRANE; E=9e-04"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ45"
FT                   /protein_id="CAD71440.1"
FT                   /translation="MESSSMRRGGSVARQALAALVCLATSGGALANADEWWTPANQVGS
FT                   DSVLVAPESAPTLNSFGGMLSNQYSAAPMSAQDGLLEDTLQSTAADVDQEPSGLQTLAD
FT                   DEQNQDALADDESFEDRLDAFASRLEALDTLEEEWTDYQDGLAADAKAKKKKSTIKIGG
FT                   RVHIDHWSFSNTDAGINRIESGGDPDQSPENITAFRRLRLEISGTVPQNMKYRLQVDFN
FT                   NPQTPEIKDAYLGWTDLPNNQTLLLGNQKRPLGLDHLNSSRYNVFAERPLAVEAFNEDA
FT                   RRFGLAMYGHNDEESFCWTYGIYNLENINTDGRFIGDSAQAGGYSRLWGSPWYDDTSGG
FT                   RGYWHWGLAGAVAKPDGNAGANDTNNNEGRFRTRPLARSSQRWLNTGRIDGADWYQNIG
FT                   FENILNLGSLQITGEYILTPMQVEDPAAGVDDNLFFHGGYIYASYFLTGEHMPYNRSTG
FT                   TLSRVKPHENFFLVDRCNGCRGNGWGAWQLAFRYDHLDLTDGGVNGGVGNLYTAGLNWY
FT                   WTPYSKVQNNLVWGEISESGLAANGDNPLDAPVNAGNFLIFGTRFMIDF"
FT   CDS_pept        102804..102965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB197"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ44"
FT                   /protein_id="CAD71441.1"
FT                   /translation="MADDCRADKSRYFLTFQFAAFRLTGTTDPWRAGTIPTTESPRQTH
FT                   LPIRESVQ"
FT   CDS_pept        complement(102935..104761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB198"
FT                   /product="N-acetylgalactosamine-4-sulfatase precursor"
FT                   /function="sulfatase; sugar, glucoside, polyol and
FT                   carboxylate catabolism"
FT                   /EC_number="3.1.6.12"
FT                   /note="PMID: 2303452 best DB hits: BLAST: gb:AAF49302.1;
FT                   (AE003522) CG5584 gene product [Drosophila; E=3e-35
FT                   gb:AAF49287.1; (AE003522) CG7402 gene product [Drosophila;
FT                   E=2e-34 gb:AAF30402.1; AF109924_1 (AF109924) sulfatase 1
FT                   precursor [Helix; E=1e-33 COG: ydeN; COG3119 Arylsulfatase
FT                   A and related enzymes; E=6e-28 BS_yfnI; COG1368
FT                   Phosphoglycerol transferase and related proteins,; E=3e-07
FT                   VNG0061C; COG3119 Arylsulfatase A and related enzymes;
FT                   E=2e-04 PFAM: PF00884; Sulfatase; E=1.5e-40"
FT                   /db_xref="GOA:Q7UZ43"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ43"
FT                   /protein_id="CAD71442.1"
FT                   /translation="MSRWLFCLAFVFAGSLWEGLPLAHSVRAADRPNVVMVITDDQGYG
FT                   DCGFTGNKVVQTPNIDALAAESSVLTDYHVAPTCSPTRSALMTGHWTNRTGVWHTISGR
FT                   SMLRDNEVTFGEIFSDAGYQTGMFGKWHLGDNYPYRAEDNGFTEVYRHGGGGVGQTPDF
FT                   WDNAYFDGSYFHNGKAVKAEGFCTDVFFKEGNRFIRECVEADEPFFAYIATNAPHGPLH
FT                   APQKYIDMYPEMNDNVATFFGMITNVDDNVGQTRKLLRELGVHDNTIFIFTTDNGTAGG
FT                   ASVYNAGMRGKKGSPYEGGHRVPFVMHYPEGGFAKSRTNNTLCHAVDVVPTLLDMCGVE
FT                   APESVKFDGTSIVSLLKDEVDSSFNDRMLITDSQRVIDPIKWRQSSVMQDKWRLINGKE
FT                   LYNIANDPGQENNIAGDHPEQVASMRAFYEAWWAELEPTFSQTTEMTVGHPDHPVVTFT
FT                   AHDWIGQAPPWNQSAIRAAAAVFPKKAKKQELTHNGHWAINVHEAGKFEVALRRWPEES
FT                   GVAIAAAVPAGEDVPGASAAYRTQDGRAIPVQSAEVRVDGKPIASKTVGEGDSVVTMEI
FT                   ELSKGSHQLAPVFKIPTGEVGAYYCTLSRIGK"
FT   CDS_pept        complement(104925..106544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB200"
FT                   /product="mucin-desulfating sulfatase
FT                   (N-acetylglucosamine-6-sulfatase)"
FT                   /function="sulfatase"
FT                   /EC_number="3.1.6.14"
FT                   /note="PMID: 10809675 best DB hits: BLAST: gb:AAF72520.1;
FT                   AF248951_1 (AF248951) mucin-desulfating sulfatase; E=1e-83
FT                   gb:AAG58881.1; AE005599_13 (AE005599) putative sulfatase;
FT                   E=3e-31 swissprot:P31447; YIDJ_ECOLI PUTATIVE SULFATASE
FT                   YIDJ -----; E=5e-31 COG: yidJ; COG3119 Arylsulfatase A and
FT                   related enzymes; E=5e-32 yejM; COG3083 Predicted hydrolase
FT                   of alkaline phosphatase; E=5e-05 HI1246; COG1368
FT                   Phosphoglycerol transferase and related proteins,; E=3e-04
FT                   PFAM: PF00884; Sulfatase; E=1.8e-37"
FT                   /db_xref="GOA:Q7UZ42"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR032506"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ42"
FT                   /protein_id="CAD71443.1"
FT                   /translation="MSRTLIGSRALIWMIAIAMAPWVVADDRPNILFIMSDDHTSQAVG
FT                   AYGSRLAYLDPTPNLDRLAKEGMLFENAFCTNSICTPSRACIMTGQYNHTNGVFDLNGR
FT                   IEPKNQHLAKEMKKAGYQTAMIGKWHLKAEPAAFDYYCVLPGQGKYFDPEFRIQGDKPW
FT                   PKNTIKKEGMHSTDAITDITLNWFDEVREDGKPFFLMHHYKAPHDFFEYAPRYEEYLAE
FT                   IAIPEPKNLWSQPQFGSLATRGANDEMMPYIGTSIGRRNPRRNYASHYGVDSWLSDEDA
FT                   KREAYNIYMKHYLRCVKGVDDNLARLFAKLEETGQMDNTVIIYTGDQGFMLGEHDYMDK
FT                   RWMYDESQRMPFLVRYPKSVPAGSRSNAIVENVDYGPTMLAFAGVETPEYMQGKSFREI
FT                   CETGQEPEGWKQEAYYRYWMHMAHHDNPGHLGIRTKTHKLIYYYGVNYEGKQQTPPGWE
FT                   LYDLVNDPTEVVNQIDNPEYAEVAKKLKQRLADLRERVGDDGSHYPAVEDVVQEFWDYS
FT                   DEDRQKAIEISHEYAKAKQSQK"
FT   CDS_pept        complement(106781..107647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB201"
FT                   /product="sugar phosphate isomerase/epimerase"
FT                   /function="C-compound and carbohydrate utilization"
FT                   /EC_number="5.3.1.-"
FT                   /note="best DB hits: BLAST: swissprot:Q9WYP7; Y416_THEMA
FT                   HYPOTHETICAL PROTEIN TM0416 -----; E=4e-26
FT                   swissprot:O50580; DT3E_PSECI D-TAGATOSE 3-EPIMERASE -----;
FT                   E=6e-13 swissprot:P73599; YD04_SYNY3 HYPOTHETICAL 32.8 KDA
FT                   PROTEIN SLL1304; E=2e-12 COG: TM0416; COG1082 Predicted
FT                   endonucleases; E=4e-27"
FT                   /db_xref="GOA:Q7UZ41"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ41"
FT                   /protein_id="CAD71444.1"
FT                   /translation="MPHPIHPHQSPPQRINMTFKSAITVSLVEEARGGPFVYWDGLKDA
FT                   CEKSAALGFDAIEIFAPGPNAVDEAELKGLLQEHGLVVAAVGTGAGMVKHGLSLTHAEA
FT                   DHRAKARDFVKQMIDFGGKYNAPAIIGSMQGKWGGDISRDQALAFLREALDELGPYAAQ
FT                   YNVPLFYEPLNRYETNLLRTVDEGVEFCKTLSTDNIKLLADLFHMNIEEADLAAAIRAG
FT                   KGYVGHIHFVDSNRQAAGMGHMNHEPIIQALKDIGYDGYLCAEAFALPDSDTAARNTIE
FT                   AFKRLTA"
FT   CDS_pept        complement(107732..107884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB202"
FT                   /product="similar to neurogenic locus Notch protein"
FT                   /note="PMID: 3097517 best DB hits: BLAST: pir:A24420; notch
FT                   protein - fruit fly (Drosophila melanogaster); E=0.11
FT                   swissprot:P07207; NOTC_DROME NEUROGENIC LOCUS NOTCH
FT                   PROTEIN; E=0.11 embl:CAB37610.1; (AL035436) EG:140G11.1
FT                   [Drosophila melanogaster]; E=0.11"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TU14"
FT                   /protein_id="CAD71445.1"
FT                   /translation="MKHKGVSPMALTLKIHPPPGRVERSEGRATHRVLGSPSPARSGPT
FT                   LPEGG"
FT   CDS_pept        complement(107922..108965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB203"
FT                   /product="putative oxidoreductase-possibly Aldo/keto
FT                   reductase"
FT                   /function="C-compound and carbohydrate utilization"
FT                   /note="PMID: 2498333 best DB hits: BLAST: pir:T04984;
FT                   hypothetical protein T16L1.160 - Arabidopsis thaliana;
FT                   E=3e-59 gb:AAF54729.1; (AE003694) CG18547 gene product
FT                   [Drosophila; E=3e-44 gb:AAF54731.1; (AE003694) CG3397 gene
FT                   product [Drosophila; E=4e-36 COG: YMR041c; COG0667
FT                   Predicted oxidoreductases (related to aryl-alcohol; E=9e-22
FT                   TM1183; COG1453 Predicted oxidoreductases of the aldo/keto
FT                   reductase; E=1e-14 BS_yccK; COG0667 Predicted
FT                   oxidoreductases (related to aryl-alcohol; E=2e-14 PFAM:
FT                   PF00248; Aldo/keto reductase family; E=1.3e-14"
FT                   /db_xref="GOA:Q7UZ40"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ40"
FT                   /protein_id="CAD71446.1"
FT                   /translation="MRWHRRQREVTLAASCRPGIRHHHLTPRTAKMLPRRRLGQTDMEL
FT                   TTLSFGASSIGQEFRSVDLGESLQAVRVALDSGMNFIDTAAFYGRGMSEMMLGRVLPDI
FT                   PRDQYYLGTKLGRYTGEHFDFSAKRVTESIDTSLERMKVDHLDIVLCHDLEFVEMSQIV
FT                   EETIPAIRREIAKGKVRYVGVSGYPMKMFKYVMANTDIDCLLTYNHYTLQNDMALELVP
FT                   LAKEKGVGLMNGAPFSARLLTNAELPPWHKATPQVREVAAAAAKHCADRGSDIAKIALQ
FT                   FSIANEDFATCIPGSANPNRVAQWVEWAQEPIDETLVAEVKEILKPIHNWFYIEGLPEN
FT                   NDEPVAS"
FT   misc_feature    108884^108885
FT                   /note="cosmid pircos-b1h08/ cosmid pircos-c1d12 joining
FT                   point"
FT   CDS_pept        complement(109144..109251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB206"
FT                   /product="hypothetical protein-signal peptide prediction"
FT                   /db_xref="InterPro:IPR011479"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ39"
FT                   /protein_id="CAD71447.1"
FT                   /translation="MMSRTALAAVSQTPTRADAYRQIVVIRYATKSTGC"
FT   CDS_pept        complement(109385..111136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB207"
FT                   /product="similar to endosomal protein"
FT                   /function="DNA repair (direct repair, base excision repair
FT                   and nucleotide excision repair)"
FT                   /note="PMID: 11930014 best DB hits: BLAST: pir:S44243;
FT                   endosomal protein - human ----- embl: CAA55632.1; E=0.71
FT                   gb:AAA79121.1; (L40157) endosome-associated protein [Homo;
FT                   E=0.73 swissprot:P02566; MYSB_CAEEL MYOSIN HEAVY CHAIN B
FT                   (MHC B) -----; E=0.82 PFAM: PF01882; Protein of unknown
FT                   function DUF58; E=0.11"
FT                   /db_xref="GOA:Q7UZ38"
FT                   /db_xref="InterPro:IPR019934"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ38"
FT                   /protein_id="CAD71448.1"
FT                   /translation="MIRWRFLLTRLIVVATILMLLFWGLGPMASYITVRGLEASTGARA
FT                   DIGATRVGLFPPQIQFDSVHVADPRDDKEFRNAFQADSVNLVIDGDALLRRRWVIRQGS
FT                   IAGLQIGTTRETSGHLEETPDETEASGPSMIGNLLSSATNGLSARAEAMGKDLQTVRTG
FT                   EEIRRRWKSEYERLVQQTKELEKRVETIREAASGIDNPLRDWPELQRTLAESEAAREQL
FT                   ISLRNAMNAMPDQMKSDLARLEKAKQADLDKVDAFVPGDLSESKNFGVDLVSAEIRRSL
FT                   SQLRDYLDSGRTLANYTVVAPDTERVRGEDYDFLGRNRRPELMIRHCDVSGTMRADGKV
FT                   FTLTGVVENMTPTPELLADPTRARLRLEGPETVDVDYVRDRRQGEQLDRLTLHWPQMDA
FT                   DPIHLGRGKDVGVAIAGGVREVWVQLSSRGEHLEGRLVSKQTGVNMRLDVKGDAGASTA
FT                   AIQMNQSLANVDHVEIDAEFNGTWEDLDLKLNTNLGQVFNDAAKTAIASQMEASKAKVA
FT                   AKVDEAHREQMLELNEWMLAQQNQAQSLLAKADKSVEDLSRKILSEINGADQYLGKLKT
FT                   AFGSSLR"
FT   CDS_pept        complement(111133..112158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB210"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="GOA:Q7UZ37"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="InterPro:IPR019935"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ37"
FT                   /protein_id="CAD71449.1"
FT                   /translation="MPMMTRIPVVTSIDQPRGPSFMILFSIKLLSSLRKAIAGRKYPSQ
FT                   LAWGLALGLLIGLIPHGNLLAVALVFGVLMLRVNHAMVALTAIGVTMVAPRLDPISDQF
FT                   AQWFFSQQGVSEVMAQAWDFPLVPWTDLNNTVVMGSFLIGLISLVPAFAISYPMFKAVS
FT                   GNWNEDDDLEDDVVVTPARKRRSQNTEQHFVDAPHSKVSEPHFAPDTAQESDSSTVDAI
FT                   AFDSEASSGRVFDFRRVDGAEPVLAKISPYRDERADSKRASAAIDAPASDVSSKQNTTH
FT                   IEVLDADSDLHSMSNEKAVALGSGNSNRPALTTNDDQHKIDEALSYLLRQLRDSQDKDA
FT                   A"
FT   CDS_pept        112302..115646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB213"
FT                   /product="hypothetical protein-signal peptide prediction"
FT                   /db_xref="GOA:Q7UZ36"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR011444"
FT                   /db_xref="InterPro:IPR022655"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ36"
FT                   /protein_id="CAD71450.1"
FT                   /translation="MQGSSRNRIRFADILSRSVTMSFPPTLLPILPFIVVSPPMHFRLL
FT                   PFDFLRWTTVCLLGLSSSWLVSASADEPEISFNQDIRSILSENCYFCHGPDENNRQAGL
FT                   RLDVREEAIDYAAIVPEDVDGSELVARIDHEDPELVMPPPDSHKTLTEKQKQLLKAWIA
FT                   QGAPYEEHWSFSPIQRPEVPDLTKWDETVESNDVHPVDAFIRARLLAKGHDLSGPARPD
FT                   RLLRRMHLDLVGLPPTWEETQDFFTRVQETQASADARSALIDQQLNELFENPHHGERMA
FT                   AFWLDLVRFADTVGYHGDQNQHIFPYRDWVIDAFQNNMPFDEFTIKQLAGDLLPNPKTD
FT                   DLIASGFNRLNMITREGGAQPGEYLSKYATDRVRTVGMAWMGLTTGCAECHDHKFDPFT
FT                   AKDFYSLGAFFADIEQWGVYSDYGYTPNPDLKGYNNNFPFPPEIELTSPALLREQTQAK
FT                   QELIQLARLQLAAMPDDQKTAANDWLANVNGWLEREADGWQSLPMASVPSKDKKVQAWT
FT                   ANDESVSLGSLSPQSIQVNLLTAANQSPQNVEVRFYIEETKPPTSEESGSEEPKDEKKE
FT                   EAKRTRTDVSVSFARANRWLPSFSSTVAQQNVASRWSVPATDAAGRAVKQRPHQFMIDQ
FT                   SKHADDPMRAVFELSGPLQLKEGQSLIAEIKGLASDTEVTFESSPLVRLRPFDAAELEA
FT                   IQICDSISQPNALLSWMMSNPKQAKDAGAIKHWRDRYLACRDGRTWTMVTKATEPMEVR
FT                   VLPRGNWQDKSGAVVEPATPGFLGSYGIATDKEADNKDANAKRLTRLDLARWIVHRDNP
FT                   LTARVVANRLWKQFFGVGLTAAVDDLGAQGDPPSHPELLDYLAIELIDSGWDLRHVTRL
FT                   ILTSRTYQQDSRVRPELSEIDPENRLLSYHPPRRLEAEIVRDNALAVSGLLNLEIGGPS
FT                   VKPYQPDGYYSNLQFPSRSYRSTAGDNQYRRGIYMHWQRTFLHPMLANFDAPSREDCVA
FT                   IRANANTPQQALTLLNDPTFIEAASELAWNMIEQKESDETRLRTMVRRSLQRDATSEEI
FT                   ERLTVFLNQQRELFLADEALSVQLTSIGQSATRHNESLSPADRAEWAAWTATARIVLNL
FT                   HETITRY"
FT   CDS_pept        115765..117177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB218"
FT                   /product="hypothetical protein"
FT                   /note="PMID: 11743194"
FT                   /db_xref="GOA:Q7UZ35"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ35"
FT                   /protein_id="CAD71451.1"
FT                   /translation="MNSFPTIQRRSFLKSGTYSVGMAALGSMLARESQASQSDSPQPHF
FT                   PGTAKTVIHLCMAGGPSHVESLDPKPELDKINDQPFPASMTDGQQLAQLQGSKLVARGS
FT                   FCKFKKWGQSGLEISELFPNIGSVADDLCIIRSMHTEQINHDPAHAFMNTGSIQKGRPS
FT                   MGSWFLYGLGAETDSLPGFIVFTSQGRHGAQPVSARQWKAGFLPSRFQGVQFQSRGDAV
FT                   HYVRPPGGITDTTQRATIEAVNAFNQDLLADRGDSEIATRISQYEMAFRMQTSVPELAD
FT                   MSDESQETLDLYGVTKPGDGSFASNCLMARRLAERGVRFIQLYHRAWDHHSNLEVGMKD
FT                   SAKAVDQASAALIQDLKRRGMLDDTLVIWGGEFGRTPMKQGSGRDHHINAFSLWMAGGG
FT                   VKGGISYGNSDELGYRYLKDGEETHVRDLHATMLHTCGLDHMKLSAKYQGLDVRLTGVE
FT                   PARVLKPILKNA"
FT   CDS_pept        117170..118141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB220"
FT                   /product="hypothetical protein-signal peptide prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ34"
FT                   /protein_id="CAD71452.1"
FT                   /translation="MLDRMNQTSVNRARQTRSRFFAWALASTLVVHAASVDAADDNALF
FT                   NQMRSGGIALTDDVTSQIPSLAFVDASGEPVVPSEVKKQLEKLARAGGIQRFIRDSVVA
FT                   PIAIDMDSISNAEGQRIGHLLDVTFVVHAPIDLVEDSDTLQSLLGVNNQEAETDEAGAA
FT                   NKVTTEELSRLGIAVDSESESFGRVSFPLLDRVLINGVIHAETKRHIEGTADDYVTVAW
FT                   QLDPRFENSWSPIERNDLGEEVTGDAKTYRGLGGLITATRLPVDIAGSDSDATIVQAKL
FT                   VVHEPVDWFGGRNQLRSKLPLIIQDRVRDLRRKLAEVHDALR"
FT   CDS_pept        complement(118214..118324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB222"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ33"
FT                   /protein_id="CAD71453.1"
FT                   /translation="MPGDSLCSKASVETPGNDLAYGAPITTRSVSKVSRR"
FT   CDS_pept        complement(118401..120395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB223"
FT                   /product="4-hydroxybenzoate decarboxylase"
FT                   /function="C-compound, carbohydrate catabolism"
FT                   /note="PMID: 10438791 best DB hits: BLAST: ddbj:BAB07649.1;
FT                   (AP001520) BH3930~unknown conserved protein in; E=1e-170
FT                   swissprot:Q9Z8L0; Y328_CHLPN HYPOTHETICAL PROTEIN; E=1e-86
FT                   swissprot:O84087; Y085_CHLTR HYPOTHETICAL PROTEIN CT085
FT                   -----; E=3e-86 COG: BH3930; COG0043
FT                   3-polyprenyl-4-hydroxybenzoate decarboxylase and; E=1e-171
FT                   PFAM: PF01977; Protein of unknown function UPF0096;
FT                   E=6.7e-19"
FT                   /db_xref="GOA:Q7UZ32"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ32"
FT                   /protein_id="CAD71454.1"
FT                   /translation="MPKAKTVRSIPRLRSTISRYVHQNVAAIGRSWLQQRLKGSREPLD
FT                   SGSRQKVFALKHRSTRDVVEDLRSGDRLITVDDEVDPNLEMAEIQRRVYLRGGPAILFT
FT                   NVRGCKFPMASNLFASLDQARYLFRDTLERVRRLIEVKLDPSALPKSPMRYAGVPMTAL
FT                   TMLPRFTRSGAVQANQCRLSELPALKSWPMDGGSFVTLPQVLSADPEAPSNLMRVNLGM
FT                   YRVQLAGNEYDPENQVGLHYQIHRGIGVHHRAAMDRNESLQVAITVGGSPAMSLAAVMP
FT                   LPEGLTELTFAGALSGRRVRMIRGSHAPVYADADFAIVGQVDPTATMPEGPFGDHLGYY
FT                   SLQHPFPFMKVEHVWHRKDAIWPFTVVGRPPQEDTTFGQLIHELTDPIIPTVIPGVKAV
FT                   HAVDAAGVHPLLLAIGSERYMPYLKAKEPQELLTQANAILGNGQLSLAKYLWITDDPDD
FT                   SIRIHDIGSFIQHILRRVDWRRDLHFHTKTTIDTLDYSGTGLNQGSKLVVAATGQSTRE
FT                   LATEIPSGLSLPDGISDPQLVMPGVIAVRGPKYTGDASREDVQRLTAHLEHQPGLESVP
FT                   LITLCDDSEFAAATLNNWLWLTFTRSNPAIDVDGVGVQVVAKHWGCRGPLVIDARVKPH
FT                   HAPPLVEDAEVTAKVDARATRGDELAKYL"
FT   CDS_pept        complement(120568..120834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB226"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ31"
FT                   /protein_id="CAD71455.1"
FT                   /translation="MIYFICWVVFLLAMILSVVVVGLKNRKPRPAAAVVPACEEEMMAD
FT                   GDEIEVVEGDEFEAVAVDGDDFGGGEFVAEGGDDFAAFEDEFK"
FT   CDS_pept        120858..121037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB227"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ30"
FT                   /protein_id="CAD71456.1"
FT                   /translation="MKVVERIEKDAPHPNCRWSSRQIWLRQASEAPFSRVISPTIHPVA
FT                   HPKRSPAGDFAQRV"
FT   CDS_pept        complement(121025..122782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB229"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /db_xref="InterPro:IPR011446"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ29"
FT                   /protein_id="CAD71457.1"
FT                   /translation="MNSLIWRRLPRFAKNCAVLVACLACSPLAAQVRVKKPDRGTYQTP
FT                   GSAAEKTTGDWELYPDSSPELSRIQINEVVYDDMEVASAAEGDGLQVMDEPGGLRLRKL
FT                   GEVVGSNSQPSSAQIVRPVSAMSVRPHGVPSEGARIIQSTGSSHRGRVLQKTSGSVTIM
FT                   EHPTFAGETIVGSGTPMNFQGPGCGMEGPGCGIEGCGCGFDVGCGLEGPGCGFESYGCD
FT                   SCGYGGCDGMCGPAGAICVDPNRWFGSAELMIMFRKGDRLPALVTTDTAPDTGSLDTGT
FT                   VLAGDDSVLKDATAGGRLTLGLWLDNHQCRSLVFRGWVAGDENYSFGADQRNFDVLAIP
FT                   FFNVATDAEDSNVVVFPNAPADPAINGRFGAVGVDAYSELHGGDISVRQFWRGGLGTTF
FT                   DVLYGYQYMRLSEGLNISSSSTLTEGTDAGNYISIRDSFGATNEFHGAQFGLAGRYREG
FT                   CWSFNWLAKAAFGNVRRTANRQGSTTVGPPDTPQDGGLFVDSDTNEGTFTSDTFGWVPE
FT                   LDVNLGWHRFNHFDVTIGYHLMAMSDAIQVSGIFDRNINDANNNLPAPSMRDDTFYVQG
FT                   IHFGLSYTR"
FT   CDS_pept        122781..123017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB233"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ28"
FT                   /protein_id="CAD71458.1"
FT                   /translation="MGCFAWIQSSGVVANQSGRRARSVLSTRHLAHHQMPRELVSDGTI
FT                   VTVEPFWQTLPVRPQLRLTGSFTRAVFHRSRWR"
FT   CDS_pept        123018..124316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB236"
FT                   /product="conserved hypothetical protein-putative
FT                   hydrolase"
FT                   /note="best DB hits: BLAST: pir:S74628; hypothetical
FT                   protein slr1772 - Synechocystis sp. (strain; E=6e-17
FT                   pir:E82406; probable hydrolase VCA0877 [imported] - Vibrio
FT                   cholerae; E=4e-13 gb:AAF67801.1; AF148138_1 (AF148138) bile
FT                   salt hydrolase; E=0.028 COG: slr1772; COG3049 Penicillin V
FT                   acylase and related amidases; E=5e-18 PFAM: PF02275;
FT                   Choloylglycine hydrolase; E=0.47"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029132"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ27"
FT                   /protein_id="CAD71459.1"
FT                   /translation="MKSLLMISVPAKQNLLPRIEFDTMNLRTGRLTTATTFALVAAHSL
FT                   PEFTHMRLRRNSHPARRIHSVTGVGLVLQAAMVGVLAITAIQPATACTVMRMTIRGKLV
FT                   IARNHDWPFGEALVITNLRGIEKTSLAPIKPATWVSKYGSVSFCQFGREIPFAGMNEKG
FT                   LTVDLLRLPGATFPDPVAVEADPNLTAVNAIQWVQYQLDTAETVAEVVDSLSTVVPIPM
FT                   LPMVETVHYFVTDSTGDVAVVEFINGSAVVRHGDDYRLDDGKPKTHACVLANSSWEDSQ
FT                   TELQNNSSRMRYGRGVRLVEMANEIGVEIAPIDYAIRCLRMVAQGPLTQWNLVYQPEER
FT                   RIHFRTQNSQQQRWIDLDDLSFEPEQTPQAIDIDRNINGNVVPHMKAVTDADNERIVNH
FT                   AFDHFVPAGLPSLMIKQLLLDYPSKLRSPQTAP"
FT   CDS_pept        124403..124546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB241"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ26"
FT                   /protein_id="CAD71460.1"
FT                   /translation="MKLSGTLTAAESVAHARNFPAAHRLKNAHFCSLNLHFELRRFFTV
FT                   VS"
FT   CDS_pept        124632..125636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB244"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /note="best DB hits: PFAM: PF00114; Pilin (bacterial
FT                   filament); E=0.038"
FT                   /db_xref="GOA:Q7UZ25"
FT                   /db_xref="InterPro:IPR011453"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ25"
FT                   /protein_id="CAD71461.1"
FT                   /translation="MTCLTTQSSRRTPATPCTAPSTARPTTSTRGFTLVELLVVIAIIG
FT                   VLVGLLLPAVQSAREAARRMQCGNNLKQIGLGLHVYHDTFNKFPYGWDNRGMTWSGHIL
FT                   PQIEQANLYQTLIFQESGLGNWGTDDGPNEEACETVIPTYRCPSMALPLHMDYNGIPQR
FT                   VPASYRGVAGTLATSDDTSTALPDTISLESLDQDGIFYACSKTKFRDILDGTSNTIMIG
FT                   ESYNNPKFVKDGQGMDYWYIGAPQTDPCRCDGGTGGTEFSEVAGVTITPVNAVIRAPLM
FT                   SGRLMELSFGSYHLGGAHFLKCDGSVSFLTESLAEDVYDALGSRDGGEIPGEI"
FT   CDS_pept        125688..126200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB246"
FT                   /product="hypothetical protein-signal peptide prediction"
FT                   /note="best DB hits: PFAM: PF02369; Bacterial Ig-like
FT                   domain (group 1); E=0.48"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ24"
FT                   /protein_id="CAD71462.1"
FT                   /translation="MAMNSAIQQAMALTSVACLALTLATTTGCGPSAQADYASIGLVPI
FT                   TGNVTLDGQPLEGAVVMFESPDTTFCYGTTDAEGNYEIKFNSEVMGVPPGDKMVRISTT
FT                   ASTGEVDSEGADEDDDDAVARRKKKKKRNPNELVPEAYNEDSQIKATISDSQTVYDFAL
FT                   KSDGSPL"
FT   CDS_pept        complement(126264..126458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB248"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ23"
FT                   /protein_id="CAD71463.1"
FT                   /translation="MGQNSRSSKQGRSQGLAAQDNAESFQPTKNGGSHWEAPVVVGKHI
FT                   LAICSIVQDSSGLGSPSYN"
FT   CDS_pept        complement(126492..128021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB249"
FT                   /product="probable transposase"
FT                   /function="retrotransposons, viral and plasmid proteins;
FT                   recombination and DNA repair"
FT                   /note="PMID: 10986268 best DB hits: BLAST:
FT                   swissprot:P03835; YI41_ECOLI INSERTION ELEMENT IS4
FT                   HYPOTHETICAL; E=0.002 gb:AAC72261.1; (U91581) putative
FT                   transposase [Lactococcus lactis; E=0.008 gb:AAF27554.1;
FT                   (AF179847) putative transposase [Lactococcus; E=0.008 COG:
FT                   yi41; COG3385 Predicted transposase; E=2e-04 PFAM: PF01609;
FT                   Transposase (IS4 family); E=0.024"
FT                   /db_xref="GOA:Q7UZ22"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ22"
FT                   /protein_id="CAD71464.1"
FT                   /translation="MSKKLDSHESSKAKEHARQRKFNRAKRKVKSESQRQHYRKAQTRN
FT                   AKEIRSAIDWVLGDEQAVPTQAHGNTGWKTMTLMIQALLWIFSDKDKLKDAFDSGTRQC
FT                   KKVHGRIAFSSYSGLIKALVRWTPWLSEVLLTRIQKQIETTAGKLWRTTGWVVMAVDGS
FT                   RDTTPRTLSNEKAFCAPNHGHGKTARYRKKKTKGMRRQAIEKNPPAPPVPQIWITMIWH
FT                   VATQLTWCWKLGPSNASERAHVQEMLENGEFPEKTLFTGDAGFVGYEFWKSIIDGGHHF
FT                   LVRVGANVNLLHSLGYDVEPDEDNLVYCWPKDKRREGMRPLKLRMIQIQLGRKKAVLLT
FT                   SVLDEKKLTDKQALVIYKSRWGIELEFRNLKQTYGRRQLRCRQSIRALVELHWSILSIL
FT                   IVKLYALKVHLAKKRRRGDPVAMPGRISFAGVVRSFQRILENLNETDLEEPSLSEMLGD
FT                   ALIDNYERKSSKEARYKPNKKDKPRCGLPNVTRATKEDRDRLQKLGFCTVA"
FT   CDS_pept        127991..128251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB250"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ21"
FT                   /protein_id="CAD71465.1"
FT                   /translation="MIRENRVFLTQPDPFLTEVFQLVGRGIRLLHFKGSSAKHHKSRPQ
FT                   NRSRRCPLGLVSGSPQRTPGDAWGYLRAAPLGRRTEQVPTS"
FT   CDS_pept        complement(128316..129644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="RB251"
FT                   /product="histidyl-tRNA synthetase"
FT                   /function="tRNA-synthetases"
FT                   /EC_number="6.1.1.21"
FT                   /note="PMID: 2991272 best DB hits: BLAST: swissprot:P56455;
FT                   SYH_HELPY HISTIDYL-TRNA SYNTHETASE; E=5e-81
FT                   swissprot:Q9ZK27; SYH_HELPJ HISTIDYL-TRNA SYNTHETASE;
FT                   E=1e-79 swissprot:O83647; SYH_TREPA HISTIDYL-TRNA
FT                   SYNTHETASE; E=1e-73 COG: HP1190; COG0124 Histidyl-tRNA
FT                   synthetase; E=5e-82 PFAM: PF00587; tRNA synthetase class II
FT                   (G, H,; E=3.3e-08"
FT                   /db_xref="GOA:Q7UZ20"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7UZ20"
FT                   /protein_id="CAD71466.1"
FT                   /translation="MIQPRTLKGFRDYLPAAMIPREQLMQTAREVFRSFGFAPIDTPTL
FT                   EHLEILTGKGSDETDRQLYSFEDNGGRPVGMRFDLTVPLARFAAQHIGTLGTPFKRYHI
FT                   APVWRGEKPQEGRYREFVQCDFDTIGTTSELADIEAVCVIDALLRAIGIDAFTISINNR
FT                   AILTGLLESLGLADKTTPVLRSLDKLGKIGREKTANEMVESAGVTAEQADAVLRLAECD
FT                   GDAESILASLPEITGGNETAAAGIERLTQIYRGALASGVSPDRLKIDVSIARGLDYYTG
FT                   VIFETTLDELPGIGSVCSGGRYDNLAGLYTKQHLPGIGASLGLDRLLAALESLGRLSGV
FT                   SKPCAVFVPFFDKGHRDDYLKLASQLRDAGIGVEVYPEPKKLGQQLKYADSQGFAVAII
FT                   AGGNEWEAGAVQVKTLATKESQDVAYSHESPDALIEAIQAATS"
FT   CDS_pept        complement(129759..130250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB252"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ19"
FT                   /protein_id="CAD71467.1"
FT                   /translation="MPTASKLPVATPPSVNGRRRSDFPADANLCDHCTAKCCKYFALPI
FT                   DEPVTRKDFDFMRWYLLHDRATVFVDEDTWYLLVHTTCKHLQDDHRCGIYETRPQICRE
FT                   YTTKECEFEDDWCYEKYFETPEQIDEYADALFGPQFPEGADRDIDSIRSRRPTGLPIVG
FT                   "
FT   CDS_pept        130316..131215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purU"
FT                   /locus_tag="RB256"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /function="purine-ribonucleotide metabolism"
FT                   /EC_number="3.5.1.10"
FT                   /note="PMID: 7868604 best DB hits: BLAST: gb:AAG20130.1;
FT                   (AE005091) formyltetrahydrofolate deformylase;; E=5e-24
FT                   swissprot:Q55135; PURU_SYNY3 FORMYLTETRAHYDROFOLATE
FT                   DEFORMYLASE; E=3e-17 pir:C82633; formyltetrahydrofolate
FT                   deformylase XF1831 [imported] -; E=2e-15 COG: VNG1946G;
FT                   COG0788 Formyltetrahydrofolate hydrolase; E=5e-25 TM1248;
FT                   COG0299 Folate-dependent phosphoribosylglycinamide; E=2e-07
FT                   Rv2964; COG0788 Formyltetrahydrofolate hydrolase; E=8e-07
FT                   PFAM: PF00551; Formyl transferase; E=1.4e-10"
FT                   /db_xref="GOA:Q7UZ18"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ18"
FT                   /protein_id="CAD71468.1"
FT                   /translation="MEVVITALGPDHSGLADPIIHHVTARGARISEIQMYDHDEEELFA
FT                   MLCRLQFDAGADPAELLGQLQDEMKQIGEHTGLSIRAWSPDARANRPRLAVACTYVEHT
FT                   PRAVLEAVSSGQIAAEVPVIISNRKKLGFLADEFECDFRMIGDGTGAVDDAALLATLDE
FT                   YDIDYLILARYMRILPADACWQFAGGRIINLHHGLLPGFPGFRPYHDAHNVRMLTFGAT
FT                   CHFIIPELDAGNQTINQRTFSVAPGTPLERIIAQGESENEPACLVEGVRRVVDREVHLH
FT                   FHRVVPRKDLVAKSAAAK"
FT   CDS_pept        complement(131592..131813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB257"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ17"
FT                   /protein_id="CAD71469.1"
FT                   /translation="MHALRQTCAIRRGEPFRSIRRIGAVVGRNAVAEANFASSAGIQSD
FT                   AVDRESGGGLDERVIVEVCQPQCVSTGF"
FT   CDS_pept        complement(131782..132336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB259"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ16"
FT                   /protein_id="CAD71470.1"
FT                   /translation="MAGDPQEVDLSDSSGGPREVFHRNRFATDSVDAVIDERLGFEVGD
FT                   RGQLHASRTVQTKIESAGRSPPNHFTLSQRELMGLKLSQIAQFVFDLATQLRQIDRFEG
FT                   VPDHQHPFVQREVCCRWCHAASTWQISSKNEAIWSLRASDAVGIDAPHGESWGRSGSGP
FT                   VVRPSQLKFIPIARVAADLRD"
FT   CDS_pept        132414..132683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB262"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ15"
FT                   /protein_id="CAD71471.1"
FT                   /translation="MPRRWQNAQVHTRSEIPFWIKIESGVFAIKRLYFPFPRLWGAVLG
FT                   RYDSRPSPRRVWHLLRSDATLHSSTWRIWTMQTIELKGFTERQW"
FT   CDS_pept        132677..132871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="RB264"
FT                   /product="similar to 30S ribosomal protein S21"
FT                   /function="ribosomal proteins"
FT                   /note="PMID: 11679669 best DB hits: BLAST:
FT                   swissprot:P49225; RS21_MYXXA 30S RIBOSOMAL PROTEIN S21
FT                   -----; E=0.78 PFAM: PF01165; Ribosomal protein S21;
FT                   E=2.9e-10"
FT                   /db_xref="GOA:Q7UZ14"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7UZ14"
FT                   /protein_id="CAD71472.1"
FT                   /translation="MVKLLVRDRETIQEAVRRFRKLVERSGIKKEMRRREFYEKPSETN
FT                   RRARLRAERRNKRTRMLSR"
FT   tRNA            133023..133099
FT                   /product="Val tRNA"
FT                   /note="Val, tRNAscan-SE-score 86.79%"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(133252..133707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB268"
FT                   /product="conserved hypothetical protein"
FT                   /note="best DB hits: BLAST: pir:H75286; hypothetical
FT                   protein - Deinococcus radiodurans (strain; E=5e-11 COG:
FT                   DR2326; COG2314 Predicted membrane protein; E=1e-11"
FT                   /db_xref="GOA:Q7UZ13"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ13"
FT                   /protein_id="CAD71475.1"
FT                   /translation="MTESAKAGVRCPDCQSEFEFSVAESGGIQACPNCSSLVTLAAEVI
FT                   VGADGLDRFNDPFREEFIDKKLTAGLLGMFLLGAYGSHKFYLGLNRGALLMASVSVVGI
FT                   IGGMFFIWPLLLVFVMATISFVEGFIYLAKSDESFYEDYRVREQQWF"
FT   CDS_pept        complement(133878..134096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB269"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ12"
FT                   /protein_id="CAD71476.1"
FT                   /translation="MAGGTFRNAKNAASVICPASATGGFSKCRPGSTWQSRNVLEQNEA
FT                   CAPFHVTATWKFNWPVTHARWNLAYRQ"
FT   CDS_pept        complement(134068..134205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB271"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ11"
FT                   /protein_id="CAD71477.1"
FT                   /translation="MCTIPCDINVEIQSASHPRQVEPGLQLTTRLHQKSLNGGWHLSEC
FT                   "
FT   CDS_pept        134180..134296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB272"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ10"
FT                   /protein_id="CAD71478.1"
FT                   /translation="MMSHGIVHTPRFVPKHCRRCQVEPGLHFENPPVKEAAF"
FT   CDS_pept        complement(134462..135280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB273"
FT                   /product="probable secreted glycosyl hydrolase"
FT                   /function="sugar, glucoside, polyol and carboxylate
FT                   catabolism; polysaccharides degradation"
FT                   /note="best DB hits: BLAST: embl:CAB94634.1; (AL359215)
FT                   putative secreted glycosyl hydrolase.; E=7e-08 pir:T34929;
FT                   hypothetical protein SC3F9.07 SC3F9.07 - Streptomyces;
FT                   E=1e-07 embl:CAB45032.1; (AL078635) putative large
FT                   multi-functional; E=0.002"
FT                   /db_xref="GOA:Q7UZ09"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ09"
FT                   /protein_id="CAD71479.1"
FT                   /translation="MKCRCLPNRKFHLIGAVIWTASVWMCCLLNAADNVGTATEGAPSA
FT                   EQSDAAADFVELFDGKSFDGWEHSGNWRIEDGAFFRAAGGGSLTYKRTLVPDDFELRFE
FT                   WKVSDGCNSGVYYRPGQVEYQVLDNVGSPYGENPRQSAASLFFCMAPSKDATRPVGEWN
FT                   SGRVVCKGTVIQHWFNGQKVLDFDYTDPKWAEMVRLLTIRGGDLTGRGGELWLQDHGQP
FT                   VWYRNLRWREIPDEESLKPSPNFEPMAIPPAALAKEQKRVQAMLKKPESK"
FT   CDS_pept        complement(135370..135819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB275"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ08"
FT                   /protein_id="CAD71480.1"
FT                   /translation="MMEAVRTRRCPLPSHYHIGFDRDACLFEVATCFHSVQTNRVDFVA
FT                   GRFAEAFASGHARVECAIGQAECTFADHPRIARAFGQTHQFIFGVRVVDDFASVVFVFG
FT                   PSDDDVGVRFDFKQRHGGNVRWRKKSRDAACACWYYILVHAATGL"
FT   CDS_pept        135460..135786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB276"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ07"
FT                   /protein_id="CAD71481.1"
FT                   /translation="MPLFEIETDAHIIITWAENEDDAREVVDDAYPEDELMRLTKRPRD
FT                   SWVISKGALGLTDRTLDPCMTARECLSKSAGDKVNAIRLYRMETGCDLEQARIAIESNM
FT                   VMGW"
FT   misc_feature    135663^135664
FT                   /note="cosmid pircos-c1d12/ cosmid pircos-d2e11 joining
FT                   point"
FT   CDS_pept        135837..138587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB278"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="GOA:Q7UZ06"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ06"
FT                   /protein_id="CAD71482.1"
FT                   /translation="MMNAASPPNPWLWFAWVMLVPLLVGCDGCRQTEETDLKEEVAQQK
FT                   LPPFTIGPAKAFPATRADAGTKGATDGAVKPGHWFAAGVTLKSNREDERGAIVTDTKIV
FT                   RPVNALTDQVERFELDAKIADASSRTVGKSFRVRRPAVLPKGQRRELETRALASEAGGR
FT                   LIEGLEFDGDFVSSRTGAAVPLRPSKFAALQPQSFFFVVLTERSERFTRLQTADWVEPM
FT                   RATNEFYRPRENYRIVIPPTKGVLPLSETMLDWTSTAVLFWDDLTSSALTPGQRNAIVD
FT                   WLHFGGTLIVNGPSGADAIDDPKLKSLLPIQADGNEELNGDNAIAFLKSHRVQTDESIP
FT                   AIEARLSGDNSTVSVAGQPTADATSLGTGDLVYQRRIGRGRIVQSRVDLLSEWMTAWKS
FT                   YDSFFNSVVLSRPPRVCQKLEGTPASMPQPFLSEDEIDTVSEEEMAAIIDQPMVQQNLV
FT                   GMTIEDAPPTINSGFRLFARDMRLGKLPSLDEVKDASDEPNGDEASVGSGRSRTSLVRS
FT                   AKDYRNRLDEEVMQHPVSGVGGWKDDSALMLSFRNSLQERIGVTIPDSSLVVKSLLIYL
FT                   IVLIPLNYAVFRWMGRLEWAWLAMIPIALVGAFMVARAAQLDMGFARSRNELAFLEIPR
FT                   DHDRGHLTRAIALYNSLASNYSVQFENPDAAITMLASRRTDSRNEAMFGSDGLTLQLGF
FT                   DAGPRLDGIAVGSNSYGSVHVEQMVPVGGQISLSQDGSTLRNDSNLDLTDVYVIRQPTG
FT                   SSDTSKTEIAVLGSVAPGENPKISYQSADQVRVPEGVDSGVRQCMRRILNSTYIEPGTT
FT                   RLLGRLAKVPLDQADDDESPAWGGLEIQPVCKQVEADTIVLAHLEYPAVPTPQPDENLM
FT                   DDFRSRTTTLEEEKANKAKEAKKKSEEESAGTEVTEESDTTKETP"
FT   CDS_pept        138584..139510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB279"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="ABC transporters"
FT                   /note="best DB hits: BLAST: pir:S74476; ABC-type transport
FT                   protein slr1113 - Synechocystis sp.; E=5e-49 pir:H71008;
FT                   probable ATP-binding transport protein - Pyrococcus;
FT                   E=8e-43 pir:S76626; ABC-type transport protein sll0489 -
FT                   Synechocystis sp.; E=1e-42 COG: slr1113; COG1131 ABC-type
FT                   multidrug transport system, ATPase; E=5e-50 yadG; COG1131
FT                   ABC-type multidrug transport system, ATPase component;
FT                   E=1e-34 BH1054_2; COG0842 Permease component of an
FT                   ABC-transporter; E=1e-34 PFAM: PF02223; Thymidylate kinase;
FT                   E=0.064 PF00005; ABC transporter; E=2.4e-45"
FT                   /db_xref="GOA:Q7UZ05"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ05"
FT                   /protein_id="CAD71483.1"
FT                   /translation="MITLEGFGKDYGEFTAVESIDLQIDAGETFGFIGPNGAGKSTTIR
FT                   FLATLLRATRGRGEVAGCDVMNDPMGVRRAIGYMPDNFGVYDGMRVWEFLDFFAVAYGI
FT                   ARSQRGPIIDNVLELLDLGHKRDDFVNGLSRGMKQRLCLAKTLVHDPPVLILDEPASGL
FT                   DPRARVEVKALLKELRRMGKTILISSHILTELADCCTSIGIIERGQLLMSGPIDQVYRK
FT                   IRRNRTVEIAFTENAEAGISILRSSPALRDLEMRPDRVIAELETDDAGLSTLLNHLIAQ
FT                   GVQMRSFYDRDPTLEDVFMSVTEGLVS"
FT   CDS_pept        complement(139488..139634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB280"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ04"
FT                   /protein_id="CAD71484.1"
FT                   /translation="MLLSSVERLRKSDGPNRAECQRQFARSCCPRLAAVDAIVNRPMRP
FT                   NLR"
FT   CDS_pept        complement(139597..139926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groS"
FT                   /locus_tag="RB281"
FT                   /product="probable GroES chaperonin"
FT                   /function="protein folding and stabilization"
FT                   /note="PMID: 10206714 best DB hits: BLAST: gb:AAA83440.1;
FT                   (U29483) GroES-like chaperonin [Thermus aquaticus]; E=5e-04
FT                   swissprot:P56970; CH10_CAMJE 10 KDA CHAPERONIN (PROTEIN
FT                   CPN10); E=6e-04 swissprot:P26879; CH10_LEGPN 10 KD
FT                   CHAPERONIN (PROTEIN CPN10); E=7e-04 COG: Cj1220; COG0234
FT                   Co-chaperonin GroES (HSP10); E=6e-05 PFAM: PF00166;
FT                   Chaperonin 10 Kd subunit; E=4.5e-05"
FT                   /db_xref="GOA:Q7TU13"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TU13"
FT                   /protein_id="CAD71485.1"
FT                   /translation="MAKKKTAPKVFEYVEPIGDRVLVRKDEPKRETRGGIALPDAAEIP
FT                   TITGRIVTISAVVENDEELPLRQYDKILFHPKNAIPVDLEHDNQLFVVPVDDIVAVFRR
FT                   EAPEE"
FT   CDS_pept        complement(140047..141075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB282"
FT                   /product="conserved hypothetical protein-putative ATPase"
FT                   /note="best DB hits: BLAST: ddbj:BAB03825.1; (AP001507)
FT                   BH0106~unknown conserved protein; E=2e-52 swissprot:Q06754;
FT                   YACL_BACSU HYPOTHETICAL 40.9 KD PROTEIN IN; E=4e-51
FT                   swissprot:Q48762; YOR6_LISMO HYPOTHETICAL 39.5 KD PROTEIN
FT                   (ORF6); E=8e-51 COG: BH0106; COG1855 ATPases of the PilT
FT                   family; E=2e-53 PFAM: PF01850; PIN domain; E=0.11"
FT                   /db_xref="GOA:Q7UZ03"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ03"
FT                   /protein_id="CAD71486.1"
FT                   /translation="MTNAAPTMALIVLRFIFLLCAGGVSAIINTSLPSGGSEAVPWLTF
FT                   VAIMGLAVAIVVLDIYVPRKRIDTITSVYFGVLIGVLLTFILTIAAAPLIEMTSNLRVF
FT                   QLVVGLVLCYVCTSVLLQTKDDFRFLIPYVEFVREVKGFKPLVLDTSVVIDGRIADLVA
FT                   TGVFDNQLIMPRFALSELQAIADSSDKLRRTRGRRGLDVLNRLRADENVDLQIFDRELP
FT                   ELAGQTVDLKLVLLAKHLEGKVVTGDYNLNKVAKVQGVPVINLNEISNSLRPVFLPDES
FT                   FRLRIIKPGEGPEQGIGYLDDGTMVVVEGGRHKIGQEIDVRVTSTLQTNAGKMIFSKVD
FT                   GR"
FT   CDS_pept        complement(140975..141220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB283"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ02"
FT                   /protein_id="CAD71487.1"
FT                   /translation="MSPVDALNRFVATVNLGFSCTGEPPGRSSGTIYTGASLFSSPYLL
FT                   KRRFDQRCTHHGTDCPAIHLFAVRRRRFSDHQHLPA"
FT   CDS_pept        complement(141290..142468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="RB284"
FT                   /product="dGTP triphosphohydrolase"
FT                   /function="purine-ribonucleotide metabolism"
FT                   /EC_number="3.1.5.1"
FT                   /note="PMID: 2826481 best DB hits: BLAST: gb:AAD53927.1;
FT                   AF179611_11 (AF179611) dGTP triphosphohydrolase; E=5e-51
FT                   swissprot:Q9ZE82; DGTP_RICPR DEOXYGUANOSINETRIPHOSPHATE;
FT                   E=3e-48 pir:F75449; dGTP triphosphohydrolase-related
FT                   protein - Deinococcus; E=2e-47 COG: RP064; COG0232 dGTP
FT                   triphosphohydrolase; E=3e-49 MJ1154; COG1078 HD superfamily
FT                   phosphohydrolases; E=4e-04 PFAM: PF01966; HD domain;
FT                   E=2.7e-10"
FT                   /db_xref="GOA:Q7TU12"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TU12"
FT                   /protein_id="CAD71488.1"
FT                   /translation="MMERRLMSLAGPMIDLRRYADREHLLLASYAMHSSDTAGRVHPEQ
FT                   PHAYRGPYGRDRDRILHSSAFRRLSGKMQVFTGEMGTYHRTRLTHTFEVASVARTLARV
FT                   LRLNEDLTEALALMHDIGHPPFGHCGEDVLSECMQSVGGFSHNQFALTIVQELEQRYHA
FT                   FPGLNLSQETLAGQDTRAHKAEAAVGHAPLLEVQIVDAADSIAYDAHDIDDALQMGLLS
FT                   IDALSELAIIRRTLERVREKAGELPVGPLRQLLVHELIDLQVGDLLHISIERMQDADGL
FT                   SADAACQAGIRVGHSQTMASERAELESFLFEAVYRHDRLMPVREAAANRVRTLFEALHQ
FT                   NPERLPLRFRRRLEHRPKDRVVGEYLAGMTDRFCDQQFSVLRQSKNGPLSDW"
FT   CDS_pept        complement(142498..142722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB285"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ01"
FT                   /protein_id="CAD71489.1"
FT                   /translation="MAAGRLLMAISSPFLQRLDGDGIEIRRVNAAQSVVAARIVLHVRR
FT                   VETESAIAWHLMVEVSIESPLSTTTEITR"
FT   CDS_pept        complement(142776..143069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB287"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UZ00"
FT                   /protein_id="CAD71490.1"
FT                   /translation="MMGRKKTREPFVGTAPIRRAQSIPMFVFSNQFVGRMFPRLPGRRL
FT                   SREFPARFTAEFVRKPVSRRKLAENAAVRTLHAKMARCEGDGGVRCYGRMAQ"
FT   CDS_pept        142779..143096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB286"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYZ9"
FT                   /protein_id="CAD71491.1"
FT                   /translation="MRHSPIASDPTVAFATSHFGMQRSDRGIFSQFSPRNRFPHEFGGE
FT                   SCRKLARKPPPRQTGEHAPNELVAENKHRNRLSPPNRCGPYKRFSRLFPTHHYDRPSTP
FT                   P"
FT   CDS_pept        143024..143932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB289"
FT                   /product="dolichol-phosphate mannosyltransferase"
FT                   /function="protein modification (glycolsylation, acylation,
FT                   myristylation, palmitylation, farnesylation and
FT                   processing); biogenesis of cell wall (cell envelope)"
FT                   /EC_number="2.4.1.83"
FT                   /note="best DB hits: BLAST: pir:G75191; dolichol-phosphate
FT                   mannosyltransferase PAB2307 -; E=3e-21 pir:H71223; probable
FT                   dolichol-phosphate mannosyltransferase -; E=3e-18
FT                   gb:AAC98797.1; (AF007875) dolichol monophosphate mannose
FT                   synthase; E=5e-13 COG: PAB2307_1; COG0463
FT                   Glycosyltransferases involved in cell wall; E=3e-22 yfbF;
FT                   COG0463 Glycosyltransferases involved in cell wall
FT                   biogenesis; E=5e-12 MTH136; COG0463 Glycosyltransferases
FT                   involved in cell wall; E=3e-11 PFAM: PF00535; Glycosyl
FT                   transferase; E=1.1e-23"
FT                   /db_xref="GOA:Q7UYZ8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYZ8"
FT                   /protein_id="CAD71492.1"
FT                   /translation="MRSLQTVLASFSDPSLRSALHPTLINSMTDPVIGSESPVPAASAT
FT                   TTAPITNRFRPAKVIMALPAYNEEQSLPELLERIGEAFADSGLPYEVVIVDDGSKDDTA
FT                   KIASQMSFQMPIHLVRHEVNQGLGVTIRDGLKEAVDRAGERDIIVTMDADNTHPPGLIN
FT                   RMVQSVHEGCDCVIASRFQNGARVVGVPIERHFLSIGARVLFTVLFPTRGVRDYTSGYR
FT                   AYRASALRAAFDHYGDDFVGETGFSCMADILLKLRKQGCVFGESPLRLRYDQKGGDSKM
FT                   QVFKTIWLTLKMLGRHRVSGT"
FT   CDS_pept        143933..145348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB291"
FT                   /product="protoporphyrinogen oxidase"
FT                   /function="metabolism of vitamins, cofactors, and
FT                   prosthetic groups"
FT                   /note="best DB hits: BLAST: gb:AAG20016.1; (AE005082)
FT                   Vng1795c [Halobacterium sp. NRC-1]; E=2e-30 gb:AAB89520.1;
FT                   (AE000983) A. fulgidus predicted coding region; E=2e-21
FT                   embl:CAB56041.1; (Y15115) zeta-carotene desaturase
FT                   [Anabaena; E=4e-05 COG: VNG1795C; COG1232
FT                   Protoporphyrinogen oxidase; E=2e-31 slr0940; COG3349
FT                   Uncharacterized ACR; E=1e-04 PFAM: PF02254; KTN NAD-binding
FT                   domain; E=0.00031 PF00070; Pyridine nucleotide-disulphide
FT                   oxi; E=0.00077 PF01266; D-amino acid oxidase; E=0.11"
FT                   /db_xref="GOA:Q7UYZ7"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYZ7"
FT                   /protein_id="CAD71493.1"
FT                   /translation="MMSVASPSNPVSDSSSTPHSSSTNDGSPSTRWLVIGGGVMGLQVA
FT                   RDLIDRGQEVTIAEAAPTFGGLTSAWNLGDVIWDRFYHVTLLSDTKLRDLLTDLGLESQ
FT                   MDWVETKTGFYSGGQLISMSNTAEFLKFPPLNLIQKLRLGGTIFYASKIKNWRRLEKLS
FT                   VEKWLRRWSGKGVFEKIWQPLLQAKLGEAYKQTSAAFIWAHTARMYKARRSGMKTEMFG
FT                   YVPGGYATILDKWVGWLKERGAETLTSSPARQVRKLESGEFEVDFGDGRTQKFDNVVST
FT                   IASPVIADTVPQLSDEEKKRHRGIRYLGVVCASMLMKKPISEYYVTNITDTWVPLTAVI
FT                   EMSTIVNPDKQLGGNHLVYLPKYLPDDHEGLNESDEDYKEKCLSTLEKMYDHFSRDQVL
FT                   DFKIARAKYVAALATIDYSTRLPDIVTSVPGFYALNSAHIVKGNLNVNETITLGEEKFT
FT                   EEVWPDYQRRVAK"
FT   CDS_pept        145338..145973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobA"
FT                   /locus_tag="RB293"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein MobA"
FT                   /function="metabolism of vitamins, cofactors, and
FT                   prosthetic groups"
FT                   /note="PMID: 11080634 PMID: 8020507 best DB hits: BLAST:
FT                   gb:AAG45171.1; AF317883_3 (AF317883) molybdopterin
FT                   cofactor; E=3e-05 pir:D70864; hypothetical protein Rv2453c
FT                   - Mycobacterium; E=0.80"
FT                   /db_xref="GOA:Q7UYZ6"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7UYZ6"
FT                   /protein_id="CAD71494.1"
FT                   /translation="MRNELTAMPHAAPPPLLGVLLAGGRSSRMGTPKALLPHPSGGTFL
FT                   THSLDRLRLVCEEKIVVSLASEAHRAQVQLPPSVPALFDSQPALGPAMGVSVALQHASS
FT                   NGFAGCLFTPVDLPDLSVDDLLSLVHAWRESPTQIVLAQQTDPERLQPLVGIYPVACMD
FT                   SIQRVVESEHRSLYRSLRSSDHQTVAIPSTRLRNVNTPADLGPPFDST"
FT   CDS_pept        145984..147264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA"
FT                   /locus_tag="RB295"
FT                   /product="molybdopterin biosynthesis protein MoeA"
FT                   /function="metabolism of vitamins, cofactors, and
FT                   prosthetic groups"
FT                   /note="PMID: 9515915 PMID: 3045084 best DB hits: BLAST:
FT                   gb:AAG55200.1; AE005263_9 (AE005263) molybdopterin
FT                   biosynthesis; E=7e-40 swissprot:P12281; MOEA_ECOLI
FT                   MOLYBDOPTERIN BIOSYNTHESIS MOEA; E=3e-39 swissprot:Q44243;
FT                   MOEA_ANASP MOLYBDOPTERIN BIOSYNTHESIS MOEA; E=4e-34 COG:
FT                   moeA; COG0303 Molybdopterin biosynthesis enzyme; E=2e-40
FT                   PFAM: PF00994; Molybdenum cofactor biosynthesi; E=4.4e-76"
FT                   /db_xref="GOA:Q7UYZ5"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYZ5"
FT                   /protein_id="CAD71495.1"
FT                   /translation="MNATPKFAFDSPEEAIDALSRRIGTTGVQRVEIGESHDSLRSLHR
FT                   RVLATPILADRDSPAADVSAMDGYAIRESDLLNEGPIEVTGESVPGSPPPSASDTGVIR
FT                   IFTGAIVPVGCDRVIQREHTDETAPASASDSHSLGQIQWTDQAKSIPAGANIRRQGENL
FT                   SAGSIAVEAGLELTSPRLAALTNFGVQQVDLHKPVRVAVLTTGDELASGTAPDQSPLPP
FT                   WKIRNSNASALLGLLTNQPWIDCAPPMHAVDEPAALLTAVQHAIEHHDVVLMTGGVSMG
FT                   DYDYVPRILREAGAEIVFHKLPLRPGKPILGAVHQSDSKSTLILGLPGNPVSATMGARR
FT                   FAMPLIRKLAGMTNWEEFPPLVTLEEVSEKTLPLHWLRGVRLTQPGRAALVIGKGSGDV
FT                   ATLAGTDGFIEMPPHANHAGPWPYFAW"
FT   CDS_pept        complement(147231..147404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB296"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYZ4"
FT                   /protein_id="CAD71496.1"
FT                   /translation="MVWTFQITAKKVISSPDFLFPRLNSKTLEHSDARAFFFVNVNTRG
FT                   VNHHAKYGHGPA"
FT   CDS_pept        complement(147355..148944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="RB297"
FT                   /product="ammonium transporter"
FT                   /function="nitrogen and sulphur transport; cellular import;
FT                   other cation transporters (Na(+) ,K(+) ,Ca(2+) ,NH4(+)
FT                   ,etc.)"
FT                   /note="best DB hits: BLAST: gb:AAK00343.1; AF329498_3
FT                   (AF329498) ammonium transporter AmtB; E=4e-82
FT                   gb:AAC38548.1; (AF005275) AmtB [Azospirillum brasilense];
FT                   E=3e-81 embl:CAA12410.1; (AJ225126) ammonium transporter,
FT                   AmtB; E=4e-77 COG: PA5287; COG0004 Ammonia permeases;
FT                   E=2e-76 PFAM: PF00909; Ammonium Transporter Family;
FT                   E=1.5e-154"
FT                   /db_xref="GOA:Q7UYZ3"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYZ3"
FT                   /protein_id="CAD71497.1"
FT                   /translation="MAEITLHPPSSPSTFHWSLPGMLSRVLVVVCLLTCILGVPLVGLP
FT                   VASVGAQDEVANTSAAETAPAEPSASAEEIAPAEENEAAEEPAAPTLESLQAGVDEALL
FT                   AGHNGWMLVCCALVLFMTAPGLAMFYGGLVRRKNVLSVMMQCIFLMGMMTVLWALYGYS
FT                   FAFGGSGGWFGNTDYLFMEGVQRYWDDDLGKAITPMEGAMTRMTHMLFQGMFFIITPAL
FT                   ICGAFAERMKFSAMVVFSILWGTFIYCPLTHWVWDEGPLSYFAGDKALAGGALDFAGGT
FT                   VVHISSGISALVAALLIGPRMGYPREPLQPHNLTYTALGAAMLWVGWFGFNAGSELASD
FT                   DLTASAFAVTHFSAAAGAVAWVTLEWLVLGKPTVLGASSGAVAGLVCITPAAGFVQPMP
FT                   ALIMGAMAGGVCYWACSTLKHKLRYDDALDAFGVHGVGGTLGAILTGVFATRAAWDVSD
FT                   GVPIGLIESGGDFTLVIGQVVAVLVTYVFAGVGSLILLKLIDICIGLRVPAESEQRGLD
FT                   ISDHGEEGYQFA"
FT   CDS_pept        complement(148946..149146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB298"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYZ2"
FT                   /protein_id="CAD71498.1"
FT                   /translation="MGGPRNGMVRSRMTPLKQRAGCPGFGRHRILPEIMKNARVSRVDC
FT                   GPFPWGSEPIEAGSRGCPLWS"
FT   CDS_pept        149063..150331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrA"
FT                   /locus_tag="RB299"
FT                   /product="probable serine protease HtrA"
FT                   /function="stress response; proteolysis"
FT                   /EC_number="3.4.21.-"
FT                   /note="PMID: 1645840 best DB hits: BLAST: gb:AAK02818.1;
FT                   (AE006110) HtrA [Pasteurella multocida]; E=0.003
FT                   swissprot:P45129; HTOA_HAEIN PROBABLE PERIPLASMIC SERINE
FT                   PROTEASE; E=0.010 gb:AAC38202.1; (AF018151) HtrA
FT                   [Haemophilus influenzae]; E=0.010 COG: HI1259; COG0265
FT                   Trypsin-like serine proteases, typically; E=0.001 degQ;
FT                   COG0265 Trypsin-like serine proteases, typically
FT                   periplasmic,; E=0.009 PFAM: PF00595; PDZ domain (Also known
FT                   as DHR o; E=5e-11"
FT                   /db_xref="GOA:Q7UYZ1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYZ1"
FT                   /protein_id="CAD71499.1"
FT                   /translation="MTAEPGTPCPLFQRCHPAPYHAISRPSHPSCGPMRSVSLIHQSTK
FT                   IAGFLLLSTLASVSHAATPEEIAAQIESLSSDSYLRRENATEALLKAGPAAIDPLVKVL
FT                   ERGDLETTQRAIGILQSIAMARPIIEGESERPKLARLDPDEPDAWETLLSLSTMGGSRG
FT                   ERASMAVEEITHVRRAQTIQTLSLQGAVIGVKEFVYGATSTLQRVVEINEAYQGDDSLL
FT                   ELLRWIDRVEYARIEGPAIREGVLKGITQMPDLKTLSLLYGDINMETMKVIGDLESIDH
FT                   LEFRYVTLNDEMIDAIAKLPIRVSLTLNGTDASSDRVDRLRQTLPGLKIEYKRGGFLGV
FT                   RCNDTFNECIIQSVVEDSGAEAAGLRRDDVIIQANGEPVRRFADLQAVINTRDPGQNIH
FT                   IVYRRLNVEYETDAKLGKLTEPN"
FT   CDS_pept        150470..151573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="RB301"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /function="DNA repair (direct repair, base excision repair
FT                   and nucleotide excision repair)"
FT                   /EC_number="3.2.2.-"
FT                   /note="PMID: 2197596 PMID: 9846876 best DB hits: BLAST:
FT                   gb:AAG58092.1; AE005526_5 (AE005526) adenine glycosylase;
FT                   G.C -->; E=2e-57 swissprot:P17802; MUTY_ECOLI AG-SPECIFIC
FT                   ADENINE GLYCOSYLASE; E=3e-57 gb:AAK04939.1; AE006318_2
FT                   (AE006318) AG-specific adenine; E=2e-55 COG: mutY; COG1194
FT                   A/G-specific DNA glycosylase; E=3e-58 aq_282; COG0177
FT                   Predicted EndoIII-related endonuclease; E=2e-16 MTH496;
FT                   COG1194 A/G-specific DNA glycosylase; E=3e-15 PFAM:
FT                   PF00730; HhH-GPD superfamily base exci; E=4.5e-42"
FT                   /db_xref="GOA:Q7UYZ0"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYZ0"
FT                   /protein_id="CAD71500.1"
FT                   /translation="MRKRLLSWFSDNARDLPWRRDHSPYRVWISEIMCQQTQVATVLPY
FT                   FERFLSTYPTIRDLADADESQLMRMWEGLGYYRRARSLHAAAKKMVEEHNGEFPESFDD
FT                   VLALPGIGRYTAGAIQSISRNKAFPILEGNTQRVFSRWIGLTVPPTEKVAQARLWELSD
FT                   KMLPPRKADDRSNGPAGFNQAAMELGALICSPRSPKCDECPVATMCHANQMGLQDEIPG
FT                   KISKVQYESRTELAVVISRDDRYLVRTIPEGVRFAGMIDFPRAGPPEAADVVGMESWLA
FT                   DQLGGDVRIGMCLKTIKHAVTRYRMTLHVHIGEWIADGDRVAESGPIPDSWQWATVDEL
FT                   ADMPMSVTGRKIVRLLDRPQRSLFSEL"
FT   CDS_pept        151630..151791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB303"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYY9"
FT                   /protein_id="CAD71501.1"
FT                   /translation="MPKMLNCRSCLKARNQRVSHRLAIGFPAVTASRENKPDSSARCFV
FT                   STTPSQTL"
FT   CDS_pept        151755..153029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB304"
FT                   /product="cytochrome-c peroxidase"
FT                   /function="electron transport and membrane-associated
FT                   energy conservation"
FT                   /EC_number="1.11.1.5"
FT                   /note="best DB hits: BLAST: pir:B75584; cytochrome-c
FT                   peroxidase (EC 1.11.1.5) DRA0301; E=2e-45 swissprot:Q49128;
FT                   MAUG_METEX METHYLAMINE UTILIZATION PROTEIN MAUG; E=9e-45
FT                   swissprot:Q50426; MAUG_METFL METHYLAMINE UTILIZATION
FT                   PROTEIN MAUG; E=2e-42 COG: DRA0301; COG1858 Cytochrome c
FT                   peroxidase; E=2e-46"
FT                   /db_xref="GOA:Q7UYY8"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYY8"
FT                   /protein_id="CAD71502.1"
FT                   /translation="MLRFNDAFPNTLNFTMTIHRFLMCAAATLVAAGPTAFAAETVSLG
FT                   DPTLTAGIPGDGPLTLEQAQRFLADDDNHTELNVELPKGLDAASGNIYIPEDNPITRAK
FT                   IELGRQLYFDPRLSADGTISCATCHAPETGWGAPTQFGEGIRGQTGNRNSPVSFNRILS
FT                   KHQFHDGRAASLEEQAVGPIANPIEMGNTHEVCVKTLADNPVYKAQFDKVFDDGVTIDN
FT                   IGKALATFERAIVTGPAPYDYYAPLSAFEKTFAEDLEYLDEEPALAEQYAKLKEEAAKN
FT                   PMTESSIRGMELTFGKANCTACHAGANFTDEQFHNIGVGMDSENPDLGRFEVTKEEKDR
FT                   GAFKTPTMRNVADTGPYMHDGSQATLEEVIEWYNKGGHPNPYLSNKMKPLNLTEQEKAD
FT                   LVEFMRQGLQSDFPVIEAGRLPAEG"
FT   CDS_pept        153262..153450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB306"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYY7"
FT                   /protein_id="CAD71503.1"
FT                   /translation="MGEVRRVQIRRKAALKNCTTKNHGGDRRATALHASLCCKASVRLP
FT                   GENLAYFYFTAKTIEPT"
FT   CDS_pept        complement(153443..154873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB307"
FT                   /product="NAD-dependent malic enzyme"
FT                   /function="C-compound and carbohydrate utilization"
FT                   /EC_number="1.1.1.38"
FT                   /note="PMID: 2644282 PMID: 36376 best DB hits: BLAST:
FT                   swissprot:P16468; MAOX_BACST NAD-DEPENDENT MALIC ENZYME
FT                   (NAD-ME); E=1e-141 embl:CAB72197.1; (AL138851) putative
FT                   malate oxidoreductase; E=1e-135 pir:S74511; malic enzyme -
FT                   Synechocystis sp. (strain PCC 6803); E=1e-118 COG: slr0721;
FT                   COG0281 Malic enzyme; E=1e-119 PFAM: PF01842; ACT domain;
FT                   E=7.3e-05 PF00390; Malic enzyme; E=0.034 PF01488; Shikimate
FT                   / quinate 5-dehydrogen; E=0.17"
FT                   /db_xref="GOA:Q7UYY6"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYY6"
FT                   /protein_id="CAD71504.1"
FT                   /translation="MNQHSPSYAITIRLRYSDSPGAMGKITTAIGEADGAIGAVDIVNI
FT                   RGGKISRDFTVNARDVDHGKRIVEHLRTVEEVEVVHTSDRVFLMHLGGKIEVLPKMPIK
FT                   TRDDLSMAYTPGVARVCNAIAEDPDSSFALTIRQNTVAVVSDGSAVLGLGNIGPRAAMP
FT                   VMEGKAMLFKEFAGVDAFPICLDTQDTEAIIETVRQLAPTFGGVNLEDISAPRCIEIEE
FT                   RLDKELEIPVFHDDQHGTAIVVLAGLKNSLLRVGKALPNIRIVVNGAGAAGTAIVKLLL
FT                   ISGAKDIVVCDRDGAIHAGEPSQPDASKQWIADNTNPRGASGKLSEVIQGADVFIGVSA
FT                   PNVLQTEDVAAMAADPIVFALANPDPEILPANAAPHVRIMATGRSDFPNQINNVLCFPG
FT                   LFRGVLDVRATTINNEMKLAAAEAIAATIPESDLLDDYVIPSVFDRRVAKVVAQAVAKA
FT                   AVDTGVARRRNKPAEDIM"
FT   CDS_pept        complement(154993..156441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlI"
FT                   /locus_tag="RB309"
FT                   /product="probable magnesium protoporphyrin chelatase"
FT                   /function="metabolism of vitamins, cofactors, and
FT                   prosthetic groups"
FT                   /note="PMID: 8663186 best DB hits: BLAST: pir:G75255;
FT                   probable magnesium protoporphyrin chelatase -; E=3e-84
FT                   pir:D70717; hypothetical protein Rv0958 - Mycobacterium
FT                   tuberculosis; E=4e-69 gb:AAF82071.1; AF232750_3 (AF232750)
FT                   Rv0958-like protein; E=2e-25 COG: DR2594; COG1239
FT                   Mg-chelatase subunit ChlI; E=2e-85 PFAM: PF01078; Magnesium
FT                   chelatase, subunit Chl; E=1.1e-12"
FT                   /db_xref="GOA:Q7UYY5"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYY5"
FT                   /protein_id="CAD71505.1"
FT                   /translation="MTSPVPSPAKTTMDAPEARNLQQLIESGWKSKSVKQEIRDNFSRM
FT                   LANREELFPGIVGYEDTVIPEISLALLAGHDMLFMGEKGQAKSRIMRQLVQFLDPWIPF
FT                   IDHPDLPVHEDPLNPISSLGKRLVAEHSPEDIQIGWWHRSERYAERLSPGTKFADIIGE
FT                   IDPAKLTGGVSMSAEEALSFGLIPRMHRGIFAMNELPELDDLVQVGLFNILEERDVQIR
FT                   GYPIRFELDVMILFSANPSTYNRSGKVIPQLKDRIGTIVQTHYPSERTQGIEILQQEVG
FT                   DDLGGPYPVHVPLFMYQIIEEITHQARQSKYIDQASGVSARFSLANFRTIVASARQRGI
FT                   VHGESPAVPRISDLGHLYASSLGKLELDLMGTHQMTEKQVIDSVIAEAIQTVFGEYIEE
FT                   HGLAEIAEIFRGGVRVEVGTMLPSSEYAERLQHVPPAWDRAFEVNASENEAMRASCVEF
FT                   VLAGLYSMDKISRSQRHGKISYET"
FT   CDS_pept        complement(156664..156945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB313"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="GOA:Q7UYY4"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYY4"
FT                   /protein_id="CAD71506.1"
FT                   /translation="MLWRLELLVSRFNDGATLVITAFRAYDVRWHGGAALRAVGHLTLF
FT                   QVIVGAAFAGTAIGVLAFWDGHGRQARERAILEWVEWTNFKPRKISTR"
FT   CDS_pept        156968..157897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="RB314"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /function="fatty acid biosynthesis"
FT                   /EC_number="2.3.1.39"
FT                   /note="PMID: 1339356 PMID: 7768883 best DB hits: BLAST:
FT                   embl:CAB45522.1; (AJ007046) [acyl-carrier protein]; E=9e-58
FT                   pir:T00580; probable [acyl-carrier-protein]
FT                   S-malonyltransferase (EC; E=1e-57 gb:AAG43518.1; AF210698_1
FT                   (AF210698) malonyl-CoA:ACP transacylase; E=1e-56 COG:
FT                   HI0156; COG0331 (acyl-carrier-protein)
FT                   S-malonyltransferase; E=6e-52 PFAM: PF00698; Acyl
FT                   transferase domain; E=3.2e-16"
FT                   /db_xref="GOA:Q7UYY3"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYY3"
FT                   /protein_id="CAD71507.1"
FT                   /translation="MSLDAAKPAILFPGQGAQTPGMGTWLCAEYPIANELFDEAADVLG
FT                   YDLKSLCADGPAEKLNETVHSQPALFVVGVAAARVHDDLNPELAKKIVAAAGLSLGEYT
FT                   AVCYAGGVSFADGLKLVQKRGEAMQACADATDSGMASVLGLDLEKLTSVCEECRSGDEI
FT                   LQPANLLCPGNIAVSGHRSALERLEPAASAAGAMKVVPLSVAGAFHTPIMDGAVEQLTR
FT                   ALEEVELSDTRIPVYSNVDAKPHTSADEIRQLLARQVVNPVRWDDSINAMLGDGVDGFL
FT                   EAGTGRVLRGTIKRIARKTPTDGFGDQP"
FT   CDS_pept        158031..158789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="RB316"
FT                   /product="3-oxoacyl-(acyl-carrier protein) reductase"
FT                   /function="fatty acid biosynthesis"
FT                   /EC_number="1.1.1.100"
FT                   /note="PMID: 1556094 PMID: 8759840 best DB hits: BLAST:
FT                   ddbj:BAB06210.1; (AP001515) 3-oxoacyl-(acyl-carrier
FT                   protein); E=3e-52 swissprot:Q9X248; FABG_THEMA
FT                   3-OXOACYL-[ACYL-CARRIER PROTEIN]; E=7e-50 pir:G75333;
FT                   3-oxoacyl-acyl carrier protein reductase - Deinococcus;
FT                   E=1e-49 COG: BH2491; COG1028 Dehydrogenases with different
FT                   specificities (related; E=3e-53 BS_fabG; COG1028
FT                   Dehydrogenases with different specificities; E=1e-49 RP762;
FT                   COG1028 Dehydrogenases with different specificities
FT                   (related; E=7e-48 PFAM: PF00106; short chain dehydrogenase;
FT                   E=3.2e-73 PF00678; Short chain dehydrogenase/reduct;
FT                   E=9.9e-16"
FT                   /db_xref="GOA:Q7TU11"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TU11"
FT                   /protein_id="CAD71508.1"
FT                   /translation="MDLSLSVDLKDQVAIVTGASQGLGRAVAVALGQNGAHVVCVARNA
FT                   EKLAATVAEIEAAGGKGEALPCDVTDRKAAAEAIEGTHKKHGRLDILVNNAGITRDKLM
FT                   RGMSDEEWDSVIATNLTSCFVCCRSAAGVMRRSKYGRIINMASISGLIGNPGQANYSAS
FT                   KAGMIGMTRTMSKELVSRGVTVNAVAPGFIASEMTAELGEVVLEEVKKRIPAKRVGQPE
FT                   DVAAAVLFLASRDASYISGQTIVVDGGMVG"
FT   CDS_pept        158928..159173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="RB318"
FT                   /product="acyl carrier protein precursor"
FT                   /function="fatty acid biosynthesis"
FT                   /note="PMID: 1556094 PMID: 2091027 best DB hits: BLAST:
FT                   gb:AAC63956.1; (AF038925) acyl carrier protein precursor;
FT                   E=2e-16 pir:E82128; acyl carrier protein VC2020 [imported]
FT                   - Vibrio cholerae; E=1e-13 pir:F75333; acyl carrier protein
FT                   DR1942 [similarity] - Deinococcus; E=3e-13 COG: VC2020;
FT                   COG0236 Acyl carrier protein; E=1e-14 PFAM: PF00550;
FT                   Phosphopantetheine attachment site; E=2.2e-19"
FT                   /db_xref="GOA:Q7UYY2"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7UYY2"
FT                   /protein_id="CAD71509.1"
FT                   /translation="MASIEERVVDIVSEQLGVDKDKITRETSFVNDLGADSLDTVELVM
FT                   ELEEEFDISIPDDSAEKIQKVGEAIDFIEKEKGEDA"
FT   CDS_pept        159334..159621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB319"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYY1"
FT                   /protein_id="CAD71510.1"
FT                   /translation="MCSSHSCLCPCVCTDRRILVCPHSNERLDTTSNHASPGNVSPIAI
FT                   IRNADCIAAISHCQFVILTRCWRRFLLCCLSRVPRSLLSTLNHVNSSPRS"
FT   CDS_pept        159618..160907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="RB320"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase"
FT                   /function="fatty acid biosynthesis"
FT                   /EC_number="2.3.1.41"
FT                   /note="PMID: 7972002 best DB hits: BLAST: pir:G69842;
FT                   3-oxoacyl-[acyl-carrier-protein] synthase (EC 2.3.1.41);
FT                   E=1e-105 pir:T12022; 3-oxoacyl-[acyl-carrier-protein]
FT                   synthase (EC 2.3.1.41); E=1e-103 pir:S77464;
FT                   3-oxoacyl-[acyl-carrier-protein] synthase (EC 2.3.1.41);
FT                   E=1e-103 COG: BS_yjaY; COG0304
FT                   3-oxoacyl-(acyl-carrier-protein) synthase I; E=1e-106 PFAM:
FT                   PF00896; Phosphorylase family 2; E=0.27 PF00108; Thiolase,
FT                   N-terminal domain; E=0.071 PF00109; Beta-ketoacyl synthase,
FT                   N-ter; E=1e-78"
FT                   /db_xref="GOA:Q7UYY0"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYY0"
FT                   /protein_id="CAD71511.1"
FT                   /translation="MTDASSTPSYDPSMSRRVVITGLGTVTPLGCDVETLWSALLAGKS
FT                   GIHELSIMDTSKYKVHFGGDIPDFNVADHVEPKEAKRLDRFTQFAVHAGAQAVQDSGID
FT                   WEKTDRTRCGVILGSGIGGLNEIEEQIERMLNKGPDRVSPFTVPKMMVNAAGGNISIRY
FT                   GLKGPNYAVATACASATNAMGDALRSIRGGETDVVITGGTEAAITRMGLAAFQNMKALS
FT                   TRNDEPQRASRPFDSDRDGFVLAEGAGLLVFEELEHAKARGAKIYAEVLGYGTTSDAGH
FT                   ITAPDPEGLGAAAAMRAAIQDSGRAASEIDYINAHGTSTPLGDKAETRAIHTVLGDHAQ
FT                   NVAISSTKSALGHSLGASGGIEAVILCQTIQNNVIAPTINLDTPDPSCDLDYVPNQPRE
FT                   QKVDLAMSNSFGFGGHNACVLFGRFSHDGS"
FT   CDS_pept        160852..161607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB321"
FT                   /product="response regulator"
FT                   /function="two-component signal transduction"
FT                   /note="PMID: 9741082 best DB hits: BLAST: embl:CAA05049.1;
FT                   (AJ001848) TDIR [Thauera aromatica]; E=8e-28 gb:AAD12186.1;
FT                   (U57900) putative DNA binding protein TutB1; E=1e-24
FT                   gb:AAK00179.1; AF222754_7 (AF222754) probable nodulation
FT                   protein; E=4e-24 COG: PA4196; COG2197 Response regulators
FT                   consisting of a CheY-like; E=3e-22 PA5511; COG2204 AAA
FT                   superfamily ATPases with N-terminal receiver; E=1e-15 uvrY;
FT                   COG2197 Response regulators consisting of a CheY-like
FT                   receiver; E=2e-10 PFAM: PF00072; Response regulator
FT                   receiver doma; E=5.1e-23 PF00196; Bacterial regulatory
FT                   proteins, l; E=5.1e-10"
FT                   /db_xref="GOA:Q7UYX9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYX9"
FT                   /protein_id="CAD71512.1"
FT                   /translation="MAVTTHAFSLDGSLMTALDNPNSDLFDPNASPQEDAGPEPVVYLV
FT                   DDQQAELDLLQRWCSQEGLKTETFNQAEDLLKLLHADSHGCVVADLRMPRLSGLELQAE
FT                   MSRRELTIPVILVTGHGDAENCRAAFQQGVFDFIEKGFRHEEILHAINSAIRKHRRDRF
FT                   RHQVRKEALDLLRKISPRETEVMLLLAGGSPLKGIAQELSISVQTASKHRGSIFTKLNI
FT                   DNEVDLYKMLLAAEVNLDVGPAALIPPAP"
FT   CDS_pept        complement(161698..162702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB322"
FT                   /product="probable multidrug efflux pump"
FT                   /function="drug transporters"
FT                   /note="PMID: 9925549 best DB hits: BLAST: ddbj:BAA34299.1;
FT                   (AB015853) MexX [Pseudomonas aeruginosa]; E=5e-05
FT                   pir:E82263; conserved hypothetical protein VC0913
FT                   [imported] -; E=5e-05 pir:A83342; conserved hypothetical
FT                   protein PA2430 [imported] -; E=5e-05 COG: VC0913; COG0845
FT                   Membrane-fusion protein; E=4e-06 PA2430; COG1566 Multidrug
FT                   resistance efflux pump; E=5e-06 PA2019; COG0845
FT                   Membrane-fusion protein; E=1e-05 PFAM: PF00364;
FT                   Biotin-requiring enzyme; E=0.46 PF00529; HlyD family
FT                   secretion protein; E=0.0014"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYX8"
FT                   /protein_id="CAD71513.1"
FT                   /translation="MLASGTELKIANLFSRRSDAFSIRRMPANQALAAAAFVTMTFGGA
FT                   SMLLADDAKSKPIVIEGAQTTLVTDLTLAAPIAGRVMSVTATEGQQVSKSDVLVQLDDR
FT                   RAKAELAAAESAAKAAELRSTSDVDQRYAERTREVRMRELEQSIDANKRYQNSVTATEI
FT                   DRLQLVIDQAGLSIEQARKELEVAEAQADEKLSLVEMAKLRLSEHRVDSPVVGNVAETM
FT                   VSVGEWVEAGAPLLRVVSLDPIRVSGFVDGRVHGGELKGRPVEFEWTQSIGGEDQSIVL
FT                   SGEVTFVSLEVHPVNSQVRMWATLRNPDQLARPGVRGTMRILPAVGEAKTPAE"
FT   CDS_pept        162731..162880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB324"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYX7"
FT                   /protein_id="CAD71514.1"
FT                   /translation="MNQTSRQSNSIVCACRPLSKPASDPAEMPNRVGICYDARRRLTTS
FT                   INIL"
FT   CDS_pept        162916..163155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB327"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYX6"
FT                   /protein_id="CAD71515.1"
FT                   /translation="MEPPPETVVQQVKLFKGVDSELPELERQINRWIRKSGARVLSING
FT                   NLAPAPAAGSGPMNSFAAGDVLIIVHVEIDTPQG"
FT   CDS_pept        complement(163156..163788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="RB328"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /function="pyrimidine-ribonucleotide metabolism"
FT                   /EC_number="2.4.2.10"
FT                   /note="PMID: 6207018 PMID: 1709162 best DB hits: BLAST:
FT                   pir:B70464; probable orotate phosphoribosyltransferase (EC
FT                   2.4.2.10); E=3e-31 pir:S76099; probable orotate
FT                   phosphoribosyltransferase (EC 2.4.2.10); E=7e-27
FT                   pir:A70834; probable orotate phosphoribosyltransferase (EC
FT                   2.4.2.10); E=1e-26 COG: aq_1907; COG0461 Orotate
FT                   phosphoribosyltransferase; E=3e-32 MJ1655; COG0503
FT                   Adenine/guanine phosphoribosyltransferases and; E=3e-05
FT                   HI0272; COG0461 Orotate phosphoribosyltransferase; E=3e-05
FT                   PFAM: PF00156; Phosphoribosyl transferase domai; E=7e-27"
FT                   /db_xref="GOA:Q7UYX5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7UYX5"
FT                   /protein_id="CAD71516.1"
FT                   /translation="MVFVPIEPLTSSLENTWMSSDSANRDLAPLIALMETEALQRGEFT
FT                   LASGKKANYYLDCRRVTLHPKGACLIGRAMLDVVLANAKESGVMPAAVGGMAIGADPIT
FT                   ASIVTLAGGDDVDLKGFMVRKEPKGHGMGQQVEGPVTPGQKVVIVEDVITSGGSALKAV
FT                   EAVQAFGLEVQYVLAIIDRLAGGAEAFAQKGLELKTLTTIRDFGLEP"
FT   CDS_pept        163877..165901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB331"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYX4"
FT                   /protein_id="CAD71517.1"
FT                   /translation="MAPAPARIPTPLNPHILSPACSMPSSVFRGSLRFVFAIAFAGASV
FT                   CVNQAFVTADETTQWLQLIEQSKSELDANRLPSQEQTEVEVVAAMEAADAFFQRVTDPS
FT                   NYDAWMKFLDFGPLQSAIEGHESVAKRGNAAVELSQRLSGPEEGLELSRLVALRESLDR
FT                   YLAALRYGDPKRGLAVIERQLETLTEILSPEEIDGEQSESTPRSLVDLSGEEVAQIESI
FT                   VETLAAANQSGDLVSRITGRYSSPNLRAFVDGRVIADAITRPVNNPERVNDCLLGTRII
FT                   GDARVVGNVTGSLLPSEGNVRLLIRLDGQFSTSTKGYNGPVTLRSSGFGQVYAARQLVI
FT                   TEKRIFAGEPIATASLSTQINQINHPLKLVRKIASKKAAEMKPQAEAISRRKLQDRVLE
FT                   GFRQQTDEASARTFPDLDAKMSPWLRRLDLPAPTRTIGSTTDAVHVQATMRRPFGLSAA
FT                   GEGPSLSMVRTATSSGTYPGGYSAAIQVHESILNNTVMKLLAGETFTPEKLRDLTSSFG
FT                   IPSDKDDASVETDSNDDEQAESFEVDFSGFRPVYFEARDQTLRIGLRGDRFAQGDRELD
FT                   RRLEVSAVYRPAITGDGRMILIRDEDIDLKFPGGRRLTLSQTAIKANIEEGFDKLFPMT
FT                   LLHREWTLPSTLQLPALAGRSAKVIGIDARDGWLTIVVR"
FT   misc_feature    164513^164514
FT                   /note="cosmid pircos-d2e11/ cosmid pircos-b2f07 joining
FT                   point"
FT   CDS_pept        166018..168441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB334"
FT                   /product="copper-transporting ATPase"
FT                   /function="metal ion transporters (Cu(2+), Fe(2+), etc.);
FT                   transport atpases"
FT                   /EC_number="3.6.3.4"
FT                   /note="PMID: 8490659 best DB hits: BLAST: gb:AAD11750.1;
FT                   (AF067954) putative cation transporting P-type; E=0.0
FT                   swissprot:Q9X5V3; ATCU_RHILV COPPER-TRANSPORTING ATPASE
FT                   -----; E=0.0 embl:CAC07984.1; (AJ278983) CopF Cu-ATPase
FT                   [Ralstonia; E=1e-180 COG: sll1920; COG2217 Cation transport
FT                   ATPases; E=1e-150 PFAM: PF00122; E1-E2 ATPase; E=1.8e-93
FT                   PF00702; haloacid dehalogenase-like hyd; E=1.8e-32"
FT                   /db_xref="GOA:Q7UYX3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYX3"
FT                   /protein_id="CAD71518.1"
FT                   /translation="MPPSQANAMNPTEIQAIDPVCGMSVDPAKSLSSQHNGRTFYFCSA
FT                   GCQKKFDSDPDGVLESRKKENAESESSDCCSTQPTCCGGGSHGKPQTSQQSDDPEAVYT
FT                   CPMHPEVEQVGPGDCPICGMDLEPKFVDPTSSGDEAQYNDMKRRFWIGVALSVPLLILS
FT                   MGPMVGLPINRWISSGMDGWLQFALATPVVFWCGWPLLVRGAKSFRSWNLNMFSLIALG
FT                   SLAAFGFSVLAILLPDWIPTAFYEADRPPLYFEAAAVIITLVLLGQVLELRARQQTGGA
FT                   IRELMQLTPDIAHRIEGEDERDVSLDEVQSGDHLRIRPGEKIPVDGEVIRGSSRVDESM
FT                   LTGEPVPVEKNEGDALTGGTLNQSGSLEMTATQVGGDTVLHRIVQMVADAQRSQAPIQK
FT                   LVDQVAQYFVPAVILSSILASIVWSIVGPEPALAYAFVSAIAVLIIACPCALGLATPMS
FT                   VMVGVGRGAKEGVLIRDAEILEIMEKVDTIVVDKTGTLTKGRSAVTAIETQGDWSESDV
FT                   LAIAAAVEQSSEHPLGRAIVEYAEASDTQRRVAKDFQSTTGKGVVAEVDGKHVAIGNPN
FT                   WLAELNVTGLESVRDPAEQHQANAATVVYVAVDRSLAAIIAIKDPIKSSTPDAIQALHS
FT                   LGLRVVMLTGDARSTAEAVAKQLGIDDFRANVSPEAKHDFVQQLKQEGKTVAMCGDGIN
FT                   DAPALAASNVGIAMGTGTSVAMESAGVTLVGGDLRGVVAAKQLSQKTMRNIRQNLFFAF
FT                   AYNALGIPIAAGLLYPFFGILLSPMIAAAAMSFSSVSVIANALRLRTIQLSAPN"
FT   CDS_pept        complement(168385..168642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB335"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYX2"
FT                   /protein_id="CAD71519.1"
FT                   /translation="MRAGPEGLRPAANKVSVWGRRARALPLTKLGEGTRIIARRRRKLP
FT                   SGVALPRSGLLIPNVNPRLIINSVRCAQLDGAQSKSIGND"
FT   CDS_pept        complement(168676..169191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB336"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q7UYX1"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYX1"
FT                   /protein_id="CAD71520.1"
FT                   /translation="MRLQDDPIAFFLTWTCYGTWMPGDDRGWTKWHCGDQVPQPRLADW
FT                   CRDKMVDSAVLLLPEQRTMIESVVREHCEKRCWCLHAVNCRTNHCHVVVTAPNYDGEQV
FT                   RDQLKSWGKRRMKERERQLGVAEECVRDRWWTRKGSVRYLFDEDSLSAATTYASEAQDV
FT                   GGSSANSL"
FT   CDS_pept        169241..169534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB337"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYX0"
FT                   /protein_id="CAD71521.1"
FT                   /translation="MLPPRAVRILPGNQELVSFRMDRLNRQLQMRGSAPGGLRHSANKI
FT                   PLPSSLRPTNSPPLLAVGREPSGFQHRLKFERWLGFRNIQNPFIFLCSIGWF"
FT   CDS_pept        complement(169531..169830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB339"
FT                   /product="conserved hypothetical protein"
FT                   /note="best DB hits: BLAST: swissprot:P72699; Y230_SYNY3
FT                   HYPOTHETICAL 13.3 KD PROTEIN SLL0230; E=9e-37 prf:2118405D;
FT                   ORF YBL0105 [Saccharomyces cerevisiae]; E=8e-16 pir:D75018;
FT                   hypothetical protein PAB1240 - Pyrococcus abyssi; E=1e-12
FT                   COG: sll0230; COG0011 Uncharacterized ACR; E=9e-38 PFAM:
FT                   PF01910; Protein of unknown function DUF77; E=3.4e-51"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYW9"
FT                   /protein_id="CAD71522.1"
FT                   /translation="MKVIVDLCVVPMGVGVSVGKYVAECQKVLQEAGLKHQLHAYGTNI
FT                   EGDWDEVFAAIKLCHERVHAFGAPRITTSIKVGTRTDREQSMQDKIDSVVEKTT"
FT   CDS_pept        169852..170124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB341"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYW8"
FT                   /protein_id="CAD71523.1"
FT                   /translation="MARSVGWLLSLRGRDASGTAHRLASCDSCLGRTTRFVCVLANSTL
FT                   SAQKRSDFRERLDFATVESKYESKAHFRRSCRRNAGCKTGAKKWK"
FT   CDS_pept        170094..170666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkpA"
FT                   /locus_tag="RB342"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /function="protein folding and stabilization"
FT                   /EC_number="5.2.1.8"
FT                   /note="PMID: 8703024 best DB hits: BLAST: swissprot:O08437;
FT                   FKBA_AERHY FKBP-TYPE PEPTIDYL-PROLYL CIS-TRANS; E=4e-22
FT                   pir:H83238; probable peptidyl-prolyl cis-trans isomerase,
FT                   FkbP-type; E=2e-21 pir:D82331; peptidyl-prolyl cis-trans
FT                   isomerase, FKBP-type VC0354; E=2e-21 COG: PA3262; COG0545
FT                   FKBP-type peptidyl-prolyl cis-trans isomerases 1; E=2e-22
FT                   PFAM: PF00254; FKBP-type peptidyl-prolyl cis-trans;
FT                   E=1.3e-29"
FT                   /db_xref="GOA:Q7UYW7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYW7"
FT                   /protein_id="CAD71524.1"
FT                   /translation="MQDRSEKVEMKTWLPVCLIGMLLIVPACRSTAPSTPPIVSEPTLP
FT                   DFPDAQPAKPNFVSFVDRPELQAGTGPMDSDASLEFIETSSGLKYRILRKSDGKKPTAF
FT                   DTVSVHYRGWLNNGKVFDNSYDRGEATTFPLDGVIAGWTEGMQLIGEGGMIELWVPSYL
FT                   GYGERGSPGSIPAHAILHFIVELESVK"
FT   CDS_pept        complement(170782..171516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB343"
FT                   /product="conserved hypothetical protein"
FT                   /function="viral proteins"
FT                   /note="PMID: 8572946 best DB hits: BLAST: gb:AAA96808.1;
FT                   (L41843) ORF910; putative [Bacteriophage mv4]; E=0.002"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYW6"
FT                   /protein_id="CAD71525.1"
FT                   /translation="MSSFMNCRWMLFVVAITLTTTAKAVDSDAASLTLGKLPAGKVLFL
FT                   GNSITLHGPSEKIGWKGNWGMAASSKEQDYVHLVTARIAKSIGDRPKIKVRNIAAFERE
FT                   YETFDVATGLKDEFGFRADIVIVAIGENVTAPATEEAKVAFAEAFSGLLDSVRQHGKPE
FT                   IFVRSSFWPNSVKDDIMRHASEAAGATFIDITELGNDQANRASAERDFEHAGVAAHPGD
FT                   KGMQAIASAIVAAIRANAGVTE"
FT   CDS_pept        complement(171693..173795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB344"
FT                   /product="probable xanthan lyase"
FT                   /function="sugar, glucoside, polyol and carboxylate
FT                   catabolism"
FT                   /note="PMID: 11157235 PMID: 10966413 best DB hits: BLAST:
FT                   ddbj:BAB21059.1; (AB037178) xanthan lyase [Bacillus sp.
FT                   GL1]; E=3e-13 gb:AAG24953.1; AF242413_1 (AF242413) XalA
FT                   [Paenibacillus; E=2e-10 gb:AAG42262.1; AF318176_1
FT                   (AF318176) putative xanthan lyase XalB; E=0.050 PFAM:
FT                   PF00070; Pyridine nucleotide-disulphide; E=0.00077"
FT                   /db_xref="GOA:Q7UYW5"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYW5"
FT                   /protein_id="CAD71526.1"
FT                   /translation="MSLITRATTVFLSVLLTLVWSMPTGAADPEPVDLVVYGGTSAGIA
FT                   AAVQAQRMGKTVIVIEPSQRVGGLTTGGLGQTDIGNKAAIGGIAREFYEDIATYYQYAS
FT                   AWKFQRSDEYRGGGQSKTAAGEAAMWTFEPSAALSVYEDWIERDGIRVDYGKRLDRSAV
FT                   MMTRSLPARIIAIRMESGETYRARMFIDATYEGDLLAAAGVSYTVGREANEQYGETLNG
FT                   VQTKMAIHHQLRNGIDPYVVPGDASSGLLPHIDPDGPGEEGGADHRVQAYCFRMCLTDH
FT                   PDNRIPFEKPDGYQPLWYELMLRNYEAGENAAPWINSPMPNRKTDTNNRLGFSTDFIGQ
FT                   NYDYPEATYEEREKIVAAHRLYQRGLMWTLANHPRVPENVRKQVARWGMCKDEFEEGNG
FT                   WQDQLYIREARRMVGEYVMTQKNCQGLPVEDPVGLAAYTMDSHNQQRYVDENGHARNEG
FT                   DVQVGGFPPYGISYRSLVPKRREVSNLLVPVCLSATHIAFGSIRMEPVFMVLGQTTATA
FT                   AVIAIDDQVAVQNVDYERLASRLLEDKQVLTYAGPEAKPGIDPKSLDGVVVDNSQAKTE
FT                   GGWMVSNSSGQRVGMNYLHDGDASKGDCVAVYEGKLKRPGRYQVNLLWPVHPNRASNTL
FT                   VTITDASGKQHEVRVNQRDSKSGGQANLGEFELEASATVEIKNEDSDGYVIADAVQFIP
FT                   VGVAGE"
FT   CDS_pept        complement(173846..174388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB347"
FT                   /product="ferredoxin, 2Fe-2S"
FT                   /function="electron transport proteins"
FT                   /note="PMID: 791660310884354 best DB hits: BLAST:
FT                   pir:S75307; ferredoxin [2Fe-2S] sll1584 [similarity] -
FT                   Synechocystis; E=2e-29 swissprot:O66511; FER2_AQUAE
FT                   FERREDOXIN, 2FE-2S (AAFD4) -----; E=3e-08 pdb:1F37; A Chain
FT                   A, Structure Of A Thioredoxin-Like [2fe-2s]; E=3e-08 COG:
FT                   sll1584; COG3411 Uncharacterized protein; E=2e-30 TM0010_1;
FT                   COG1894 NADH:ubiquinone oxidoreductase, NADH-binding (51;
FT                   E=8e-09 aq_108a; COG3411 Uncharacterized protein; E=8e-09"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYW4"
FT                   /protein_id="CAD71527.1"
FT                   /translation="MGIHVDHGPAVGILAVLVGTICETLRCLGTEARAGNDDIEGAPMT
FT                   SEPNSESTEAINPCDSESLRAIAGKLGIQTAKRHLFLCADQTKPKCCDKDASLESWNFL
FT                   KRRLKELCLVGPDASVIRTKANCLQVCAAGPIAVVYPDGVWYRDCTPEVLERIIQEHLI
FT                   GGEIVEEYCFTRNELNR"
FT   CDS_pept        complement(174256..175818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB348"
FT                   /product="arylsulfatase B"
FT                   /function="sulfatase; C-compound, carbohydrate catabolism"
FT                   /EC_number="3.1.6.12"
FT                   /note="PMID: 2303452 best DB hits: BLAST: gb:AAF49287.1;
FT                   (AE003522) CG7402 gene product [Drosophila; E=4e-41
FT                   gb:AAF30402.1; AF109924_1 (AF109924) sulfatase 1 precursor
FT                   [Helix; E=2e-39 swissprot:P15848; ARSB_HUMAN ARYLSULFATASE
FT                   B PRECURSOR (ASB); E=6e-38 COG: ydeN; COG3119 Arylsulfatase
FT                   A and related enzymes; E=2e-36 PFAM: PF00884; Sulfatase;
FT                   E=1.4e-48"
FT                   /db_xref="GOA:Q7UYW3"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYW3"
FT                   /protein_id="CAD71528.1"
FT                   /translation="MVSNKLCPSDFPPSSSNPAPANMPATNFAAVSRFVFLPLIFVFAT
FT                   EASRAAESTPPNIVVILADDMGYGDMGCMGSQTLQTPNLDRLAESGVLCSQAYVASAVC
FT                   SPSRAGLLTSRDPRRFGYEGNLNASDENYATRPELLGLPTSEKTLADHLGAAGYATALI
FT                   GKWHLGMGEMHHPNRRGFDHFCGMLTGSHHYFPATMKHVIERNGKRVDDFSSEYLTDFF
FT                   TDEGLRFIDQHKSANPDQPWFVFFSYNAPHTPMHATEADLARFANIQNQKRRTYAAMMY
FT                   ALDRGVGRIREHLEETGQWENTLLVFFSDNGGATNNGSWNGPLRGVKGSMREGGIRVPM
FT                   IWTWPAKFPAGVLYDGVVSSLDLLPTFCSAAGAEPLALADPMSHEDASNRKRMNRLSGT
FT                   HDGIDMAPHLADGSEPPNRRLYWRLQGQAAILDGTDKLLRPSHRPAELFEVSTDVSESH
FT                   DLSAQNPSRFRELYDELGAWESMLTTVPLWGSSPYWSGQSAKHYDAWEPRPEPETTTSK
FT                   EPQ"
FT   CDS_pept        175963..177417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB352"
FT                   /product="arylsulfatase (A or B)"
FT                   /function="sulfatase; C-compound, carbohydrate catabolism"
FT                   /EC_number="3.1.6.-"
FT                   /note="PMID: 7910580 PMID: 2303452 best DB hits: BLAST:
FT                   ddbj:BAA04535.1; (D17629) N-acetylgalactosamine 6-sulfate;
FT                   E=2e-32 gb:AAB03341.1; (U62317) arylsulfatase A [Homo
FT                   sapiens]; E=5e-32 gb:AAA51779.1; (M32373) arylsulfatase B
FT                   precursor [Homo sapiens]; E=7e-32 COG: PA0183; COG3119
FT                   Arylsulfatase A and related enzymes; E=4e-21 PFAM: PF00884;
FT                   Sulfatase; E=5.6e-75"
FT                   /db_xref="GOA:Q7UYW2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYW2"
FT                   /protein_id="CAD71529.1"
FT                   /translation="MSNPSFFAKAVAAFCCLVASDSHFAVADAENRPNILFILADDLAW
FT                   SDLGCYGHPWHDTPHLDRLASEGARFTQAYSPAPICSASRASILTGKTPARLQFEFVTK
FT                   NEPGRQKIDFPTPMSAPPLTLNLPLEEQTIAECLKDEGYQTAFFGKWHVSSHHERYLGW
FT                   SPTHGPAKQGFEFAEEDYGAHPYDWKRSPVATIKEPGRFAPDSMVQRVGAFLRQDHDRP
FT                   YFAMASSFYVHTPVRTPCQWLREKYDARVPATSKKRNNRIEYAAFLETFDHHVGQILNS
FT                   LEASGRADRTIVILNSDNGGHPEYTANAPLRGSKWNLYEGGIRVPMIVRWPGVVQPKTE
FT                   IDRPVIGYDLLPTMVALAGGNPPKCDGESFAGSLRGDSPPTNEQHSLIWHFPYYHPENG
FT                   FAKAPDSIGIDDFATSRTRPQSAIRRGQFKLLQFAEDNRVELYDLSNDIGELHDLSTQQ
FT                   ADLASELQQELRQTLTRQNARFPMAK"
FT   CDS_pept        complement(177380..177535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB354"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYW1"
FT                   /protein_id="CAD71530.1"
FT                   /translation="MDSPVASTCNRGRRPNGSNRNTRSFLPICFVRYPVRTARITSPSE
FT                   ILHFAA"
FT   CDS_pept        177713..178822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB356"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYW0"
FT                   /protein_id="CAD71531.1"
FT                   /translation="MILPIQANIPIVPRMFDMRLCFTATAVLFAFTCTVVHADHPSRKG
FT                   LADKHAPAGIMGDHLHQKGEWMVEYKYMVMSMEDNRIGETTVSDQDAIGPAGAPAGIVV
FT                   DGIQTNAGATPTQMTMEMHMAHIMYGASDDVTLYTMLMMPALTMDHIRGDGNPAGRGGE
FT                   FTTHNSGFGDTALGALLRLYSTDSQDLLFNLGCSVPTGDIYRETTAPTGGLMSQPLPYP
FT                   MRLGSGTFNARPGVTWKYFREWWSGGVQFQTDLPIGRNYRGYSVSDEFRLNSWTSVLLT
FT                   DNWSVSLRGEHLWRTDYDGSDSSANNLVISTNVEEFRGGYWYNLGIGTQLMAHGHYFNV
FT                   EFVPTIAQDLDGIQLETDYSVIASWSKAW"
FT   CDS_pept        complement(178844..179599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="RB357"
FT                   /product="probable ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /function="biosynthesis of vitamins, cofactors, and
FT                   prosthetic groups"
FT                   /EC_number="2.1.1.-"
FT                   /note="PMID: 9045837 PMID: 9139683 best DB hits: BLAST:
FT                   swissprot:O86169; MENH_BACST
FT                   2-HEPTAPRENYL-1,4-NAPHTHOQUINONE; E=1e-11 prf:2104259J; ORF
FT                   5 [Streptomyces peucetius]; E=3e-09 gb:AAG54506.1;
FT                   AE005196_4 (AE005196) unknown [Escherichia coli; E=7e-08
FT                   COG: DR0026; COG0500 SAM-dependent methyltransferases;
FT                   E=2e-07 PA5063; COG2226 Methylase involved in
FT                   ubiquinone/menaquinone; E=3e-07 aq_262; COG0500
FT                   SAM-dependent methyltransferases; E=1e-05 PFAM: PF01209;
FT                   ubiE/COQ5 methyltransferase f; E=0.0065"
FT                   /db_xref="GOA:Q7UYV9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYV9"
FT                   /protein_id="CAD71532.1"
FT                   /translation="MSEAIKPTSRFDDLKILWHLLFRPVRGNTHGERLESFYEGQASHY
FT                   DSFRARLLHGRSELMSWVDFPDNGVWVDIGAGTGHNLFSIEERSKSLAEVHLVDLSPSL
FT                   LQIASERIEERQLSNVTLHHADATQFELPENSVDVVTFSYSLTMIPDWFESVLIARRIL
FT                   KPGGVIAVTDFHVSRKHAAAPSRQHGWLRRTFWSLWFASDNVYLSSDHLAMLHRQFKIE
FT                   RCEERLGSVPYMPLVKAPYYLFLGRKPAN"
FT   CDS_pept        complement(179596..180843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB360"
FT                   /product="hypothetical protein"
FT                   /note="PMID: 11214968"
FT                   /db_xref="InterPro:IPR021829"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYV8"
FT                   /protein_id="CAD71533.1"
FT                   /translation="MVANWLGNKCFKVVHQKNLVYNTCWEDPRIDRQALSLGPDDSVLV
FT                   ITSAGCNALDYALQAPKSVHAVDMNPLQNALLELKCASIRCLTYDDFFNVFGRGYHPAW
FT                   QSLYHKHVRGALTPDTRAIWDRRLDFFDGTSRRKSFYFRGTSGLFAWLVNGYLKRPAGL
FT                   REAIAELLQAESVDQQREIYQKREINRLLWSKPLRWALRRDTTLAMLGVPRSQRNQLDQ
FT                   CYPGGIGGFIQDRIEAVFKTLPLRDNYFWRVYLTGSYTPDCCPEYLKEENFTELKNGLV
FT                   DCVQTHTNTVEGFLTEHDQPISRFVLLDHMDWLYDRYPELLASEWQSILNRATSDARVL
FT                   WRSAALAVDFVNPLMLQHNGSQVQLGDLLHYHDELASSLHARDRVHTYGSFYIADLFGH
FT                   SVGECVETRGAAGVAA"
FT   CDS_pept        complement(180893..181831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB362"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID: 10984043 best DB hits: BLAST: pir:G83242;
FT                   hypothetical protein PA3219 [imported] - Pseudomonas;
FT                   E=9e-45 pir:D83421; conserved hypothetical protein PA1792
FT                   [imported] -; E=0.024 pir:C82150; conserved hypothetical
FT                   protein VC1850 [imported] -; E=0.030 COG: PA3219; COG2908
FT                   Uncharacterized BCR; E=8e-46"
FT                   /db_xref="GOA:Q7UYV7"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYV7"
FT                   /protein_id="CAD71534.1"
FT                   /translation="MFGRSHPFQAKDAGMQRLAPTSVRTLLVSDVHLGSKHSRADEFLA
FT                   FLREFHPESLYLVGDFIDGWKINTGWHWSSVCDEIIAHLIGLARRGTKIHYVAGNHDAF
FT                   LRNPAFRAGCLATLPRFEVGNEFVLQTLTGWKFLITHGDLFDRVESIAPWLSKGTTAFY
FT                   DTCLSMNRWCYRTWQPSEGNPYGLCSVLKDRVKRWIRFVSDFESRILHHAKQRECDGVI
FT                   CGHIHTPDIVSSDSMWYCNTGDWVENCTGLVERHDGRLHLVRRYDEDLFLRLPTQEETL
FT                   RRCFDASKTPSTDATELVSVNGEDSSCGYAA"
FT   CDS_pept        181855..182100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB363"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYV6"
FT                   /protein_id="CAD71535.1"
FT                   /translation="MTGEKPGVDRPLLEIDFERRLSTECDVLVNARCGLQENSRARQRL
FT                   KFLNHFENANRQGCANITAHKKIARCETHRAIKMLS"
FT   CDS_pept        complement(182117..183754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB365"
FT                   /product="hypothetical protein-signal peptide prediction"
FT                   /note="PMID: 11259647"
FT                   /db_xref="InterPro:IPR025388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYV5"
FT                   /protein_id="CAD71536.1"
FT                   /translation="MSQRNWKRRLLSAIAIATAAISTHSHAQDTSGLEPVEVLVFQQDS
FT                   GALTEPGPSPTSPSEAPAASSIVESQSPIAEPVVDSSTYSDPYASYSAPCTCCANGCCT
FT                   KKKKEAAMAKMKGAYQGVFYANDFSYLDDPCYDGPSFFGDSLKGMFNGTLDVGGEARVR
FT                   YHNENNHRGLGITGNDDNFWLTRYRMFANWRLSDNLRFYGEYLYADSGGELFNNRPIEE
FT                   NRGEAQNLFLEAQLTDNLSVRGGRQELLLGAQRLISPLDWANTRRTFDGVRATYANKDG
FT                   SIDAFYTHPVKRTAAYEDKWDATNQDVQFFGAYMTRKDTWLGQWENYYLGLNNDTTNFD
FT                   YHTIGSRIVGKTDSDWLYEYEGGTQFGTNSDGTDHSAGFFTGGLGRQVAMTSDWKPTFW
FT                   FWYDYASGGDDELRGGDGFDHMFPLAHKYLGFMDLFGRRNIHDINAQFITPFFGEKVKL
FT                   VLWYHYFMLDEKTTPFNVVMNPSNPGNAAGDRELGHEIDVLFQIALNPRNSALIGYSHF
FT                   NSGKYYSTTAGVQDLDADFFYFQYQTRF"
FT   CDS_pept        complement(183721..183924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB367"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYV4"
FT                   /protein_id="CAD71537.1"
FT                   /translation="MNAPIAKTGRYEVLDVEFVSSPFSLHFLYLRRKEPRRSKSIRMIR
FT                   IHSPLHEGGTTPCPNAIGNAAC"
FT   CDS_pept        183951..184247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB368"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYV3"
FT                   /protein_id="CAD71538.1"
FT                   /translation="MFQYASPPTAPKRCNDQSLPTHSATLLPCSRVIAVVFSSNHSQPI
FT                   GPRFWGYGEANPAKTRLRMGIPPQANTDRFRPETALKARAQSACRVALSLLKT"
FT   CDS_pept        complement(184244..184384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB369"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYV2"
FT                   /protein_id="CAD71539.1"
FT                   /translation="MPDAGARCALLVLVVRERTLGGVRERKVRQGGSAVDWEIVGRVGS
FT                   A"
FT   CDS_pept        184428..186089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrtC"
FT                   /locus_tag="RB370"
FT                   /product="nitrate transport ATP-binding protein"
FT                   /function="ion transporters; ABC transporters; nitrogen and
FT                   sulphur transport"
FT                   /note="PMID: 9495773 PMID: 8437564 best DB hits: BLAST:
FT                   swissprot:P73450; NRTC_SYNY3 NITRATE TRANSPORT ATP-BINDING
FT                   PROTEIN; E=3e-61 gb:AAB86900.1; (L27431) nitrate
FT                   transporter component; NasF; E=2e-51 pir:S75959; nitrate
FT                   transport protein C-1 - Synechocystis sp.; E=6e-49 COG:
FT                   sll1452_2; COG0715 ABC-type
FT                   nitrate/sulfonate/taurine/bicarbonate; E=3e-62"
FT                   /db_xref="GOA:Q7UYV1"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYV1"
FT                   /protein_id="CAD71540.1"
FT                   /translation="MLTVSALFSTDSFLMLFRVPGFCLESQSVPLISTESESNSRSESA
FT                   GTRQTASSRTTSGSAWKKAIRTTNKLMLLGCVALAAVFTGCADSGVSLEDLEAAAAKVD
FT                   ISKIEVDVNPTESAAMLDLEKSDLTFGFIKLTDCAPLVIAKEKGYFDDEGLNVTLETQS
FT                   NWKILLDNVINGQLDGAHMLAGQPIGATIGVGTKSPIVTAYSLDYNGNGITVSNEVWAQ
FT                   MQENDPELKSPTPKHPISAASLKPIVEDYLQDAGEPFPMGMVFPVSTHNYEIRYWLAAS
FT                   GIHPGMYTESDIKGFTDAQVKLSTVPPPQMPQNLEADIVKGYCVGEPWNQKAVVTGIGV
FT                   PVTTNYDIWKNNPEKVFGVTGEWAEKNPQTHLAVIKALIRAGKWLDATDDSGKLVNREE
FT                   AVEILSRKDYVGAEKEVIGNSMMGTFVFQSTDVREMPDFNVFFKHEASYPHYSDAIWFL
FT                   TQMRRWGQITESKPASWYAETAKKIYKPEIYRQAAELLISEGKLDPNEIPAPDYDGYRA
FT                   VTTEFIDGNKYDAKDPIGYINSFEIGNKDDESLAKK"
FT   CDS_pept        186173..187288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrtB"
FT                   /locus_tag="RB372"
FT                   /product="nitrate transport permease protein"
FT                   /function="ion transporters; ABC transporters; nitrogen and
FT                   sulphur transport"
FT                   /note="PMID: 8437564 best DB hits: BLAST: ddbj:BAA21794.1;
FT                   (AB000100) intrinsic membrane protein; E=6e-30
FT                   swissprot:P38044; NRTB_SYNP7 NITRATE TRANSPORT PERMEASE
FT                   PROTEIN; E=4e-29 gb:AAB86903.1; (L27431) nitrate
FT                   transporter component; NasE; E=1e-27 COG: sll1451; COG0600
FT                   ABC-type nitrate/sulfonate/taurine/bicarbonate; E=9e-28
FT                   BB0145; COG1174 ABC-type proline/glycine betaine transport
FT                   systems,; E=1e-05 PFAM: PF00528; Binding-protein-dependent
FT                   transpor; E=8.5e-12"
FT                   /db_xref="GOA:Q7UYV0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYV0"
FT                   /protein_id="CAD71541.1"
FT                   /translation="MNWRGNLLRFCDVAGLPILEPFVRLAAGEDKREQCIGIAKFILLP
FT                   IVAVSVFLLLWAGAASTVVTDSAKLPSPQATWAAGKQLITMHYDQRAADKAAKQEKLTE
FT                   AVQLLAEANAYTAAATTESGQTQTLLENKALSLKKRAVAAANFTPSSAPTFIDQIWTSV
FT                   KTVFFGFFLATIVAVPVGVLCGMSPWFNAAMTPFIQIFKPVSPLAWLPLAFIVIMWYYA
FT                   GYSSGETFFNKAFLISASTVCLCSLWPTLVNTTLGVASVDKDFINVADVLRLSWWQRLT
FT                   KIILPASLPLMFAGMRISLGVGWMVLIAADMLAQNPGLGKFVWDEFQNGSELTYARIAF
FT                   SVIVIGLIGLVLDRIMIFFRNLVSFGNPSPV"
FT   CDS_pept        187285..188283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrtC"
FT                   /locus_tag="RB373"
FT                   /product="nitrate transport ATP-binding protein"
FT                   /function="nitrogen and sulphur transport; ABC
FT                   transporters; ion transporters"
FT                   /note="PMID: 8437564 best DB hits: BLAST: pir:S58789; ATP
FT                   binding protein nrtC - oscillatoriacean; E=4e-60
FT                   swissprot:P38045; NRTC_SYNP7 NITRATE TRANSPORT ATP-BINDING
FT                   PROTEIN; E=2e-59 pir:S75959; nitrate transport protein C-1
FT                   - Synechocystis sp.; E=9e-59 COG: sll1453; COG1116 ABC-type
FT                   nitrate/sulfonate/taurine/bicarbonate; E=6e-59 NMB0610;
FT                   COG1130 ABC-type sugar/spermidine/putrescine transport;
FT                   E=1e-35 PA2308; COG1116 ABC-type
FT                   nitrate/sulfonate/taurine/bicarbonate; E=2e-35 PFAM:
FT                   PF00485; Phosphoribulokinase / Uridine kinase; E=0.18
FT                   PF00005; ABC transporter; E=2.2e-56"
FT                   /db_xref="GOA:Q7UYU9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYU9"
FT                   /protein_id="CAD71542.1"
FT                   /translation="MILDVSVSSLSSSIGANMSAVLETSPTIKRRAISSAPKPILQMRG
FT                   VCKGYGSGVTRNEVLQNINLNIREGEFLAVVGFSGSGKTTFTQLLAGLISPDKGTITMN
FT                   DEPVKGPSPDRGMVFQNYSLLPWLTVRGNIALSVNAVFKEWSREQRRDHVEKFIDMVGL
FT                   SHAAHRRPHELSGGMRQRTSLARTLALKPKVLLLDEPLSALDALTRGQLGDEILKIWSE
FT                   EKQTCVMITNDVDEAIMVADRIVPLNPGPNASLGPVFTVGIDRPRNKTELNDNEEFKGL
FT                   RNAVTNYLVAVRQKARRDEMAANPTQAFRLPEIEPSDLTRPTRAVFNTGPR"
FT   CDS_pept        188377..189222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrtD"
FT                   /locus_tag="RB374"
FT                   /product="nitrate transport ATP-binding protein"
FT                   /function="ion transporters; ABC transporters; nitrogen and
FT                   sulphur transport"
FT                   /note="PMID: 8437564 best DB hits: BLAST: pir:S75959;
FT                   nitrate transport protein C-1 - Synechocystis sp.; E=1e-61
FT                   pir:S58789; ATP binding protein nrtC - oscillatoriacean;
FT                   E=1e-61 pir:S77386; nitrate transport protein D-3 -
FT                   Synechocystis sp.; E=2e-61 COG: sll1453; COG1116 ABC-type
FT                   nitrate/sulfonate/taurine/bicarbonate; E=2e-62 PA3254;
FT                   COG1130 ABC-type sugar/spermidine/putrescine transport;
FT                   E=4e-29 PA2329; COG1116 ABC-type
FT                   nitrate/sulfonate/taurine/bicarbonate; E=4e-28 PFAM:
FT                   PF00005; ABC transporter; E=3.5e-57"
FT                   /db_xref="GOA:Q7UYU8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005890"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYU8"
FT                   /protein_id="CAD71543.1"
FT                   /translation="MRGYVEMFRLGKTYDTHNGPVVIVEEFDLNLEKGEYVSLLGHSGC
FT                   GKSTVLTMVAGLNPITTGGVAIDGREIDGPGPDRGVVFQSPCLMPWMTALENVMLGVNQ
FT                   VYLQASKRDRRDLASYYLNLVGLGSNLHKRAKDLSQGMQQRVGIARAFALRPKMLLLDE
FT                   PFGMLDSLTRMELQEILLEILIRDKVTTVMVTHDVDEALFMSDRVVMMTNGPRAKVGAI
FT                   FSLPFDRPRVRADVLDHPEYYDFRGKMIQFLEDQDHKKLRADAEKRAKAQEELATADAT
FT                   "
FT   CDS_pept        189235..190170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB375"
FT                   /product="hypothetical protein"
FT                   /note="best DB hits: PFAM: PF01590; GAF domain; E=0.89"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYU7"
FT                   /protein_id="CAD71544.1"
FT                   /translation="MTSISVPAPSNASITLRHSLPPLAVSDQCYLQGIHVCEVVAPGEF
FT                   TPDCDSSALPIAQQCLHESDAVVVQDPALLPTEAAAAIAIPVHFDGAIQSVIVFFAKAP
FT                   SEAMPDPVGVFEVWRPVGPYDEVALREGYYGKLERFQNVSSFVRFEKGNGLPGVVWEQG
FT                   RALAQDDLANHMGFLRAAGASADLLNAAVGFPVFADQYLSTAVLIQSKRSPMARAIEVW
FT                   NIDGKECELTSQAYGEVENAFRFDTGTRVPLTTGILGLVAEHQRVVLLEDMEALLLTRP
FT                   AERVMPCPTAGLAIPFFDGTHLSSITVLMF"
FT   CDS_pept        190095..191966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB377"
FT                   /product="molybdopterin oxidoreductase, iron sulfur
FT                   subunit"
FT                   /function="nitrogen and sulphur metabolism; electron
FT                   transport proteins"
FT                   /note="PMID: 8635740 PMID: 1834669 best DB hits: BLAST:
FT                   embl:CAC23825.1; (AL512979) molybdopterin oxidoreductase,
FT                   iron; E=5e-26 gb:AAD37318.1; AF135170_9 (AF135170) dimethyl
FT                   sulfoxide reductase; E=2e-25 swissprot:P18776; DMSB_ECOLI
FT                   ANAEROBIC DIMETHYL SULFOXIDE; E=5e-25 COG: dmsB; COG0437
FT                   Fe-S-cluster-containing hydrogenase components 1; E=4e-26
FT                   TM0396; COG1142 Fe-S-cluster-containing hydrogenase
FT                   components 2; E=5e-16 aq_067; COG0437
FT                   Fe-S-cluster-containing hydrogenase components 1; E=6e-16
FT                   PFAM: PF00037; 4Fe-4S binding domain; E=0.026"
FT                   /db_xref="GOA:Q7UYU6"
FT                   /db_xref="InterPro:IPR007059"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYU6"
FT                   /protein_id="CAD71545.1"
FT                   /translation="MPNRRARHSVFRRNPSQLHHRFDVLIHMSSLLPTEPNFAHPDGAA
FT                   PGVVTSPGLPIEGQGDSFDLVSLLLQEQQTLTAVEDFAAAHDSGTAEDNVADQPAQARY
FT                   YSKLMPASPPGPGQQFAFDVNLDTCSGCKACVVACHTMNGLDETESWRRVGTLVIGETE
FT                   PEAIPAAIGVQHVTTACHHCEDPGCLNGCPVKAYDKDPETGIVRHLDDQCIGCKYCTMM
FT                   CPYEVPKYSKRLGIVRKCDMCHQRLSVGEAPACVQSCPNEAIAIRVVDQQCQEVSDEER
FT                   LVAGAPLSSITRPTTVFRSNDPTKRFQGVAQDNGIDEPAEDHWPLVGLLIATQVGVGML
FT                   LTERVLAAIGWLAGSPMPTETTRWTATVALMVSMIGMNLAPLHLGQPLRSWRIFLGLRT
FT                   SWLSREAVLLGKFVGVLTMAVVAMWLPAVSEYLPDWVSIPAWVPGMVLLGAIVFGVAGL
FT                   FSSAMIYIATKRVLWRFDRTMIRFMGTAVVGGVAASAAVIAATSDRSNSVTVLLGLATF
FT                   ALIAKLVWEQSILLRSEPGSSNDQWDRRSQRLVRHHLSKWSLSRLALGYAGLALLVVSS
FT                   ALAIAGSSMLLTVFAAAATMLLVAGETTERLIYFSSVVHDRMPGTLR"
FT   CDS_pept        191963..194224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narB"
FT                   /locus_tag="RB378"
FT                   /product="nitrate reductase catalytic subunit"
FT                   /function="nitrogen and sulphur utilization"
FT                   /EC_number="1.7.99.4"
FT                   /note="PMID: 7868621 best DB hits: BLAST: ddbj:BAA74791.1;
FT                   (AB017192) nitrate reductase catalytic subunit; E=1e-156
FT                   gb:AAB40292.1; (L49163) narB [Nostoc sp. PCC 7120];
FT                   E=1e-105 swissprot:P73448; NARB_SYNY3 NITRATE REDUCTASE
FT                   ----- pir:; E=1e-105 COG: sll1454; COG0243 Anaerobic
FT                   dehydrogenases, typically; E=1e-106 MTH1552; COG3383
FT                   Uncharacterized anaerobic dehydrogenase; E=5e-74 aq_217;
FT                   COG0243 Anaerobic dehydrogenases, typically; E=4e-69 PFAM:
FT                   PF00384; Molybdopterin oxidoreductases; E=1.2e-89 PF01568;
FT                   Molydopterin dinucleotide bin; E=5.9e-29"
FT                   /db_xref="GOA:Q7UYU5"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYU5"
FT                   /protein_id="CAD71546.1"
FT                   /translation="MSISIKDNRNDAGKTFQLPTLLQRRTGPMTRELVLRPGDHGLGMT
FT                   HDSMAADTTTTATCGFCATGCGLRLHLKDGEAIGLTPETAYPVNLGMACPKGWEALRVL
FT                   DSPERATLPLLRDETGKLSPIEWDDAFSKFCDGMKQVQSEHGPESIAFLSTGQIACEEM
FT                   AFLGALARFGMDIRHCDGNTRQCMATAVTAYKESFGFDSPPYTYDDFEQSDCLVFIGAN
FT                   PCVGHPIMWERVLRNPHNPEIIVIDPRRTETAAAATQHLQLRPKNDLALLYAITNELIL
FT                   RDFVEHDFVQNHTQGFEELRQHVSQYDLATVCEEAGLAVEDVSAAVEAIGRGRAVSLWW
FT                   TMGVNQSYQGTRTAQAIINIALITGNIGRPGTGANSITGQCNAMGSRLWSNTTNLFGHH
FT                   SFTEESDRRKVAEALNIPVEKIPSTTSWKYDRIIEGIRNGEIKGLWVVATNPAHSWIDQ
FT                   GDVRELFDQLDFLVVQDMYKTTETCSHADLILPSAGWGEKEGTFINSERRYGLLKKVRH
FT                   APGQALADFQIFRGIAHRWGVGEMFAEWTSPEAVFQIMQRASRGQPSDISGIEGYEQID
FT                   RCGGIQWPWSADHASGGFEPEQQRRLFADGRFFHEDRRARLIVDDVSPMPEPAGEDYPI
FT                   VLLTGRGTVSQWHTQTRTRQSPLLRSLYPNQPYVEMHPRDAAELDVEHGDLVRVRSRRG
FT                   HADATACLTHSVQPGQVFMPMHYECTNQLTLSHFDPHSGQPSYKDCAVRIEPVLTSDHD
FT                   "
FT   CDS_pept        194217..196058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirA"
FT                   /locus_tag="RB379"
FT                   /product="ferredoxin--nitrite reductase"
FT                   /function="nitrogen and sulphur utilization"
FT                   /EC_number="1.7.7.1"
FT                   /note="PMID: 8490140 best DB hits: BLAST: swissprot:P39661;
FT                   NIR_SYNP7 FERREDOXIN--NITRITE REDUCTASE -----; E=9e-54
FT                   gb:AAF00916.1; AF178846_1 (AF178846) ferredoxin nitrite
FT                   reductase; E=4e-53 gb:AAC46074.1; (U61496) nitrite
FT                   reductase [Nostoc sp. PCC 7120]; E=4e-51 COG: slr0898;
FT                   COG0155 Sulfite reductase hemoprotein beta-component;
FT                   E=2e-49 BS_nasB; COG1251 NAD(P)H-nitrite reductase; E=0.008
FT                   PFAM: PF01077; Nitrite and sulphite reductase 4Fe-4;
FT                   E=1.7e-16"
FT                   /db_xref="GOA:Q7UYU4"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR012798"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYU4"
FT                   /protein_id="CAD71547.1"
FT                   /translation="MTDQQDSKPFSDEQQQYLAGFTFGADVARAVQGLPVISGSGGQGT
FT                   TLAIGGGSTTVDGESVPTGPDRFAFEAQSAVLAAGKKLSKEEQAKRDKNPLDMWDEMQA
FT                   RSDAGEFPKGTDVFLQKFHGLFYVTPAQDSFMCRLRLPGGQIQAWQLRGLADLADQSAG
FT                   PYLDLTTRGNVQLREIPADQAMNILFGTRELNIVPLGSGGDNIRNCTSSAMSGLDADEL
FT                   IETLPLAIRMHHYILNHREMYGLPRKFNIAFEGGGRIASLEDTNDIGFKAVRVLDENAS
FT                   DDLPAGVYFQLCLGGITGHKDFARYTGVLLRESECVAVAAAIVRVFIRTGDRTDRKKAR
FT                   LKYVLDDMGFEKFIAEVEAEMGRTLTKVDVSRLTVQDIEDRSAHVGVFPQKQPGLNSLG
FT                   IVFPVGRMTTDQARALADLALRYSNGDIRLTVWQNLILTNITDADLPAVQAGIRECGLD
FT                   YEANSVRAGLVACTGSAGCKFAGAPTKANAIEIAERVESVLTLDQPINIHLTGCHHSCA
FT                   QHYIGDIGLIACQVEVGDDMVDGYHICLGGGWGSRQGIAREIFKSVPFAEVPDLVTGIL
FT                   SSYQQNRVDSNESFNDFAGRLSDEELKSLVATPSVVC"
FT   CDS_pept        196136..197740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysJ"
FT                   /locus_tag="RB380"
FT                   /product="sulfite reductase [NADPH] flavoprotein
FT                   alpha-component"
FT                   /function="nitrogen and sulphur utilization; amino-acid
FT                   biosynthesis"
FT                   /EC_number="1.8.1.2"
FT                   /note="PMID: 2550423 best DB hits: BLAST: pir:G70040;
FT                   sulfite reductase (NADPH) (EC 1.8.1.2) flavoprotein yvgR;
FT                   E=8e-80 ddbj:BAB04328.1; (AP001509) sulfite reductase
FT                   (NADPH) [Bacillus; E=2e-79 gb:AAG57872.1; AE005504_4
FT                   (AE005504) sulfite reductase (NADPH),; E=4e-75 COG:
FT                   BS_yvgR; COG0369 Sulfite reductase flavoprotein subunit;
FT                   E=8e-81 PA3490; COG2878 Predicted alternative beta subunit
FT                   of; E=2e-04 PFAM: PF00667; FAD binding domain; E=1.9e-14
FT                   PF00175; Oxidoreductase FAD/NAD-binding d; E=2.8e-35"
FT                   /db_xref="GOA:Q7UYU3"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYU3"
FT                   /protein_id="CAD71548.1"
FT                   /translation="MIPMSSYIPETAPFNEQQRAWLNGFFAGLTGIQESAGGSVATAMA
FT                   AGLPSAEAPVEEEEDFPWHDDSLPIVDRMELAEGRPLDRKLMAAMAQLDCGSCGYVCQT
FT                   YSEAIASGEEPNVSLCSPGGKETKQMIKKLLAEAGDSVKASTNGNGSATNGVATNGAAA
FT                   WSRKNPYSANLIESRPLNQEGSAKDTRHVAIDLVGSGIKYEVGDALGIYPTNCIDLCTQ
FT                   IIDRLAADSHVKVATPQGNTKPLLEALQEDCCLKDPSDELLELLVGRTPNADAQATLNH
FT                   LLAEGVPEGFDVLDVLEVAGESTITATEFIECLDPLNPRLYSIASSMKAVGDQVHLTVG
FT                   KVIYEREERVRKGVASTMLADRVGTGESMRVFVQPNHGGFTVPADENAPMIMVGPGTGI
FT                   APFVAFLQERAARKSPGDNWLFFGDQHEAYDFLYESELTEYVHSGVLSRLDTAFSRDGD
FT                   TKVYVQDRMRENAAELWAWLNRGAHFYVCGDATRMAADVERALLHIITQEGGMSEDEGK
FT                   AYLKTMTSEKRYVRDVY"
FT   misc_feature    196862^196863
FT                   /note="cosmid pircos-b2f07/ cosmid pircos-b2f12 joining
FT                   point"
FT   CDS_pept        197737..197862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB381"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYU2"
FT                   /protein_id="CAD71549.1"
FT                   /translation="MIVGISRRPLGPVFDVSLTVAIQGRLTEKVKLTIVNCKLLS"
FT   CDS_pept        197889..198533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB382"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR011450"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYU1"
FT                   /protein_id="CAD71550.1"
FT                   /translation="MTPPSKRAVRLTTKYREWRRVLISKLLIRELNHQTNFIFTIVNLT
FT                   FSIPTLPNTLSPKPSEAGACPRGPDRSAAAHRPSLEHPRRFRRTRFRRAMGMRRRGRSL
FT                   RSQIRSRRRCHLLRCRRCEPRERSRTTPRRRVEQSCRNESVRRCRVSPQPPGPLPPNVV
FT                   RSQSPRPASLAGTPALHRPRNRRRVRKSGCLPASGFARSTSSLDLANENRR"
FT   CDS_pept        complement(198058..198732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB383"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYU0"
FT                   /protein_id="CAD71551.1"
FT                   /translation="MTVNASKLFEVHRVCIRSDWMAWQQIEIPDSIKTLPYHDSAEHLI
FT                   DSANDAIEAFMLADESVIENFVTCDFHLLDQAMTWIEQNHLLAGNRFCELGAGFAVGAM
FT                   LASLRGMQAVGIEIEPRLVEAAQAVADSLDNDAQIHCGSFVPRGVEELSEIAREVRNVD
FT                   TEEGDIYDEIGFEIEDFDLFFAFPWPGENEFFETVVDARGSVGALLLTYRGREGMHLLR
FT                   KV"
FT   CDS_pept        complement(198704..199000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kptA"
FT                   /locus_tag="RB384"
FT                   /product="probable RNA 2-phosphotransferase"
FT                   /function="tRNA processing"
FT                   /EC_number="2.7.-.-"
FT                   /note="PMID: 9915792 best DB hits: BLAST: swissprot:Q9I778;
FT                   KPTA_PSEAE PROBABLE RNA 2'-PHOSPHOTRANSFERASE; E=3e-10
FT                   pir:S56556; hypothetical 24.6K protein (iadA-mcrD
FT                   intergenic region); E=6e-09 swissprot:P39380; KPTA_ECOLI
FT                   RNA 2'-PHOSPHOTRANSFERASE; E=6e-09 COG: PA0054; COG1859
FT                   Uncharacterized ACR; E=3e-11 PFAM: PF01885; Domain of
FT                   unknown function DUF60; E=6.1e-16"
FT                   /db_xref="GOA:Q7UYT9"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYT9"
FT                   /protein_id="CAD71552.1"
FT                   /translation="MIPLTNHPATEKPPVFRLGGMNKRLTRISKYLTFILRHAPQSIGL
FT                   NLDADGFASVDELVSNANASGKSITVEQVHQVVAGHETPMFALSDDGQRIQAL"
FT   CDS_pept        complement(199036..202650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB386"
FT                   /product="saframycin Mx1 synthetase B"
FT                   /function="polyketide synthase"
FT                   /note="PMID: 8936303 best DB hits: BLAST: pir:T18551;
FT                   saframycin Mx1 synthetase B - Myxococcus xanthus -----;
FT                   E=1e-112 pir:T34918; polyketide synthase - Streptomyces
FT                   coelicolor -----; E=1e-102 pir:H83343; probable
FT                   non-ribosomal peptide synthetase PA2424; E=1e-101 COG:
FT                   PA2424_1; COG0318 Acyl-CoA synthetases
FT                   (AMP-forming)/AMP-acid; E=1e-102 Rv1529; COG0318 Acyl-CoA
FT                   synthetases (AMP-forming)/AMP-acid ligases; E=7e-83 Ta1189;
FT                   COG0156 7-keto-8-aminopelargonate synthetase and related;
FT                   E=6e-62 PFAM: PF00501; AMP-binding enzyme; E=2.2e-08
FT                   PF00550; Phosphopantetheine attachment si; E=1.3e-09
FT                   PF02490; Aminolevulinic acid synthase dom; E=0.0015"
FT                   /db_xref="GOA:Q7UYT8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYT8"
FT                   /protein_id="CAD71553.1"
FT                   /translation="MTGHGASKITVKRERDCSATASLQQVESVDLQQYFKNETPPHDHF
FT                   VSVLRHWVQVRPDAPAFTFTDGEGSDQTLSYAELWEEVRGLAGYLQGRCGIRAGDRVLL
FT                   LYPPGLDFVIGLFATHAAGAIAVPAYPPRRNRKASRIRSIVVDADARWALSTSSVVDQL
FT                   SGNELHEDLVGVQLLGTDLPTKRDATHWRCPKLRSEALGVLQYTSGSTGSPKGVMLTQA
FT                   NLIANSELILHGFEPESTIIGASWLPTYHDMGLVGGVLMPMFVGRHNILMSPMAFLQRP
FT                   SRWLQTIARHQVTISGGPNFAYQLCVDKIRDEELEGVDLSSWEIAFNGAEPVRSSTLDA
FT                   FSKRFEKYGFRHSSHLPCYGMAETTLIVTGGPISPRPVLQQFDGPALDEKAVRPAVDVP
FT                   ADLAKQSDDEDDSKTSSARATRELVGCGRVLPGERVLIVDPDTRQTLPSDAIGEIWVQS
FT                   PSVGRGYWQRREQSAKTFAAMTSEGEGPFLRTGDLGFLYGGQLYVSGRLKDMIIVRGVN
FT                   RYPQDIEATVEHASDVVQAGSVAAFAMNADSDETETGREKLIIVAETVRKRDLDWDDHL
FT                   QSIRRAVTEEHDLPPDAIYLVRNSSVPKTSSGKIQRHACLHAVRDKELKVIAQWIRGEE
FT                   SSLHNAGLAGETMMKAAAASDASGLDSVADPVVAEAIVSHVRAIAGERAGSINPETNIV
FT                   LDLGLDSLERLEIARNLERTFGGRFPEQVLDEIETIGQIATAVERYLPAGALGRAEQFL
FT                   AGRGDTQRDGDDDLVNTNANGRSSTDGEGPLARVMQTPQVEPEDDVTQFAEYRRLKSTM
FT                   RQMQLTGVPNPYFTVHDCVVGDKTIVDGKSLISFASYNYLGLSGHPEVSKAAADAITKY
FT                   GTSVSASRLVSGEKPIHGELERKIAKWVGVDNSITMVGGHSTNETTIGHLVGPGDLILH
FT                   DALSHNSIVQGALLSGAKRRPFPHNDYEALDKMLTALRGQYRRTLIIIEGVYSMDGDFA
FT                   DVPKFVEVKKRHRAMLMVDEAHSFGTMGATGHGIAEHFGFDARDVDIWMGTLSKSASSC
FT                   GGYIAGSEALVELLRYTAPGFVFSVGMPPGQVAAAIASLEVLEREPQRVERLRHNSELF
FT                   LNLSREAGLDTGDSGGTPVVPVITGNSLVALRLSNRLKKDGINVQPILYPAVDESAARL
FT                   RFFITSEHSEEQIRFTVERTAHHYNDLCDTPAKLRGTA"
FT   CDS_pept        202649..202828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB388"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYT7"
FT                   /protein_id="CAD71554.1"
FT                   /translation="MRCGGAISHCCNDAPTAPIGQGSALHRLVQRSGGGGHDHRVSRLD
FT                   RSAATIQDRVATPL"
FT   CDS_pept        202881..204269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB390"
FT                   /product="probable alkylhalidase"
FT                   /function="dehalogenases"
FT                   /EC_number="3.8.1.1"
FT                   /note="PMID: 10094695 best DB hits: BLAST: gb:AAG38844.1;
FT                   (AY010120) putative reductasehalogenase; E=9e-35
FT                   pir:T30590; alkylhalidase homolog - Amycolatopsis
FT                   orientalis -----; E=2e-29 pir:T17419; probable
FT                   alkylhalidase (EC 3.8.1.1) pltA - Pseudomonas; E=7e-29 COG:
FT                   aq_104; COG0644 Dehydrogenases (flavoproteins); E=2e-07
FT                   PFAM: PF01134; Glucose inhibited division prot; E=0.14
FT                   PF02254; KTN NAD-binding domain; E=0.15 PF01494; FAD
FT                   binding domain; E=0.00011"
FT                   /db_xref="GOA:Q7UYT6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYT6"
FT                   /protein_id="CAD71555.1"
FT                   /translation="MSAQQPFGYTRRLLTLQFPIELPLSNMSTPKMKDFYDCVVIGGGP
FT                   AGGAAASIVADSGVSTLLIERDPVPRFHVGESLMPECYWPLERLGLIDQVKRSGWQAKK
FT                   SVQFVTHTGKESAPFFFREHDERECSTTWQVERSEFDKMLYDRASELGADCFDQTRLID
FT                   VQTEPGETEDQPIARAVVVRTADGTEKTIGCKVVVDATGQQAFLAGKMGLKEINPDLKK
FT                   AAIWTYYRDAVRGEGDNDGATIILNTKSRDSWFWFIPQSRGITSVGCVGDNDYLLKGRG
FT                   TPEEIFEEELANCPGLQPRLANATRVGKITTAKEFSYMTRRHSGPGWVLIGDALGFIDP
FT                   VYSSGVYFALEMGVRAGDAIVEGLKKDDLSAEQLGKWTDDFKEGASKVRQLVHAFYNKD
FT                   FSIGRFMKEHPEYRGNVTDLLIGRVFHEDAGKMFPALDRSIEMARADAMSKADSMAETK
FT                   PMST"
FT   CDS_pept        204269..204925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB392"
FT                   /product="putative phosphatase"
FT                   /note="PMID: 7826004 best DB hits: BLAST: swissprot:P77475;
FT                   YQAB_ECOLI HYPOTHETICAL 20.8 KDA PROTEIN IN; E=7e-26
FT                   gb:AAG57799.1; AE005497_10 (AE005497) putative phosphatase;
FT                   E=8e-26 pir:D82431; CbbY family protein VCA0662 [imported]
FT                   - Vibrio cholerae; E=1e-25 COG: yqaB; COG0637 Predicted
FT                   phosphatase/phosphohexomutase; E=7e-27 DR0729; COG0546
FT                   Predicted phosphatases; E=1e-09 yieH; COG0637 Predicted
FT                   phosphatase/phosphohexomutase; E=9e-09 PFAM: PF00702;
FT                   haloacid dehalogenase-like hydro; E=8.5e-24"
FT                   /db_xref="GOA:Q7UYT5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYT5"
FT                   /protein_id="CAD71556.1"
FT                   /translation="MSQSDNNTASILSPNELGQLHLDIAIAHDLTERYEGLIFDCDGTL
FT                   TNSMPLHYLAWNETMTRHGIDFPESRFYAMGGMPSEKIIAVLSSEQGVSIDVDLATEEK
FT                   EANFIARIPSVERLEHVTDIAERHLNRIAMSVASGGMRDIVADQLRTIGVADWFPVLVG
FT                   SEDTELHKPEPDVFLCAAERMGVDPKRCLVFEDSPLGFEAAKRAGMDWVDVRVDA"
FT   CDS_pept        complement(205043..207007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB393"
FT                   /product="similar to peptidase"
FT                   /note="best DB hits: BLAST: ddbj:BAB09011.1; (AB012239)
FT                   gene_id:K11J9.20~unknown protein; E=0.11 pir:T35304;
FT                   probable peptidase - Streptomyces coelicolor -----; E=0.19
FT                   ddbj:BAA76932.1; (AB024705) fls485 [Homo sapiens]; E=0.83"
FT                   /db_xref="GOA:Q7UYT4"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYT4"
FT                   /protein_id="CAD71557.1"
FT                   /translation="MSSKRGPSGGGLSSEWSFREQVVYRFADVQIKALDMFLNRFSVAI
FT                   AVLVTLAGLGWPSVGRSQGPVTWQSRAGSSVEAELIRVDDSKVVLQVEGNRSPVEVSLD
FT                   SLTPESRLQAMQIWFNERDAKQFQMIRQHLPGMYERPEAVSRLLLEIHKAVPESPYAGI
FT                   WAGVGLSEGENNLELAKRLLMQAVKRIEAQQEVMAGRHSMTLASARNNLGVVALKQQEA
FT                   NPAASSFIAGVQSSNVVSAVLEHNMQLLAQTDSMRTGLIELAPRLRSELLATLASADVS
FT                   TSKPNLNESLYYTLDFDLPIEAGAGNRKVEGLDSPSVFMELVSIGTGFVVAPGIVLTST
FT                   DVITNTDGYGPKMVTVGSYQHGIFKALTCKNCLMTAPRISARSGIVIRTNETIGTVTRF
FT                   RIIPHRAGSSDAELAALHVPGLDLAPLCIANDTPAKATDLTLYGYDPGQNLVKQGVREF
FT                   TGEILSEPDHQGVQNVSNETTGGNRGGPLMSDDKAVHGIVFAMSENELETSGRAFGARM
FT                   IRSWFNRNVRTTSLTSVDDQPIEKRFDPKASVVPVFVWGLKSGSGLFSDVADGTGPSES
FT                   LMIENTWCVSCIGSSYQDCPNCVNGSQSYRKQEVVSSSRIGGDVYAPVVKKKRCPTCSG
FT                   RGKLKCPHCKNGRLDLRRR"
FT   CDS_pept        complement(207055..207192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB394"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYT3"
FT                   /protein_id="CAD71558.1"
FT                   /translation="MVAILVHRLGRRASHSPLEPVGTSYGTRWPKSIGRTFGRSCYENL
FT                   "
FT   CDS_pept        207191..209692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB395"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR011478"
FT                   /db_xref="InterPro:IPR013036"
FT                   /db_xref="InterPro:IPR013039"
FT                   /db_xref="InterPro:IPR013042"
FT                   /db_xref="InterPro:IPR013043"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYT2"
FT                   /protein_id="CAD71559.1"
FT                   /translation="MSPSRILRLLSTEPSRYPSRPQFFLLAAALALGTHSFAVNASEPT
FT                   SISNPEIQTFLQNHCRDCHADGASEGGLNLDTLPRTIGGAADLAVWVRIHDRVQTREMP
FT                   PPDSSTLDETRRTDFIAALATPLNQHHASEKGTVLRRLNRREYENTLNDLFGTAVELET
FT                   LLPADGRSHEFDNVGESLGISMVHLERYLDAADLVLESAIAKTADPPPVHVIDTHYAET
FT                   REAKTHLGKVWKQLDDGSVVFYQNFGYPDGMLRTSSIPESGRYRILITGYAYQTDQKIP
FT                   FYVGAKSFTRGSEQPTLGYFDMPPLSPDGEMTTIELTAHLEYRYMLNIIPYGLVVRDYN
FT                   IRNDGVDGYTGPGLAIANVQLEGPLKDEFPSRGHRLIFDDWQREEVMPNPPSKREKSWY
FT                   KPEFELTSSNPDESLRNSLQRVASAAMRRPVNASELTPYIELFRSEQDRGASTEDALRT
FT                   AVAAILCSPDFLYFREPPGKLDDHAIATRLSYFLNRTTPDKALLRAAGQNELTRSTESL
FT                   LSHAKRLVAEPRFDRFVVDFTDAWLNLRDIDQTSPDQKLFPEYDRYLRDSMVEETRQFF
FT                   ATLIRENLPVTNLVKSDFAMLNLRLANHYGIEGVDHADIRRVRLPNDSVRGGLLGQASV
FT                   LKVTANGTNTSPVVRGVWVTERLLGVHPAPPPPGISGVEPDIRGAATLRQLLDQHRSEE
FT                   SCHACHALIDPPGFALESFNPIGGWRDRYRSLGEGERIDLRVNNRRVQYRLGLPVDSSG
FT                   TLPSGESFEGFDAFRDCLLKDPDQLAMSLITKWLTFATGREMGFSDRQEIESLTRQSAQ
FT                   RGHGLRTMLALVIASDIFRTK"
FT   CDS_pept        209745..211058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB398"
FT                   /product="hypothetical protein-signal peptide prediction"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011447"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYT1"
FT                   /protein_id="CAD71560.1"
FT                   /translation="MLIPSQPMSRRRLLRSAGGAALALPFLEAMGPSLGRRVLGNDQSV
FT                   DAERAPKRFVAICASLGFHGDHLFPESTGRDYAITPYLEQVQRHRDDFSLFSGLSHPEQ
FT                   NGNNGHASELTWLTAARRPGLAGFRNSISLDQLIAREIGLKTRFPFLALTTGGQSLSWT
FT                   SSGVEIPAQHSPAKLFTAMFVDGKPHEVEADLDRLRRGRSVLDTVGLRAQSLKRELGIR
FT                   DQQKLDEYLHSIRDLESRLQQSEGWVRRPKPVVDEEPVSDINDKALAIERQRLMYRIIA
FT                   LALQTDSTRTVTFQLAGLNSVPQIPGVQSDWHGLSHHGKDPEKIAELKRIEAAEWGAFG
FT                   EFLDQLKSIEEHNRSLLDHTAVMFGSNLGNASAHDWRNLPILLAGGGYRHGKYVAHDAA
FT                   NNTPLCNLYVDLAQRMGLEIDAFGSSTSAGIKGLESTT"
FT   CDS_pept        complement(211175..212728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="RB399"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /function="C-compound and carbohydrate utilization;
FT                   glycolysis and gluconeogenesis"
FT                   /EC_number="5.3.1.9"
FT                   /note="PMID: 2549364 best DB hits: BLAST: swissprot:P80860;
FT                   G6PI_BACSU GLUCOSE-6-PHOSPHATE ISOMERASE (GPI); E=6e-53
FT                   ddbj:BAB07062.1; (AP001518) glucose-6-phosphate isomerase;
FT                   E=4e-52 pir:S15937; glucose-6-phosphate isomerase (EC
FT                   5.3.1.9) - Bacillus; E=5e-52 COG: BS_pgi; COG0166
FT                   Glucose-6-phosphate isomerase; E=6e-54 PFAM: PF00342;
FT                   Phosphoglucose isomerase; E=6.8e-31"
FT                   /db_xref="GOA:Q7UYT0"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYT0"
FT                   /protein_id="CAD71561.1"
FT                   /translation="MRRGANLSHPAQRRAIQYHLARGHRGVIQFNPNIRNSSPFFCTEP
FT                   IMSLLRFDASGSINDDYGITQAQIDSLKGQMETLRTEMVETDQKQYESGDIPADKQPLD
FT                   ARFFWLPEEMLEAYAKEREASELGRIFKVANGLHDQIDAAVVLGIGGSYMGARAMMEAC
FT                   CDPYHNEMSRAARGSKPRMYFEGNNVDNDASDSLLQRVRAGGYADSDAEKRHAIIVISK
FT                   SGGTMETAVAFRQFLANLESELGSEAEDWLSRLVVPVTGESGKLHDLATEIGCDEIFTV
FT                   PDGVGGRFSVLSPVGLVPAAFLGLDCMKLLEGAVAMNEHFKTADYADNVVMQYVAVNHL
FT                   LSQHRDKSIRVMSVWSKALESVGLWYDQLLAESNGKDGKGVTPLTTLNTRDLHSRHQQH
FT                   QQGRNDKVFNNVIVESQRTDSLAVGHSQRNQDTLNDIAEKTLPDIMAAAIKGTNDALHA
FT                   DGRPTTDIILPQIDTHVLGQLFQMLMIATVIEGRLLGINPYGQPGVEQYKTNMNKNLGR
FT                   "
FT   CDS_pept        212820..213275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB402"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYS9"
FT                   /protein_id="CAD71562.1"
FT                   /translation="MRVGRTFSFGNCLSFIPASHFEMIHYTCDRCRQVIDPTQSSRYTI
FT                   AIEVQKLEEEWNDDEAVDHLDALHQAIEADEAEDELVELIGHDAASPRNESEPECFAEP
FT                   TIELHDAPISTGETVSQSFDLCESCYRRYRSNPLGRERNLKLHFSNN"
FT   CDS_pept        complement(213284..215665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB404"
FT                   /product="hypothetical protein"
FT                   /note="best DB hits: PFAM: PF01423; Sm protein; E=0.11"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYS8"
FT                   /protein_id="CAD71563.1"
FT                   /translation="MNAVVWKRSLRGSLLYLFAFPILFNVSSLPELPAQELNGRPLKRA
FT                   GENQADEKRAEQAAPEVDLGLRSVTLHAAGKGWFEFRGKINGARVFRVEVGEFELDEAI
FT                   RVSRILDPAAPGEIRMVSSRDPVHPPTTSPNTRTLGDLLVSMKGQRIVATEHSGKKVEG
FT                   TLVAIEQRTEIVDEQRIEREVMTVLTETGLSSMWVDGFESIDAVDEEFRSRLREALEKE
FT                   ARPAELATHAVEFVFGDGPEREVTIGLMRSVPMWKVSYRIEGDQLIHRSIVENTSGIDW
FT                   DGVELSLVDGSPVLFTMDLRSVLRARLNQLQRPSRQVAMAPRFSESLGRAYDDLELAGP
FT                   GIREETIGMDGSMGIMGMDVDLSMGMGMGAGGMGGGMGGGSFGAMPGRASGKGSADLFA
FT                   GESGYGSSLNQVLNETTDAPAGSTLELQFDSVDLDSGKTALLDTLIDPVSVTDVSVYRQ
FT                   SYHPTATLLCLEIENNTPALLPSGPGSVLAGDQMRSILGEVVLPDLAPSVKRLVGYAMD
FT                   GGVRVTTHPVETTSEQQSIEIDEKLHRITIRTQHQRSTQYDVLNRSGDDRNVILEVPLP
FT                   PRPFELQALKDKDIEVEKTDEWHRLRVKIPDGGSREIVTVSKHTADDPNGWGEIAMGTL
FT                   ERWVAEAKWNEAQLETIRSILADRRELEETDRTLEGLLDLRKHLVTELERISNQLTRQR
FT                   GSSSFPREVIQRYQTELLKQENRLAQCEQRMQEFAIQRRKLVDQLGMDRELPSSLSGLK
FT                   AFVIDTDLIPEGMSTVLPSETTTPAEQPKDYPFGSDPFGN"
FT   CDS_pept        complement(215823..217496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB406"
FT                   /product="mucin-desulfating sulfatase
FT                   (N-acetylglucosamine-6-sulfatase)"
FT                   /function="sulfatase"
FT                   /EC_number="3.1.6.14"
FT                   /note="PMID: 10809675 best DB hits: BLAST: gb:AAF72520.1;
FT                   AF248951_1 (AF248951) mucin-desulfating sulfatase; E=4e-37
FT                   pir:F83354; probable sulfatase PA2333 [imported] -
FT                   Pseudomonas; E=2e-19 gb:AAF55296.1; (AE003712) Sulf1 gene
FT                   product [Drosophila; E=2e-18 COG: PA2333; COG3119
FT                   Arylsulfatase A and related enzymes; E=1e-20 yejM; COG3083
FT                   Predicted hydrolase of alkaline phosphatase; E=7e-04
FT                   BS_yfnI; COG1368 Phosphoglycerol transferase and related
FT                   proteins,; E=0.001 PFAM: PF00325; Bacterial regulatory
FT                   proteins, crp; E=0.29 PF00884; Sulfatase; E=4.3e-51"
FT                   /db_xref="GOA:Q7UYS7"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR032506"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYS7"
FT                   /protein_id="CAD71564.1"
FT                   /translation="MGGVLVSAEDDETQAAEPRSMMNKMANVDRMLSGNRIEVLAAKVH
FT                   FYCEKLLLYLARPRPWPSPLEKPPSCQNIMIPSWCRKVWFRHVSPACGLSVFAALLVGS
FT                   LSSPVSADSDESAKASDAPMNVVVLYADDWRHDTLGVAGNPVVKTPTLDALASEGMRFT
FT                   ENCVTTSICGVSRACLFTGQWMSSHGCDGFKPFETPWQQTYPGILRDNGYYVGHVGKWH
FT                   NGKFPGEKFDFGRSYYGRHWFKMPDGSKVHVTQRNENDALEFLGKRPKDQPFCLTVAFF
FT                   ATHAEDGNPQQFLPQPESMHLYQDVEIPVPANATDESFHRLPEFVANDGNEGRNRYHWR
FT                   FDTPEKYQIMMKNYYRLATEVDSTCGRILKELEKQGVLDNTLVIFTTDNGYYHAEHGLA
FT                   DKWYPHQESIRVPLIIRDPRMSADKHGSTNEDFTLSVDLAPTILNAVGAEVPESMQGRD
FT                   MSVLYGANDAEQGDWREEFFYEHPTIRDKNFIPTSEALVRKDWKYFYWPEFDREQLFHI
FT                   SEDPHEENDLVNDPAQAKQLAEMRARFQELKREAASKSNG"
FT   CDS_pept        217387..218925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB409"
FT                   /product="arylsulfatase A precursor"
FT                   /function="sulfatase"
FT                   /EC_number="3.1.6.8"
FT                   /note="PMID: 7910580 best DB hits: BLAST: swissprot:P50428;
FT                   ARSA_MOUSE ARYLSULFATASE A PRECURSOR (ASA); E=2e-38
FT                   gb:AAF63858.1; (AF112242) N-acetylgalactosamine-6-sulfate;
FT                   E=7e-38 gb:AAC27821.1; (AF013158) arylsulfatase
FT                   [Heliocidaris; E=1e-37 COG: ydeN; COG3119 Arylsulfatase A
FT                   and related enzymes; E=2e-25 yejM; COG3083 Predicted
FT                   hydrolase of alkaline phosphatase; E=1e-05 Rv0296c; COG3119
FT                   Arylsulfatase A and related enzymes; E=3e-05 PFAM: PF00884;
FT                   Sulfatase; E=1.5e-38 PF00391; PEP-utilizing enzyme, mobile
FT                   do; E=0.65 PF00884; Sulfatase; E=4.6e-44"
FT                   /db_xref="GOA:Q7UYS6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR032158"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYS6"
FT                   /protein_id="CAD71565.1"
FT                   /translation="MRFPLNMRSTFAILFIILLGSAACVSSSSAETKTPPNVLILYADD
FT                   LGYGDLNLQNAESKIPTPHLDQLARSGMRFTDGHSSSGICTPSRYALLTGRHHWRDFHG
FT                   IVNAFGESVFEPEQLTLPEMFQQHGYQTAAIGKWHLGWDWDAIKKPDAKTFGEGRKKGY
FT                   GPEAFDWTKSIPDGPLAHGFDSYFGDTVINFPPYCWIEDDKVVKAPDTIMDTAKWKPIK
FT                   EGNWECRPGPMTSDWDPYQNIPTTTARGVQFIESQKESDQPFFLYFAFPAPHAPIIPND
FT                   EFDGRSGAGPYGDYVCETDDACGKLLRALKESGQSENTIVIFSADNGPERYAYARDEKY
FT                   DHWSSQPFRGLKRDLYEGGHHVPFVIHWPGVTDSGSTCDALVSQVDIFATLAEMLGHSI
FT                   PDGQAKDSRSLMPLLKEPKQQHRQSLVQNTRVDVYAIRDGKWLLIDAKSGYVSGRNKGW
FT                   ESRRQIPADDKLPHELYDLSVDIGQSENVAGEHPEIVERMKALLQTIREDGYPE"
FT   CDS_pept        complement(218958..219986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="RB410"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /function="amino-acid biosynthesis"
FT                   /EC_number="2.4.2.18"
FT                   /note="PMID: 9061023 best DB hits: BLAST: swissprot:P94326;
FT                   TRPD_BRAJA ANTHRANILATE; E=4e-55 ddbj:BAB05379.1;
FT                   (AP001512) anthranilate; E=3e-53 swissprot:O66576;
FT                   TRPD_AQUAE ANTHRANILATE; E=1e-50 COG: BH1660; COG0547
FT                   Anthranilate phosphoribosyltransferase; E=2e-54 PFAM:
FT                   PF02885; Glycosyl transferase family,; E=7.5e-13 PF00591;
FT                   Glycosyl transferase family,; E=1.6e-96"
FT                   /db_xref="GOA:Q7UYS5"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7UYS5"
FT                   /protein_id="CAD71566.1"
FT                   /translation="MTDSSTDPSLSFSDAITHARGGNDLSAEQTGALIDAMLQGAANEE
FT                   EVGQLLLALREKGEAVSELVGAARAMRKHMTRIDHEHDVLLDTCGTGGSGSGTFNISTA
FT                   VAILASACGVAVAKHGNRRATSKTGSADVLECLGVKIESEPDQVSRRLNDIGICFCFAA
FT                   KLHPAMRHVVSVRRKLAVPTLFNLLGPLCNPAGATHQLLGTAAPETQQKIAAALAELDT
FT                   QRSYVLHAQDGQDEVSLDGETSCIEVASGTQQNHTWTPADFGLTPVHQNALAAADPPES
FT                   AEIIRNLFGGSPGSHRDTVLAGCAAALRLVGRVSSLTEGVEIAAEAIDSKAAQDKLKQL
FT                   AE"
FT   CDS_pept        complement(219979..220110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB412"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYS4"
FT                   /protein_id="CAD71567.1"
FT                   /translation="MKRDEGVSCWLLRIVAASYTWGVQPNVALRKHALMLLSCQADD"
FT   CDS_pept        complement(220107..221150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB413"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /note="PMID: 11997336"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYS3"
FT                   /protein_id="CAD71568.1"
FT                   /translation="MSTSSSSLQRTQTGFATVVIATLFGVGLTIAAGATAADGVSVVSF
FT                   HGYDDCLRLSNGDAVVTLCPAAGGRVLEYSVDGTNVLYLDPDDAGWTLQQFEKGQTDRR
FT                   GQLSAGRFDIGPEMVVQRGNVLWNGRWTAEIVADRTVKMTSQYDPKSGARLTRIFELDE
FT                   TGSHLRCTQTIANESDRPVSLCHWSRTFAVGGGIVLVPRSGPVRFPNGYVRYENGLIRS
FT                   RPTEPNIHVDEDTVVISATPEFPKLGFDSHAGWLAYLAPTDQLFVKRFPTFPERSYNEL
FT                   AGLTVSVWYPEKDLVELEPIGPAENLSPGERADFTEDWYLMPYEFPAESRQMDREEIEQ
FT                   RVKSLSE"
FT   CDS_pept        221324..222268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iunH"
FT                   /locus_tag="RB417"
FT                   /product="inosine-uridine preferring nucleoside hydrolase"
FT                   /function="purine-ribonucleotide metabolism"
FT                   /EC_number="3.2.2.1"
FT                   /note="PMID: 8634238 best DB hits: BLAST: pdb:1EZR; A Chain
FT                   A, Crystal Structure Of Nucleoside Hydrolase; E=3e-32
FT                   swissprot:Q27546; IUNH_CRIFA INOSINE-URIDINE PREFERRING
FT                   NUCLEOSIDE; E=2e-31 pdb:2MAS; A Chain A, Purine Nucleoside
FT                   Hydrolase With A Transition; E=4e-31 COG: yeiK; COG1957
FT                   Inosine-uridine nucleoside N-ribohydrolase; E=3e-31 PFAM:
FT                   PF01156; Inosine-uridine preferring nucle; E=1.9e-51"
FT                   /db_xref="GOA:Q7UYS2"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYS2"
FT                   /protein_id="CAD71569.1"
FT                   /translation="MSRKIIIDCDPGIDDAIAITMALFDPRLDVVAITPTAGTVDAAQA
FT                   SINAMGIVDLLDPARYPQLGTAVAPTDPPMLDDSHLNGPDGLAGLNFPSATRQNDHSSD
FT                   KLMADLIRRHPDEITIVCLGPLTNLARVCRMDPAVLPLIDKVVISGGAVSHSGNATAVS
FT                   EMNFFFDPSSAKQVIASATTKSLVPLDVTDAVTFGVDLLEKLPPETTRAGALLHKILPY
FT                   KFRISHQKLGREVIPLQDATALISVIEPEMFQWDEMAGDVEVNGALTRGMTVFDRRLRP
FT                   EWSVNMEVARRASITDVRDAIVRSIRYAGQQTR"
FT   CDS_pept        222222..223313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB418"
FT                   /product="conserved hypothetical protein-putative membrane
FT                   protein"
FT                   /note="PMID: 1466286 best DB hits: BLAST: gb:AAG59144.1;
FT                   AE005625_7 (AE005625) orf, hypothetical protein; E=0.15
FT                   pir:I78664; hypothetical 34.1K protein (katg-glda
FT                   intergenic region); E=0.20 swissprot:P32667; YIJE_ECOLI
FT                   HYPOTHETICAL 32.9 KD PROTEIN IN; E=0.24 PFAM: PF00892;
FT                   Integral membrane protein DUF6; E=9.9e-10"
FT                   /db_xref="GOA:Q7UYS1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYS1"
FT                   /protein_id="CAD71570.1"
FT                   /translation="MPSCVAFVTPANKPARSTLPMEWMLMALVSAGLLGVYDLAKKLAA
FT                   RENAVPMVLFASACVATAIWGPLLIAQQFTGDAFPIEFLKVQPLTWTDHGKLLAKSVLV
FT                   GASWTLALFALKHLPLSIAAPIRSTSPVWTIVIAIGVLGERPAMMQWAGIAIVVASFWL
FT                   FSTLGKSEGIKFTTNRWVGCMLIATLLGSFSSIYDKYLLQGAGYSPATVQAWFTIYMLP
FT                   VMTPLALHWWFNRRRIAPRGENVDRATSEDLSPTETASKTTARSSTIGTARGTIPGSST
FT                   SKFEFRTAVWCISPLLLAADMVYFTAMANPDAMVSVISTLRRCSVVVALVLGASRLGEV
FT                   NLQRKAFCVAGILLGAAMILLGK"
FT   CDS_pept        223486..224613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB419"
FT                   /product="probable serine/threonine-protein kinase"
FT                   /function="unspecified kinase or ATP dependent regulatory
FT                   protein; unspecified signal transduction; cellular
FT                   communication/signal transduction"
FT                   /EC_number="2.7.1.-"
FT                   /note="PMID: 7768349 best DB hits: BLAST: swissprot:Q11053;
FT                   PKNH_MYCTU PROBABLE SERINETHREONINE-PROTEIN; E=5e-14
FT                   pir:T42076; protein kinase homolog - Streptomyces
FT                   coelicolor -----; E=2e-13 pir:H69878; probable protein
FT                   kinase (EC 2.7.1.-) yloP - Bacillus; E=4e-13 COG: Rv1266c;
FT                   COG0515 Serine/threonine protein kinases; E=5e-15 PFAM:
FT                   PF00069; Protein kinase domain; E=3.3e-32"
FT                   /db_xref="GOA:Q7UYS0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYS0"
FT                   /protein_id="CAD71571.1"
FT                   /translation="MNGMPATTRYEPVPTITYLGEESSQCDPKLVSRYDELTRRRKINW
FT                   TGHYNLRRMLGRGGQGEVYLTEHRGTDGFTVPVAMKIFSPERFPDARSYDEAMQRIASI
FT                   AARIALIQHDNLLDVQNFFERDRIRVMLMEWVDGYDLRQLVMPKCLELLRDHITPKRWK
FT                   YINDVIITEGPEQSRFKPGVAVAIVRECLAALAALHRDGIVHGDVKPANIMLKRSGHAK
FT                   LIDMGSSIDYRNPPKDRECTPLYAAPEVLDNLDATPRSDLASVGYVLVELLSGFNPFNN
FT                   TKNLGELLQAKRELPMNLERILPEEVLRNALLMNFLRGLIAPDPTLRFVSAEAAEHVEQ
FT                   GAAAFHRQLIIGNMSTEYDNDIRLWLEELRRLEND"
FT   CDS_pept        224577..225464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="RB422"
FT                   /product="inositol-1-monophosphatase"
FT                   /function="second messenger formation"
FT                   /EC_number="3.1.3.25"
FT                   /note="PMID: 10747806 best DB hits: BLAST: gb:AAK02399.1;
FT                   (AE006067) SuhB [Pasteurella multocida]; E=5e-35
FT                   ddbj:BAB06354.1; (AP001516) myo-inositol-1(or
FT                   4)-monophosphatase; E=2e-33 swissprot:P22783; SUHB_ECOLI
FT                   EXTRAGENIC SUPPRESSOR PROTEIN SUHB; E=6e-33 COG: BH2635;
FT                   COG0483 Archaeal fructose-1,6-bisphosphatase and related;
FT                   E=2e-34 VC2722; COG1218 3'-Phosphoadenosine
FT                   5'-phosphosulfate (PAPS); E=4e-11 PFAM: PF00459; Inositol
FT                   monophosphatase family; E=8.5e-66"
FT                   /db_xref="GOA:Q7UYR9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYR9"
FT                   /protein_id="CAD71572.1"
FT                   /translation="MVGRASPVGKRLTASDPSDRLQPTPKTNSMDSAHLRLAVDAARAG
FT                   AAELMSRRDHRVVSEKGPKDLVTDADLASQKAIRDMLVGAYPDYAFVGEEEGENDPPAS
FT                   VRAGDPDAPPCWVVDPLDGTVNFVHRLQSFAVSIGLYAAGKMRLGVIYDPTRDEMFTAI
FT                   DGQGAHCNDQKMSASGCTAIEESLVACSFRAGVTADSPEVTRFVKVLEKCRSLRRLGSC
FT                   ALNMCYVADGRLDGYWATNVAAWDSAAGTVIARESGAILEGYGGEEFDDWNPKFCVSAT
FT                   PELQSLLTKQLRGT"
FT   CDS_pept        225404..226054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB423"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID: 10984043 best DB hits: BLAST: pir:A83440;
FT                   conserved hypothetical protein PA1644 [imported] -; E=8e-29
FT                   pir:F75254; conserved hypothetical protein - Deinococcus
FT                   radiodurans; E=3e-26 ddbj:BAB05997.1; (AP001515)
FT                   BH2278~unknown conserved protein; E=1e-24 COG: PA1644;
FT                   COG1853 Conserved protein/domain typically associated with;
FT                   E=8e-30"
FT                   /db_xref="GOA:Q7UYR8"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYR8"
FT                   /protein_id="CAD71573.1"
FT                   /translation="MRFGNARTAIAFDKATERHMIIDPNDVSIGAVYESMVALITPRPI
FT                   AWVSTLSADGIANLAPYSFFGGVGANPPTVMFCPVNRLDGTPKDTLANVRANGQFVVNV
FT                   VTEEFAETMKQSAADVRPDEDEFVLTGLQKAPSVKVEVPRVADVVAAMECEMLTSMQLG
FT                   PGRGGANLVVGRIVSFYVADSVVGKNGLPDPEQIFTIGRMGGPRYTRTRDRFE"
FT   CDS_pept        complement(226068..226220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB424"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYR7"
FT                   /protein_id="CAD71574.1"
FT                   /translation="MNYLTINATMLQTNRLGWESIDLITGLLCALYQLTSLATPMNQDY
FT                   LPGHS"
FT   CDS_pept        226258..229863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB426"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q7UYR6"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR011444"
FT                   /db_xref="InterPro:IPR022655"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYR6"
FT                   /protein_id="CAD71575.1"
FT                   /translation="MIWNVFASRRTIGWFAALLLSCIAFSGTASAEETASKAEIDFARD
FT                   IRPILSDHCFACHGPDEHDRQAGVRLDSAEGIADVIDQEEWQASLLIERIATDDSDMIM
FT                   PPEDFHKPLSPKQIELLNQWVSEGAVYASHWAFATPRRHELPSEEGVVSSDVDRIDQWI
FT                   DVQLKSLGLSAADSADRRSLARRVSFDLTGLPPKLERVEAFVADSSPNAYENYVDELLA
FT                   SPDYGEHMARYWLDLVRYGDTHGLHLDNYREMWPYRDWVIDAFNQNMSFDQFITRQLAG
FT                   DLLPETNEAETLRNQIASGFNRLNVTTNEGGSIYDEVFARNVIDRTDSFGTIFLGLTTG
FT                   CSVCHDHKFDPITQKDYFALSAFFNSLDGRAMDGNNKAHPPVVRVPSAEQSAELKQIAS
FT                   DLAELKAEMAGPLLEVDAAQLQWQQTLAASEESFHANLMPVEVTTKNDGKFKQNEDGSV
FT                   EWDGTPPAKDVMHIISSLPAGTWRMLQLHAKTDEEHPRVGTASNQNAVLSEIKIETRPD
FT                   DQSEWTEVPIRSAKATREQSGDEFAVTKAIDGKIDAKTGWAVGGHEATGDRTAWFGVQT
FT                   IEAEMGQIRVSLHYESQHVSHMLRHVALSLHSSMDQLPEDQRIVLGDSHLIGPLKVENV
FT                   GNGLNKSFAGEDKNEFDPAKKVSYQDQDHEWQHRTDIVSVLSNELPTINDSTSVSILHQ
FT                   VIRSPSDQSVELMFGTDEGSVLFLNGKEVAKQKPGNRKDDDIQPLSQRHKLSLKKGDNH
FT                   LFVRHVNRSGPATLTYAIHSPTVQFSEPLKQRLATLSAPEESSDSPTVDWRAARAFYRE
FT                   LICEHPSWIALNDMHDGMIAMRVKINKQVPTTLVWKETAKPRDAHILERGLYDSPGEKV
FT                   ERAVPGFLPEFPEGAPVDRLGLAQWLLREDHPLTARVAVNRFWQQLFGNGLVKSSEDFG
FT                   SQGHLPSHPELLDELAIDFRESGWNVKEMMKRLVMTETYRRDATATSNMLTVDPNNRYF
FT                   ARGPRFRLDAETLRDQMLSLSGLLVTTRGGPSVKPPQPAGLWEAVGYTDSDTANFVPDE
FT                   GDKTVRRSVYTFWKRTSAPAVMSTFDAPSRESCTARRERTNTPMQALLLLNETQAMLAA
FT                   KAMAQEITASPTPDQSDWEAISRKRIQSAFERVTLRPIETNELRSLELLMADLIEHYSV
FT                   QLEEARKLAGTPDPELAAWTVVMNTLLNLDEVVCK"
FT   CDS_pept        229809..231377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB430"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q7UYR5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYR5"
FT                   /protein_id="CAD71576.1"
FT                   /translation="MDRRDEHPFELGRGGLQMSRSEFPCEDWNALTQSPLMSSVLQERM
FT                   QHLTRRSLFSSAAAGLGAAALASMPGIGRAVDSQPGVPGQPGLPHHEPAAKRAIYLFMS
FT                   GAPSQMDMWDHKPQMADWFDKDLPESIRQGQRLTTMTSGQSRFPIAPSIYKFSPHGANG
FT                   TMASELIPHMAKKVDEIALVKSMYTEAINHDPAITYICTGNQLPGKASLGSWLSYGLGT
FT                   ENEDLPAFLVMTASWTGRKQAQALYNRLWGSGYLPSKFQGVALRSAGDPVLYLSNPDGI
FT                   DSGVRRRMLDTLAELNRNTLDRWHDPETEARIAQYEMAFKMQTSVPELTDLSDEPQHVL
FT                   DLYGPDVTNPGTFANCCLMARRMAERGVRFTQIFHRGWDQHGALPKDLPNQCRDTDQPS
FT                   AGLLTDLKQRGLLDDTLVVWGGEFGRTIYCQGALSKTNYGRDHHPKCFSIWMAGAGIKQ
FT                   GVVHGETDEFSYNIVRDGVHIRDLNATILNQMGIDHERFTYPFQGLDQRLTGVEEARVV
FT                   RELLA"
FT   CDS_pept        231337..231744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB431"
FT                   /product="hypothetical protein-signal peptide prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYR4"
FT                   /protein_id="CAD71577.1"
FT                   /translation="MWKRLASFASCSPKAKRMSPGRQRDRLPGAGQAEVWSSRSKRGPA
FT                   DPIKFGIDHRVGKGNRSRPKRWTATSTGTLSGAGSKVSTPTNNPRSIQRLKRRAGKRPY
FT                   WNSRLRVFHGVRAINRSSIGSRRRTVLLGAK"
FT   CDS_pept        231791..231988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB434"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYR3"
FT                   /protein_id="CAD71578.1"
FT                   /translation="MQTDVVCGATNKILGDPSDRPCKQSEHRYTPPHRSGDETFFIFLR
FT                   AFEEDQKLFSNALVGLFKAR"
FT   misc_feature    231938^231939
FT                   /note="cosmid pircos-b2f12/ cosmid pircos-b2f01 joining
FT                   point"
FT   tRNA            231979..232052
FT                   /product="Asp tRNA"
FT                   /note="Asp, tRNAscan-SE-score 84.19%"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        232161..233408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB437"
FT                   /product="hypothetical protein"
FT                   /note="best DB hits: PFAM: PF00589; Phage integrase family;
FT                   E=0.013"
FT                   /db_xref="GOA:Q7UYR2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYR2"
FT                   /protein_id="CAD71580.1"
FT                   /translation="MRLMPHSSGSVPKYRKHKSGQARVTINGRDYYLGPWKSKASIAEY
FT                   DRVIAEYLASNRSPNFGLSCEELSIAMILVDYLRHSRSYYGSEKTSELHRIKPALKPLK
FT                   ELYANSPATSFGPEQFKAVRQSMIASGLTRPGINSRMKRIVRMFKWAAAEGKLPPSIHE
FT                   ALRLIAPLKKGRTEAPETDPILPIEQSIVDATLKELPPILADMARVQLLTGCRPGEVCQ
FT                   LTPGCLDRSGDVWIANVAEHKTDWHGHDRTLFIGPKAQPILLRYLDREPDVYLFRPIEV
FT                   VEQLRAERAAKRATPPSCGNRRGRKNDRGGLKGKKAVKSPGECYTTESYRRAIHNACDK
FT                   AFPPPADLSEEEAKKWKSEHRWSPNRLRHTRGTDIRKQFGLEAAQVMLGHKNADVTQVY
FT                   AERDIAKGIEVARQIG"
FT   CDS_pept        233429..233737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB439"
FT                   /product="hypothetical protein-signal peptide prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYR1"
FT                   /protein_id="CAD71581.1"
FT                   /translation="MQLVSLQLCFAIQAASTNCPCPQVTRLTWRHSGFISERRRQGTSW
FT                   PLIYCFHQPVTEQKMAGTREPLKIIAPCPRPSTTETNRWCSVLAASETHQDAHASSD"
FT   CDS_pept        233878..234756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB442"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYR0"
FT                   /protein_id="CAD71582.1"
FT                   /translation="MEQEATRQGLQEYIPVRLRCAQSLKPIEHLVMLASLKSQTEGQVS
FT                   TGSLDMTKPFEFSSQDPVIWYSSEFAAAYRKLENALNKDIQTARKAGLKPRELAKTERE
FT                   LRRQFHNDYEMIAKKICQRATLPAVSKDAQDVWFEWMDAFTGPATALHHESGGELLTQE
FT                   VDFVLSESDSTNSQSGLGIADILNPDEDAKKRREGRRLAREWKAAKRIPVESFATKYHL
FT                   ALKLANALLPRRNKRAERSELAGAIYGDPNHDTSGTQIPSLRTKGNQFFDMMHIPWAIG
FT                   TEGEDVFLDCD"
FT   CDS_pept        234881..235261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB443"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR011474"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYQ9"
FT                   /protein_id="CAD71583.1"
FT                   /translation="MRQMQKTKFASLLRAIEKGDEPVSSLDADEEENKSRPLLSAIELE
FT                   NGLRPHPSTATRWCLEPNRHGNVLKSWLIGGRRMTSIAAVKEYNAANNQQSMASDSTAA
FT                   ASSIANSKTHSKAMQDLESEGL"
FT   CDS_pept        235258..236805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB444"
FT                   /product="putative ATP-binding protein"
FT                   /note="PMID: 8843436 best DB hits: BLAST: embl:CAC08270.1;
FT                   (AL392146) putative ATP-binding protein; E=1e-37"
FT                   /db_xref="GOA:Q7UYQ8"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYQ8"
FT                   /protein_id="CAD71584.1"
FT                   /translation="MMSNQTEKNGAAHEPSKAKANGSQGKKSDTDEIVQLGMQGVELWH
FT                   DKSSGRTFATIQIDSHAENYCLDSQSFQRYLESRFYFEHQKAAPANSVTNAIATLKAKA
FT                   LFEGKEHTPRLRVAGDDHSIHIDQGDDIWQSISVDANGYAITSQTPVKFVRRSGMMPLP
FT                   VPRGCDIQLLRKYINVPNEVWPLILAWLLACMRPKGPYPVLILTGEQGSAKSTTAKMLR
FT                   ALVDPNKSPIRAAPKGLQDLAIAANNAHVLAFDNLSHISPWCSDGLCRISTGGGFATRT
FT                   LYANDEETIFEAQRPIILTGIEDVASRADLADRAIVVTLPTISSDERRSEKEIWENFNR
FT                   DAPAIFGGLLDLVSAAIRGLPNVKLTSRPRMADFAEFAVAAEQQMGLQKGEWMKLYLAN
FT                   IDSVNQGLVDDSLIIQTLLPELSTDVLVKTPTEWLETLNDSASDEVKRQKKWPKSARQL
FT                   SGELRRLAPVMRRAGIEIDFETFSTQGRTKISMHLEEEPESQEPRGRDVDGVDDLGF"
FT   CDS_pept        complement(236794..236904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB445"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYQ7"
FT                   /protein_id="CAD71585.1"
FT                   /translation="MLRCGRFGFEHRVETAIGSRRSRLPASSLRLVPSES"
FT   CDS_pept        complement(236928..237320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB446"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID: 9266672 best DB hits: BLAST: swissprot:O15442;
FT                   239A_HUMAN ADULT BRAIN PROTEIN 239 (239AB); E=4e-19
FT                   gb:AAC51673.2; (U84894) 239AB [Homo sapiens]; E=4e-19
FT                   prf:2122285A; 239FB gene [Homo sapiens]; E=1e-17 COG:
FT                   APE2283; COG2129 Predicted phosphoesterases, related to the
FT                   Icc; E=4e-06"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYQ6"
FT                   /protein_id="CAD71586.1"
FT                   /translation="MELNGLKLFGSPYTPRFHDWAYMKKRGQLDLVWQSVPDNVDILIT
FT                   HGPPKGVLDLTHDIESKALVQVGCAALRRHVEERIQPKIHAFGHLHDEKGISNYGKFTR
FT                   GETQFINCSCCNLAAKLTNNGFVVEV"
FT   CDS_pept        complement(237375..237587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB448"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID: 9266672 best DB hits: BLAST: swissprot:O15442;
FT                   239A_HUMAN ADULT BRAIN PROTEIN 239 (239AB); E=0.014
FT                   gb:AAC51673.2; (U84894) 239AB [Homo sapiens]; E=0.014
FT                   ref:XP_013018.1; chromosome 22 open reading frame 1 [Homo;
FT                   E=0.014 PFAM: PF01143; Uncharacterized phosphoesterase
FT                   fami; E=0.00034"
FT                   /db_xref="GOA:Q7UYQ5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYQ5"
FT                   /protein_id="CAD71587.1"
FT                   /translation="MKIWFISDTHNRHRELTVPNVDLVIHCGDESTHGNAWMNEPEARP
FT                   FFEWYSELDVATKVFVPGNHSTAME"
FT   CDS_pept        complement(237584..238009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB449"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYQ4"
FT                   /protein_id="CAD71588.1"
FT                   /translation="MANLLAMRSVLETRPIDGADMIELTVVDGWKCVTKEDEYAAGDAV
FT                   IYCEIDSFLPVREESEFLRKSSLKTMDEREGFRLRKVATSLYLRVSTRCLRPPKERACS
FT                   IPKPNARGWSGFTVVATIVSRSKRSQTDSSPKVATSE"
FT   CDS_pept        complement(237946..238155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB450"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYQ3"
FT                   /protein_id="CAD71589.1"
FT                   /translation="MSESIETYRGEIAGHVDQKRQRRNPRRHSVDQSLVRRLAGQASGL
FT                   GDRGWRTCWRCDRCLRLGRLMART"
FT   CDS_pept        238187..238390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB451"
FT                   /product="probable site-specific DNA-methyltransferase
FT                   (cytosine-specific)-putative transcriptional regulator"
FT                   /function="transcriptional control"
FT                   /EC_number="2.1.1.73"
FT                   /note="PMID: 7607524 best DB hits: BLAST: swissprot:P50196;
FT                   MTE8_ECOLI MODIFICATION METHYLASE ECO47II; E=4e-04
FT                   swissprot:P45876; DCMR_METSP TRANSCRIPTIONAL REPRESSOR
FT                   DCMR; E=0.002 pir:T36638; probable substrate binding
FT                   protein - Streptomyces; E=0.031"
FT                   /db_xref="GOA:Q7UYQ2"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYQ2"
FT                   /protein_id="CAD71590.1"
FT                   /translation="MRVEKLSDYVKVAEAAEILGVAQATLRIWAEDGKIPMHRNPANGY
FT                   RLFRRADLERFLEEVAKPLKPR"
FT   CDS_pept        238451..241546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB452"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID: 9679194 best DB hits: BLAST: pir:F71079;
FT                   hypothetical protein PH0902 - Pyrococcus horikoshii;
FT                   E=8e-08 pir:G75134; hypothetical protein PAB0589 -
FT                   Pyrococcus abyssi (strain; E=3e-07 pir:G72734; hypothetical
FT                   protein APE0415 - Aeropyrum pernix (strain; E=0.10 COG:
FT                   PH0902; COG1483 Predicted ATPase of the AAA+ class;
FT                   E=7e-09"
FT                   /db_xref="InterPro:IPR007555"
FT                   /db_xref="InterPro:IPR026876"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYQ1"
FT                   /protein_id="CAD71591.1"
FT                   /translation="MKTVRDACELQPNALKIQLSDQVEQLDELIQTEGDGTAFFSKTFI
FT                   TDGMRDLIDVGMSRLAGQSGEAIFHLKQAMGGGKTHLLVGFGLLATNPALRKTHCNGSS
FT                   AADAFACANVAAFNGRNNPDHFFWGEIAQQLGKAETFNKYWANGPKAPDEKAWLELLDG
FT                   DDPVLILLDEMPPYFQYYDTQSVGNGTVADIVTRAFANLLTAAGKKKNVCIVVSDLDAA
FT                   YDTGGNLIQKALTDARNELGRQERSITPVDLSNNEIYEILRKRLFSSLPDSAEVDNIAD
FT                   AFGRKLEEAAKSKSVNRGAEAMADEISATYPFHPQLKNVIALFKENENFRQTRGLIELV
FT                   SRLLRSVWDRDANDVFLIGPQHFDLSIKEVREKLTEISGFRDVIAKDLWDKQKSAHAQV
FT                   IDLQSGQESASQVGSLLLTASLSTAVNSVKGLTLEEMVECLVSPLGEPAEFRTAFEELE
FT                   KVAWYLHHTGEGRYYFDRQENLTKLLQSLAEKAPQNQIDALIDKRLKEMFKPTRKTVYE
FT                   EVFPLPKLEDVADRVRKGRVLLIVSPDSKIPPEDVQKFFDGLTRKNNLCILTGDKSAMG
FT                   SIDKAARQFYAAGVADTRIPEGHPQRKDLEDKQQSYEQDFNSTILNLFDKVLFPIQRSG
FT                   QPPKLVHKALETARDTSQPFDGEEQIEKTLTSNPIKLFLDIEADFDAIRDKAQDLLWNE
FT                   GQDEARWADVVERSAEKSGMCWLVPRGLESLKSLACNRGLWEDLGNGYITKSPKKKQTS
FT                   AQVTPESEPNDEGMVRLRISALNAGAAARIHYAEDGPVSEKSPVLQDTYFDTKAMKVNL
FT                   LVADPSGMYETGDPVIWPNKLVLRTEEIGTGDGRKVALYVAPRGTIRYTTNGSEPRDGT
FT                   PYTEPFDIEDGDVLVRAFAEVDDYPDIFAKRDFPFPAVGKTGVQIDDVKPGIMISRTGR
FT                   KLDSRGKVFDGLSHAAEKKVTFEGVQLTIGQGSQVIAVTIGEVSTEADFIEKLLTQVLT
FT                   KFPDDTPVTMSFRKGRFSSGHDLKDFAAKLGIELKTEDIEQG"
FT   CDS_pept        241543..242112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB453"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR024220"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYQ0"
FT                   /protein_id="CAD71592.1"
FT                   /translation="MSKKAKTVDFGAPDTFGAHLFRVEIPSSRSESILIVEDYGYGGME
FT                   NGSPQDEERVILKRAAWSAISAAARTEFNTRLKTAKVTTGRWHSGTNLVDRLLGKELCV
FT                   LAWAAETANVDQLPVVCVKWAALRPEERWWLFAMTVAEAGLPDDTQRGWRRALYHALSD
FT                   GEKPNPAKRRRRPTERTLMPLFKEAE"
FT   CDS_pept        242109..245120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB454"
FT                   /product="probable predicted DNA methylase containing a
FT                   Zn-ribbon"
FT                   /function="recombination and DNA repair"
FT                   /note="PMID: 9389475 best DB hits: BLAST: ref:NP_071283.1;
FT                   Predicted DNA methylase containing a Zn-ribbon; E=9e-14
FT                   pir:H72310; conserved hypothetical protein - Thermotoga
FT                   maritima; E=4e-09 pir:A71080; hypothetical protein PH0905 -
FT                   Pyrococcus horikoshii; E=8e-07 COG: AF2345+6+7; COG1743
FT                   Predicted DNA methylase containing a Zn-ribbon; E=8e-15"
FT                   /db_xref="GOA:Q7UYP9"
FT                   /db_xref="InterPro:IPR009537"
FT                   /db_xref="InterPro:IPR014455"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYP9"
FT                   /protein_id="CAD71593.1"
FT                   /translation="MSTNKIVPFSLKDAPSLIEKLLPVQKLSAESYKEQMAGSGKTLTA
FT                   LGSYWKGRKPLILNKACILGCLLPATDDPKRDLEIFEMLMAMDDESFVARWKRRYRPKE
FT                   ILEKLPLDNVRDLFTSEPEGVLPESSPINWSEDEYEGVRVQWRDEVSELSRRRIEKRLL
FT                   PATVYRERVHVALRPEEVGEEVHEHIWSFVNSHLGTTAASFPELTEQLGVMRFGNRPRF
FT                   ADTFSGSGQIPFEALRLGCDVHASDLNPIACILSWAALNVVGGNLESRDRLVHNQQKLI
FT                   REVQRIIDDLGIEIDGDGWTAKAFLYCLEVRCPQSGWLVPLLPSRVVSRGKKAVARLVP
FT                   DFASKRYDIEIVSNVEDDELNAAAIGTVHSGGRGQESFMVHCPENLEYRTKIPTIRGDY
FT                   RTTDGEKGNKLRQWAKEDFQPRSDDIFQERLYAIFWMKRKSSGKRYDFEFRGIGNDDIQ
FT                   REQTVVEYVRSRISKWQGEGRVPDSRIEPGEKTDEPIRTRGWTHWHHLFNPRQLLVCAL
FT                   IKEHAVGSQIPSVANFLNYNSKLCRWDSNPGPGRVGKSQGVFDNQALNTLYTYACRSFG
FT                   WSKEFFSSDYKTFPTELGHIVKAESADQLSTDHDIFVTDPPYGDAVKYEEILEFFIAWL
FT                   RKNPPAEFADWVWDSRRSMAIKGEDEDFRRGMVAAYKRMTECMPDYGIQVIMFTHQSGS
FT                   IWADMANIVWASGLQVTAAWYVVTETESALRDGNNVKGTVLLVCRKRLGKHKTTRDELA
FT                   WEIEEEVQSQVESLTGLNQQAKGLYRDENVFEDADIQMAGYAAALRVLTRYSTIDGRDM
FT                   ASESIRPRVKGEVTFVDDLIGYAVNTANQCLVPQGVSKSHWDKLSGAERFYLKMIDMEA
FT                   RGFNSIDNYQNFAKAFKVKNFQALMASQRAKSARLKSAVEFARAEMGEGSELHQSVLRA
FT                   VLYGVMELTGDVETDDVLSHLTMNVPNWFGDMNGREMAKEFADYLAKRLEELRPEEAAS
FT                   ARVLRDLIRNQRIG"
FT   CDS_pept        245228..246406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB457"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID: 8688087 best DB hits: BLAST: gb:AAC37104.1;
FT                   (L77118) M. jannaschii predicted coding region; E=4e-04
FT                   gb:AAG45955.1; AF282921_1 (AF282921) putative RecF protein;
FT                   E=0.005 embl:CAA71688.1; (Y10687) purine NTPase
FT                   [Sulfolobus; E=0.047 COG: jhp0346; COG1106 Predicted
FT                   ATPases; E=0.005 PFAM: PF02463; SMC domain N terminal
FT                   domain; E=5.1e-06"
FT                   /db_xref="GOA:Q7UYP8"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYP8"
FT                   /protein_id="CAD71594.1"
FT                   /translation="MIHEIRIQNFKSIQDVTVEFSDVTVLVGRSGTGKSNFVEAVRFLR
FT                   DLLRGQPGGSGGGMGGVFGGGQNPFALMRPLPMTEAPTRFEICFSVRSSKERYRYLLDL
FT                   GKSPEQGRFGEEKLLLGDTILYHQSSDKNAMAWIQEPRLVDIPKPGGIALGRMPSLSDV
FT                   VVAYAALTEGIGCYTFPNSVMLIGAPAEAGQSGFQDSGANYLDTMKKIVSNFQDASARQ
FT                   RIVKSLQRVNEGVSSVELNDLRQPQYAIVGHLFNDKTLELKLSQESEGFRRFYAHLLAL
FT                   YQQPPKLAMLFEHPEDAVHPGAFSLLAEEFLAAPMEGRGQVILTTHSPGLLDRFTASQI
FT                   RVVEKEGFYTQIGPLSEEQRAALEERLTDPGELLTVDPARRQGTSAVEVVGE"
FT   CDS_pept        246403..247077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB459"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR025455"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYP7"
FT                   /protein_id="CAD71595.1"
FT                   /translation="MKKIVSFVEGEGDAEAVPFLLRKILSSQQAFDAVSIDPSPFRIGQ
FT                   VNKLRKNGFRDWHNKIRAAMKQPNVGGILLLLDGDVDLKNKQPFCAMTVARELAAEALK
FT                   VGAGATFSVACVFACLEFESWLIAAAPGMGTLPDGRELRLPDSLPPNPEEAPRAAKAWL
FT                   NTVLPGGYRATTDQSVLTKAIDLEVLRAANLRSFRRLENALAELVAAVRTGNHVASPMI
FT                   GD"
FT   CDS_pept        247083..249788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB460"
FT                   /product="probable DEAH ATP-dependent helicase"
FT                   /function="DNA synthesis and replication"
FT                   /note="PMID: 155284 best DB hits: BLAST: pir:T17395;
FT                   probable DEAH ATP-dependent helicase - Dichelobacter;
FT                   E=2e-14 gb:AAG20812.1; (AE005149) ATP-dependent RNA
FT                   helicase; HepA; E=2e-14 pir:D71079; hypothetical protein
FT                   PH0900 - Pyrococcus horikoshii; E=1e-11 COG: PH0900;
FT                   COG0553 Superfamily II DNA/RNA helicases, SNF2 family;
FT                   E=1e-12 MJ0669; COG0513 Superfamily II DNA and RNA
FT                   helicases; E=8e-08 AF2350; COG0553 Superfamily II DNA/RNA
FT                   helicases, SNF2 family; E=4e-07 PFAM: PF00176; SNF2 and
FT                   others N-terminal domain; E=7.6e-06 PF00271; Helicase
FT                   conserved C-terminal doma; E=1.1e-12"
FT                   /db_xref="GOA:Q7UYP6"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYP6"
FT                   /protein_id="CAD71596.1"
FT                   /translation="MSDIYRFSSRRERLDHAFLAKRLQSAKSYKRIAGYFRSSIFELVG
FT                   EQISSIPKVQIICNSELDAADVVISKHVRDTALKERWNEAPSEVEALLHRDRYRQLHSL
FT                   LTSGQVEIRVVPKHHVFIHGKAGVIEAGDGSKTCFLGSINETKSAFAHNYEILWEDRSA
FT                   EGVAWVEEEFDALWSDAYPLPDAIIEEVKRVADRIEIRFEDVKTQELPGAALAESPIYR
FT                   GGEQLQPWQRSFVTMFLEHREIYGKARLLLADEVGVGKTLSMAASAMVAALLGDGPVLI
FT                   LCPSTLTQQWQVELQDKLGVPSAVWLSNKKCWSDPKGHVIKTRGPEDVVRCPFHIAIVS
FT                   TGLLVHQTRERELLLERKYGTLILDEAHKARRGGGVGPKSGQPNNLLDFMLKIGPKVRN
FT                   MILGTATPIQTEVQEVWDLMSILNKGADFVLGRELYGCWADFQRSLPVVKGDEVPETEQ
FT                   DAWEWLRNPLPPAKEDALFATLRMGLSLPDNKFFTDRGFGSLEYLEQQAVSQSLEPGFL
FT                   QQHNPIVRHTVLRRRQTLEEAGLMERVGVDVHPDPDAPATSYAGVGFNGLGLMTNHPFD
FT                   LAYEAADAYTVELKKRTKAAGFMKSLLLQRICSSFASGESTARKMLRQEVADEEEQPML
FT                   IEQTLQNTTDKEAEYLNTIIEELSREEARDPKLTAIRYFLTQHRTEGKTWLEHGCIVFS
FT                   QYYDTAFSVARELALVLRDEPVGVYAGAGKSGLFRNGDFANVEREELKHAVKKRELRLL
FT                   VATDAACEGLNLQTLGTLINVDLPWNPSRLEQRLGRIKRFNQARRTVDMLNLVYHDTQD
FT                   ERVYQVLSRRMKDRYDIFGGLPDTIDDGWIEDIEQLEGKMDEYIHLRKKARDVFEMRYQ
FT                   DTVDADANRWETCSRVLSRHDVVDRLSEPW"
FT   CDS_pept        249801..250751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB461"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID: 11016950 best DB hits: BLAST: gb:AAG20152.1;
FT                   (AE005093) Vng1977h [Halobacterium sp. NRC-1]; E=0.002"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYP5"
FT                   /protein_id="CAD71597.1"
FT                   /translation="MIDWANTTTDDFLQSVPLAEDDRWEFKSAMFLERSNKGEFQKELS
FT                   KQVSALANSGGGNLVFGLSDSRVLEPCEQRVGRQPMKDYLATLVEQSVEYPLRQFKVHR
FT                   IPFTGDDSNSVFVVEVDDSLAAPDQAKSDRVYYYRIDGHTKPAPHFYVELLRQRETRAV
FT                   LEIQCVEYHVEKFLGTETGIVEVLMVLPIRNVSFQSATSWGVLIEHTRQDDSWEIRPTG
FT                   EKLDEARCFMGSPTPLLPQASTRLCIPLRGRAYDQAGALAAVQKLWKSVGFSFRPVTQN
FT                   HVGQPIAFGDWPDRIKTAVAMRELDEQLSAVLPRD"
FT   CDS_pept        250803..251342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB463"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYP4"
FT                   /protein_id="CAD71598.1"
FT                   /translation="MLMPRLSEADPAESAEGSIDPLGMYPIADALASRMVPGVRERQTL
FT                   PRFLTTIAVSLSLCSVFDEDTVADDGVSEPWQVFEWYVVEGLARATSDPKLLRGLPGRD
FT                   KADKAKAAGDCRSDVISREQELSIFTVSTERWPRKSGSKRRGDLVMPAMRCCWLGYPNQ
FT                   TMRARSTRCQFGKDAW"
FT   CDS_pept        251275..251688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB464"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYP3"
FT                   /protein_id="CAD71599.1"
FT                   /translation="MGIRTKRCVLGRLDANSEKMLGDRDVQLNADYLNGLNKAERCVHR
FT                   FTISRGQEFVETAEKTIHALARDEWGGLNSGGELLAAIVVPNEPATAKVLKLASGGWRS
FT                   VATPWRSIVTRALPRASPTCLSRHFGRRLRNDH"
FT   CDS_pept        complement(251791..252036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB466"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYP2"
FT                   /protein_id="CAD71600.1"
FT                   /translation="MQLSSKYHCSQTTLAHRSHALKTFRESVRRMNHFAIHGCILANLV
FT                   TTPQTQRPRSTPLSLTRYISCQCLDFVGDIADIWSR"
FT   CDS_pept        complement(252026..252319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB468"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYP1"
FT                   /protein_id="CAD71601.1"
FT                   /translation="MCFATSKCSKTQERFIRRSGVDHSANSRQNTRLTLPSKIKIEVSV
FT                   IRGLSQVLTKEVPDETSFAGDKSRHWRTVGQAIPCRVAPLQSLTPFRLTNAT"
FT   CDS_pept        complement(252291..252425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB469"
FT                   /product="hypothetical protein"
FT                   /note="best DB hits: PFAM: PF00665; Integrase core domain;
FT                   E=0.2"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYP0"
FT                   /protein_id="CAD71602.1"
FT                   /translation="MDFAFDNAVEERFFRSLKHEWTKFEFFADIQEAWMSVFRDVEMF"
FT   CDS_pept        complement(252456..252713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB470"
FT                   /product="probable transposase"
FT                   /function="retrotransposons, viral and plasmid proteins;
FT                   recombination and DNA repair"
FT                   /note="PMID: 7518087 best DB hits: BLAST: embl:CAB46576.1;
FT                   (AJ132945) IS1329 transposase B [Yersinia; E=2e-09
FT                   embl:CAB61574.1; (AJ251581) transposase B [Yersinia;
FT                   E=2e-09 prf:2113421B; transposase [Burkholderia cepacia];
FT                   E=4e-09 COG: DRB0019.2; COG2801 Putative transposase;
FT                   E=5e-12 PFAM: PF00665; Integrase core domain; E=5.4e-05"
FT                   /db_xref="GOA:Q7UYN9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYN9"
FT                   /protein_id="CAD71603.1"
FT                   /translation="MVSRLDRFVIGTYLPTDSGWGYLAVVTDLFSRKIVGWSVSKSLAT
FT                   PLVTSALRRAIGNRRPSTGELPHHSVRGWRCTSSEFRKML"
FT   CDS_pept        complement(252719..253264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB471"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYN8"
FT                   /protein_id="CAD71604.1"
FT                   /translation="MVSELGPRICPFQCVKLCACQPGWLLQLNGTRRVTIAHLPRRVAV
FT                   CDLCGVVSACVTLIQERTLLNLQGIRRFDRFARFQSLDWNASGTAFGIENRFPKTNSGF
FT                   TSYLKDEVACWKGFLRHLSGAPMVAIAHDWRTSGKFSKLFSVPLYVRETHSPNVQQLIQ
FT                   AGGSQSRDASRLFLRGGR"
FT   CDS_pept        253266..253409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB472"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYN7"
FT                   /protein_id="CAD71605.1"
FT                   /translation="MGHARRFYASGYLPKVIPRIPEMTAFHCVRLRVFALVNLACKLPF
FT                   SL"
FT   CDS_pept        253418..253648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB473"
FT                   /product="hypothetical protein-signal peptide prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYN6"
FT                   /protein_id="CAD71606.1"
FT                   /translation="MILGYHERSLSIRRLRVRVPSASLLKSPAVSAGLFLCAAATPSGV
FT                   TRSRIRQEFGSSLPGFDPRHDRAHIDRVHDD"
FT   CDS_pept        complement(253675..255858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB475"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /db_xref="InterPro:IPR011475"
FT                   /db_xref="InterPro:IPR022660"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYN5"
FT                   /protein_id="CAD71607.1"
FT                   /translation="MILIPPRHFQMNSTMCSRQIKFASQWISLACVGVTAFLCVIPCPS
FT                   HCAAQDGLTRLTDLFGQASVAKSKPSYSELVLPALRDRNPEAALQKLDESASSLTISDM
FT                   LYSDLPSAAAALNRALVQSSSDQQYEWLEEWTLPTEQRKRVRVLSTPVPTDAPPKVFAR
FT                   SIGERPRDNTFAVASVGPVEGFFCSGWTLVQAANELGRLPRLRITLEELHEQNVSGAEE
FT                   LLVLAQLLGSRGDLDMAKSFLEAQAALPVESTPLTSRDMTVAAIAAAAMLHDSTQAAAE
FT                   AHLASLVDRAVDERSIGMRPFLRIAHAVAVQSHRGESPPATLFENPMKFWVPATVQTSK
FT                   DIQRGQRDGMWLTHERHVLHVAGGTADVLFCRFPLTGEFDFICETQSGGSIGTDGGLVY
FT                   GGLHFQATGRNTTLSVWDADSQQRVNRHSPFARTGSQPVFNRVSIRSTKQTSQFESNLH
FT                   PIWFDDEIAQTSPWIGLRSSGTKRPVFRNVMLTGEPIIPRQVSLIAGDELRGWQSSFYD
FT                   EVQPPFRNQIAGAVFEPSPEDTAPNARELDWQVQSGVLLGTAKENADEAEQPGLLQYQR
FT                   PLLDGESIAYQFFFGEDASIVHPAVGRMAFLLEPTGMRVRWLTTGGNDWTTLPMDNTAL
FT                   EPLSRRGPRSLPLKSNAYNDVRVELSDGKALVHLNEELVYQRDLEPGASTQFGLYRSSR
FT                   GAPAKIQNVVMKGEWPEAVPEEFLANPVATIDR"
FT   CDS_pept        complement(255869..259174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB479"
FT                   /product="similar to FKBP-rapamycin associated protein"
FT                   /note="PMID: 8008069 best DB hits: BLAST: gb:AAA58486.1;
FT                   (L34075) FKBP-rapamycin associated protein [Homo; E=0.21
FT                   prf:2014422A; FKBP-rapamycin-associated protein [Homo
FT                   sapiens]; E=0.21 gb:AAC39933.1; (U88966) rapamycin
FT                   associated protein FRAP2 [Homo; E=0.21"
FT                   /db_xref="InterPro:IPR011475"
FT                   /db_xref="InterPro:IPR022660"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYN4"
FT                   /protein_id="CAD71608.1"
FT                   /translation="MMNDLKNQRVLKSVSVLVAFWMLANANQPSQADDAARSDAGAFAW
FT                   IFDDHHVSESGTMVCEHAEGLEPTERLQYLKSWVIPGPNSPRLRITADFGHVDDDQPEH
FT                   PAVISPALQLIRLAGQSNQLDSLSKDINQFAATTPEDRCDQLVMSVLIALEKNDVAAVE
FT                   KGVDELLNLVRPVSALLDRSRDGIVLLAEKAVQSKPSTTAIRELVLFTTLAYRKEYDRP
FT                   AWIRHLVAAQVRLSEPEEVGSAMEGSPQWFMGSLERAFDHGNAFPYPNPSVVQGQYRNQ
FT                   SNYGDDFLFFQSPLHGEYTVDAMATGFGYREAHLLVGGYYAGLVYNHTQNMVGNVRQEL
FT                   GRTSIGEELTDTHRYGILRTRAQVRDGEVVTSINGREIHRQPLGDSAYPWIAVRTNYRV
FT                   QGGVDNLRITGDPIIPDRIEMVESAELLGWYDYYQDPGNRSNQLANWSAYRVQDLSAGL
FT                   ITEITDPQIAYLPRGSHVEHLLRYIRPMVEDGVIEYEFWYDGDQSAAHPALGRTCYLIR
FT                   ENGVSEHQLTDGRYDKSGLRPDNERRVSAKDSPPVPLQVKAWNQMQLQRRGDEVVLRLN
FT                   GQTIHESKIESNSLSPCFGLFHFADQSALRVRNARWSGDWPKELPEIDEQQLAGDFEGK
FT                   LDWTASEPGQELSYRIDRDAMVGGRFLQIEGDPAKTLMATDEGVVLNQTSDAGYRGTLM
FT                   APDVRVGGDFDITVTYDQLQCESQKEKIGSIRMHVVADTPAEDTALIQWVNDRGNDQMM
FT                   QCLRMATVNGEQRRHYFGKIPCDGDAGRLRLSRRGDKVFYLAADGDSDYFYLIGEEEFV
FT                   KEDLKPMSIQFGVQIQGPDGRVNARFTEFQVRAERLEGVSEIDHEASLASLDQQRDRLP
FT                   FTLEHDFTKAAEDPNAIYHWGAWHRSPSGVKVIAPGTDEWTSAGVSLQHLIEGDFDIAF
FT                   YFDAVHLETPVQGQQTQLYLQIEWSDDDSTQVNAMMNKSDSGTVASRAMSRVLSDGKSI
FT                   YRIIGSQPLDNPDYLRIVRRGDRCFCIAGREDDQQSLLLGTVRVSEQPIDPRRVRVVLH
FT                   TGGAGRSSEVLLKSIHVRAAGITLAAPVMGQPVPAKPESRAPSIFDSLRNFFR"
FT   CDS_pept        complement(259182..262586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB481"
FT                   /product="hypothetical protein-transmembrane prediction"
FT                   /db_xref="InterPro:IPR011475"
FT                   /db_xref="InterPro:IPR022660"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYN3"
FT                   /protein_id="CAD71609.1"
FT                   /translation="MQFETHSVDSKSLLQTACRLSACVVGLMVSLNVCIADTPLAEELV
FT                   KDDSVALNHLFGENAIQDNAVQFLARMDDLDPPQRYEELSKWVLPGNGHGLRLGGSIAR
FT                   PAGATADVAARDWIPLSEYPETEWIHCPARELVHLSVELGREPELKKRIAEWNPAGNDQ
FT                   VRAKEAMVTLLTIAESDLNGVRHHLIERFAKNRHWQDPNAADLWWEDLIILWAAAENPS
FT                   TTDLVIEDLFGAFSGLRDYIPDANLDLTADYLCLLLGYCSARSHESMTSVPESFDVFSR
FT                   VDASSHGRGNVLPRFAMHDQGVEKVSGHELDYLVYRSPLLGDFEAVAKVATHNGAFSEL
FT                   MVGGVAVSPSDSRAVSSVGSFAKGNWEVPVSKPIEPLGGESLLRASSSDGQVEHFFNGY
FT                   LTHTESTHIASAPWVGIRGWRRSKGHIADLRIAGSPETPPTIDLLSDVSLRGWASYYNA
FT                   DTNNGLGNWSIQAEDGVFTLVSDRTGEWFGSNEEELLYYVRPIVWDARIEYEFLHDAMS
FT                   ADVFPCVGRKAFLIDSTGVSFHQTTDGMHQQTPLRPDNRMRLESGGKPDMVEGWNRVEL
FT                   WFKGDRVVVLLNGKVIAKEQVSGNESRTFGLFHYRDQTRAVVRNLRLSGDWHDSLSEVS
FT                   EQKLASSLVKELEAAAEKLPEHFEHDFANGVPAELFDVDGRADRLFSLPDGIHMVRATP
FT                   SDKVAVRLNGTIDGDFEITYGFKDLQIGDEEPTWHCGLGMTVQLDNGHRDCLDVCIRRD
FT                   RINGLHDIAFAHNKKNLGGGYKWVRGWTRRELSTSGRLRLVRRGGTIYGLFAQGDSSQF
FT                   HLIGSTGIPLGPVPPFGFYNYSVGGNGMSVSGTWTDLRIRAETVDLQLTDTPEMLEEIN
FT                   QARRGMRALDLNLSKQGMDDGDWIVVDGPVESIAETSDGLLFTALGGIETAERIAILKP
FT                   LWQTLTADFQSEFSIVKAVGNRERGMTTEAVIGLHLLDIGTEEIAPTQTTITEATLLVR
FT                   YKPDGRIELRPRIVGRNRDGETVYQPLRDLTIQMPDQLRIALKDQTLYYLYRADGTEEE
FT                   NLVATYKLKRKTVATRAETWFIGGLNNGEMRALLKRMTIHTDPTTPATNPIAAPIMVMP
FT                   VKDETAESPTQDGVPSRIYNSIRNLFR"
FT   CDS_pept        262569..262733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB483"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYN2"
FT                   /protein_id="CAD71610.1"
FT                   /translation="MCFKLHWVSRGQASSIVPHLQNVAAREWITRRNSQKMPSWFAKLR
FT                   KRQIHPIDL"
FT   CDS_pept        262633..262809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB484"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYN1"
FT                   /protein_id="CAD71611.1"
FT                   /translation="MSPHANGSHAEILKKCPLGSRSSGSDKFIQLIYSGTKEPRAFSTG
FT                   LCRSSSNLIGHRK"
FT   CDS_pept        262831..262968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB485"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYN0"
FT                   /protein_id="CAD71612.1"
FT                   /translation="MMDPPRKQFSSFLIVSAREFSTRFDLPLNAGGPRVRDPADWRDRF
FT                   "
FT   CDS_pept        262950..263633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB486"
FT                   /product="probable RNA polymerase ECF-type sigma factor"
FT                   /function="transcriptional control"
FT                   /note="PMID: 8052622 best DB hits: BLAST: pir:E71368;
FT                   probable RNA polymerase sigma-24 factor (rpoE) -; E=2e-05
FT                   gb:AAC45219.1; (U87308) extracytoplasmic function
FT                   alternative; E=1e-04 pir:T45196; probable transcription
FT                   initiation factor sigma factor; E=3e-04 COG: TP0092;
FT                   COG1595 DNA-directed RNA polymerase specialized sigma;
FT                   E=2e-06 Rv3286c; COG1191 DNA-directed RNA polymerase
FT                   specialized sigma; E=0.005 Rv1189; COG1595 DNA-directed RNA
FT                   polymerase specialized sigma; E=0.005"
FT                   /db_xref="GOA:Q7UYM9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYM9"
FT                   /protein_id="CAD71613.1"
FT                   /translation="MARPILNNAELIEGLRNREPSAAQYLNDCFVPSIWRFVYCRVDRD
FT                   AHLAEDIVAEAVLALMSAAVSDTDIENPGGWLRTVAHRRIQDHYRAAARVRHLMEDAQH
FT                   QGEPTDDNDPATQHDQKMRRESVREAIDTLPEHYRQTLEWKYVDQISVKVIAERLDTTE
FT                   KSVQGTLFRARQALRDQLKTEQIVPPQTKCSGPDKETSRPTQSDDSPSLTSPTPPKQVS
FT                   AWFFL"
FT   CDS_pept        263647..266280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB488"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q7UYM8"
FT                   /db_xref="InterPro:IPR011444"
FT                   /db_xref="InterPro:IPR022655"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYM8"
FT                   /protein_id="CAD71614.1"
FT                   /translation="MHRFASMTSERPQHPSSIDNDPSELHRNEDDESSVAMLLADALDA
FT                   PPVPRSLVKRLDAEITEQWGHSPQLTRSHATGTVTLASAKRVIKTSWWLAGSVAASVML
FT                   IVFLTGGTNTYAWATVMEAMQQHGLIQIADEDGNRWLDLSNQVACQQTPEETRWVDVRR
FT                   RTVMVRSHDVETKSSTLALPGNASPTKEELLAMVLLDRPLTAESIEQFRGVRITHQEWE
FT                   QRPDRGREIVELQVEFATQDDQRYELSLELDPKSKLPLAINVSDPPQDRLNTSSLTYLK
FT                   ESTTELQTRLQLASADLDTPADVRSLDRIAANNRASSPETKLPGMLDDSPAKARTDDDP
FT                   ASNEVKPTVDARDSIVSLPVGPANKWQPVSVISRNDEQVIARADLILDELWAERQIRPV
FT                   DRATDLQLLRRVYLDLAGRTPTVTEVRRFLENDSENRYRELVDHLLDSPDYTSQMAAVW
FT                   RSFLIPEGVDLDAFGGREAFEKWLAEQFTNDEPYDKIVRRLLLAEGRLAQSGPLLFYSA
FT                   LKLDADQLAARTSRVFLGMRLECAQCHDHPFEPWSQEDFWSYAAFFAQISRPKAMLENV
FT                   STVMQVRDVDRGEVMLPESEEVISPRFLGQEWEDQDDSQPQAPRRQRLANWLTGPNNPY
FT                   FARATVNRVWSHMFGRGIVDPVDDFGENNLPVSADLIDTLASQFIDSDFDLKQLVRTIA
FT                   LTRAYQLASSSNRDDDSPDAIEERLTTFAQMNVKTLTPEQVYDCIAVATLLDQRNEASD
FT                   YTLARFGNNQRDTFLQQFAAPATSRSEYLAGIPQALMLMNGSLIGQATHEQSSGLIRSL
FT                   NAPFFTDEQRIEVLFMATLSRPPRPSELELVAEFIPADSNREQRYTGMADLLWALINSS
FT                   EFTLNH"
FT   CDS_pept        266293..267636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB490"
FT                   /product="hypothetical protein"
FT                   /note="PMID: 11823852"
FT                   /db_xref="GOA:Q7UYM7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYM7"
FT                   /protein_id="CAD71615.1"
FT                   /translation="MSFPNMNSPSRRRFMQSMAAGIGGVSASGWFPALAEAAANDPKRR
FT                   RHCILLWMSGGPTQTDTFDMKPNHENGGEFKEVQTSAPGLRFSEHLPKLGSMADKLAVL
FT                   RGLSTKEGDHGRGSYLMRTGQKPMGPVQYPCIGSAIGKQLAEDTMSLPSNVSIGTYRAF
FT                   NQDAFGPGFLGPRFGPLFVGATDVPGGMSNGEDGYPNLKVQYLDRAEGIDAERMDKRLK
FT                   IWRRLQSHFVTSRQAGAAGMHNEVYEGAVRLMNSDDAKAFDLSDEPEKLREAYGNNVFG
FT                   QGCLMARRLIERGVPFVEVSLGTDSTSVGWDTHTDNFNAVQNLSTILDNGWGTLMQDLE
FT                   DRGLLESTTIVWMGEFGRTPAINPNAGRDHFPNAWSSVLAGGGIAGGQAYGKTSEDGTE
FT                   VIDGKISVQDLISTLCKALGLGSAPSNMSPGGRPIPIAEGRAIEEVLA"
FT   CDS_pept        267633..269384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB492"
FT                   /product="probable calmodulin"
FT                   /function="intracellular communication"
FT                   /note="best DB hits: BLAST: gb:AAD34246.1; AF084398_1
FT                   (AF084398) calmodulin mutant SYNCAM46; E=0.002
FT                   gb:AAD34433.1; AF084449_1 (AF084449) calmodulin mutant
FT                   SYNCAM26; E=0.002 prf:1003191A; calmodulin [Oryctolagus
FT                   cuniculus]; E=0.002 PFAM: PF00036; EF hand; E=0.034
FT                   PF00395; S-layer homology domain; E=0.44"
FT                   /db_xref="GOA:Q7UYM6"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR039647"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYM6"
FT                   /protein_id="CAD71616.1"
FT                   /translation="MSRLGNRNVALIAFAVLSAFVPCCIGVAVCDDTSQSLDAEPLASS
FT                   PVKMLSSSTSETRQPSMIIGVPIAPPASLPAEKLPQYRIELPRHNEADESFADGQIQFA
FT                   ITHPDLLTQIGRPLRVKAKVQVDGKPFSEVRSAYATSAQTAEQPPLMEQLSDLVEAVAS
FT                   ASESVADEIEAASEEGKEENGNDEDADEDDDADDTEDEDATPPISPATLDPYRMTTAPD
FT                   ETMRRFAEAIGEDLTDIESNWLLSHWTIGPPLLVVHPYFQSFRSDQRPAFDILDRDRDG
FT                   TVSQPEMLQSVESFNKCDANRDEVVDAMELANAADNLKDPAHIPLSNGPLLWLPDDLIG
FT                   VQETDPLLYELVRSLDEDQDGTVSESEVNEWSVQPADIEVSINFSTASPESARVDVVRV
FT                   GKEVSANIVPTTNANGIDVAFEAVTIRLCGVQESPSPEFAKAMSGQVSLGAIVDGYPLL
FT                   PNLDPNDDGRFTIRELRKLEQLLRTFDRDGDQSITRSEAASPIRVCIGLGPTAHRELAN
FT                   VRDTSQPETSPSVTAPEWFQRMDRNLDNDLSRREFPGTDEQFRSLDADGDELIDASEAQ
FT                   TFEQSAE"
FT   CDS_pept        269443..270549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB497"
FT                   /product="probable regulatory protein"
FT                   /function="transcriptional control; C-compound,
FT                   carbohydrate catabolism"
FT                   /note="best DB hits: BLAST: pir:B71126; hypothetical
FT                   protein PH0776 - Pyrococcus horikoshii; E=9e-66
FT                   ddbj:BAB04450.1; (AP001509) BH0731~unknown conserved
FT                   protein; E=1e-65 pir:C75037; methanol dehydrogenase
FT                   regulatory protein (moxr-3); E=2e-64 COG: PH0776; COG0714
FT                   MoxR-like ATPases; E=8e-67 PFAM: PF01078; Magnesium
FT                   chelatase, subunit C; E=1.2e-08"
FT                   /db_xref="GOA:Q7UYM5"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYM5"
FT                   /protein_id="CAD71617.1"
FT                   /translation="MEDPSEKTMPSRLETINAVNSNHTNNHVKQPEMDVALVVDQMHEK
FT                   LSELREQLAGVIVGQEEVAEQLLIGILCRGHCILQGMPGLAKTMMVSTLASLTDLSFRR
FT                   VQFTPDLMPGDITGTEVLEEDHTTGKRIFRFVEGPLFGNVILADEINRTPPKTQSALLE
FT                   AMQEHQLTVCGKTYKLPDPFFVLATQNPVETEGTYPLPEAQLDRFLLKIHVRYPTRDEE
FT                   REIARRQTTDYSFETKTVLDVEQISQMQSLVRSVVVSDHVYNAALDLVRGTRPDEGSMS
FT                   AELKNMVQFGAGPRATIALLMAAKARALVNRRCHATVADLVAVAKPVLRHRVILTFNAE
FT                   AAGVDADSVLEKNIAQTPSLKNNSPVVS"
FT   CDS_pept        270596..271717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB498"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID: 9634230 best DB hits: BLAST: swissprot:P71761;
FT                   YE80_MYCTU HYPOTHETICAL 34.3 KDA PROTEIN RV1480; E=7e-17
FT                   pir:G70121; conserved hypothetical protein BB0175 - Lyme
FT                   disease; E=5e-12 pir:D83106; hypothetical protein PA4323
FT                   [imported] - Pseudomonas; E=2e-09 COG: Rv1480; COG1721
FT                   Uncharacterized ACR; E=7e-18 PFAM: PF01882; Protein of
FT                   unknown function DU; E=1.3e-17"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYM4"
FT                   /protein_id="CAD71618.1"
FT                   /translation="MAKRHCSHVQPGRTLKQLAWFCPITPAYLFASPSVFPTNDRHRFM
FT                   LGLFRRQSKFDAHAPTKKSGAGASDLVDPVVMDQIGHLELLSRTVVDGLLAGKHRSTTK
FT                   GGCCEFAQHRQYAPGDEIRQIDWQVYARNDRYFVRQFEEETNLHAMLAVDSSGSMNFGL
FT                   STISKLDYARRAAACLARLLLHQRDSVGLTVLHESNSRFIPAKQHAAHLRTLMAALQSA
FT                   DASGEGNLSHQVQHCVARQRRRGLLVLLSDCFGDLDELATALRIARARGHDVVVMHILA
FT                   PEELTFNFRRWSAFQSLEIASQRLHLDPPAVRDQYLQRMRTFLADLEEMVVGLGGDYVR
FT                   MTTATDLADTLGWFLRNRMARRGLATNRGAVGR"
FT   CDS_pept        271714..274110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB500"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /db_xref="GOA:Q7UYM3"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011933"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYM3"
FT                   /protein_id="CAD71619.1"
FT                   /translation="MSFLSVAFLFALPLVAAPLLLHLFDRRRNETVQWGAMQFLMEASA
FT                   RKTSSRKLKQWLLLLLRCLAIAALIFALARPLLPTGYLGGSEQGETIFVIDNSMSMSRK
FT                   TDSGTMIASATQHAVDQLEKISARDDIRILTTAPYPTWLHSGTTRGDQRNREWITEQLR
FT                   SIDATEGRSDLLAALFTAVQLEHQPTQNTRRIVVLTDGQATDWRTEDEVGWQRLQSVLN
FT                   ETSIRTEIETVRLDDQSQRTNKGNIAVDSITLDRTVVGSETPITAIATLRNYDIATVDA
FT                   AELTWSVNDVPVHQQTIASIEGEQSAEANWNHKFDDPGIYRLSCRLDRDDDLPADNVAS
FT                   LIVEVVDRLPVVVVESATDYAEMQQDSFFVQAALGWIDGQPLNDTSVYVPTLITPNELP
FT                   TVDLSEQRVVIIPNLTELPSDAVSRLTEFVSDGGGLWIGLGPRTNVDFFNHQLFADASG
FT                   LAPRRLDQIVDASPAGTGTDAEQPLDIEEDSSTDQPVRIDPFRSDHPATRHLADNAQLD
FT                   LGDASIQRYYQFSSVNDDDDDRATLLRLSNDAPLAVENFVGQGRVIVQSIPLRLQWSDL
FT                   ARTQSFVVMVRDWIDYLAQPRATQYNLLPGQPIVVRVSKDTMNSDLAGDLNTPTGFLQT
FT                   PGDESIELTAQYADEGFEFRSSQTRRPGPYRLQIGLDEAGVPFQVQRSSDESNLISLSR
FT                   AAWQQIANSTTPKAWTEDRTPVTSAHTDPVWPYLLLALIGLITGELVLSGIMARERFGS
FT                   AGIPESSELDASHLSSFGPRGLDLTPTSVQPRSSAEAETLEATNR"
FT   CDS_pept        274107..276965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB502"
FT                   /product="hypothetical protein-signal peptide prediction"
FT                   /note="PMID: 11474104"
FT                   /db_xref="GOA:Q7UYM2"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYM2"
FT                   /protein_id="CAD71620.1"
FT                   /translation="MNLTETSANEYLSYEHPFNSGLLLLLGVGCLGILLWTLYRERNIL
FT                   GRATTGLFSVLRLGALCVAFWMLLAPTSVVEQSTSTRKAIVFVTDSSASMKTVDPPGLS
FT                   DDWRWAMSGSDDDTQQPYAEPLKLTDRSLAAIGFATQQMTLAVTELDQHGAETSVAERL
FT                   KLANQSIVRVRTHLENIRGSLPASVDSEVDSSLRRLVLMIDSPEFDAFSELTKMLERNR
FT                   TPNQAGWRESLPDLAERLVTARRVLHELAGQFERAIGDQSQNAPSQSTAFTDRTRGDRV
FT                   AKFLTGLEQSKLNAISEVADIRWISFDDAATAMTSVADTNERLASLTDQENSAKTTDVG
FT                   AALQFVDQLHRDQPIAAAFVLSDVAHNHAHEREPTEVAAQMDSTPVYVIPIGNDSRLRD
FT                   IDLISVSAPAVAMRNDDVVIEAHLGIYQCKGERCSVQLLQSGEVIDFRNVLIDSDAETR
FT                   SVQFQQRVAEIGSASFQIAIQPLDGEMTTDNNFDEIEINVTRSDIKVLLADEMPRWEYR
FT                   YLAQLFRRDPKIELDELLFRPRLIATGHRQEAGGFPVTVEEWNRYDVVILGDLPVEHLP
FT                   VASQTSLLQYMRTRGGTVITIAGDHAMPQAYVDHPLEEAIPVRPIDQPDDAGQQYSFQV
FT                   TEQGRSHAALMIAETELATNNAWAFVNQFSPLHSVSNWRAPVPTAQSLIAVVPRGEPLA
FT                   MNDPALKQSSFLCWQPVGRGRIIYLSGPDTYRLRFLRGDTLHYRFWGQLMRWAIASDLS
FT                   SGNQSVRLRTAKTLYETDQSVDIDVELLDADGQPVIRDVTDTDTLSVRLSVGEDVRTIP
FT                   LVMDDERPGHYRADVRELAPGVYQAKPEGSLIDELTAMGSDDDQSLNEEVITTFTVQAD
FT                   LPTELVDTRSNLVLADQIATVTGGQVLPPTAVEEVLELTDLEPVVTHSVQRQPLWQRWR
FT                   YLWLVLGCLQVEWIIRKSRGLS"
FT   misc_feature    274689^274690
FT                   /note="cosmid pircos-b2f01/ cosmid pircos-a3f07 joining
FT                   point"
FT   CDS_pept        276881..281737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB505"
FT                   /product="similar to myosin heavy chain"
FT                   /note="PMID: 11403381 best DB hits: BLAST: embl:CAC28360.1;
FT                   (AJ306290) myosin heavy chain [Toxocara canis]; E=0.054
FT                   gb:AAD29950.1; (AF111784) myosin heavy chain IIa [Homo
FT                   sapiens]; E=0.19"
FT                   /db_xref="GOA:Q7UYM1"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYM1"
FT                   /protein_id="CAD71621.1"
FT                   /translation="MATMAISLAGAGVFASRMDHPQVQRAILIMSTTITSRPFSHRIPS
FT                   AIESKLRRIRLRHAMLIIASAMAFSIGVLLLLMIPSMLIDWMFPFASPLLRITLTGITI
FT                   VATLTTAAYWLIGPLRQSWQWLRAANAVDDNVPELEERWSTVASLSTQDRSTMSATQRA
FT                   MANQVTSEAVAMERMVQPRRIAPPIKIRPGLLLAASGIVLFAIVFAISPSRVSVLLKRF
FT                   WFPTQNITATQLASVTGEPFVPRGDSIELVTRASGVVPSSATISVMQPDGQIEEHRLTA
FT                   DETSPDTWSHKMRVDEDVSYRVRAGDAQTEWLRLQTIDFPEIDQIEFGVEFPAYTKRAP
FT                   ILLDRLPRRVKVPQDSVLRLAIKPLDSLKKLSISLTDPEIPTPDTTVSDDGKTSLTDMD
FT                   IRELSPEADGWYRLQLPLIDDVLLRPTLLSPHDLTNQRRLFSRIDVIEDKAPVARVITP
FT                   NDETAVAEDEIIEIKFEAHDDHGIEKAELVIYDESQRDADGNAKVLHVQPIPLGDQANQ
FT                   KHLIAKTKLDLKELGLTEGQEISYSIRVTDNKPETDSLATKPNGRQAESESAKSESSKS
FT                   GSPKNESLAKSENTQNPDATRKGDSPQSADSKNSDSKNSDSKLADSNPADSMQADSEKA
FT                   EAKQAEAKQAEAKQADSEMDDSDPANRKSGETQPNENNPAGDEPSEADPTDSTNADLKL
FT                   ADTGPADRDDAAKNAGDQQSDAKTKPALMDTANQSMPPESDNNSQNSKTEPSGADRSSK
FT                   PAPNAIAAADSPAQAGATKPKPPGKPTNPSGDQPRNSSDAKKSNPKNPDANKMAQSDSS
FT                   KSKPQPKVPATKVAKESKPQPKAPAKQMESQNSTVSHVTSSNRQRKQKGQNATTGRRRL
FT                   KITDKLSAIAEAEERPGDELKMRESVVEIDQMLAEIETGLRKLVERKIADSDRSEQFRR
FT                   LDTGLGNVEDFVAKLREQTRESQYAFVGLQMVDITRSHVTPARDRAFAGSQRAGSDNAD
FT                   ATMGLQHVVRARELLGALLKRFDRVKREKKLKKEMDEAITIYEVYLEKRRQLMREARQN
FT                   RNPLDRKMAIVEVDQAYLDRLAEVLELRRAMMDEFAAMLGDDPRLLSRYMELVQRRQKS
FT                   LRNELSDLSQRQYDLTEEVMNWLQIDTTQRPDLWTIIIELRLSAAEDLAKDAAQLAERI
FT                   QKQLPLEVNAESGTAANLIRTANQISATARNIQFEADELFANSNGEAKNQDSTTGARSL
FT                   IDQCERLFSQLDRLQFENEGNDALALYVESRIQETRVVADQTDVWADLHRNIQNNDYGG
FT                   LVQTEQYRLAVSTQLLRVEMLDMEPNLTAEFLRTVNTDLPGEIKDMIRTLHRLMETITY
FT                   NQIAASIRSGHRNLESGNEQQQLATDRLTEAEELFDKIRRTVVTHLDEYDPRDPNIGDL
FT                   RDPTLDEFLARLEREPNIASQLGIPNRRTNLRVRADTLLWQESASGAALAASQVAADQR
FT                   AKQAMKMEKPKRKNRKPGDKSSEELSKEQREQAKQAQDMLAKTLLEIEKQKENGDPSDA
FT                   ERQRLDEMAEKIKGLMNQDGDNASAERAWQQIVQADEAKELMQAIANGEFIADQQWNRL
FT                   LSTLDDGLWQVQGNRPPEAYRKAIEQYQDQLRVLMSTID"
FT   CDS_pept        281746..282996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB510"
FT                   /product="hypothetical protein-signal peptide prediction"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYM0"
FT                   /protein_id="CAD71622.1"
FT                   /translation="MQIPNTPAPDADTTTHEEGRLTLLIKRLKRCKLIATQTTLAALLM
FT                   CVAMPAAAQDSPPVIATSANLSSALPASEWARVESSVDEGLKWLASQQAEDGRFPSEEV
FT                   AQPAVTSLAIMAFLSRGHLPDKGPYGAQISRAIDFVLSTQRRRGYFSLQPVLPPVGHLK
FT                   PSQTVIYNHSIAGLMLGEVYGMGSGERSERIEEALHRALVFHREVQSRTKGKESDRGGW
FT                   RYGYPESPDAASDMSVTGWALMFLRSARNAEFNVPKQYFDEGLDFVELCYEPDPGEHEK
FT                   GVFRYRPHASQDNPQITLANTASATLTLILGGRQNHASIPVSVRWFRTRSYPSPWQNNY
FT                   YYLATYYSSQAMAQVGGETWEEMFPQIAAGLLKEQTENGAWPPGGSNEQHFGSTYSSSL
FT                   AILALTPAYGLLPIYQR"
FT   CDS_pept        complement(283061..284350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB512"
FT                   /product="hypothetical protein-signal peptide prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYL9"
FT                   /protein_id="CAD71623.1"
FT                   /translation="MSRRRWRRSVLAAMLLAGVTTTATNVSAQDSRTAEPANAQRQVVG
FT                   SEQDDPNRISDWGLAGVIWSDASLVRKLAAESAQRATDPKQIAKYERLVRQSTEVKQSL
FT                   ESFGWKLRSQQAEQSGNPVTESSQANSERQAEERLPDPKEVGQKLAEELRRTRPPKATK
FT                   TESDDRSNDRPTGELAVEANGLERFDTETPAGVDDPGSDDEWTAARTPIDVDNYRVDDY
FT                   VDETPAEEANMADAVEDGVEGAIASAAGRLGTGRDLGARISEREIQTLSATLPYSDDSI
FT                   YDADDYDPDRDYRVDNPLAAEPDAETGADLGDRDDDISRRADPKVIDGEDEMIAELATS
FT                   EVQRKTPAMQRRSNYQRFTTEEAVQERDAQWVQFQLDSNELVLTRHTTLENLQQRTNDA
FT                   VMKLKSDASVAWDTTENEQLKAVLKAISKF"
FT   CDS_pept        complement(284397..284567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB514"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYL8"
FT                   /protein_id="CAD71624.1"
FT                   /translation="MAYDARMLEQNALHRSPWQFGSIGESRTSVTSQCSLQSNRGLFHV
FT                   TLVFIATQSSR"
FT   CDS_pept        complement(284655..284828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB517"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYL7"
FT                   /protein_id="CAD71625.1"
FT                   /translation="MPYRTDGGANCPVQQLCSCIRNDIQFGAVFIAGSMVDSRSARVDS
FT                   SNDELIERSRDR"
FT   CDS_pept        284784..285023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB518"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYL6"
FT                   /protein_id="CAD71626.1"
FT                   /translation="MLNRAICSTISSIGHQFSLPLAENDTQLNFIVGPFFAWKHRVAHR
FT                   HPICGLHHQTIEPFHCQLREDIDRDRVSNQNTID"
FT   CDS_pept        complement(284872..285036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB519"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYL5"
FT                   /protein_id="CAD71627.1"
FT                   /translation="MSQQFSQLCFGWKRDHGRCPLLIGNEMAQSSDGEDRKSGADERRG
FT                   ASMRRKARQ"
FT   CDS_pept        284989..286116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB520"
FT                   /product="conserved hypothetical protein"
FT                   /note="best DB hits: BLAST: pir:S75232; hypothetical
FT                   protein sll1830 - Synechocystis sp. (strain; E=8e-04"
FT                   /db_xref="InterPro:IPR041289"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYL4"
FT                   /protein_id="CAD71628.1"
FT                   /translation="MIAFPTKTQLTELLTHEKGDCVSILMGTYQAGRDTNQNPIRFKNL
FT                   VQQAIGELKKKESPLLPQVKELAKLEHDSTFWQNQTAGLAIYISEGFEERVLLSHDPGE
FT                   TVSIASEFNLRPIASVACGETNLMTLALSWERARLFRSDGHSTMEIEDDIFPLTMDELV
FT                   TARDPEKQLQYSSHETLGGGGSETVMYHGHGNGEDKIKADRRAYLSRVGEYVAKRLYNT
FT                   DQQLVAVATEEVAGHFDAAAESVELTQCIHVSPDGLSDSQLRARITAFAKEHNQHNDDV
FT                   IAERLGSAIADNQGSDDWKQVVLAAVEGRVDTLLLGQDQPIVGRCDQSNHQVSLDDEGT
FT                   DLVNTAVRLTLKSGGTVRRLQGNSTAQPMAAIFRY"
FT   CDS_pept        complement(286208..286399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB521"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYL3"
FT                   /protein_id="CAD71629.1"
FT                   /translation="MASSSNKSNLGSEGLPSRSDAETGWRCLRSHEDVNHRQSRLTPCG
FT                   KKSMLSVLFYSRGMPFLR"
FT   CDS_pept        286375..287550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylR"
FT                   /locus_tag="RB522"
FT                   /product="xylose operon regulatory protein"
FT                   /function="transcriptional control; C-compound and
FT                   carbohydrate metabolism"
FT                   /note="PMID: 8041620 best DB hits: BLAST: swissprot:P37390;
FT                   XYLR_ECOLI XYLOSE OPERON REGULATORY PROTEIN; E=3e-49
FT                   ddbj:BAB03212.1; (AB046360) putative xylose operon
FT                   regulatory; E=1e-42 swissprot:P45043; XYLR_HAEIN XYLOSE
FT                   OPERON REGULATORY PROTEIN; E=3e-42 COG: xylR_1; COG1609
FT                   Transcriptional regulators; E=2e-27 xylR_2; COG2207
FT                   AraC-type DNA-binding domain-containing proteins; E=1e-15
FT                   BS_degA; COG1609 Transcriptional regulators; E=1e-08 PFAM:
FT                   PF00532; Periplasmic binding proteins; E=0.085 PF00165;
FT                   Bacterial regulatory helix-tu; E=2e-18"
FT                   /db_xref="GOA:Q7UYL2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYL2"
FT                   /protein_id="CAD71630.1"
FT                   /translation="MICWTKMPKQKAVALLIETSNAYARGLLGGIASYIHEHDLWSIYL
FT                   VEQERGAAPPSWLNDWDGDGLIARIENEEIASSVRNLKIPVVDVSAARRIPNIPWVETN
FT                   DVAIGELAYQHFRERGFENFAFCGESRFNWSILRRQAFEARVKEDGFQCQSFNFNVDDR
FT                   RPQSLKRERDRLAEWVLSLQHPIGVLACYDIMAQKILDVCRLHGIKVPSELALLGVDND
FT                   ELLCDLCTPPLSSVVPAAHQTGREAASLLDAMMRGEEVHAEPHLIEPLGVATRQSTDVL
FT                   AIKDPEIAAAVRFIRDHCCDGINVQDVVKKVPLSRRVFESRFLALMGRTPHQEITRRRI
FT                   ERVRYLLIETDLTLVQISRRTGFQNHEYMSVAFRRAMGHPPATYRRKFRKI"
FT   CDS_pept        complement(287547..287798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB523"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYL1"
FT                   /protein_id="CAD71631.1"
FT                   /translation="MVSRSPRCCEMVAWMGLQVPRVETRSERRSGGRGVMRPTDILRDH
FT                   RSSASPRFHRARNSEVEDPGWQFARFSDLRISETFAAD"
FT   CDS_pept        complement(287813..292486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB524"
FT                   /product="probable secreted glycosyl hydrolase"
FT                   /function="sugar, glucoside, polyol and carboxylate
FT                   catabolism; polysaccharides degradation"
FT                   /note="PMID: 8843436 best DB hits: BLAST: embl:CAB94634.1;
FT                   (AL359215) putative secreted glycosyl hydrolase.; E=1e-09
FT                   pir:T34929; hypothetical protein SC3F9.07 SC3F9.07 -
FT                   Streptomyces; E=1e-04 embl:CAB55721.1; (AL117387)
FT                   hypothetical protein SCF41.18; E=2e-04 PFAM: PF00034;
FT                   Cytochrome c; E=0.0012"
FT                   /db_xref="GOA:Q7UYL0"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013427"
FT                   /db_xref="InterPro:IPR013428"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYL0"
FT                   /protein_id="CAD71632.1"
FT                   /translation="MRDFSLLLAWLCLASSRCLHHNGSLRRFDRSVPRGRHGRFGVDLL
FT                   PNTSYHGICCRPNLMKNTLLIAFAFLATWTSTSAWHAVNASAADQQRLNVLFLGDNGHH
FT                   QPKPRFDELQPVMQRNGIDLTYTDDMSMLSLEKLNQYDALVLYANIDEIAKPQADALLQ
FT                   YVEEGGGFVPLHCATYCFRNNSEIVALMGAQFQRHGTGVFRTTPDKPNHEVMKGYSGFE
FT                   SWDETYVHHLHNEANRTVLEYRVDSNGREPWTWVRDQGKGRVFYTAWGHDSRTWTNPGF
FT                   LNLVERGIRWVAKKDPQQAGEFADAAAFPVPEMTSLPEGDKPFTFTDVGAKIPNYTAGK
FT                   KWGEQGELKTLMQDPLPPEESIKRYVNPKGLHMELWASEGGPESNSQGGIGGKPIAMTW
FT                   DERGRLWICETMDYPNELQPKGKGRDRIRICEDTDQDGVADKFTVFAEELSIPTTLVCY
FT                   RGGVLVQDGQETVYLKDIDGDDKADFRQTLITGWALGDTHGGVSNFRYGLDNWIWGMQG
FT                   YNASRPVINGERQQGFRQGFWRFKVDADPNGEANAIDGSTAGNEFSDHTLRVEKVEFMR
FT                   ATDNNTWGLGFTEEGLVFGSTANRNPSNFLPIPNRYYEQVRGWSPQTLRMISDTHLFDP
FT                   ITPNIRQVDQHGGYTAAAGHGIYTARQYPQAWWNRTAFVCGPTGHLVGTFVLTPDGAGF
FT                   KSTSPFNLVASDDEWAAPIMAETGPDGFVWVLDWYNYIIQHNPTPHGFETGKGNAYETD
FT                   LRDKKYGRVYRLVTDGDASKTVSVPSLSSDDVPGLLAVLKHSAMPVRSQAQRLLVELGQ
FT                   IDDATVSSLLELIADQEQDAIGLTPGAIHALWTLDGLGMVGNGNATIDAAVREALQHPS
FT                   AGVRRSAVKVLGSSEEDIQHLIESGVLSDSNAQVQLAALLKLAEPTTPTTDMVVSALVQ
FT                   SMKSLGDDRWLLDAWTSATAMHAGGTLPAVLASAPERDLSRSIRGRLNVISEHFARSQP
FT                   EAESLQGLIQSVAKTATGNASGVLEGLAKGWPKDHSVELPEAAESQLVALFDHVSVDQQ
FT                   SQLVQLSEKWGTDALTEKVAELAEQLLELVQDDSLSDRDRISSARQLVAMQPTDDDVVF
FT                   DLLESIGPQTSPAATAGILDALKSSRSEELGGALIEQTAASTPSVRGSIIRVLLSRPNT
FT                   TLELIDSIEAGELRMSDLSLDQRQALSNHPDKAIKQRAEKLLKSSGGVPTANRVALLHE
FT                   WLPVAHAKGNATLGAQVFKKHCANCHRHSGEGADVGPDLTGMAVHPKEELLTHILDPNQ
FT                   SVEGNFRTFAVLTTEGQVFTGMLGGESRTSIELIDAQAKRHTILREEIEQLNASSQSLM
FT                   PEGFESQIKKEEMTNLLEFLTARGKYTPLSFSGIATAVSTKGMFSNGDNGPDQIIFSDW
FT                   GPKKHNGVPFTLVDPQDGRVPNVILLHGPQGSKPPSMPKQVPIVCNASASAIHILGAVS
FT                   GWGFPFGSEGSHTATIRLNYADGQVEDHKLLNGVHFADYIRRVDVPESEFAFDVRGQQV
FT                   RYLKLTPKRQEPLETIELIKGDDSSSPIFVAITVESP"
FT   CDS_pept        complement(292699..293757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB531"
FT                   /product="iron (III) transport system (iron (III)-binding
FT                   protein)"
FT                   /function="metal ion transporters (Cu(2+), Fe(2+), etc.)"
FT                   /note="PMID: 2404942 best DB hits: BLAST: pir:S75102;
FT                   hypothetical protein sll0237 - Synechocystis sp. (strain;
FT                   E=7e-43 ddbj:BAB04232.1; (AP001508) iron (III) transport
FT                   system (iron; E=9e-24 ddbj:BAA75385.1; (AB013374) Yvfk
FT                   [Bacillus halodurans]; E=2e-21 COG: sll0237; COG1840
FT                   ABC-type thiamine transport systems, periplasmic; E=6e-44
FT                   VC1424; COG0687 Spermidine/putrescine-binding periplasmic
FT                   protein; E=7e-04 PFAM: PF01547; Bacterial extracellular
FT                   solut; E=0.027"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYK9"
FT                   /protein_id="CAD71633.1"
FT                   /translation="MSLKTVCVPVASFSALQLVFVAVWLSFCSGCVSRSESDVVVYSAL
FT                   DEDFAAPILAAFERSTENEVGVIGKFDIESTKTVGLANQLIAEADAPRCDLFWNNEIMH
FT                   TVRLQKLGILEPHDWQVPSTWPQDMVASDGTWCGFAARARVLLVNTDMLPDADARPNRV
FT                   NELADPKWAQNCAMARPLFGTTATHFAVLRDIMGREKTLELLQSIHSNAVVLSGNKQVA
FT                   QAVSAGKVAWGLTDTDDAIIEEELGYPVEIIYPDQQPEQPGTLRIPNTLAILKDAPHPV
FT                   AAGKLADFLMTPEIEDRLAMGRSSQLPISKESKFPPAVLPSEPVRWMRVDFEAAAEDWD
FT                   AWAKTLADLFAN"
FT   CDS_pept        293751..295241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB533"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q7UYK8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYK8"
FT                   /protein_id="CAD71634.1"
FT                   /translation="MTREAEYAGGMMDKRLQSQLWRVLLAMAIGGIVSLTTDSVSADEN
FT                   NFDETGLLTREGQHLRLTSDVNDALLLNDLVQSFDDSVPQWLAFWGVPESRTANWKIQG
FT                   YLMRNVDTFRKSGALPDFVPRFDHGYSSPHTIWIRHQDTTYYNRHLILHEGIHSLAFEL
FT                   FGAGGPSWYMEGTAELLALHRDRVPTPSKQPRSELSLNTSVLAQSMDPFTINQLPRNRL
FT                   DTPGWGRYKIIAQHREAGTLPTLKSVLKLPTELNGEVEAYTWCWAASSLFTQSPESNAA
FT                   FLKAARKGSDQSEAFTSEFYRDVAEQWPVLSARWRLMMNDLDYGFDWSRHRVELSTSDP
FT                   RASGASIQMNVTPDQSWQSVGVWFPKGARLRFAAEGRVHVTSDWISEPAGITLEYNRGN
FT                   PLGQLQVCVLPIATPAGATIPGLDIQPVITRADVARFKSNTSDDSTNDSAPMTGANVIS
FT                   LTEPSWVLLRINLPAGHSPIETTANAQEAYQVQIIPSR"
FT   CDS_pept        complement(295211..295480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB534"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYK7"
FT                   /protein_id="CAD71635.1"
FT                   /translation="MDVANCELGGETSRGDDASLCSKASAGVPCETWPTDTSWLDSQEF
FT                   RCAHRSWIRQNSDVRDGDRPNSWRIRLRLMSKKLCHRLGMIWTW"
FT   CDS_pept        complement(295255..295503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB535"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYK6"
FT                   /protein_id="CAD71636.1"
FT                   /translation="MSDGGIANWTLQIANWVVRRVGAMTPRFVPKHRLGCHVRHGLPTH
FT                   RGWIRKNSDVHIVAGFARIQMYEMVIVRILGESGYGS"
FT   CDS_pept        complement(295500..296285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxJ"
FT                   /locus_tag="RB536"
FT                   /product="pyridoxal phosphate biosynthetic protein"
FT                   /function="biosynthesis of vitamins, cofactors, and
FT                   prosthetic groups"
FT                   /note="PMID: 10225425 best DB hits: BLAST:
FT                   swissprot:P24223; PDXJ_ECOLI PYRIDOXAL PHOSPHATE
FT                   BIOSYNTHETIC; E=4e-60 gb:AAG57679.1; AE005487_3 (AE005487)
FT                   pyridoxine biosynthesis; E=1e-59 pir:H83548; pyridoxal
FT                   phosphate biosynthetic protein PdxJ PA0773; E=5e-59 COG:
FT                   pdxJ; COG0854 Pyridoxal phosphate biosynthesis protein;
FT                   E=4e-61"
FT                   /db_xref="GOA:Q7UYK5"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7UYK5"
FT                   /protein_id="CAD71637.1"
FT                   /translation="MMATTLSSTSFFLPHMPHFIDLGVNVDHVATLRQARRGQEPDPIT
FT                   AASLAEQGGADGITFHLREDRRHISDRDVELFVQTVQVRTNFELACAADVLAICCRVQP
FT                   DWALLVPESREEVTTEGGLDVAGDSGRIADAIQMLKDAGIATSLFLDPEPNQIEAAAKL
FT                   QVDAVELHTGPYALARGAAVQHELRRLADTGKMIRDAGMRLHAGHGLNYVNVRPVAAID
FT                   GMAELNIGHSIVSRSVMVGMREAVAEMRRLLDSVTIAAQ"
FT   CDS_pept        296227..296457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB537"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYK4"
FT                   /protein_id="CAD71638.1"
FT                   /translation="MKCGMCGRKNEVEERVVAINRTSNVQPMGASRMVLAEWHLLHPPS
FT                   GRVGPLRAGEGEPKTRCVALPSLRSALPGGG"
FT   CDS_pept        complement(296509..297921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB538"
FT                   /product="conserved hypothetical protein"
FT                   /note="best DB hits: BLAST: pir:T34935; hypothetical
FT                   protein SC3F9.13 SC3F9.13 - Streptomyces; E=2e-43
FT                   pir:T36186; hypothetical protein SCE29.07c - Streptomyces
FT                   coelicolor; E=2e-37"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYK3"
FT                   /protein_id="CAD71639.1"
FT                   /translation="MTSTPTGFPDVTAVIEKSHDKAVDGAKGAERSNDSDSSIRWTVGY
FT                   CTNIHAGADVEGVTNNLLNISAEVRRRILNSQYSDENGSPKVQTGKNFATIVSTAPPLG
FT                   IGLWLSAEATADLRRNGLKPLTSAMKQARLLAYTFNGFPHDNFHQDVVKHAVYSPTWWE
FT                   DERIIYTRDLAKILAEILPADTNLGTISTLPIGWPQRTDEDGNRVSVTDDQLHHAGTNL
FT                   RRMAEDLRRLEDRTGKRIVLAIEPEPGCILDTAAKVIDWFDKQLPDATHRRYIGVCHDV
FT                   CHSAVMGESQHDVLAAYAKAGIVVGKIQISSAIVVDWSRIADTDREATLTQLRSFAEDR
FT                   YLHQTGRVTASGKFVLEEDLPAVLADLDANPSRYAADKRWMIHFHVPIFAEQFGHLQTT
FT                   RSDVLDTLKSIMELTDASKRRQPLQFTGHLEVETYAWSVMPESAGRSDLAGDIASELIW
FT                   LHDVLSEMSSNN"
FT   CDS_pept        298032..299390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cinA"
FT                   /locus_tag="RB539"
FT                   /product="competence-damage inducible protein CinA"
FT                   /function="recombination and DNA repair"
FT                   /note="PMID: 7538190 best DB hits: BLAST: gb:AAB47708.1;
FT                   (U87792) CinA [Bacillus subtilis]; E=4e-36
FT                   swissprot:P46323; CINA_BACSU CINA-LIKE PROTEIN ----- pir:;
FT                   E=3e-34 ddbj:BAB06104.1; (AP001515) competence-damage
FT                   inducible protein; E=7e-33 COG: BS_cinA_1; COG1058
FT                   Predicted nucleotide-utilizing enzyme related to; E=2e-31"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR041424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYK2"
FT                   /protein_id="CAD71640.1"
FT                   /translation="MTRFVAPGQRGERVFSPFLLLPFCHANRMPHITAEIISIGDEMIT
FT                   GARLDTNTQWLSQRLGELGVDVQFHTTVADTLSHNTDVFRIAARRADVVVATGGLGPTR
FT                   DDLTREAIAESLGLPLQLHEPSLEFIRGMFKRRGREMPERNHCQAMFPLGSTPIHNPQG
FT                   TAPGIDVRATREDGTQSRIFALPGVPAEMKTMFDESVAPAVLAANGQRQHIAHHIMKFF
FT                   GIGESDMEAKLGDMIARDRQPRVGITVSAATISLRIVATGDTPDACQAAIANTREEILE
FT                   KAGEYYFGDGETFEQHHAVIRHLNEVGQRLLLVELGRAAPLGDWFAAVSDEPGFTADVP
FT                   AFVGGISLANLDDLRQWTGMPDDASAETCLTALRQRLSADWVLLVDEYPSLHQTNDHPL
FT                   PGSDVTFLVAAPDGSFPSITQHLGAHPSILHARVAKAGLFWLRKCFVTASSGV"
FT   CDS_pept        299365..299871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB541"
FT                   /product="hypothetical protein-signal peptide and
FT                   transmembrane prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYK1"
FT                   /protein_id="CAD71641.1"
FT                   /translation="MSPPHQEFETMIRSIVLAFACTAMFASNVGVATAQAPTESTENAA
FT                   RELRLAKYLSGATFTGHFTVDGKEDRALKPESYTIKSCEKLPEADMYSMKVAIKYGDTD
FT                   GEFPMQLKILWSDRTPVITMDSVWIPGLGTFSSRVLIHDGRYAGTWQHDAKGGHLFGKI
FT                   TPAKE"
FT   CDS_pept        299822..300022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB543"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYK0"
FT                   /protein_id="CAD71642.1"
FT                   /translation="MQKAAICSAKSRQRKSNSHRLTLVQTRKIQQKSGAAKRFISQSSR
FT                   AITPPPGSPTCIFHSGKCTIG"
FT   CDS_pept        300059..302806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB544"
FT                   /product="hypothetical protein"
FT                   /note="best DB hits: PFAM: PF01239; Protein
FT                   prenyltransferase alpha subu; E=0.28"
FT                   /db_xref="GOA:Q7UYJ9"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR011444"
FT                   /db_xref="InterPro:IPR022655"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYJ9"
FT                   /protein_id="CAD71643.1"
FT                   /translation="MTLNRQGRSFFRVRLSVFFFTIILGCEAKAVDFIKDIEPIFQAHC
FT                   IDCHGPDEQESQFRLDRLAALISGGNSGEPAVVPGKPGESFLLKLILHEESGMEMPPDD
FT                   SLSDSEIASIKAWIAGGAKTPESYGPEKTDIELSHWSFQPVKRSQGSTIDRFIRDKLVA
FT                   NGLTLSPTAERRVLVRRLYLVMLGIPPTPEQVEAFATDESDDAWQNLVERVLASPHCGE
FT                   RWATYWLDLVRFGETHGYEMNRERPTAWQYRDWVIESLNDDKPYDEFVRQQIAGDALGA
FT                   NVATGFLVAGPVDQVKGSDPKLRQIQRMNELDDMINTTGTAFLGLTTGCARCHNHKFDP
FT                   ISQRDYYSMQAVFAGVQHGDRALPPTPETAKRIASLDEEISELTNRLKKFIIGDESKPR
FT                   PAVNAKRNEEVFEERDARFIRFTIRKTTGGEGCLDELEIYSNGLNVALASSGSKAISSG
FT                   DFVHPKHKLMHINDGRHGNDHSWIVDSSSGDWVQIELAEPTVIDRIVWSRDRSGKYTDR
FT                   LPIEYRIDSAMEADNWELLTSSADRQTFTGKESASPKYQFEKFPSAEAQQGRVWQNRLQ
FT                   AALEEKRQLEKSTLVYAGTFVQPGPTHRLYRGEPDAKREQVAPNAIEVFTSLNLATNAP
FT                   ERDRRLALANWIASKDNPLTARVIVNRLWQFHFGTGIVDTPSDFGLNGSSPSHPELLDW
FT                   LASELMDHNWSLKHIHRLILNSDTWRQSNRPNEDAIRVDATSRLLWRFPPRRLEAEAIR
FT                   DSILAVTDALDLEAAGGPGFSPFEVELENVRHYHAKQAFGPADWRRMIYMTKVRQEREQ
FT                   VFGAFDCPDASMVVAKRSRSTTPLQALNLLNSRFVMQQADLFAKRLENESDTLSHQITR
FT                   AWRLCFQRKPTDEELADSVSFIEQEGVQQFTRAMLNANEFVFIP"
FT   CDS_pept        302834..304291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB546"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q7UYJ8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYJ8"
FT                   /protein_id="CAD71644.1"
FT                   /translation="MTPFLNRRHFLTQATSGLGSIALASLLDQQRLLADSTPIRPNIDP
FT                   AKPFASRPPHHPAAAKNVLVIFCAGACSQLDTFDYKPELIKRHGQPMPGAESLVTFQGE
FT                   QGMLTKSPWAFKPRGQSGKMISELVPQLGELADDMCFLHSLTGKTNTHGPGENFMSTGQ
FT                   TLDGFPSMGAWATWALGTENKNLPAYVAIADPRGTPQSSVNNWGPGFLPAAFQGTEFSA
FT                   LKPLDNLDIPAGVSPETDRATRGFLERMNQRHLKQFPGDTELAARISSYQLAARMQLSV
FT                   PEVTDLSSESKSTLREYGADDSQNILKAQFAKNCILARRLIESGVRFVQLFNGAYQTGG
FT                   EGVSNWDGHKSLHEQYSKHGPVLDQPCAALLRDMKRRGLLKDTLVVWMTEFGRMPTFQK
FT                   GASGRDHNPEGFTAWMMGAGVKAPFTYGATDEFGYKAVENVSTVYDFHATILHLLGLNH
FT                   ERLTYYHNGFERRLTDVHGHVLKEVLN"
FT   CDS_pept        complement(304329..306230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB"
FT                   /locus_tag="RB548"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /function="polysaccharide biosynthesis"
FT                   /EC_number="2.4.1.18"
FT                   /note="PMID: 8068720 PMID: 3013861 best DB hits: BLAST:
FT                   swissprot:P52980; GLGB_STRAU 1,4-ALPHA-GLUCAN BRANCHING
FT                   ENZYME; E=2e-46 swissprot:P30537; GLGB_BACCL
FT                   1,4-ALPHA-GLUCAN BRANCHING ENZYME; E=7e-45 pir:D82511;
FT                   1,4-alpha-glucan branching enzyme VCA0016 [imported] -;
FT                   E=1e-44 COG: VCA0016; COG0296 1,4-alpha-glucan branching
FT                   enzyme; E=1e-45 BS_amyX; COG1523 Pullulanase and related
FT                   glycosidases; E=2e-21 YEL011w; COG0296 1,4-alpha-glucan
FT                   branching enzyme; E=3e-20 PFAM: PF02922; Isoamylase
FT                   N-terminal domain; E=2.3e-15 PF01208; Uroporphyrinogen
FT                   decarboxylas; E=0.27 PF00128; Alpha amylase, catalytic
FT                   doma; E=2.5e-11"
FT                   /db_xref="GOA:Q7UYJ7"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYJ7"
FT                   /protein_id="CAD71645.1"
FT                   /translation="MSFAMVDSLRRTVAQRLIVIEGREMEQTALLDGMEENATEQSSVT
FT                   KSGMGAIVHDDGVAFRVWAPNADSVSVLGTFNQWKEDATPLKREEHGTWYVDVADAKAG
FT                   DEYKYRIIRGDKSYDRIDPYAREVTNSIGNAVVYADTFDWKHPTFDRPAQNELVIYEMH
FT                   IGTFHRDDPDQPGTFSDAVAKFKHLKELGVNAIQIMPVAEFAGDLSWGYNPAHIFAVEQ
FT                   AYGGPDALKAFVDAAHEAGFAVIIDVVYNHFGPSDLDLWQFDGWSENDKGGIYFYQDHR
FT                   SNTPWGDTRPDYGRGEVRQFIHDNAMMWMREYHADGLRYDMTAYIRTISGIGDDDIAEG
FT                   WGLMQWINRDLRNEFPGCYLIAEDLQTNNWLTKTEDQGGAGFTTQWDAAFVHPIRSAVQ
FT                   EIDDAHRDMWAVRDALCHRYNGDAFQRVIYSESHDEVANGKSRVPSEIDAEDPESRFAK
FT                   KRTILAAALALTAPGVPMLFQGQEMLEDDWFEDTDPLEWERTRRLKGIKRLFRDLIHLR
FT                   LNNDGLSKGLTGQHIVMHHVNENDKVVAFVRRAEDPQDDVVVLANFANRSWDQYEIGFP
FT                   DSGDWQLKLNTDWSGYDQDFDDHPVEHVDATEQPYDGLAARAEVSFGAYAVLVYTRK"
FT   CDS_pept        complement(306211..306324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB549"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYJ6"
FT                   /protein_id="CAD71646.1"
FT                   /translation="MRSASFQGSEQLPTPWHENCLLRSGLRNLAPVEFCDG"
FT   misc_feature    306285^306286
FT                   /note="cosmid pircos-a3f07/ cosmid pircos-b2d11 joining
FT                   point"
FT   CDS_pept        complement(306296..306709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB550"
FT                   /product="hypothetical protein-signal peptide prediction"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYJ5"
FT                   /protein_id="CAD71647.1"
FT                   /translation="MVSTGSRSMLASMFPAARSIALAAPSAASLVVSTRDDVSCFILSV
FT                   STRTDGSPSSDVNRNQPTTAISRTIATTKMRARIRHLWCEWFVGQRRLSRWPIWNQFCL
FT                   QSDNERSLPMSRSIARAIPASKMTNAIRLISGK"
FT   CDS_pept        306967..308226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB555"
FT                   /product="probable sigma-70 factor, ECF subfamily"
FT                   /function="transcriptional control"
FT                   /note="PMID: 10984043 best DB hits: BLAST: pir:G83477;
FT                   probable sigma-70 factor, ECF subfamily PA1351; E=1e-94
FT                   swissprot:Q52997; YDNY_RHIME HYPOTHETICAL 47.0 KDA PROTEIN
FT                   IN DNAA; E=9e-61 pir:T35586; hypothetical protein SC6G4.35
FT                   SC6G4.35 - Streptomyces; E=3e-52 COG: PA1351_1; COG1595
FT                   DNA-directed RNA polymerase specialized sigma; E=5e-39
FT                   PFAM: PF00515; TPR Domain; E=0.00013"
FT                   /db_xref="GOA:Q7UYJ4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYJ4"
FT                   /protein_id="CAD71648.1"
FT                   /translation="MSSAQAVSNQIDRIYRTESRKVFATLVRVLGDFDVAEEAMHDAFA
FT                   AAMENWARDGIPDNPTAWLISTGRFKAVDRIRRRRRFDDLQPELVQRIDQIELANNSLA
FT                   EQDIQDDRLRLIFTCCHPAIDQKVQVPLTLREVCGMTTDEIARAFLVAPSTLAQRIVRG
FT                   KAKIRDAGIPFSIPSLSELPSRLDAVLSVIYLVFNEGYSATSGDTLLRTDLSAEAIRLA
FT                   RLLLELLPDPEVAGLLALMLLHESRRTARVNEDGDIVLLEDQDRSLWDQELIEEGSQLL
FT                   QRSLRTRRIGTYTIQAAISAVHAEAERASATDWSQIVALYDVLLRIQPSPVVELNRAVA
FT                   IAMRDTPAEGLKHIEAILDSGHLRDHYLAHSARGELLRRMGEDDEAIRAFEQALSLAMN
FT                   APEQRFLHQKLTALKDNAGH"
FT   CDS_pept        308213..308356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB556"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYJ3"
FT                   /protein_id="CAD71649.1"
FT                   /translation="MPVIDRACRSLRLHWPFGRSPRFPRTIQKGSSRWGTTELQVQTLN
FT                   NL"
FT   CDS_pept        308223..308384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB557"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYJ2"
FT                   /protein_id="CAD71650.1"
FT                   /translation="MIAHAEAYDCIGRLGDRHGSLAQFKKVRLGGGPPSYRFRHSTTCS
FT                   TAVTAVKS"
FT   CDS_pept        complement(308327..308491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB558"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYJ1"
FT                   /protein_id="CAD71651.1"
FT                   /translation="MGGGLAQRCKLCSGTGADGRRLMSSLALAFLLGTRSQDFTAVTAV
FT                   LQVVECLNL"
FT   CDS_pept        complement(308542..309384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB560"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID: 10984043 best DB hits: BLAST: pir:E83477;
FT                   conserved hypothetical protein PA1349 [imported] -; E=3e-18
FT                   swissprot:Q52996; YDNX_RHIME HYPOTHETICAL 13.6 KDA PROTEIN
FT                   IN DNAA; E=1e-07 pir:C83475; hypothetical protein PA1354
FT                   [imported] - Pseudomonas; E=4e-06"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYJ0"
FT                   /protein_id="CAD71652.1"
FT                   /translation="MVGPPNRVEITASQALYAHTFKRRENDMKYMLMIYGAEEGWTEEE
FT                   RERCMLDSMAICEELAVDGKWLDSSPLHSVATATSVRVRDGKSEVTDGPFAETTEQLGG
FT                   YYIIDVPTRDEAVAIASRLPPAKKGTVEIRPLLPVPIPMPSLSEDLSSLRTKETNAGKD
FT                   YIVLLYAAEGAWPPEEHAAALEESIRLCHELHEQGSYRAASPLQSPTTATCVRVRGGNQ
FT                   EIVDGPFPETKEQLGGYFLIHVADLDQAISVAAKIPGARRGTAEIRPLFPLPVVHRAS"
FT   CDS_pept        complement(309395..309868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB562"
FT                   /product="hypothetical protein"
FT                   /note="PMID: 11474104"
FT                   /db_xref="InterPro:IPR011473"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYI9"
FT                   /protein_id="CAD71653.1"
FT                   /translation="MFAKPQSEHQWLEQILGEWKFDHDCKMPDGSNSTTHGKMSCRSLG
FT                   GMWVICESGGESAEGEPWSSIMTLGFDTAEGRYVGTFVGSMMSNIWPYEGCLDESGKKL
FT                   LLSSRGPAFDGSGKANYRDTIHIMDADTWMMTSELQDENGQWIEFMSGKHTRC"
FT   CDS_pept        complement(309988..310866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RB563"
FT                   /product="conserved hypothetical protein"
FT                   /note="PMID: 10984043 best DB hits: BLAST: pir:C83475;
FT                   hypothetical protein PA1354 [imported] - Pseudomonas;
FT                   E=7e-41 pir:T35585; hypothetical protein SC6G4.34 -
FT                   Streptomyces; E=3e-14 pir:E83575; hypothetical protein
FT                   PA0557 [imported] - Pseudomonas; E=7e-09"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q7UYI8"
FT                   /protein_id="CAD71654.1"
FT                   /translation="MRVMVMVKASESSEAGKMPDEKLLTDMGNFNEKLVEAGIMKAGEG
FT                   LKPTSQGVRVHFHGTERTVTDGPFAETKELIAGYWIWEVRSMSEAIDWVRRCPNPMMED
FT                   SDIEIRPIFELEDFGDEMTPELREQEATIQQKLQCDGEAELRRLIHQWSTALEARDYDG
FT                   LVANYTEDSVLYGGIPPYKTVGPQNIRKLWEGCLPHFPEFKSVHHDLTFEVGDDVAFVH
FT                   GLHQFQTEVADHPAGQSWMRVTICFRKKEGQWKVLHEHVSLPFNPMTNEAWKIKDPAML
FT                   DEPSYGAESCV"
XX
SQ   Sequence 311050 BP; 70675 A; 87881 C; 84452 G; 68042 T; 0 other;
     aactagctgt tcgtggcgga atccatcgtt tcttccattt gcttttcgta atcttcttgc        60
     tcttgttgca cttcggctgg cgagcgggtg tcttcgatca cttcgttgcc gccgcctccg       120
     caaccaacag tgaagacaga aacgctgaac gcaaacaggg cggagaaaaa caatcgcgac       180
     attactattg ctcgatggat gcaaggaatg agtgtgaaaa acttgtccga gaattaattc       240
     ttctacggat cagtccgtga cgcaagtagc cacagcccaa tttggtcttg agcgagggca       300
     ttcgacaaag tcagttgcgt gacctgaaac caaaaaaaat gcgttcggcg agttgccgaa       360
     cgcattgcgt catcgacttg ccaacaagat cagtcgaatc acttctgggc cattcgcgaa       420
     atctcaattg tgtcaccatc caaggtcact ttcgtcgcga gcaacatcac gcggtccttc       480
     acttgaacgg cgggaccgtt gattgtcact tggctacctt cagtgatgtt ggtgtccaag       540
     tcttgcttgc gtcccaaatc gacgagcatc tttttgccgt catcggtttt gatttttgca       600
     agctgtcgtt gctgacctcg cacatcaacg gtcttcgtgc tttcaatcgt gcccgagtat       660
     tctcgaccac tgcgttcaac ttgcatctgt tggccgttgt gttcaatcga tcgcgaaagc       720
     aacacgctcg tatctcccgc tttgaacggc gaacccttga ccgtcagggt gtcgttcagt       780
     tgtggcatgc ggtcgagttg atccgcaggg cccaagtcgg cgatcatcga tttgccttca       840
     ctttggttct gaagttccac aacgacattg gtcgttgccg gtgtcttcac cttcttggct       900
     cgggtgatcg ttccggtgaa cgattggctt ttggccgatg cgttctgttg atcggctttc       960
     ttctgagcag tcttctgcga gtcattttgc tcagcactgt ttgagaacga gatatacgtg      1020
     gcgtcgtcgt agatgccatc gccatcggtg tctgtgtacg aagcgaaggc gtcgtacacg      1080
     ccgtcgttgt cgtagtcgta gtagttcgag gtgtactcgt agttgccgtc gttgttggag      1140
     tcaccgtagt ccgagtaccc gtggtcgtag taatcgtaga accaagtgtc actcgaatca      1200
     gtatcggcgt agtacccgtg atctttgttg gtccagtcga tgtcgttgtc tgagtcgctg      1260
     gacgtcaggg cttcatcgcg gtcgtacgtt tcgttgtccc accgtccgat cgcttcgtcg      1320
     gttgggttgt aatcatttcc gtcgaaccat tcgctgacgt cataccaggc atcgtcctcg      1380
     taataaggcg atccggtttc ccattcccat ccgaaacctg ctttcgcggt ggatgcagcg      1440
     gccagtggcg tgatcagtcc ggccgcaaca gcaagtacaa gacgtcgttg gcgtgtaggt      1500
     agtcgcttag tcatttcggt ctcctgtgta ggggcacaaa ttgacgcgtg cgttcacgtt      1560
     cacagagcgt cgttcaggag acaaatggcc gcaaagtcga tgccaaaaaa gacattggcg      1620
     cagcgagagt tgcgcaacca aatcgctttg gcgggaaact ctcaggcgtt gcagcgggcc      1680
     gcggtggaaa gcaaaaagtc cagtgattcc cgctgcgaaa cgctgttgtg gatcagccca      1740
     tttcagcctt gatcaggtcg atcaagtctt gcgtttgcaa cttcgcggcg gcatcggtgc      1800
     catccaagat gccggcaacg agctctcgct tgtctgcatg caactgaagg atttgctcct      1860
     cgatcgttcg ctcagcgacc aatcgataaa ccgtcaccgc acgttcttgc ccaatgcggt      1920
     gcgctcggtc agttgcttgg tcttcgacgg cgggattcca ccatggatcc aagtgcaaca      1980
     catagtcagc cgcggtcagg ttcaaaccgg ttccaccagc cttcaatgag atcaagaaca      2040
     gatcgccttc gccgttttgg aaagcatcga cgcggcgttg tcgttcgtgc gacggagtgg      2100
     caccatcaag gtactgatac gatattccac gttcgtccaa agcggctcgc accacgctga      2160
     ggtgtttgac gaattggctg aacacgaggg cgcggtgatc accttcgcga agctcttcca      2220
     ccagtgacaa gaacagttgc aatttggaag aggttccctt ccagcttggt tcgaccaacg      2280
     atgggtgaca ggcaagttga cgcagacggg tcaaccatga cagtgtttga attcgacgcc      2340
     ggccttcgtg cgatggtgct ccgccgcccg cggtcaattc cgctagcgcg gccaaacgag      2400
     cgtcttcgta aagtttgcgt tcgggcgccg acaattccgc gcgaagcgtg atctcggttc      2460
     gaggcggcaa ttctttcagc actttgtctt tggtccggcg caacacaaat gggcgaacca      2520
     aacgcgccaa cgattcacgg cgatccgcgt cgctgtgtcg ttcaatcggt tcggcgaatc      2580
     gacttcggaa tctttgccat gatccgagca agccgggact caacgttcgg aagagactcc      2640
     acaactcgcc gaggtgattc tccagtggcg taccggaaag ccccaaacgc caatccgctt      2700
     ggatcgttcg aatggcttgc gaagttttgg tttgcgagtt cttgatgaat tgagcttcgt      2760
     cgagcaccaa cgtgtgccaa cctcgcgaag cgaatcgttt cgcgtcgcgt tgcagcaatt      2820
     ggtagctgac aatcagcaag tcgttcgggc ccgcggtctt gatgacttcg tctcgatcgc      2880
     aatcgcggta aagcttgccg gtcaacgcgg gagtgaattt ctccgcttct cggacccagt      2940
     tctcaccgac actggttggc gccacgacca acgcggggcc aacggggcca cgttcgacca      3000
     agatgccaag cgtctgaacc gttttaccga gacccatgtc atcggccaaa acaccaccga      3060
     cgccccagcg actcaaacga gccaaccatc ggtagccgtc caactggtaa tcacgaagcg      3120
     ttgcgtccaa gccttccgga cgatcgggcg accaatcctg aagcgaatcg agacgctcaa      3180
     tcgcttggtg ccaagccgcg gttgtttcca gcgtcacgtc gtcgccaaga acgtcgcgag      3240
     ccaatggcac ggccgctccg gccaatcgca gttgtccttt ctcgctgacc agcgtatcgc      3300
     ccaactgagt caaacgtttg cgaaacgcct cgctgatttt cgcgaaacgg cgatcgccga      3360
     cacggacgag ttgccggtct tcgcggaccg ccattaacag atcttgcagt ggcacgtcga      3420
     caccatcgac ggtcacggtt cccgtcatgc cgaaccagtc cggtgagtca tcgattttga      3480
     ttcgtaggga cttcggtgtg atctcaccac gaacgcggaa cgtttctcct tcgggccaaa      3540
     cgattcgggg tgattcatca ccggcgtcat gcaaacgacc gagcaaatcc aatgcggcgt      3600
     gatcggtcag cgcgacccac tccatagtgc tttcgtgaga caggcggctg agtccaaaac      3660
     gttgcacaat cttttcggca gattccaatt ccgctttcaa atcgcgttgc aatcgaatcg      3720
     gaccggtctc ggccaggcac ggcaccaact cgggagcatc cccaggaatc aacgaatctc      3780
     gtaaacgtga ctcgtacacc cgcagagata ccttcagtcc tgcccccgga cgcggacgca      3840
     tttgcagcac caactcacac ggagccggaa cgattgggcc ggccaattgc ggtggcaact      3900
     ccactcgaat cagcgagtcg atcgatccag cggccagagc caaacgcgaa gcggtcgcgt      3960
     gatcaagcag ggtgtcgcgg taatcgccgc gcagcaagaa ctgaatgatc ccgatcgcgg      4020
     cgggatcggc cagtgtgcac aggacgatgc ggtcttcgtc ggcgtcggcc aaaatgatcg      4080
     ccggctcgac ggggctcagt ccgccgacaa cgatctcgca cttttgcaca tcgatgtcga      4140
     ttccgtcgac cgacagtcgc ggttggaatt gcacctcgac cttttcgtca tcgggaatca      4200
     aatcgtcggg gatcaaacca tcagcggatg gagcctcgat ggagtcgagt tccgattcgg      4260
     gcatcgtcat cgttgcggtg acgttgccca ataactcatc ggccgattta cccgaacgtt      4320
     tgcctgatga cttgcgagtg gtttttgccg cggtcttttt cttcgaagct tcgccgtcgg      4380
     tttggctttt ggatgctttg ggtttcttgg actgttcgac ttcgacgggc tgcaacgtca      4440
     acaacaactg actgcagaaa acttccacgg gaagtgcgtt ttgatcgtcc caggcaacat      4500
     tctcgtggcc ggccagcatt cgcaaggctt cgaagatggc gtagttgtcg tcatgaacgc      4560
     cgtgtgtcgg caccgacgtc agcgatgcga tcttgctgtc cagtggatcg gtcaacaagt      4620
     tttgatccag caaatcaaag ctgcggactt cgcgaccctt cgtccaaccc ttgccaccct      4680
     tgcgttgctt ttgttcaaac ggcgtgattg tcagtggtgc cgtttgcgat gccatgttca      4740
     cgcgaactcg ccattgcaaa cgagtgggtt cagcgtcttc ggcgggtgcc ggtcgcgaat      4800
     ttttagctcg tcgcaacagt tcatcaacga actgcttgcc cgccgcgacc gcgtcagctt      4860
     tcaggccgcc caaaaattcg atcagctgcc cgttgccgtt tctgcgagcg atttgttctt      4920
     gcaaccacca cgcggcggcc agtgtgtgcg ggcacgaatt gtctcgcaga aaagccacgc      4980
     atccgcactg gcattcgctg gacagttcgc cgactccgcc gggatcgtcc tcgtcgactt      5040
     gcgggacgat ttcgagagca acggtttgct gcttttctcg gttgccaacc acttggaaat      5100
     caaagcgaac accgttgtcg ccttgagtca gggttggggt cttcaccgtc agcattgctg      5160
     cgcgggaatc gaaaccctgg tcgtgcgaat caacgagacg ctccaccgcc tcgcccatca      5220
     gcaatccaag cgatccgagt tggtcttccg cgatccagtc catgcgtgtt gcttctcaga      5280
     aggtgcaatt caaaaaacga gcgaaacagg ttacacgcga tgacggcgta aagcgatggt      5340
     gcaaagcgac aacctcccac gtcggagctc aatggacgat tcgtccccca aagggtgctc      5400
     ttgtgcctcg aaccagccat ctcgcggcga ctgaccgaac cgactactat gatggcgcta      5460
     aggcgaaagc cggcggagtg gcaccggtcg cgtgccaaac catcccaccc ggcccctttt      5520
     cagatcgact cggttgtttc cagcccggtt ggacaaaggt ggttgttcac acgttgtgtg      5580
     cgggagttcc ttgggaatga cactcggaca agacactttg ttgccaggga tcgttccgga      5640
     ggggattttc ggacaatcct tcgaaagttg aggatcgctt gattcaggcg tttccatcaa      5700
     ctcgaacgaa cgtcggggaa acggatggcg ggcgacaggg gtgagccgca ccgtctcggt      5760
     tgccaggatg gtcctgagta acgtttcgga cgtttcccga tagttttttg ttcggtcttt      5820
     gaatcgctgg ttgccatggg gcaaatgcat tttgatgtcc ctgacgcagc gaacgagttc      5880
     tttgaatcga ctcgttggga agacgcgtat ctatgcggca tcgaaggggt gccgtggcag      5940
     tcgcggaatt cttactcgaa cggccgcttc acgctgactc gcggcgtcga tacatcggcc      6000
     aaattgttcc tgacttgccc aattccctcc atcgggtatc gccaactcag cacatgcagt      6060
     ttgcgttgtc tggaccgttc ccaccgactg tttgtcgaat tggctcgggg aagttgttat      6120
     cgcgttcgtg ttcaagccga tgtctggcaa cgcggcgggt tggttctcag tgatcgattc      6180
     gacgacttct taacgcgagg caccaagcgt tttctggatg cggcgcagtg tgccccagac      6240
     gatccgtcgt gcgtggatgc cgccttggaa gccatcgaag ctctcgagca cgcctccaac      6300
     gaactgggcg atctgttctc gactcagtcc gttgcctatc gccgtagtcg cgaaactcgg      6360
     ttgagcacca tgttggccgt cggagtcttg ccgccgctgc ctgccaccga agtcaccgcg      6420
     gacatgcaat ccgggcgtgc cagcaattca attgacgaac aagccaccat cacgcgagcg      6480
     ttcaacgccg ccgcggttcg aatcagctgg ggcgaaatcg aaaccgattc ggggcgtccg      6540
     aattacgaac ccaccgatga agccctgacc gcgtgtgccc aaatgggact gcgtgtgatc      6600
     ggcggaccgg ttatcgatta ccgcaaaggt ctgctgccgg attggttgac tttgttggac      6660
     gacgacttcg acaagttgat gtcgacaatg accagcttcg tcgagaaaac ggtcgtgcaa      6720
     tttcgcggac gcgtgaacct ttggaacgcc gcctccggac tgaacgtcgc cggaccgctc      6780
     ggttttgacg atgaacaagt catgcggttt tcgatcggaa ttttgcagac gatccggcga      6840
     tgcgatccga acacgcccgt tctgatgtcc ctggaccaac cttgtggcga atacctcgcc      6900
     cgcgatgaac aagggatcag cccgctgcac ttcgccgatg ctttgctgcg aagcggtttg      6960
     gggttggctg ggatcggatt gaatttccgg tttggtttcg acgacggtga cactcaccct      7020
     cgatcggcgg tcgagttcgg gcaaatgatc gaccgttggg gaaccctgaa cgctccgctg      7080
     atggttcagt tgtccgtcgc cggcgcaccc ggtaaagacg ccgccgcacg attgccgatt      7140
     caaacacggc cgttgtcacc cgaaatcaat ggcgagcccg acgcttgggc gaaggctcag      7200
     attgaatttg tgcaaccact gattgagacg ttgctatcca agcaaatcgt tcacgcggtg      7260
     gtgtgggacg gttggtcgga ccagcatcct cacatgacgc cgcacgcggg agtgatcgat      7320
     gccaaaggcc gaccacgtcc gatgcttgcc tacctcacca aaatccgcga agagatgttg      7380
     atctgaaagc ggagggtgtc tttccttgct gacgcgtcag gttgggacag aaatgtaggc      7440
     caggttgtac ctggcggggt gtatggacgg acatcgctga gtcttgcgtg accggctggg      7500
     cggctcgctt tgttccaaag catcggctgg gtgccaggta atgacctggc ctacgttggt      7560
     agcttcgcca gtattcagac gtgtccctcg ctgacgcgtc gggttgggac agaaatgtag      7620
     tccaggttgt acctggcggg atgaatggac ggacatcgct gagtcttgcg tgaccggctg      7680
     gacggctcgc tttgttccaa agcatcggct gggtgccagg taatgacctg gcctacgttg      7740
     gtggcttcgc cagaattcag acgtgtctct cgctgacgcg tcgggttggg acaaatatgt      7800
     aggccaggtt gtacctggcg gggtgaatgg acggacatcg ctgagtcttg cgtgaccggc      7860
     tggacggccc gctttgttcc aaagcgtcgg ctgggtgcca ggtaatgacc tggcctacgt      7920
     tggtggcttc gccagaattc agacgtgtct ctcgctgacg cgtcgggttg ggacaaatat      7980
     gtaggccagg ttgtacctgg cggggtgaat ggacggacat cgctgagtct tgcgtgaccg      8040
     gctggacggc ccgctttgtt ccaaagcatc ggctgggtgc caggtaatga cctggcctac      8100
     gttggtggct tcgccagtat tcagacgtgt ccttcgctga cgcgtcgggt tgggacagaa      8160
     atgtaggcca ggttgtacct ggcggggtga atggacggac atcgctgagc cttgcgtgac      8220
     cggctggacg gctcgctttg ttccaaagca tcggctgggt gccaggtaat gaccttgtct      8280
     acgttggtgg cttcgccaga attcagacgt gtctctcgct gacgcgtcgg gttgggacag      8340
     agatgtaggc caggttgtac ctggctgggt gaatggacga acatcgctga gtcttgcgtg      8400
     accggctgga cggctcgctc tgttccaaag catcggctgg gtgccaggta atgacctggc      8460
     ctacgttggt ggcttcgcca aaattcagac gtgtccctcg cggacgcgtc gggatttcat      8520
     ttcgacggac ttggaaatcc atcgtcctgg gagtgttgct tttgcaacgc tacgcggcgc      8580
     gacgttggtt ctcgttggat tccaacacgg gcacatgtgc tcgcttgcga cggaggtccc      8640
     gcatgacggc ggcactctcg tgcagtttgc cttccagcac tcgcatgcgt tcttgcatct      8700
     ccgcgtttgc atcgaggctt tgatcgagtt cactggagac gcgtttgagt tcgacggtga      8760
     ggtcggcgac ctgggattgc atcgccacgg cacgcggttc gtgctgacga gcagtttgca      8820
     gagattcctt ggtcgacttc aactcctgag tcaatcgttg caccagcgag gtttgttcgc      8880
     tgattcgtga ctcgagctgt tcttgcgatc gtcgcagcga ttgaacttgc tgattgcgtt      8940
     catcgatctc ttgctgcaac tgcgtctcgc gttgttgctg attcttgacc tgttgagcca      9000
     gacgcgtggt ttcgttggtg cgttccgaaa cggtttgctt cagcttttca aattcgggac      9060
     gaaccgattg aagtcgttcg atttctgcac gatgccgcga cacggaatct tgctgcacct      9120
     gcagatcgtt tcgcagttgc gagatcgcat cgtctttcga cgcgatggtg gcttccaatt      9180
     gtgtggcttc gttgcgcagt tgttccgtcg acgcgtgaat ttcttgcagc gttttctcgt      9240
     gacggtcgcg ttggacgatc gcggacgcga gcgaagactc cgtcgtttcc aaacgcgacg      9300
     cggtggatgc cagttcggtt tgagcttttt cgagttgaga ctcaaccgac gacagctttt      9360
     gcgcggtggc ggaaagcctg gattctgatt ctgacaactt ggctttgctt tcggtccaac      9420
     tggtttgaac cgacgccagc tctgttcgtg tttgttccag ctgagactcg gtcgtcgata      9480
     atttttcgac cgtctgcgtg agttgcgact gggtttcggt caggctcaat tccgtcgacg      9540
     ctagttgcga tgcggtgtgt tccaatttgg agttcagttc cgcgtgagtc aggctcagcc      9600
     gttcttcgag ttctgacagt gccgattcgg caaccacacg gctgtcgatg gcttcttgaa      9660
     ttcgaagcgt tcgctcgtcg agttcttctg ccagctcttc gcgttcgctt tgcagcgtct      9720
     gtagtttcag ctcgttctct tgcaacgtgg attccagctg ggtgcgagcc gttttcagtt      9780
     cgctcacttc ttcgttgcga gtttccaatt cttcgcgaac caattgaacc gtttcttcgt      9840
     ggcgggtcgc ggtttgaata gcgatctcat gttgcgatcg caggttctcg tattcttttt      9900
     gcagctcggc aaagcgttga ccggtctcgt cgtattcgtt ggaaacgttc tctcgctcag      9960
     cagcgaattg atcacgctgc aggatcgcgg cgtcacgctg agtaacggct tcttcgactc     10020
     gctgaagaag cgattcgttg gcttggctca gtgagtcgat ctcttcgttc gcagcgttga     10080
     ggtccgcgag aatttgttgg acctggcttt gagtgttttc ttgttcgttt tgcagcgagg     10140
     tttgctgttg ccggaatgcg ttgagggctt cttcggcggc aaagacttca ccacgggtga     10200
     cttcgatttg cgattcgagc tcggcatttt gtttcttcag ttgctcgttg gcctgcatca     10260
     ggaattcctg ctgcttttct ctgttggcga gctcatcgcc ggtggcgttg gcggtttcag     10320
     cgagttcacg cattttggaa gcggactctt cgaatcgggt ttcgttgtct gccaaagcag     10380
     aacgcagtga ctcgatttct ttttccgctt gttgcagcga agcggtcgca gcttggcgag     10440
     cttcttccgc atccttgttg gccaattcaa aacggctgtg ttcggtccgc agatgtccga     10500
     gttcggtttc cgcttcggcc gtcaattgct tttggtcttt gagccactga cggagttgtt     10560
     cgctttcggc tttgacttcg tctcggctgg attgcagcga atcgatgtcg ccctgcatgc     10620
     tgaggaagtg gtgtttgcga cttcgggctg ccgctttcgc ttttgcgtac ttcttctcgg     10680
     cgtctttaat ggcttgcaca tcgcggctgc gatcgcggta ccacagcaaa tgtccagcca     10740
     gaatgcctgc caacatacag acgagggcgg taaacgacgg gattccgatc caagtattca     10800
     tggcagccac caacacaaaa caaacgagaa cgcgtggcaa aaaccacact ccatgtggcc     10860
     tgtagcaagc cgccggccgg tgtgtcgata ccaaacccgg tgctgaaccc ctgtgagggg     10920
     accgaggtcg cgcagttttg cttcaccctc ccaaggggag gatgatgaca aacgcgtggc     10980
     aaaaaaacag cttggaaact gcacggcctc ccgtacgggc gaggctggca ggacgtcaag     11040
     aacacagcac ttcaacctcg atcagtcgtg ggactctgaa cgagagtcag ctcgctcacg     11100
     agccagtgcg gatgcgggga caaccagggc atggcgggat cgattgggac ggtttcacgc     11160
     cggtttgggg tgggggagag ggaatcgaag atcttctccg cgttggttgg cgatcgcccc     11220
     ggcaggcggt taatatatgg acttctccga gcgatcgctc gacggcgtgg tttgcgaccg     11280
     cgtcccccac ccctccccat ccctccggca actgcttcgt ccatgaaatc cctctgttct     11340
     tccacgtccg ctggcgtttt cgcgagctcg cacgcgggaa acgttttgtc ccggcgagtt     11400
     ttcgcagcga cgtcctctgt tcttcgtctg ggggccttcg ttggcgtcct tgggctgagc     11460
     cagcttcatc ttccgaatgc ttcggctggg ctgggcgtca cacccgccga gcagttcaaa     11520
     gtcccggaag gctttgaagt cgagctgttg cacgaagtcg cccccgagtc ggaaggttct     11580
     tgggtcagtt tgaccgtcga ccccaaagga cgcctgatcg cctgcgatca atctggcgga     11640
     ctcttccgaa tcgacatgag ctcgggcgaa gccaaggtcg aaaagctcga gattgaattc     11700
     gtcggtgccc aaggtctgct gtgcgcgttc gggtcgttgt acgccaacgt caacgctcga     11760
     gagtttccgt gtggtttgtg gcgtttgacc gacaccgatg gcgacgatca gtacgacaaa     11820
     aaggaacaca tcattccgct caacggcggc agtgagcacg ggcctcacgc gttgctggtg     11880
     acgcccgatg gcaaacgcat catcatggtc gccgggaaca acaccaatct gccggaagaa     11940
     atcgcccact ctcgagtgcc aaaggtttgg gacgaagacc acttgctcgg ccgcatgccc     12000
     gatgctcgag gtcacaacgc caaccgaatg gctcctggtg gattcatctg ctcgttgaac     12060
     cctgacggca gcgatgtgga attgatcgcg actggttttc gtaacccgta cgacattgcc     12120
     ttgaatcgtc agggcgaact gttcacctac gacgctgaca tggaatggga cgtcggcacg     12180
     ccttggtacc gccccacccg aatcaaccac gtgatcagtg gttcagaatt cggatggcga     12240
     aacggtaccg gcaaatggcc tgcgtactat cccgactcgt tcggatccgc cgtcgatatc     12300
     ggtccgggtt cgccaacggg catcgtgttt ggctacggcg ccaaattccc taagaagtac     12360
     gaaaacgctc tgtttatttc ggattggagc tatggcaaca tccacgcggt gcatttgacc     12420
     gaagatggtt ccagctacag cgggacttac gaaaccttcg ccaccgcagc accgttgccc     12480
     gtgaccgact tggtcattca tcccgatgga gccctgtact ttgcgatcgg tggtcgtggc     12540
     acgcaaagcg gtctgtaccg gatcaagtac accggtgaca tcgccgctgc tgatgcggcg     12600
     gaagaagtcg ttgccgcgtc tgacgaagcc aagcaacttc gtgaactgcg tcacagcatc     12660
     gaagctttgc atgtggacga cgcggatcta tcggtcagtc cagaggaggc tgtcaagcta     12720
     gcgatcgaga acctgagcca tgatgaccgg gcgattcgct tcgccgctcg cattgctctg     12780
     gaacaccgtt cgccttcgag ctggaagaaa gcggcactga acgaagcaaa cgccgaagcc     12840
     aaaattctcg gcgtgatcgc tttggcgcgt acgggcgaga aagcggatca agccgatgtt     12900
     gtcaaagcgt tggaaacgat cgatctggaa tcattggcgg ccagtgaaaa gatcgacttc     12960
     ctccgtgcgg ctggcttggt ggcgatgcgt ttgggcgagt tcacgcaaac gcaacgtgac     13020
     gctctattcg gaaagatcaa aggccaattc ccaaccggcc ttgattcgct cgaccgtgag     13080
     ctggcaatca tggcgatcta cttgggcgac ccggaatcga ccgcttcggt tgttgccgcg     13140
     ttgcaaaatt cgccgagcca agagagccaa atccactacg cgatggcgtt gcgagcagcc     13200
     aaagaaggtt ggagcaatga tctccgtcgt gattacctag cgtggttcaa cgagatggcg     13260
     accgctcgtg gcgggatgtc gtttggcgga ttcctggaca acatcaaaaa ggtcacggtt     13320
     gagcgtttgt cagacgctga caagcaatcg ctcgccgatg tgctggccaa gcccaagcaa     13380
     accgacgagg ctcccgccgg accgccacgt gagtttgtca agcaatggaa ggtcgacgat     13440
     ttggtcgatt tggtgagcga cgaaaaccgt cgtcccgact tcgaaaacgg caaggcgatg     13500
     tttgccgctg cgacatgtta caagtgtcac cgaatgggac tgcagggcgg aattctcggt     13560
     cctgatctga ccagtgccgg tggcaagttc agtcctcgtg acatgttggt ttcgatcatc     13620
     gaacccagca aggtgatcag tgaccagtat ggttcgacgc agttcctgac cgaggatgga     13680
     gaagtcatca ccggtcgtgt gatcaacatg cggaacaaag tcctgaacgt gatgaccaac     13740
     atgcttgatc catcttcgtt ggcggaggtt gaccgcgaag ctgtcatcca aacgcgtgaa     13800
     tccaccgtca gcatgatgcc caacggattg ttggacacgt tgaacgagga agaaatcgct     13860
     gatctagttg cctacctgcg agccggtggc aacgccaagc acgcgatcta cacgcaacca     13920
     gtcgcgacgc gatagttcgc cagcgatcga tttcaaagac aaacggcccc ggagagtctg     13980
     cctctccggg gtcgtttttt atgcttgctt ccttaagtcg ctatccttga ggttcatcaa     14040
     ccgccgctcc tattgcgagg aaatgctgtg ccaccccgac aactgctgcg tgccctggaa     14100
     ggagattggc gaggggcctg tcaaacctgg ttcgagccag gcaagctcgc tgacaaatcc     14160
     gaagtctccg gcagcatcaa gccaatgctg gaaggtcgct tcctgcgtca cgtctatcaa     14220
     agtcagatcc aaggccgtcc gcgtcacggc gaagaatgga tcgccttcaa tgaagtcacg     14280
     gagaactttg agatctcctg ggtagacgat ttccacatga gcggcgccat catgatttcg     14340
     cgtggaccgt tgacggtgcc cgaaggattg tcaaaacgaa gtgctgcgtt cgaagtcttc     14400
     ggccactacg acgttggcaa agatcaccca cgctggggct ggaaaactcg ctacgcgtac     14460
     gatgaagaat ccggcctggt catcaccgcc tacaacgtca cgccagacgg agaagaggcc     14520
     aaagcgatcg aaacggttta ccaacgaaac tcgtgaagat tcctacgcag acgattggag     14580
     cgcccacaag caacggattc ctcgcccgtc tatctgcaag cctcatctcc agcgtgaaaa     14640
     cgtttcgcgt ttccaatgca aacccaccgg gatccatccc atgcaaacca attttgttgt     14700
     cgtcgatgtg tttgatcacg tggttgatgc ggagatgttg gccatgttgt tgacgcgaga     14760
     aggtttgacg cctcagctcg tggacaacca caccgtcggc atgaactgga tgcattccgg     14820
     agcgtatggg ggcgtcaagg tgaaggtgcc cgagtctcag gaggcccatg ccaagcagat     14880
     tgccagccaa ctgaggactc aatcgaaggc tcggcttcag atgatggcga acacgaacga     14940
     ggacgcgtgt ctggcgtgtg gcaaagaaat ggcggaagac aacgacgagt gcagggagtg     15000
     cggttggtcc tacgggcaga ccagcagcga ggccgactga gtcgcgaatc aagcggccat     15060
     caaaacgcgg caggtcaact cgccaaatcg aaaccggtgg tttaaactgc cgctcgtcgc     15120
     catcgagcga ccctcctctc gcgcccatag ctcagctgga tagagcaacg gacttctaat     15180
     ccgtaggtcg gtggttcgaa tccacctggg cgtgcctttc cgccgatcct gattcctcag     15240
     caccgatcag gatcggcttt ttgctgggtt tcgagtcatc gtcgatggct cctgctttcc     15300
     tccgttcagc acggacgaca ccgcccgcga caccttcgac cgattcttcg attgctcgct     15360
     gccaatgagt ttcggtcgtc aaagtcgaac cgcggtatcg cccattcgcc aggaggagcc     15420
     gtctcggtcg tagagagcgt actactatca agattgcttt taagtgcgag aaccagttcg     15480
     tcgaactttg agtctccaat caggcacaaa ccgctcagcg tcgtcgattg cgtcttctgc     15540
     ttcgtcatcg tttgcgccaa cagaattgcg aagcagttcg aggttcatcg ttatggtgtg     15600
     agtgacgggg ggaacgtcca ccggcaccga gcgttgaggg taaagctaac catcaggaaa     15660
     cgcactgacg ccgttccgcc gcaaggcatg tctatccaca gtctgccgtc agccagtcga     15720
     gcacgaacgt cgagtaacct tcccaagtct cgggaaaacg tgtgacgttc ggaatgtggt     15780
     taacttcaag caagtggggg acgccattgg tgtcaacgat gtagtcgttt gcagcgatct     15840
     caagcccgaa tccgcgtgcg acggcacgcg tatcatcaac taaagcggaa tcgagatcaa     15900
     tcaaagaagc ggtgtcgtgg tgaatagact tcagccagtc gtcaccctcg aggcgaatct     15960
     gccacgcact gtcgccaata acaacgacgc gaatggcctc gccagaaacg aatggttcga     16020
     caatggaggc attctcggtc accatcgaat cgtcaaatcg ttctttgttc tcgccacaat     16080
     gccagttgcc ccattttgcg acggacggcc cactggcaat gtattcaagg ccaggtgatg     16140
     agtatccacg cggaggatcc gcaaacgacg caaaacgcaa agcacgggct aagcatggca     16200
     atttgagccg acagtccatc attgccgcgg cgttcggcaa gcattcaccg gcccagatag     16260
     ctagcccagt gatgaagtcg tgatcgtcag cgaagatgcc gtgaaagacc attcgcgaaa     16320
     tcggaaggag ccgagcgcca ctcgcgggtt ggacaaagag ctggcgatca cgaaccatca     16380
     tttgcggcaa tagctcgtgg cacaccatag ggccaccgta gcgctgtttg atgtcggcga     16440
     gttcgtcagc gtctaggcca atgatgcagg gtagtggttg catgtgattt ctttactcgg     16500
     gaaacgtcgg gcatcaccgg agacgaacgg aaaggcaacc acagccaaaa cacgttttct     16560
     agtcctccgc gtgcatcccg tggttcgccg tcaattgtac agtttcgaat cgtcgaatat     16620
     gtcacacaaa tacgcggcaa cgctgtcggg aaaaccacag cgggtcatcc cgtgacatag     16680
     tccggcatag tatgcagtgt tgatatgaac cggaagatat ttagaaagga ttgctaggtt     16740
     gggatcagga gtcttgcgtt tgcgatagtt ttgcactgct ttctgagtgg agatctggaa     16800
     agcgtcttga tcgcagtcgt agatcgcttg caccatgttt gcaaggagtc gtattcgagt     16860
     ttttcggctc tcggaacacc gcgagagttt tcgaacgaaa ccaggcttga gactaccctg     16920
     aaagagaccg gcagtaacca gtgtcagttc ttgaatctcg ttgtcgagcg gaccttcgta     16980
     gcccggtttc ttacggggcg ttgcccattg acagagccgt gccatttttc ggttcatgcc     17040
     taagaaagcg caggcaaata tgccttcgct gagtggccgg taccaaccct caaggcttgt     17100
     tcttccagcg tcgaagtcgt cgattgcagc atcaactgaa tcattcgcta gctcgataag     17160
     cgtagggacc gggacgttcg cacccaaatg ccgagcgcgt atcaattcgc aacagatatg     17220
     caggttgcgt ttgctgcgga cgtcttcttc agcatgtcgg agcagtgact ccacgagttc     17280
     ttgaagtgaa aaagcgacat ggaatcctat ttcgcgcgct gcatcattta gcggttcctg     17340
     tggtacgcct ggcggaatag tctcttgccc acctcgagtg attttgcgaa cttttttgcc     17400
     gatcttgttt acttgatccc gcagttgttg tttggcttcg tcgagctctg cttgcccgtc     17460
     gggcgacagc ggcgtgtagt atttctcagc cgtgccttta aatacatcaa tgaaatgcgg     17520
     tttcgacgta atgtcgacac caacccgctt gctcagttct gacagcattt cgtcctgcca     17580
     aaagcgaagg cttttgcgtt tctgcgtctc actaacggaa gacgcgagtt tatagagagc     17640
     atcgcgatcg aaaagctttt cggccgcggc aagtattttg gcgcgagtaa tatcatccat     17700
     agcgatgtag catcatgcga tttgcgtcgg cgaacgggaa gcatctgcgt ggtggcggaa     17760
     accagatttg cagttgctgg aggtctctac cgtcactcca cggcatgaat tggttattgc     17820
     gtgatgtgaa ttcacgcatc ctgcgttaga gaccgaaagt gtaaaggaag tacatgccga     17880
     cgagacaaac caacgtgtgc gggagcgtca atggaatgag ttgagcaacc cgagggaaac     17940
     gaatgaacgc aggtaccatt gaaagcccgc cgatatagag cccgtttgcg tatagcgtta     18000
     cgacctgttc gccctcccct agatcgctaa aacggtcgga gagccagagc aaagatgcaa     18060
     acagaaacag cggaacgaaa cacactgcag caccgatata gcgagatctg aagtagcagc     18120
     ccacaaatgc gccaacagcg gcaaaagtca caacaaacgg aacagcaatc aacgaaatgt     18180
     aagcgtcttc atcggtcgcc aacgacaaca atgtgccagt taacgcaaac gctccaatta     18240
     cgatcagccc aagagcggca aaaccaagtg acgcccaagt aatcgcaatc gcgtctacgg     18300
     cccaatgcag gtgcgtaggc gtgtgcaacc gtgcgacagt cgtgtcagct gatgagtatg     18360
     gattcaatgc gtggtgcgtt tggtgaggtg catttcagtc ggacaaagaa tttaagaagt     18420
     ccgtggtatg aggcgagtcg gttgctgcac gctgctgacc aggccgtgac cgttctcttt     18480
     cgagacgtca ctatcaacac ttcttgcacg ttgacacctc aaatcacgga gacctctcat     18540
     gttgatagcg atgaccggac tacggcgaac gatcatccaa ttcggaaaca cgagtccgcg     18600
     tttacgtgtt cattgcttgg ttcacccatt ccgtgaattc aaatccgaaa cgcaattttt     18660
     cgcgaaatca ctgggagagc gacgccggtg tctgatagcc gtgtcgttta cgaggtcgta     18720
     ggtttagcag catagcggct ttgcgaacct gctgccagct gatcgaacca tagtccactc     18780
     cctttggata gtactgacgc agaagaccat tggtgttctc attggtcctt cgttggccac     18840
     tacagtatgg atcggcgaag aacaccatga ctttgaacca agtaaaaaga aatggatggt     18900
     agaagaattc ggtgccattg tcgaaggtca ttgtcttgat gtattccttc ggcaccttct     18960
     tgaacatcga ccgaatcgta tccatcacca aacgcgataa cttcttttgg cagcgaccaa     19020
     ctaaggtgta gccagtcttg cggtccacgg cggttaccag gtagccagtg ctcttcttgc     19080
     agaccaccaa atcgagttcc cagtcgccaa cccgtttccg gttgctggcg acttttgggc     19140
     ggtcgtgaat tgacacacgg tcagtagcct gtttgcgaat gaatcccggc ttttgcttgc     19200
     gattgcgacg cccgcttcgc cgcatcactt tgcgaattgg gtagtttcga tccaaagacc     19260
     atagatactt gtagatcgtt tgatggctga tttgctgctt aagatgtgca tagctgactg     19320
     agcccgcatg agttgttggg atttgaagct ccaaacagct tggcgggctc agtcggtgtt     19380
     tcgccagggg gcgttgaaaa acctttcgtt ttttcaacgc tctgaaaatt gcgtttcggg     19440
     tttgaattca cgttcttcag ctagccggtg ggcaacgcgc cagtattggc acgaacgtat     19500
     tcagcgagca gccggaatgt ctcatctgat gattcaaagt atagagtgtc tgcagtctca     19560
     aatccaagca gtgctttgat catcgaaagc ggtaatcgaa gcctgtttaa cggtcgcgag     19620
     atcgcggacg tggggcgaat ccacaaagtg ccacgaagaa atcgggagaa tgctcgatgt     19680
     gcttgttcag cgccgattgt tgcatgcgat tcgggcatga gtgtgcagag gtcgaagtca     19740
     gcatcctttc gttcgagcaa aaattggaat ccgccgttcg aaattcgagc gtgtgcttgg     19800
     ttgaccgcga gcacaatttg atgcggcttg gggatcgagt aaatgtcgag ttggttgccg     19860
     tgaagtttca gtattcgctc gacagtatca cccaccagct cagagtcgga gtcgtcgatc     19920
     attcaaacgt tgtagcaacg gtcttggggt tagtcgggga acgtcaccca tcagcgggct     19980
     cgcggagata attaatcact gccaagccgc ctgatcgcgt gctccgttgc atgggatggt     20040
     tcgtcgtgat catcattcga ccaagaatcc gttctcgatt tcgatgaccg gcagcctaaa     20100
     tctctcatct ggcccagacg gaagcacgag cgttacgccg aggcactcga ttggtggctc     20160
     gccgggcgta gatcctttgt agtacacatc gtggtcgaag aacgtattgc gcgggagtcg     20220
     gtgactactc tgtatcttct tgagcagcgt cgttacgtgc tctggagtat tccccagcga     20280
     cagcgtcgat tgaatagctt gtaggaccgc attctcgtcg agcagcgtgc tatcgacttt     20340
     gactgtatcc gagatctgat cgttgaactg agcgactgct tgtggcagcg gagtcgaatc     20400
     cagccagtca aatagggggc gtgcgatcgc caacgcaact gccgctactg cgacaatcaa     20460
     gatcaatgtc cgtaattggt atcgaacgag tcttgactgc cgtttcgaat tctgtgtcat     20520
     caaagaatat gctgtaggta cggcgaacat tgcggatcac cgcgtgggga gagaaaagtc     20580
     atccatttga aaatggccgc aagccccact ccggcgcatc cgagggttat ccggtcagtt     20640
     cgagtcgatc gttgagcatc cggtcgtacc agtcgcgacg gaagtcaagc agcgattcgt     20700
     ggataacctc atgcggttct ccaccctctt ggtcaaacca aatcacctgc ccccgcgtga     20760
     agccgtgccc atccctgacg acgtagcaca agtggtcgcc accgccgttg tccaggaagg     20820
     gaagctacgc aggctgccag tgctcggatg gccaaccttc ggaaagggcc atgtcagtga     20880
     gcattgtgtg ggtcgccatg gactcacgca acgtcatgaa tgtcagattc aataacagtt     20940
     cggtaaagtc gccggattgc tgaccgttgt gccaccgata aagttcggcg aactcctcag     21000
     ggagcgtgca gcagtacaca gtggccgccg ctgccagttc ggaatgagta gcaggtggtt     21060
     gaagtagccg gtggtagtcg agccggtttg ccacgagcca atcgtcgagt tgctgatagg     21120
     aagccatggt tcagtccgat agctcgatcc tcacctgttg taccgggtga gatcatgtgt     21180
     tggaggatgt tccggacggt tcagtggtga gaatgagtct tgagggggcg atttgtcctc     21240
     gcctgttccc atcccaacgg gatctattgt cccggttgcc catgtgcaag gcaaggttcc     21300
     actgattcgt tcgctgacga tcataggccg atcaatcgcg gttttgactg ctgcccactg     21360
     gtacgcggtc accgatcgag aaaatgaatc gccggtgctg atggctgttc gcggaaggcg     21420
     aattacacgt gatcgattct cggtcaatcc gttgctattc gtccgttgca tgtgacgata     21480
     tctggtctcg gatcagattg gcggggacca tcttcgacag tttggcaccc gatacgtcct     21540
     ttaccacacc gatgtgcatg ccaatcaccg tcaattctcc gtcgggctgg ttgttcaaaa     21600
     aagctgggcc accgctggtc ccttgagcga gggctggcga gcaatacacg attggttcgt     21660
     gcccccaagt gtttgccgtg ttcgtttcgc gagatgcgat gtgtcccacc accgcgacgg     21720
     gtgagatcac atcaccggct ccgatcgcga gcggaaaacc gaccgccacg atctcggtcg     21780
     tgcgtggcgg ggtttcggtg caaatggaat ccaaggagat cgagagtgca gagaggtgag     21840
     aacggtacgt ttcagctccg tcgacactgg ggagctctgc gatcgcgaag tcggattgtt     21900
     cgtttcgttg ccacgggttg gtcgatgttc ggaagaatgt cttgagcgat acccactgcg     21960
     ttaccccatc tggatctcga taccggagct tgcttttgag gttggtttca gcggaagcgt     22020
     ggccagccgt cacgagaaat agtcgttcgt ctgcggtgac gagaaacgcc gagcaaagct     22080
     tgccagtgtc aggtttcgat tcgacctggc tttgaatgca aacaactctg tcccacgctt     22140
     caatcggctt tggttcagac gcattgatcg atgttgagaa tgccaccacg gcaaagatca     22200
     atgcggacgc atttcttacc ggagaatgga ggcggtgcat ggaatcgttg ccaagctcac     22260
     gagagaaaag aagtggcgtc atgaaagttg cttcgcgtgg ggtgaaggct gtggatgcac     22320
     aggtttattt gatgagcttc gagatgcgtc tgcagaaagt agcgttgatc aacacacagt     22380
     ggtagcgagc gatcggctct ccaggattgt tcctgcgaac acttcagccg ttttggcgct     22440
     agccacggtt tcttcagcca gcccaaacgg tcgattcaac ctgacgctgt ccggtcagcg     22500
     ctcaccgcgt tcgtattgcg tttggtcaaa cgcatccaac tcgacgtccc aaaccctctc     22560
     cagctttatc aatccagcat cgaaggcacg attgaaatcc ctgtcggcct ctccaaaggc     22620
     cgattcgatt tgttcaaaga gggcttcaaa ctcatcgaac ttttcgggag gcagcgacaa     22680
     gcggtaggtc gggaaccagt ccgttcgatc ttggtaaatc accgcttctt cgagcgtcag     22740
     ttgaatgtca ccgacttctc gatctttgac agctcgggtt agtttgttca aattctgaag     22800
     agcaaagaag atgaccgctc gttgcgctct cttgttcgcg tcctccaagt cttgaccgat     22860
     gtccaccatg ctcgacagat cagctggcct cgccacgatt tttacagttt gatcgtcagg     22920
     gctgacgacg acggaatcag ttcggaagta gccctccgcc aacagctgaa ccgcctcatt     22980
     gtcaggcatg gttggattct ctcgaacctg ttgaattttc gcggccgcca attctcgctc     23040
     ggtcggatgg ttgcatccga tgagtgaagt catttgtgcg atccccatca agcaaatgag     23100
     cgaggcgacg tttcggtgca acatggcgtg agtcttaaaa gcgaagggat tgcacgacat     23160
     cttcgaggcg aacgaagcat gcgttgccac aatggaaatt cacgcacaac aggtgggagc     23220
     taaacgatag ccggtgcgga aagcgaaact tcagttgcat gccaatcgtc gaatcgcgat     23280
     cttccgtcag tttaattgat tccagtttct aacgacgaat gtttaactgc ggctcccgtg     23340
     acgctcattc aatgcggggc aatcagggaa cgtcgctcgg atctcgggat cgcgaagaag     23400
     tctcagggcc cagataccga acgggatacc cagccagacg aatggtgtca gcaagggaat     23460
     gcacgccaaa atcgatccga cgcgtgccat tcgatacgat tctagaaatc caagcttggc     23520
     ggcaccgatg gagatgacga tcatcgacat gagttgccca gcggcgatgc cagtcgcgag     23580
     cagtgaaata cccgagccaa gctgtcggta gtagacaaag cctgctgaaa caaggtggat     23640
     cgtcacaatc acagcatgga tcgacgccat gatgagcagt gcagtcgctg gtcgagaaac     23700
     tcgtttgcga actgcttgat ggccgaaatc aaaactggca tcagcctacg gcgtttgata     23760
     gggattcgtc aacagattcg atctttacga gtgattttga tcggggaacg ttgctcggtt     23820
     ggcgggcaac ggcatcagat tctcaacact tcgctgcgcg tccgatcaga gctcacgcgt     23880
     cttggcttgc ccgtttcgac gtgccgtgat gagcgtattc gaggaagcaa aaccagatcg     23940
     caatggtggg gcagatcacc gcgaccatcg cagtgatcgc aattgactga ggccaattga     24000
     ggagctcaag ggaatctggc gatgcgttgg ttgaaacggt gaaccaagca aacggagtcg     24060
     tgatcgagaa cagcatcaac atgcctatca acgctcggaa cggacgcacc cggtcacggt     24120
     tgtgccaaag ggcgatcccc aaaagaatcg ccagcaagca gcatcccaaa ggtacgagag     24180
     cgagtaaggg gtggccgttc agcgccagga ttgccgacat gggaaccagc caagcggatc     24240
     cgccgacaac gcatccaaac caaccactgc cttgccactg aaactgccga ggcccaacga     24300
     tggctgactt ggcttgcttt tgggtcattc ggaaacactg aaattggcaa cgattgcgtc     24360
     ggattcttgt ttgcagcaaa cgtgatttga ccggtttggt cgtgggctct cgtcgttgca     24420
     atctcttcag catacgtgct gcgggaaccg cactcaacga tcgaagctgc actcagcttc     24480
     ggaattcggt ggaaccgtcg aaaggtattg gttccccgag ggacgttcga tttccgagtt     24540
     gatcctggaa aacgcgacgc ctttcacgct ttgattcgtg cttcggaccg atcgtatgag     24600
     ttcagcaggt cgtcgacttt gctgccgaaa tgaatgtaac ttgctgacga agtttcgttg     24660
     attgaaatac tagggagcga atcgagcaat gcatccgttg tggtggaaaa ctggatctga     24720
     acaccgtcca aggtcgcaac gattttgtcc ttcgttaccg tggtcaagtt catggcggca     24780
     gtgtcgtgac ccgtttggta ggccaggata ttttccaagc gaccctgagg cacgtagtga     24840
     atggttagtg ccgtgccgtc gatatcccat tcaaagtatt gaacgggaag agcaggggat     24900
     tgtgggtcac gggatcgacc ggagccatca gcccgaaatt aaaacgtagc gccggtgtca     24960
     gaaaaccaag tagcagttgg caacgatgca aaattgggtg gcaccgttga ggacgaagtg     25020
     ggtcttctgc ggtccgtttg atgcaacgca tagaaaataa aagttactaa taacacagag     25080
     atgattgcga tgacttttcg gcgacgcgat atagcgagtc cgaaaggatg acggcttgga     25140
     ctggagtcgg acaacgtcat tctcgtgttt ggcacaaatg tagaggatga atttttacgc     25200
     tcacgcactc gcttgcttcg gcaggtacgt gcttcgttgc acctacaacc gtttcaagct     25260
     gcacaaccga aaaacagcct gtcgccgcga agtatcgaat cataccgcca gctaggattc     25320
     ttggtttctc tcttgagagg ggaaggtagg gttttctagc gagtacgaag aaatggtttg     25380
     agtgaaccca tcagtcgatt gtggttccat attgcgaccc tggccaacgc tagacgattg     25440
     agccactcaa tgacctcatc ttacccgcat agccgacggt attcttgcgt ttcagatttg     25500
     tctgccgccg atgaatcagc ttgcaagaac gcttgtcaaa ttcatcagtc ttgattcgac     25560
     tcactcattg gtaggtgcgc ccaacccttg ccacttcgca gaaccaaaac accagacgga     25620
     acacggaaga cactcaggaa tgtctcattc gaaagcttgg tcgcgtgctg gttgatgcag     25680
     gatggttggc agctttattc gccgatggtg gaccatgggc acaaaacaga tttattgatc     25740
     tcagatggtc cgaactttca tcgtatccag atcaagacgt ttgaaagcaa aggaaaaaat     25800
     caagagatta acaattgttg gtctccgtgc aaaattgact acgtggtctt gattgctcgc     25860
     aatgctaact ggggactgat cacacctgcc ttcaccgaaa aacggcgacg gatcaatcac     25920
     aaagaacact gcaagttcga aaagaacaag caggaattct tgcgtgcgtt ccgtcaggtt     25980
     tgacctcagt attgctgatc cgtggtctcc gcttcacgat gcctgaccgt ggcggtgtgg     26040
     agtgtctcga gagtgtttgc tgcagccggt agggcgatcg attgcttggg atggaagggt     26100
     tgaaccttgt cgacaacgtt ctgtcggagc ttttcccggg cacatcggtc cgacgagcca     26160
     gttcgaattc tctgttcgaa ttcccggttc aagcattcaa tggtcgagaa aggcgggctt     26220
     tcaccggtcg atctgggcac ttgtcaattt cacagcgtgg tttgaaagag cgtgtaatcg     26280
     ctatttgctt tgaagtagaa tcatcgccgc cgagccgttt gccgcgattt ccctgaagga     26340
     tcgagcttaa aacggcacct gatttcgtcg cccaattgac agacccggct cggaaaacag     26400
     agattggcac ccgcaggatg taccagcttg gcttgtggaa accacaacca cggccggtgc     26460
     atttcagacc caccgtcctc caaaaagatt ctcaatcgtg tcgtacaccc gaatattcat     26520
     ctgctccgtt tttgcgttcc tctccggaat tcctttggcc ggaatggctc atgaaggcca     26580
     cgagcacgga gattccgacg cgtcaaagga atcctccgcg gagtttgatc caactgcacc     26640
     gaccaacaag tttcaagtga acggcaaaac gtatcgctgg gaacatcgcc ctgagttggg     26700
     caagcaatcc aaagcgatga tcgacgcggc caaaggtggc ttgcacaaca atgccgatcg     26760
     agatttgttg accggagaaa tcgtgacggc cgttgccaag cacggactcg tgacgcttga     26820
     tcccgagttg aaggaatgga cactcgtcga agggcaggat ccagcgttcg ctgccggcat     26880
     gaacgctcac gggactgatt gttttgtctt ggatggcgaa tcgtactggg cgtttgcttc     26940
     aaccaacacg caagaagtat tcgtgacgaa acgcggagaa gtccttgcaa aactgactca     27000
     gcccaaaggc gatgaattcg acaacccgac cgtcaacgaa tacttcaagt caggtggaag     27060
     attcacgcca tgcgatgttg tctttttgcc ggatgcgaag cgattggttg tcgtcatcgg     27120
     atacgcaccg ggtgactttg cgttgtccgc agagttggtt gacggccagt ggaaatggaa     27180
     tggtccggca tggggcggcc gagaaggcag tggcggcatg ctcaacactg ggcacggcgt     27240
     tcaagttgca accgaaaacg gtaaagagat tgttgagatc gcatcgcgtt ctcacggtcg     27300
     gatttttgcc ttcactccag gtggagctca gcttcgcaca ccgggagcag gaaaggagta     27360
     ctacattcag ttgccaaagg gttcgaatcc ttgcaacatt tcaagcattg gcgacagcat     27420
     gttcctgccg ttgttgaacg cactgccgac gacaaatgga tcagcgcccg tgttggtgat     27480
     ggacaatgga aagccatctg gtgcattggt gcccgcgacc tatgaaacgc tgcagttgat     27540
     gcaacacatg catggtttct gcccggttga aatcgatggc aaactgtacg gcgttgttct     27600
     ttcatggcga cgtgccagcg aaaattcgaa tggccaaccc aacgatgggc aaattgcagt     27660
     ttttgaagct gtccaagagt agaccgagtt ggcatgggct gtgtccgtgc gatccccgct     27720
     gcatgaagtg accgatgtca tgacaaacct tcctttggca ttggtctggt tgctgttttt     27780
     attgttcgcc attcccctcg cgggagtggc gtggaacgct cggcagcaat cgcgtgcggt     27840
     cgcgcaggtc gatctcacgc ccaagacgac ctatgaaggt ccggtcatcg acaacgggga     27900
     cggaacaagg tcgcaaaaga tcactgtttc cgtcgtgacg tcggtttcga catcgcaaac     27960
     ggtgcagttc gggccatttg cggtccaggt tcatgcccga gagtgggccg ccaacgcggt     28020
     gctgatgagc atcgttttgc tggggatcgg cttgattggc ctgctgcatt tcccggacga     28080
     ttcaccgacg accgaatggc caatgagttc agagacaatc agcgcccctt ttgacgattg     28140
     attcggcccc tgatgaagac ggggatcatc cgacgatctt cggtcgatga gcttgttcgt     28200
     tctctcactt cgagcgttta catgcagaga agacattttc tttcgttctc agcgttcgct     28260
     gccgccgcat cggtcacggg atgtgattcg ggcgaggtga cagagcccat cacggcatcg     28320
     gtggagcgtg tggcaacgca ggtcgaggaa gccgtcgatg agacatcgac cgaaaacttg     28380
     gaacgttacc gcgttgcgtt gcgaggctac gaaatcgtgt cggggatgat tggcccgcga     28440
     gtgttcttct tgccatatcc tgggatgcgg attttatccg tggtgattgt ggcgaccacg     28500
     gtctcggcga agttggcggt caagtacatc gacacggagt tgattcaacg acagttcgaa     28560
     gaagagctga cggatcatga acgctcgctg gtcgaggccg atggccacgt ccgattcgaa     28620
     accgaaagcg gcgtctcaga gacggtgatg ctggggccaa gcgagtacgc ctgagttcca     28680
     ttcatcggcc acctgaaatc cactgagccc atcgtcggag ccaattttga aagccccacg     28740
     ccccaccatc actctcgggt tcaatgttct gctgattttg tactcggcgg ggaccgggtt     28800
     catcacgttc gctttttcgg acaaagccca gaacgtaccc atccaaggct tggtgcttac     28860
     atcgttgatc gattttgttc gctacctgat catgatgttc atttccgcat ggttcattcg     28920
     cgaattctgg aatcgattgg tcgcagattt gttctcgatc cgcttcctcg cctatcgtga     28980
     ggccatcacg attgtcgtcc tcttgggttt gttcggcttg tgaacaagcg acgattgatt     29040
     cacaacgggc aaattgactc gatcatgttt gactcggcca agcaggggca ataagatcac     29100
     gtgatcgctt ccctttcgtg accaatggtc gacggagtgc attcggcgaa ctttccagtc     29160
     catttgtttg ttggagaatt cagccatgca cctttccgtt ggtatcttcg aactcgtctt     29220
     gcccgtcgtt cttgggcttg tctcactgct tctgcggtgg cgtcacagca agtatcagca     29280
     aacggcggtg attgcctttg cctgttcctg cggcgcgacc ttgctatcgc ccgcggacct     29340
     tgcgtccacg ttgatcttca ccatcgcatt ctttttgtgt ttccaacttg gtacacgttc     29400
     caagaggccg gtgaagacaa acgagatgaa ggagacggat gtcgaccatt cgcgatcgag     29460
     ctggatcaat ccgtttcgat tcggagtcgt tctggttgtt ttcggatccg cggcgttcgc     29520
     gtttgggcaa attcagcttt ggcagccgcc gtcaggaccg ctgagtcatc aagtattccg     29580
     agcatgggcg gccaactgga tcggaaccat tctgcttgtt ctgtcagcag cgttttgggg     29640
     ctaccatttc gcgagcaggc aaatactgaa tcaaaacgat gcttccgttt gatcgagaga     29700
     gaagcaacgc gaatgtttgg cgagtgggcg ggttgaagtt gcagcaagtt tcgaaagagg     29760
     tgcctcatgc gtttcacatt gacgcaaatt ttgaccaccg tcctcgttgt tgctttggga     29820
     cttgcgctcg tcggtagcca gttccggcat cagcgacgga ttgctgcgct ggaacatgct     29880
     ctctatcaaa cccgcaagga cattgcgatt gccgagtacg gttctgcgag ttgtcagctg     29940
     ctggaatttc acccacattt ttatgacgat ccatcgagct tgcgtttctt gaatcacgaa     30000
     attgctcgtt cgattttgat gcactgggaa cgcgaagcgg caatcgatgc ggccgttgac     30060
     actcctggtc atagcaaggc atttgcaaaa cgggccttgg ggctattgga gtgcacaaca     30120
     ccagacgatt ttgttcgaga gttgcgttcg aggttttcaa tctatcccga tgatgaattg     30180
     gtgtcatggt tctcgcgcag tccaccaggt gacctgctca acttcaaggc gttcttgcgg     30240
     gcggcacttg aactgaatga acctgccggt ggataggctt gtccgtctac caactgacgc     30300
     tactcggaca ggaatggtgg catcggtttc cagcctgtgt tctgcgcaat cgcaggctgg     30360
     aagcctatca gcttgttgat ttagtcgtat accgagtgac aacgattagc cgatgggcgt     30420
     tagccccggt tggcgtctga ctaaccgccg ctaacgcggt tcggctcatt aaatcaacag     30480
     gccgctatgc gatttgtttt ccaatcattc ctgccgacgt gattacattc caagactgtt     30540
     taacgaaatc gacatgagtt catctcctaa tccagacgac tacctcgggc attgcgagga     30600
     cattgatgct ggtcatccgg acatcgttga atgtgcacgc aagttgacgg gggcatcaat     30660
     caaggaaacc gcgaaaaact gttttgagtt tgtgcgtgac tcgatccagc acaccggaga     30720
     tgaacagcgg aacccggtga catgtcgagc gtcggatgtg ctgcggcatg ggatcggata     30780
     ctgctacgcc aagagtcatc tgctttgtgc gttgttacga gccaaccaaa tccctgccgg     30840
     aatgtgttac cagcgattgt cgatcgacgg cgatggcgca ccgttttgct tgcatggatt     30900
     gaacgcggtt catctgccag ggcatggctg gtttcgggtt gacgctcgtg ggaacaaacc     30960
     cggtgtgaac gcccagtttg atccgcccca tgaacagctt gcgtttggaa cggatttgga     31020
     aggcgaacgt gatctcccgg agatttggcc aacgccacat ccggacgtgg tcgaacggct     31080
     gagacggcac gacgattggc ttgagctgtc caacgatttg cccgatgtcg gttgaaggca     31140
     accggcctcc gctaaacggt ataatggaag caccgtcgcg gcgtgttcga ttgtgtcgcg     31200
     acggttgctc ggtgcttgtc ttcatgcctt cttgaaggtg cccgccaagt gatgatgaaa     31260
     ccgaagaggg gctgagccct cctgcgccag ctaagtagcg acgagattgc ggcactgtcc     31320
     tcttccagtg tttggaatca actcgttgag tttcggtcga ttgatttggt gatcgctgga     31380
     gataccctga aaagccacgc cgctttttcg gcggtatgcc acaccgaagt gagctgtctt     31440
     gaaacagacg accgaacgca aattgccaat caccgtcgtc ccatattgcc ttgagagaat     31500
     gacatcatga agtgtttgtt gaatcggatg actcgagctg ccgttgcggc gttctgtgtg     31560
     tgccttgggg tcaattcagt cctcgcgttg gacgacgcgc cgaaggacaa ggaaactgaa     31620
     aaggctgctg aaccgatcaa ggtgcaaggg accttcgagg caactcaaag ttgggagttg     31680
     attcacgggt tggatcagtt tggtgaactc gagatcaaaa agatcttgcc tcacggaacc     31740
     gaaatcaaag aaggccagac ggtcatttgg tttgacacgg aatccatcga caaaaaactt     31800
     tcggacgccg agaacgatat tcgcttggcg aggattgacg cggctgatga acagttcgcg     31860
     tttgaccaat tcgttgcttc tcaagagctc gatcgccaag atgcggagcg tgcacgtcag     31920
     tccgccaagc agacttacga caactatctg caagttgatc gggatcggaa aatcaagagt     31980
     gctgagtttg acctcgaaat gtccaaagcc tcgttggaga acgccgcgga ggaattgaag     32040
     caacttcaac aaatgtacga cgctgatgat ttgacggaag agtccgaaga gatcgtgctc     32100
     aagcgtgcca agcgagcggt tgagtccgct cagtttcgat tggaaagcac ggagatccga     32160
     tccaaacgaa ccttggagca atccattcct gccgaggatg ctcaaacgga agcgacgtgg     32220
     gaacgagctc aaatgacata cgagaaaacc attcggaacc tcgacagtgc caaaaagaaa     32280
     cgcgaccttg aacgccggaa ggcggccaaa gcattggccg aaaaagaatc tgatttcgaa     32340
     gagcttcgcc aacagcgaaa ggcgattgtc atcaaatcgc ccggcaacgg catcctgctt     32400
     tacggagaac tcaatcgtgg tgctctcaac gccaaaccaa gtcccatcga ggcggggtcg     32460
     aaagtttcga ctaaacaggt catcgctacc gtcgtccagc caaaaaagat gcgagtttgt     32520
     ttgactttga gcgaggcaga tttggttggt atcaagaccg gcgactcatg cgtgatcaaa     32580
     ccagcgatcg accccaaagc tgaagtgaaa ggcgtcattg attcggttgc gaccgtgcca     32640
     tttatgggaa ccaagtttga tgccaccgtg aaggtcgttg ggcaattgcc cgaagcggtg     32700
     aagcccacca tgacggcgtc cattgagttg acgaagtgat cgtagtcatc ctcgggaaaa     32760
     tgcaatgaat attaagcaag ccgatcaccc attcgggacg actttgagca ctccgattgt     32820
     ccgaagtttc tccgcttgct gcgtgtggat gatggctatt tgtccgctga tactgagcgg     32880
     agcatcctat gcggaagagc tcacggcggt ggagcacttc gatgtgactc gcaccccggt     32940
     gccacccgag attgacgcgc ccaccgaatc ggagatccgc gacgcgatcg tgcgtggggt     33000
     ccagttcatg ctcgatgatc agaactcgaa cggttcttgg ggttcaccaa cgcggaccaa     33060
     agggttgaac atctacgctc cggttcctgg agcacaccat gcgtttcgcg ccgcgaccac     33120
     gtcgctagga atcgctggat tgattgacac tctagagcac ctaccagcgg atgcgtccga     33180
     acaaggattg cgaactcaag tccgcgaatc ggtcgaacga gcggaaacgt ggttgttccg     33240
     cgaattaccg aaactgcgac gcgccgatgg ctcggccatg tacaacgttt gggggcacgg     33300
     ttactcgatc caggccctgg tgcgattgca tgactggcac aaggacgacg cggatcgcca     33360
     agccagcatc gtcagcctga tccaggatca attcgaaatg ctgcagcgtt acgaatcggt     33420
     cgacggtggc tggggctact acgattttcg ctaccaagct gaccagccaa catcatcgtc     33480
     gaccagcttt gtcaacggag cggtgttggt ggcactgaag gaagccgact cactcggtgt     33540
     caccccacca aaacggatgg tggatcgggc ggtggccgcg ctggggcgac aacagaaacc     33600
     ggacttcagc tatttgtata gcgaaaacct gcaataccaa ccgatgcgcg agatcaatcg     33660
     cccgggtggg agtctgggcc ggtcccagtg ttgcaatgtg gcgatgcgag tctggggtga     33720
     ttctaaaatc accgatgatg tcgtgaaggt ctggctttgt cgactctatc tgcgcaacgg     33780
     ctggctcgac attggacgca agcgaccggt gcctcacgaa gcctggatgc aggtggctgg     33840
     gtacttctac ttctttggcc actactacgc cgcagtggga atggatttgt tgcccgaaga     33900
     agaacgtgct ccgtaccaat cgatgctggc caagctgatg ctggatcgcc aagagacgga     33960
     tggttcatgg tgggactacc cgctgtacga ttaccatcaa ccttacggca ccggatttgt     34020
     tctgatgaca ttggatgctt gtatgccgtg aacgcgaaaa cgctgaagcg ttcgaccggt     34080
     tgagtgcggg aaccgtggct aacgccaagc ggctcagata cccgacgacc cttgagtacc     34140
     agttggatct gaaaggctgg agcggccgtc ggcattctcg cgcatcaggc tgtgataaga     34200
     tggtcggccc gttctgacac gggcctgcct gaacctccac cgcgaatgcc gccatgaaga     34260
     gaatgctgtc cgggatcctg tttgcgatcc ttcttgttgc ttttgtctca tacgccaaac     34320
     cacccatccc gacgccgcga gaaactccgg tcgtgggcga catggaccac ttctttctcg     34380
     agtccatgta tgggttgaag gagaacgatg agagtttgag ccgcgtggtg agctctccgg     34440
     aattccggga actgattcag aagcacgatt tgaagctttt gggcgggccg atgctgggat     34500
     gcgtcaccga tcatagcgct cgcatttggg ttcgaacgac agaagccgcc agcgtgcaag     34560
     ttgtgatgga cggcaaagca agcgaggtcg tcacaacatc gccgcagatg gacttcaccg     34620
     cattgttgga tctggaagga ttgcagtccg ccacggatta cacctacgac gtcttggtcg     34680
     atgggcaaag cgttttccgc gatcagaagc caacgttcca gacttaccca tccaaagatg     34740
     agaaatcgac gttcagcgtc gcgtttggcg gtggtgcccg ttacaacccg ccgaaggaaa     34800
     agatctggga cgtgatcgcg gggcgttcac cggaagcgat tctgttgctc ggcgataacg     34860
     tttacatcga tcaacccaaa tcacgaacga aacagcgagt tcactactac cgcagacaat     34920
     tgcgacccga gtttcggcga ctgaccgcgt caacctcggt gtacgcggtc tacgacgatc     34980
     acgatctagg tgtggatgat tcatccggtg gtcctggtcg tttcaagccc acttggaagt     35040
     tcgaatcgtg gaaggttttt cgcgaaaatt ggaacaaccc tgcgtatgga ggcggcgatg     35100
     agcttccggg gtgttggttt gatttctcga tcggcgatgt cgacttcttc atgctcgaca     35160
     accgttacta tcgatcgttc gaggatggga cgatgttggg gcccgaacaa aaagaatggt     35220
     tgctggccaa gctgaaagcg tccgatgcga cgttcaaggt ccttgcctca gggacgctgt     35280
     ggaccgaaca cgctgacaaa gcaggtcggg attcgtggtg gggcgtgaaa gaagaacgca     35340
     acgagatctt cgacttcatc gaaacagaaa acatcggcgg cgtgattctg ctgtccgccg     35400
     atcggcaccg caccgatgtg tacaagatcg aacgtccaaa cagctacgac ttgttcgagt     35460
     ttgaaacatc aaagatgacc aacgatcaca cccatccgac caagaaggaa gccgtcttct     35520
     cttacaacga agggaacttc ttcgggatgc tgaagtttga cttggagaag accgatcctg     35580
     aaatgacgtt tgagtgcatc acaatggaag accagaaggt ctatgagttg acgttgaaac     35640
     gaagccagct gcaggcggcg gagtgaccgg aaggaacgtc gccgatgaat tgccacgatt     35700
     gatgcttctg tcgggcctag ccgcagacga gaggatcttt gtcgcgcaga agttggcgtt     35760
     tccacaacta agcgttccgc agtggctcgc tccatttaag aacgaaccac tggatgatta     35820
     tgcaaagcgt cttgcttctg aaatcggccc tgggccctgt gtgattggcg gtgcttcatt     35880
     cggagggatc gtcgcgatgc atttggcgcg tcatctgaac ccggaagcgg tgattttgat     35940
     tggtagtgta cgctcgccat ccgaactgcc gatgtacgcc aggctggcca gaccgctgcg     36000
     atgtctgacc ttatggttgc cggttcggga aatgcagtgg gcaatgaagc ctttgctttg     36060
     tggtccgctc cgaacggcga tgccattcgt gcatgggttg ctgagccaat ttttgcaaag     36120
     cgaccccgcg gtatttcgat ggtcgctcca tcaaattcta aactggaaat cagcaccagc     36180
     gtgttctttc ccgatctacc atatccatgg tgcacgggat tgggtgatgc cggcaaagaa     36240
     tacactgcca gacaaaattg tccctggtgc gggacacgtg ttgtcattga ctcatccaca     36300
     agaagtgaac gaattcattc gcttcgtgat gaagcgagtg aagctttcgt gcaatccatc     36360
     cagtcattga aaaacgttat tgcgtgagtt gtctgtcact tactgaccgg tctgaccttg     36420
     ccacacggac acttcgtcga tccagccatc gaagttgcgt cccgtgcctt ctcgatgacc     36480
     gccgatgaca agacctccga actctgacgc ggggccggag acgggcaacg tgtgcttcgc     36540
     gatttgctgt tcattgagag acagtttgag tgtctttgaa tcaaacgtca gcgtgatttg     36600
     attccagcga cccagtaagc tctcgcgggc aaccaacgaa tcgaaaccgc cctgcgactt     36660
     cgcctcggga gccgcctctg gttgcttggc gggttgaagc gtatgagtgt agagttgcag     36720
     gttgatctgg tccggtgatt ccgacgatct cattcctagt gaaaggtgcc aggcggtttt     36780
     tgcggagact tctccctccg cagtgctttc aaagagaaag tgtcgctccg aagtgccatg     36840
     cttcggaagg ctcgtcggtt tgaaccaaag tgaaacagtg tgatgaggcg aattgtcatc     36900
     caggaaactt cgcggaatac ggatgtactg ttgtttggat cgatcgagtc tcaacgctcc     36960
     accagacaga ccgttgttgt cgatgcgggc accattctcc gcgaccgcgt caatgcgatg     37020
     gccgagagtt gaatcatttt tcatgttttc atcaaacgac cagtgtgctc gccgattggg     37080
     atgcttctct tcgtttgccg tcaaagatgt gaggggcagc tcaactttgc gattcacaat     37140
     tccgtctggt tgacggaatt cggcggtgag caatggctcg tcggtggtgc cgtccgctgt     37200
     gagcgtcaaa aattgccaac cttccaccag cgaccattcc aaggatggat gaaagacatc     37260
     cagttcagta atggtgcgtt tgtgacctgg cgagataaca aagtcgttca agtcgtaccc     37320
     agtccgctga ggatgaatca gatgccgtgc aacgtggata tcaccgccca gtagaacgac     37380
     tccactgatg ttctcgtttc ggatgatgtc caggagagcg tcacgttcat accaatacgt     37440
     gaacatgtca tcggtttctt tgtttttctt gtcttcccaa atggcgccaa acgccagcac     37500
     cttgaacggg gctttcgagt ctcgcaattc ggtgagcagc caggtccatt gctccgatcc     37560
     aaaacaagtt ggctgggacg catcgacggg agagggttcg gtttgcgaaa agtatcgcgg     37620
     gtcgaggaag aacacttcca tcatgcccag gtccgatttg tggtaaacgc cttccgttgc     37680
     gttgccgtat tgtgaatggg cccggtagtt gacgaatccg cgacgcgtgt ccgcttttcc     37740
     tttcgacaaa ttgcgtccat tcccgttgtt tcgaccgaag tcgtgatcat cccaagtgcc     37800
     aacggtggag gtgttgccag acagttccgc caggtctgac atttgcaaaa attgccgatg     37860
     ccgtgacctg accttcgcta gatcggtgct gtcgatatac ggcgtgtcgc ccatcaggca     37920
     aaccatgtcg aggtccagag tttgcatctc tttccaaatg ccattgggct cgatgtccac     37980
     gcacgaaacg aatccgaccg aaacacggtg cccttcacgc ttcgggttag tagtccgaaa     38040
     aaagtgctgc ccgtctggtt tgatcaaagt cgcttgcgtg tccgcgtcgt cgatctggta     38100
     gtggtagaca gtgtccggct gaagattcgt gacggaaaac ttcgccacgt agtcatcttg     38160
     ttctccgccg atcgacgtaa ttcgctggac aacatctcct tcctgaagaa ccgagagttg     38220
     cagtggttgc tcggatgcac cggctcggta gagcaattgt gcggaggtgc tatcgattga     38280
     gcccaccagt gggcctacca cgtcgttggc gtgagatgcg gtcggcaccg caatcatcaa     38340
     aagcatgcac gaaaagcaaa ggacgattgg acaaattctg tgagggggca tgatgtattg     38400
     tgaaagtcgc gtcagttgaa ttgcggggtg gaaggccaag gtgtcaagct gaatcaaaac     38460
     agttgttcgc tacggagtgg taagtggtgc cggtgatttc ggtttcgcac cgccactgcc     38520
     tggcagttgc agttcatggc gaacccagcg aacaccctcg atgttttcat tcaatgattc     38580
     tttggcatcc aattccgatc ggtggtcgag aataccaatg gggccctggc aatcgctttc     38640
     catgacgact cgaatcatgt ccacttcatg ctgccctttg ccgatgccca ggatcttcgg     38700
     attggcgttg tccaccatcc cgttcatatt cagacagtgc agaaatggtc gcatcgaatt     38760
     gaacgattgc ttccagttgt caatgtgatc gtggccatga tgaaagttgt aggtgatgcc     38820
     aacgtgatca aacccttgct cacgaagcaa acggcacatt gagaccaagt tctctggttc     38880
     acccgcccaa cctccgtggt tgtacagaga tagcttgcag cccaatcgct gggtttctct     38940
     cgcggcagga accatttgct gaacggtttg ttggactctc cgctcctggg tcccattttt     39000
     gatgttgggc ggcatcatcc aaatttgcgg atgcagatcg tgcttttcaa acagtcggta     39060
     cgcttccgga tggccgcccc aaaaggcgaa gaactcgatg ccgtgctccc ggtattccag     39120
     gatctcttgt tcgaaggttg ggacatgttc agctcgccag tcgtaagcac aacgacggat     39180
     gcccaaatcg agaagcattt gagcacgctc ggccggagtc cgcttggcgg cgtcaaaggg     39240
     tactatgcac caagccacca aattctcttg tcgcaggatg ctggtcgtgg cggcatcgtc     39300
     cgagtgagga gactgggcca gcacagaggc gggctgcccc atgaataatg gcaagccaat     39360
     gaacaacagc aaagctgata gacggaacaa agcgaacatg gcgagtgctt caggtgggag     39420
     gtgatcaacg caattcagca ctgaacacgc gagcgatggg cgggatggat ccactataga     39480
     agctgtctcg ccgtttgtcc tgactgtcag cagtcgttgg cattagaagc agccattaag     39540
     aatttgatgt gaagagaaga tgtgtttatc tggctcttta gcaaggcgtc accagtcgct     39600
     cgccatatca gctgttctat cgatcgcagt caacctcatc gcaacttcgc gtgaagtgaa     39660
     ttccgagcag aacctttcgg ggatcgccat cggctttgaa ggtcgcaagc aggagatagg     39720
     ggaagctgaa catgcctcca aggaacacgc tcaggaatgc gtagtagtgt cctttggcag     39780
     tgaagccttc acgccaagtg atccaagtgg cacccagcaa aaggtagatg agaaagtcgg     39840
     tgtcaaactg cgaccgccag ttgaacgcta tcaaatcgtt ggtcgcaacg cttggccaat     39900
     tgattccatc agaaagcgaa gcaatcaacg tcattgaata aatcaacacg gttgagaaca     39960
     acaaaaaaac tcgcaggaaa ttcatgcagg atgcttcggt tggcggctgg tggaagactt     40020
     ttgtgaaacg ccctggacgg cgcgtgcgag atcgaaacgc aggagggtgt gcgatgccag     40080
     tctggggcac aaagcgagaa gggtagacga gtgcccgatc gcaaaagcca tgttaagcag     40140
     gtaggcaggt gtcatcgggt atgtgagccg tttggcgtta gccacggttc caacgcaaaa     40200
     ccggggctaa cgcccaaacg gctcacatgg tgaaacccaa tcattcctgc gtacctgctt     40260
     agacaattgg cgaactacgt atctcgcttt gattccgaag gcgtgaacgc agcgccacat     40320
     ttcatgcaat tgaaaatcgt ggtgttgaca gttcggatct tttgcccgca cttcgggcag     40380
     acaagttttt gcatgctgaa gaatagcgac gcaagaaaca acgtggggcc aatggcgaat     40440
     gcgagcagta gattacccgt gctgatgccg tatccagaaa caggcagcca gaccaaccaa     40500
     ccgctgtacc agaggagtcg ccgcggccat aacgatacgc tgcgcgtcga ctttggcatg     40560
     cggtggacca ctcgacggaa ggttgtagca gcacggccct caacgaagcg aacgatgctt     40620
     gaattaaggg agattgtacc gatgccagcc tgcgtgacga acgatggaag gtttgccgaa     40680
     agcgtagcga aaaactacat tgaacgacat tggatcgcca gaaatctatc caccagagaa     40740
     tcgctctacg caccatcgca gcagcagaac ggattgcaac aacaacaaga cgagcgacgt     40800
     tgcaaatggc agcatgaacg gaatgcccat gcagatgctg ccctcgggaa caaaaagcca     40860
     actgtacaca accatgaagg ccaacatggc caagaatgcg gcccaccacg caacggtgaa     40920
     gtgcaggaac caaggcgcgg cgacaccaaa cgcaatcaac aaccagtgaa gagtcgaaac     40980
     ccagagcgga tcacgatcgt catgttcgtt agcggttgcc attgcggaaa gacttcgtcg     41040
     gccaacggaa agatttttac gacatcgccc caattgaagc gaaggaattt cgtccatgct     41100
     tcggggcctg tgctatcggc ttgattctag ccgacggggg tgagctgtgc aggaaccagt     41160
     cgggcgcggg gtaaaggcgt tcgatcggtg tgttgcagct gatcagactc gctcaagcta     41220
     ctcactcgac gcgagtgcct cttctcgaga tcaatcctcg attggttcca gcaattccaa     41280
     gccgaaccgt ttccctttgt cgacgcctgg aacaccaaca gccatccact cgggctcggg     41340
     ggcatcttgg agatagtggt cgaagaactg ctgcatccgt atcgtaaagt ctcggcggtt     41400
     gtggtccccc atgacccagt gcggatcgcc gttgtaattc agcatccagg ctggtttctc     41460
     gagacgtcga agcgccacaa aaagttcgat cccttgatac cacgggaccg ccccatcttc     41520
     gtcgttgtgc agaatcaata gcggcgtgtt gattttgtca gcgaagaaca gtggcgaatt     41580
     ggcgatgtat ttctcgcgag cggaccaaag gtcttctcca atccggcttt gagttctttc     41640
     gtattggaac atgcgactca tcccgctgct ccaacgtatg ccaccgtatg cgctggtcat     41700
     gttgctcacc ggagctccgg cttcggcaca cgcgaagcga tcggtttgtg tgaccaaata     41760
     gactgtttgg tacccgcccc agctgtgacc ctgcattcca atccgatctt catcgacaaa     41820
     gccctgagca accaaatggt ccacgcccgg aagaattgaa ttggccgcgc tttgtcctgg     41880
     ctttccggtt ttgtacggaa tgtcagggat gaacacgaga taaccacggc tgacgtagaa     41940
     gctgaagcag atgatcgatc gacccgcagc aggtgggtag tgactatgca ggctgtctga     42000
     tttgcgttcg tagaagtaaa cgatcatcgg gtattgcttg gatgggtcga atccatccgg     42060
     cttcatcaag atcccgtcca gctcttgccc gtcttgcgct ttccagtgtg tgagttcggc     42120
     ggtgccccaa gagacctctt cctgttgcgg attcgcatcg ctgacacgct ggatcttttc     42180
     gaaaccaatc gtgcttgtcc aaagatccgg gaagcgtctg aacgtactgc ggatgaacac     42240
     gacttggtcg ctgtcttcgg ccttgttcaa tcccgaaaga ttctcatcca gcatgatcaa     42300
     tggacgcagg atgttttctt ccgcgtcgtc tttgttgctc ggtggatcaa gagcgtaaaa     42360
     cccactggcc tttgtgtctc gtcgaaatgc actcaggatc attgtctcgg aacggtcgat     42420
     gaaccgtcgc tcggaatcga gacgcaggta acggaaccgc acgtcgttct tacggccttc     42480
     tcccagcgtg acacaaatcg gtttcgtttt gcccgttgga tccagttgcc aaatgtcatg     42540
     cgagtcatag accaagaacg cttgatcgtt gtccagccag cccgcggttc cgtacgcgga     42600
     tggcaacgtc gggcgatcgt ctagttcgtc gtagagcgga tgcttgatgc ccttgctgat     42660
     ctcgatggtc tcggtgttct ttcccttggt cgctttcgcg aaccatttgc cgttttccgc     42720
     atcaaaccaa acaatgtgtt ttccttgagg cgaaatggct gcattccaac ggaccttttc     42780
     cagcacacgc tcgcggtgtc cggaattgag gttgacgagg tagacgtcct ggaatccggg     42840
     gacttcccag gagagtgttt tgcgataggg gacgttggtg ttgccgaccg caatgttgga     42900
     aggtgatcga aggtcgatac gaagcgatgg gatttcactg tcttccaatt gaacgacgcg     42960
     attcgttttc aagatgaaag ccgcacggta gcgccgcttg cgttctcgtt cggcctcgag     43020
     aagttgttgc ggttggagtt gagggtcttg ccagtgccat atatccagtt tcgcgtgatc     43080
     gttggattcg tcttctagct ctcggccttc cgctttggca agacgttgtt tttggacctc     43140
     atcaggaacg ggtgctgttt cgaaatacag tcgacgccca tcttccgaga agctttggtt     43200
     ggattgtgga gacagccacc aaccggtcgg aagtcccggg tcgccttcgc tgacgagacg     43260
     attcgccttt ttcgaattcg ccttccattg atagagtgcc caagagggtg attcggaatc     43320
     gtagtcatct cggttgccaa tgaaggctag ctgagaacca tcttcgctga aggtcaggtt     43380
     cttgtattcg ccgattccgc tgatgatcgt tcgcagtcga agcgaatcga gttcgattgt     43440
     gtggacacca tcaaccggac cgcgctcttt gtcgtcctgt tgtttatctg acgttccttt     43500
     gccttcttgc gatggggagg acttgtttgg ctcgagtgct tcgaccgaag tcacaaaggc     43560
     gagccgttca ccgcgttttg agaattgaaa ggaccgcacg aacgggaacg tacgcagcac     43620
     ctcggtatca aggtgaatga gcttcaaggc tgtgcctgtt gatttctctt tcggctcgtg     43680
     atcttggttg tcgtcttcgt ccgccttctc tttggttggc tggctctttt gggcttcttt     43740
     tgagtttttg ctttggacca gcgattcgat tcgtccgcgt tggcgattga tctcttcacg     43800
     acttttcagc ttcagctttt tggtcggccg ttgcagtccc ccgggcgtga cttcgtagac     43860
     ttcgcgatca tcactctcgg ttttcttcat ttcgttgtca tcggttgatt tttccatcag     43920
     acacgccacc caatcgctgt tctcttccgg tattccgaat gaacgcacgc cctgcagtgt     43980
     taggaattcc ccggaatcca gttccaggat ttgcaatgac gtctgaggca tctcgtcagc     44040
     agctgtcttt tgctctcgaa gctttttgat tttcttcttt tccggcggca cgcgatatat     44100
     cacgaagcgg ctgtcgtggg tgaagcgagc accggtccca cgctccacga tgtactcgcg     44160
     agcagtttct gcgtgttgaa tgtgcagcgt gccttcgccg tcaatctcgc cactttggac     44220
     ggtgtagatg atccagtttc cgttgttgga aatgccggtg ccggtcagtg tgttccaatg     44280
     gtcgtagtcg ctatgttcca gcactcgccg tgtgatgtct tgcgaatgaa gactgctgca     44340
     aacagcaagg aagacgacgg cgaacagtga tgcctggggg ccaatgcgac gtccaagatc     44400
     aaaaacagaa agcatagaag ggtcccagga agcaaggtaa accgagcgtt caaggatagt     44460
     cgcggttttg gaagatggaa acttcggttc gtcgttgtgg gggtgtccga tcgacgcacc     44520
     aattcagaat tctgtgtcag cttgacagcc aacccatcgg gaacagcggt gaacgtgccg     44580
     acggtagcgg tttcgaagga gctcatcgtt ggcacagtgc aacgtttgac ggatcgagag     44640
     aggtcgaaag gttttttgaa cggttgtttg aaagcgtgtg ttgaatcaaa gtggcgttct     44700
     ctcaatttga atcttttgtc caatttcgga tccgatggtt gaacggatgg accatatgaa     44760
     tgccgccgga ccttgtacga gatggttgct cgccattgtt tggatgatgt gcgccgcgaa     44820
     ttgcggtttg gcacagcacc gggtgttcgt caccagcgat cgactgacgc tcggcacgga     44880
     acgacttcgg tcagcgtcgg ttcgaatagg ggacatcgat cgcgatggtg atcttgatgt     44940
     ggtggtcgcg aacggtcgcc attggccgca acagaatgaa ttggtgatca atcagggtcg     45000
     ggcgaaattt tcgatcattc gttggcttgg ggaggaccaa cgaactagct acgcctgcga     45060
     gttcgctgat ttcgacggtg atggtgactt ggatatcgcc tcgggaaatg acatggcgaa     45120
     gggccaggtt ttcttgaacg atgggagcgg ccaattccgt ttgcatggcg agtatggtga     45180
     cgtctcgagt cttcgtagtt tgctagctca tgacatcgac caggacggcg atattgactt     45240
     gattgcgacg tgccgcggac gccccaatcg tatctatgtc aatgacggcg aagctaactt     45300
     caactctggg ccatcgtttg gtcgcaacac ggattcaacg atcgatgtcg cggcggggga     45360
     tctcaatggc gatggacaca tggacctcgt tcttgccaat cgcgatcatc aacccaatga     45420
     aattcttttg ggggatgcag aactgcagtt ttcccgcagt gtgccatttg gaatcggtga     45480
     tgagcagtcg cgggctgttg cggtcgccga tttgaacact gacggccact tggattgggt     45540
     ggtggctaat atcggtcgag ccaaccaagt cttctttggg gacggtgcgg gtggtgttgc     45600
     tggatcggca gagttcggtg ccagcgatag tcaaacgtat gcactggtga ttgcagacat     45660
     gaacaatgac gaagtgctgg atatcgttgt cgggaatttg aaccaacccg gatcggtatt     45720
     ctttcgccgc gaacatgaaa tgaacttcga cgaggttccg tttggtgaag cgtcggcctc     45780
     gtatgggctc gacgtcggcg acctcgatgg cgacggctat gttgatatcg ttgttgccaa     45840
     ctcagatgac atgaaccgca tttttcttaa tcggccgagc caatgatgaa tcgattgcaa     45900
     tggacatcac ccgcgcgttt tgtgactgtg ttttggatcg cgttcattcc agcgatggac     45960
     gcatctgcgc agtcgacgac tgattggccg tccttccgtg ggccgggcaa ccggggcgtt     46020
     gcggcggggg catcgattct gaccgaatgg aatgcccatc ctgaagccga gcaaacggac     46080
     ggcgttgcgt gggcgaccga cgtgccagga ttgggacatt ccagtcccgt tgtctcgggc     46140
     gatcgagtgt tcttgctcac cgcggttccg gacgatggcg agacagaatt gaacattgct     46200
     gcgggcggga acatcgacgc cgcgaaagac agtggagcgt acagctggat cgtgctgtgt     46260
     tacgacaaaa cgaccggcaa ggaactgtgg cagcacactg ctcatcatgg cgaaccaaag     46320
     gcgacgcggc atagcaaagc gactcatgcc aatagcagtg tctgcgtcag cggcgatcga     46380
     gtggttgcgt gttttggttc ggaaggtttg tactgctacg atctcgatgg caatcagatt     46440
     tgggagcgtg atttgggtgt cgtggacgtc agcaagtatg ggatcggatg gggctatgca     46500
     agttcgcctg cgattcatgg cgatcgcgtg gcagtgatct gtgacgatcc ggaccatccg     46560
     ttcgtgacag tgcttcagct atccgatggc gaagaaatct ggcgttcgga tcggaccgag     46620
     gtttgcgagc gaagttgggg atcacctttg atccatgaag ctgacggtgt gacgcagatg     46680
     gtcatcaatg gttggccgtg gatcgtttcg tatgactttg gtacgggaga agagttgtgg     46740
     cgtcttgagg gaggcggtga caacccgata ccgactccat tcgtttctaa cggttggatc     46800
     tacatcacca acgctcacgg aggcaaagct ccgatttatg tgattgagcc tgatgctcgc     46860
     ggtacgctgt cgttggattc cgaagaagag tccagtgcaa tcgtctggag cgttgaacga     46920
     ggtgggtcgt acatgtcaac gccggttgtt gctggggact atctgtacct tggcaactcc     46980
     aacggagtgg tgcggtgttt ccatgcggag accggggaga aagcgtttca agaacgactc     47040
     ggaaaagagg cgggcgtgat cgcgtcgctc gtgacggctg atggcaacgt gtactgcgca     47100
     tcagaaaacg gaaccgtcta cgtcttgaaa tcggggccgg aattggatgt cgtggcggaa     47160
     aacccgatgg gggaaccttg ctttgcgacg ccagcgatct cgggcgataa actgtttatt     47220
     cgcacgacca agcgattggt tgcgatcgga acgacagagt gaatcgactt tgttgcgatc     47280
     atgaatcaga gcgtgggtga cgttctggtt tcgcaaacct tccagagcga aacgcgttga     47340
     gaaatcattc gggttgaatg gacaccgttt cggtcggccc tgacaaagaa tgaatctgat     47400
     gaatcgttcc atcgtgactt tcgacaacaa agactgatcc aatctttgct cggatcgttc     47460
     gtttgtcgcc agcttgcagt cgccttgatc ttcctcgtcg cccggccgac gtgatcggat     47520
     gcactttgac cagcccctcg gtgtggtttt cgaacgaaat tgttcccgat gccccatcgg     47580
     attgtggttt ggaatgaacc gtaggtgtca tcacgaggct ctttcgcgga tgagtctcga     47640
     gcaacaacga ggtcagctcg tcaatgactt tcggttcggt tgagtcgacg atgctttcgt     47700
     tttcggaatc gtcgtttcga tgatcgtaga gctctttggc ggccacttca ccactgaaaa     47760
     agtctcgcca ttcgaccaag cggtagtcgc tcgttcgaat cgagtatccc atgtattgcc     47820
     ggccttcgtg tcggcggtag tactggttga ccgcgccgtc gtgaaccttt gcatcaacat     47880
     cgttcaggat cggaaccaaa ctcgatccgt cgacgaaatc aggaacatcg attcccgcca     47940
     tttcgcaaag cgttggaaag agatcgagta gttcggcgag ttggtccgtt tgctggccga     48000
     ggcatttcac gcctgggccg gtgatcagca aaggcacgtg ggcatcgatt tcatagttgg     48060
     tcattttgcc ccaacctcga tgttccccga gtttccaacc gtggtcgctc cagagaacca     48120
     cgatggtgtt gtcggccaat ccttcttcct tcaaagcgga cagcaacctg ccgatttgtg     48180
     cgtcgatgta gctgacgcag gcgtagtagg catgcatcag gtgacgtgca tcttcggtcg     48240
     ggaccgtgtc gtcatcccaa ggctttggca gattcatgcg gtcgacatag tgagtcatct     48300
     cgctgttgtt gtgcatcgca tagggcggcg agttttttgg aatctgctcg cccgttcgca     48360
     cgggtaactt ggatgggtca tgcatgtccc agtatttctt gggggcgacc caggccaggt     48420
     gcggccgaat gtatcccatc gctaagaaga atggagcgtc gctttttcca agtcggcgaa     48480
     ggtcctcgat cgccatgttc gtgcgagcac catcgagtag ttggtcatcg gccaactcgg     48540
     gcgcggcggt gctgggcccg cgaaggttgt tcttgcgcca atcgcgatcg ggcaattcgt     48600
     tgtcgaactt cttcatttgt tcccgcgtgc catcgggata gaaggcgggc agtcgtggaa     48660
     ggtcccgaat cggctcgctc catgattgcg gatcgggcgt ggggttgtga taaatctttc     48720
     cgtgactgac ggcggtgtag ccgtaccggc ggaaccattg cgggattgtc accgcctcag     48780
     gcatggcctc gcgaaagtgg ataggcaagg tccatacggc aaggttgtcg ggtcgaagtc     48840
     ccgtcatcaa actcgcccgc gatgggttgc agaccgcgac ttgacagtag gctcgattga     48900
     actgaaccga ccgggatgcc aagcgatcga tgttcggcgt gatcgcttgc gggtcgccat     48960
     agcaaccaat cgagggacgc agatcatcca cagcaatgaa cagcacattg gggcgttgct     49020
     cggaccagca ttcgatcggg aagctcgccg caatcatgaa cgaaaggatc gctgagacgt     49080
     gaagtcgctt catgacagag gtcgcgggca atgagggtga gcggagcgtc gaccttgcat     49140
     gccacgtaag tcaacgctga atcaagcggt gtatgtgaac cagattacct caatgtttgc     49200
     catggattgg cgttggccat tgcgctaaag gccgttgagg gaatgagagc gtcggaagcg     49260
     gccatggcca gcgtttgggg cgtatgactt tccgctagaa cgctgttgtt gttgggccaa     49320
     ggacacgttt actgactgag aacgcgttcg gtgttcatcg aggtcgattg cgtcaatgcg     49380
     tgtgagggat ccgcggcagg tgctttcaca tcggaagtga tgcggaacca gcggtgttcg     49440
     ctcgatcgaa gcagcagcaa gtagaccagc gagaagaggt aaaagccggc gaagtttccg     49500
     gtgacaatca gtgctcgttc atcggcgttg ttttcctcca cgtccatgat gaacaagacg     49560
     acaaaaggca gggccaagaa cagtgggagc aatccataaa tccaggccca ttggcgtccc     49620
     agcaacgtga gtgcaagcaa cgtccacgac gctgcgatgc cgagaaccat cgtgacggtc     49680
     gctccaaaaa gactcagcca aacgctggcg attttaaaca gcacgtttcc ggcggcgatc     49740
     gtcaccgcaa ttcccagaat ttgtcggatg ttgcgttgtc cggttggcgg tgtcgggccg     49800
     cggtggattg ggcgtcggaa ccattgccaa atcaaaaacg gccccaagca cgatatgcta     49860
     gccaacagaa agagttgtgc ggcgaacgat ggcatggatt gcaatgcgaa gaccatcgcg     49920
     atcgcattga ggagcaggaa gcacccggtc aacattcgcc aacgctgcac ctgttgtctt     49980
     gcatctgctt ccgtttcgac atggatcagt gcggtccagg tccccatcgc tgtccaggtt     50040
     gcggcgagtc caccaaaagt gcatgcgaac aaaaactggc tttcatccga catggattcg     50100
     gggtcgccca gtccagcgaa cccaaccaac gaaattgaca gaaagatgga ccagacgaaa     50160
     aaccagctca acaagacccc atcgacttga tccctttcaa tcgacggatc gttcatttca     50220
     aactctgttc acgtagtgtt tcgatcgact gaaagtgcat cggcaattgc ccatcgcgac     50280
     ggtcgacgat ttgttccaag attcgagggt ccgtttcgga tgcgtgaaag cgaacctctc     50340
     cagagccgaa caaaaagtgc gcgccggttg ggtgacgact gccgaccgaa ccaaccgctg     50400
     acgcgaccgg tttggcgaag cgatccaggc ttgtttcaat tccaccgccc acatttcgca     50460
     gagtcgcccg cgttccgctg agccaaccca ggtcatccag cggaagtagt ttttccgaaa     50520
     caaaggccgt attggccaag ccgtctgtca catcatctcg cgtgatagcg acgttgagga     50580
     tgaagacgcc atggtcgctc tcgtcaatgg ctttttcagt cggatggtgc agcccaacgt     50640
     agttgctggc gttgtcaggg tcccgttcgg aggaagggca tcggaacact ggaagacgaa     50700
     gttgcatgac aggttgattg gcttcgtcgt agacgctgac ggatcgatca attcgattgg     50760
     ccacaacggg ttgatccaac aaatccatca atcgccccaa ccagttgtga tggttgcctt     50820
     ctgcggtgct tgcaattggc ccggtgattc cgtcgtcggg ggcgaggacg gtcccgacgg     50880
     ggaagtgcat ccaacgatcg tggtaacttt ggattgccaa accgatcgga atcaaatttg     50940
     attgacaggc ggcacgccgg gacttttcgc gaatcgactg cagtgcggga gcagacaaac     51000
     caaccaaaac gccgatgatg gcgattacca ccagcaactc caccagggtg aagccgttac     51060
     tgaacgcccg gttgcgacgg cgatcgcgtg attggcgacc ggcgattgtg agtttgattg     51120
     gacggtggcg attgttcatg agttgcctcg tagttgccgt cggatggaca tgcctgaccg     51180
     gtcgttgcga accaatgtgg cttcgatctg tttggattga tcgttggaat cgatgagctt     51240
     cacgtcgatc caaacgtttg ctttgtcgtc gaccggaagt cgtaggccgg acgccagttc     51300
     atcgccgagc gtttgtgcgg tgtggatggc ggattcaagc aatacgatca tttgttgatc     51360
     gcgttcgtgt ttccgtgagt tcgctgcggt tttgccgatc acgatcgcga atgtgccgac     51420
     gagcaatgcc aaggcgagca ccaataccaa tgcggccagg ccgcggcgag gtgcccgacg     51480
     acgtcgacag ggacgacatg gatcgaaaga aggtgctgga atcaatttag catcctcgga     51540
     gcggcaagga tttgaattgg ttggtcaggg cgatcgggca acgtgattgt cagttcaacc     51600
     agcgatggtt ctgtttcggg atcttcgtcg gagatcggct gcagtcgaaa attgacttgc     51660
     gagcgttcgt cgatgaggta tcggtcggac gcgatcggtt gtgcatcggc ggattcggcg     51720
     tcgcgagaaa tccatgctga cggggcgagt tcgtaggtga tctgtgaatc atcagcggat     51780
     tttagaatca gactcgattc aatcacttcg atcgtgccgg ccgatgcaac gtcgcgacgc     51840
     aggtcgtttg ccagtcgacg aatctcttgg cggtggatcg ccgcatcgct ggcgtgtttg     51900
     ctgctggtgc gaaccaatcg caccaaacca agcgttccgc cgagcatcgc gatcacaatt     51960
     gaaagcgtga tcaacatttc aatcagggtg tatccgttac gacgaatcat tcggcgggct     52020
     ccattctcca cacatggtgt tgcaaagttt gcgaatcaat ggtggattga atgacgagat     52080
     gcaacccgga ttgggagtcc gtctcaaaag aatcgatttg aatttgaacg tcggattcgg     52140
     ggccacgctg tgcagcaact cgttcgatat cttcgtaagg aaccagcaag aattgttggc     52200
     caacgttctc caccgcgagt tgtcgttcca gccgatccat ggagtgtcga gcgaacgaac     52260
     gcccgctgtg atgcatctgg acagcgaaac ccgtcgcgac ggctaaaaac gcaaacccag     52320
     ccatggtttc aagcaatgtg aagccttggc gggttttgtg tcgtgaccgg taggatggag     52380
     ccgctctcat gcgattagct gattgatgtg gtgagtttgg tcagaaacag aaacacggtc     52440
     acgatgtggg caatcacgta aatcccgacc gcgacgattc ccagcggaat caaccaggac     52500
     atccggacct tccaagtaag tgatcggcgg cgcgaaatgt tgtcgaccat ttggtcgatc     52560
     gccgatggca ggtgatgatt gttggctgca ctggtcagcc aagattgctc cttcgcggtg     52620
     atgatttgcg agcttcgcag agcgacggga aacgtggttc cgttttcgat caactgggat     52680
     gccttgcggc atcgctttcg aatccaatga ttgcgagatg attgcgatgc caatctcagt     52740
     agttccgact cggcatgttc cgatcgcatg ccaatgctca gcgaacgcaa tatctcgcaa     52800
     cgccaacgag cgatggaatc tttgccgaac cacgggatcc accggatcaa ccaggcgggt     52860
     tgccagcgaa tcaagatcgc catcacgaac caaatgaaaa cgaggatcat cacgccttca     52920
     tagatggaca tgatggtttg caacaagtca tggatgtttg acttgagatt gaaaaattca     52980
     tcggcgattt tctcaaaccg tttgaatagg aaatctcgca tcaagtaccc caaaccccac     53040
     gccagaaaca gtgtggcgat caggtagatc agttgttccg ccacgatcgg agcggagacg     53100
     ggtgtgcccc cgtcgatgct ttgttgttgg cgaacatgtg accggagagt ttcgtcgtca     53160
     aacgagttgg gcggcgtggt tgtggcctga ggatgctgaa tcgcagccaa tgtgtccgcg     53220
     gtgattggca gcttcgatcg ccggaccgct ttgaccaaag attcgccgcg catcaaacgt     53280
     gccgagaaag tcttgccttg gaaagcaatg cgactggacg aaccattggc gagcgattcc     53340
     gccaggacag gaaccgaggc tcgagtgccg gcagccaatc gcatccaacg gttcaacgac     53400
     tcggcctctt cgcggtaagt ccaacgcctg gcgacgaaca gcgatccgat catcattgcc     53460
     agcaacacaa acgtgatcgg atggggcgcc gagctcgcca aagcgatgat actggttgac     53520
     cagagcaccc attcaagaaa tgcaaagact cgaatggtaa agggacgaaa tcgcggaact     53580
     ggctgcgtga tcaaattcca cttgatcgta cgcaatgtgg cggcgaacaa tccgcacgcg     53640
     atagaaccta ggatgaaggg cagtgagtgt cccatttcta aaaccaccag ccggtgaatg     53700
     tcaggccctc tatcatcaaa acgatgtttg tgttggtcgc caagattgca agtccggcgg     53760
     tgaacaacga accaatcaac cctactcgga agagatgtct gacggtgcgc tgcgatcttg     53820
     tttgaagcaa ccagtggcta tccgacgctg ctcggtgcca catgtggatg gtctcctcac     53880
     gtgacagctg gctttgacca atcgcaatca ccgccgccaa gggatggtct ttgattggtg     53940
     ggcggagaag ggcgttttcc catgattggc cggagtccaa tctcgcggcg gagcgatcga     54000
     tccaaagccg aagcggagtg aatcgagttt cgtcagaggc ggctcgaaag gcgtcgccat     54060
     aagtttttga gttgaccacc gatcgataaa tcgattgaca gaaattggcc agggcgatcg     54120
     tctggatcgc tcgcccaagc ccagggattt tgctgacaat cgttgcaatg acaaccggca     54180
     aactgccgcg aagagagagt tgaaccagga tccagataac actcgcggcc acagcgatgc     54240
     cagcgtaaac ccagatcaag cttcgcatcc aagtgatcaa cacctctttc tcttcccaac     54300
     ccacgtagta gacggcgtcc tcactgagtt ctgcgaccgc ggagagcaga aaggcaccca     54360
     ccgccaaagc ggcgattagg tagatgaagc taaccgtggt tgcgcgagac agactggatc     54420
     gagcgtcatc tcggatgacg gaccacattt ctgcttcggc ttggtcagag atggtcggag     54480
     aagtcatcaa acgaactccc caatagcatt caggagcggt gatatcgccg tccgcaacaa     54540
     aacgatgatg atcgcaatca tcactatcca cgcgatccag tgggggacgt tttgcaacca     54600
     ccaactttgt tgccgattcg ctctttcatc gtgcaattcg cttagcttgc gcaagtcatg     54660
     ggcgatcaag tcggcatctc gtttgccggt taccaagtca acgacacatt ctttgaccgg     54720
     agccggtgtg tcaggaggga agtcgagcaa ttgttcggac gtcgcaccgg cacggacatt     54780
     cgttgccact gttcgccaga gggcgggcgt atccgaaaca gcgacttccg cggcggagtc     54840
     gattgctcga gcggtatcga tgttcgcgtt tgggatttca atctggatcg ccagccatcg     54900
     acaaaacgtg gccaagtgac gagagggttg tgcgtggcgg atcgaacgac gaattcccca     54960
     gttcatccac gccgcgaagc acgcgagaat gacgatcacg atcaatgcgg caaacaggta     55020
     gtgttgcaca aacgtttggg cgatctgttc gacggaaggt gcaaagggtg acgcgatgtg     55080
     ttgcgattcg gcgatcgaaa tcaagatcca tggcaagaca aagaacgcca ccaccgcagc     55140
     gaccaacatg ttgagaatcg gattgattgc agccagccaa acttgtcgtc gttggtcctc     55200
     gcgttggcgg atcagtcggg cggtttcgtg gatggccgcc gtggaaccag tctcagccat     55260
     gatttgcatg gcgatgcgaa tcggcgtttg atacggcaag gacaacgagg ccatcgcgac     55320
     tgatggggat tggccatgct tgacccgcgc acgaacaaac tctgcggcgc gaccgagacg     55380
     cccgagtgcc acgtcattca atcctgccag gccggatacg agtgaacgcc ctgaagcggc     55440
     catcgcggag acctcctcca gcaacatcgc gagcgactcg tcgttgagtt ggaacgattt     55500
     ggttgacgag gcgggtgtcg gagtggggtt gctcgtcatg acgttcgccc caaaacgcgg     55560
     aagacttctt cctggtcggt gacgcgttct tcaatcaatc gttcggcttg gtgacgcagc     55620
     gattcgattc cggccgcttc gaggattcgg tcgagttcca gtgcgggcaa ttgctttgcc     55680
     aaggcatcga agatggccgg tccacattgg gaatggttta agtcaacgat ttgtgagacc     55740
     ggcacccggc cagcgtatcc cgtgccgtga cagcaagaac aatcccgcga tgcctttggg     55800
     ccggcgtcgc aggcatcgca tcgtcggcgc agcaatcgtt ggcacatcac gccacgcagt     55860
     ccgctttgaa tcgcgaaagt aggcaaattc atttgcacca atcgacgcaa cgttccgccc     55920
     acggttcccg catgaatcga cgagaaacaa aggtgacccg tcatcgatgc ggccagcaca     55980
     gcctcggcgg tttcaacgtc gcgaatttcg ctgaccaaca acacctccgc atcttgtcgg     56040
     acggcggcac gcatcgcgga cgccagtgtc aaaccgctgc cggattgcag ttggctttga     56100
     ctgatcgagt cgatcacgga ttcgattggg tcctcgatcg atagaacgct cctgcgaaac     56160
     tctccgccgg cgatgtgcga caggcaggcg tacagcgtcg tcgtcttccc gctcccggca     56220
     ggcccggcga ccaacaacca accatcgcga gcgtcgcaaa tcgtttggag acgatccagc     56280
     gtgcaagcac caaggccgag ttcgtgcaac tgtcgaacgc tttcgcgttc ttccatgatt     56340
     cggatggcgg cacgattgcc atgaacggtc gggaagactc ccaatcgcat ctcacgctcg     56400
     agatcgcttc cgttgcgttc tgcatcgcca cttcgccaac gcagcggtcc ttcctgaggc     56460
     actcccatcc ggtacgacgg caatcccgcc agcgccatca gtcgtgctac tggatcgctt     56520
     tcgtcgctcc gtgggaatga ttcaactggt tgcagtacgc cgtcgattcg aaaggagatc     56580
     tcccacgatt ccattcgcgg ttgaatgtgc acgtcgctgg caccgcactg gatggcagac     56640
     gtcaagcaag actggatcac ttcgattgcg aagttaggat ccgcgggaga cagacgagac     56700
     gcggggctga tcaccgatga aagttctcca gcgaaaattc ggggcacgaa accgccacgt     56760
     gccgcaggac gttagactaa cggattcccc cgagggaagt atgcgtcgag cgtaaaaagt     56820
     ttcgaacaag acaacaggct ggaagccgat cccactttct atctgtgcga ggatgacatg     56880
     aagcgatcac aacgtcgaaa cggattcact ctgttggagt tgctcgttgt gaccggcgtc     56940
     attgggatcc tgattgggtt gttgttgcct gcggtgcagg cggcacgtga ggcggcaagg     57000
     cgaatgagct gcagcaacaa ccttgggcaa atcgctcttg gcgtgactca gtaccacgac     57060
     gcgtttgggc atctgccacc gcatggaacc gggacgttca acaacgccaa tgatccgctg     57120
     accaccaacc agtttcggtt gagttatctg gtgtcgatca ctccgttcgt tggcaaggtt     57180
     cctctgtggg aagcgatcag cgaaggctat gtggggcagc cgccggaggg cgatcacagt     57240
     gatgtggatt acgacttctt accctacgac gaagtggatt atggagtgat gggcgggggt     57300
     gacgtgcaac atcggtatga acccatggga ccatcgcctt ccatcgcggc gtacacccca     57360
     tgggaaaacg aagtcgggat gtatcggtgc ccatctgatc ccggattggg atcgccctcg     57420
     ctcgggcgaa cgaactacgc cgcgtgcctt ggtgatgcga tcgaagggtt ggatgaagga     57480
     ttgtggatac acgacggaac cgcttggtca gccagtggca agttgcaaat ggaagcgacc     57540
     gggcgcggta tgttcgtgcc tcgcaagatc acgtcctaca gcgatgtgaa agacggtttg     57600
     tccgcgacga ttttgcttgg ggagatttgc acggacttgg gcgacaacga cattcgaacg     57660
     tttccttcgt tgaacaacgg ctggggcggc ggcgtgctgg atgatgtcgc gatctgtcga     57720
     acgcaaatcg attccacgcg gcctatgttt tgggaagctg ggaaggttca gcttccaacc     57780
     aacccagggc atggacgcgg tgctcgctgg gcagacgcgt cgtctttgat gaccgggttc     57840
     aacacgacat tgcgtcccaa tgcagaaatt tgttttgggg gcaatgcaac cacgatcggc     57900
     acgctgacga tgagcagccg tcatcagggc ggcggccata tcgcgatggc ggacggatcg     57960
     atcaaattca tcaccgattc gattgatgcc gggtggggtg ctgggaccgt gattctcaat     58020
     ggggaaggcg agcgcgcacc cgggagtccc agtcctttcg gattgtgggg cgctcttggt     58080
     actcgtgatc agagtgagat gttcgactat gaatactgat tctcgtttgt attcaggccg     58140
     ttggcatcgg ctgtagcacg gtggtctcca ccgtgagttt gcgctcgtct cggtggggga     58200
     ccaccgagtt acaggttggg atgctaggtt gccttcgtag gccggaccga aacgaagtgg     58260
     agttccggca gctctctgaa cgctgacacg caaacgacag acaacaatcg ttcgacactg     58320
     ccgtagcacg gtggtcccca ccgtgagttt gcgctcgtct cagtggagga ccaccgagtt     58380
     acaggttggg atgctaggtt gccttcgtag gccggaccga aacgaagtgg agttccggca     58440
     gctctctaaa cgccaacacg caaacaactg agaacaatgg tttgactctt ccgtagcacg     58500
     gtggtctcca ccgtgagttc gcgtatgtct cggtggagga ccactgagct acaggttggg     58560
     atgctgggtt gccttcgtag gccggaccga aacgaagtgg agttccggca ttcacttcaa     58620
     agttggtcgg cttggaaggt gtcgccttga ttcaggtcac ctgttttcaa gcctttggtg     58680
     aaccaacgca atcgctgttc gctggtgccg tggttgaaag tctcgggttg gacgtaacct     58740
     cggctacgtt tttgcagcgt gtcgtcgccg atggcccgcg cggccgtcat cgcttcttcg     58800
     atgtccccgt cttcaatgat gcggtatttc ttttccgcat gatgcagcat cactccagcg     58860
     aagaagtcgg cttgcaattc caatcgaacc gaatacttgt tgtattcgac ttcgggaacc     58920
     ctttggcgaa tttgatccag ttggtcggtg tatcccagca ggttctgaac gtgatggcca     58980
     acttcatggg cgaccacata ggcttgtgca aagtcccccg gtgcaccgag ttggcgagcg     59040
     agttggccga aaaaggatgt gtcgagataa accttttcat cggccgggca atagaaaggg     59100
     cccgtgccgc tgctggccat gccgcatccg ctgttgacct ggtctttgaa aagcaccaac     59160
     gtcggttttt tgtagtcgcg accggcctga gcaaacagat ccgtccagac atcttcggtg     59220
     tcagcgaaca ccgtgctgac aaattcgccg gcttcgattt cttgcggggt cagctcgact     59280
     tcgccgccgg caccaccggg ggcaggttgt tgagcggctt gttgtagaaa ctgctgtggg     59340
     ttgccgccca gcaatccgat gatgatcgcg atgacaatca ctccgattcc gccaccgacc     59400
     accgcgccac cgccgctggt tcgacgatct tccacattgt cactttgtcg tcgtccacgc     59460
     caacgcatgc cgcacctgct gtttgattcg tttttgaaaa gaaaagggcg tcggtccaat     59520
     cggagacgct cgcgaattgt cacacaattg ttcaggtgag aaaagcattg ggaagggaac     59580
     tgcaaccgct ggaaagtgtg ccactgtcgt gccgagggat atccctcagt cggcattgat     59640
     ccagtgcaaa actggggtca gcggaaacgc ccagtgtgcg ttggattgtc gcgaaaccgg     59700
     ttgtgaccta ggtttggcgt gagaatcagc aattcagtgg gcaaatgaaa ccaattggcc     59760
     ccctcatttg gctgttcttg gaacgcgaat gggccccatc agggtaagat ggctcgccta     59820
     ttcagccctc ttatcaattc gccggtatgc catcttcttt gtcgctgatc cgattgcccg     59880
     ctttgtcgat tgtggatttg gtgggtgcag acgccaccgc gatcctgcac aacttgacca     59940
     caaacgacgt caaaaagctg accgccgatg gtccgcagca cgctggattg gaaacgttca     60000
     tcaccaatgt tcgtggaaag tgcttgggac acgtcgtcgt ctttgccacg caagatggct     60060
     accgaatgat tggtgctcca ggcatcgtcg cgaccgctga caactctggt accgtccgcc     60120
     agtcacaagc gatcgcggaa cacgccgacc gatacaccat tcgcgaagac gcgacgccgg     60180
     tgattcgtga cgaagagttg gccgcttgga tggtcatcga tggtgacgct gaaccagttc     60240
     agacgactcc gttgccgaac atgaccaacc aagacggcgt cgattcgtat cagttgccgt     60300
     gggtaaaatc cggcacattg ttcctgctgc cgatcgatac cgccgcggaa catccatcgc     60360
     ggatcgcgga ccgtttgggt gtgaatgccg aatcgttggc gatgggtgac gaaaacgatt     60420
     ttcatgttca ccgcgttgcg gccgggttcc catggttcgg gatcgatctg accgacgctc     60480
     atctgccgca agaagccgat cgagaaaccc aaacgatcag cttcacaaag ggctgctatc     60540
     tcgggcaaga aaccgtggcc cggctcgacg cattgggtca ggtccaaaag aaattggtgc     60600
     gttggaaatt gtcaggtttg cccgcggggg ctgagccggc ggcggacgac aaactgcgag     60660
     cgttggacgc accggaggat gccaagccgg tcggcagaat caccagcgtt gggcggatcg     60720
     acgatcaagg cgaaggattg gcgatgggct atgcccgccg gagccatttc gaagccggtg     60780
     agaaattggc cggcatgata tcggcggggg acgtgggcga tgtggcctac accgcagaag     60840
     tgttaccgcc cgtgttggga gattcgccgg aatgaacgat ttaacgctcg aagagttcgc     60900
     cgatctgttg gaactggttc gccagggcga cgacgacgca accgcggtct tgtgggaacg     60960
     ttacttccaa cccctcgttc ggctggcagg aactcgactg ccaaagaacc ttcggcggtc     61020
     tggcgacgaa gaagacatag cgctctctgc gtttcacagt ttcattgcgg gagttcgacg     61080
     tgaaaagttc cccgatttgt cggggccgga taatttgtgg ggattgctga tcacgttgac     61140
     cagccgaaag gtgaacgctc atttgcgtcg tcaaacgcgg caaaaacgcg gtggcggcca     61200
     agtccgcggt gagtcagtct tcttggacgc gtcgggcgat tccggccggg ctgggttgga     61260
     acaattcgct ggacgaggcg aatccgacaa cactccaccg gatttgaggt tggaattggc     61320
     ggaggcgtgc gagagattgt tggatgattt gccggacgaa caattgcgag aaatcgcagt     61380
     gatgcggatg gatggttttt tggtagacga gatcgcgacc aaattgggcg tgagcaaacg     61440
     tgcggtcgaa cgaagactgc agttaattcg caaaacgtgg accgaagcgg cggagtccgt     61500
     gcccgaccaa acataaaagc ggtgccgaac tctcgaaaac acacttcgat cacagatagc     61560
     tacggaagtg attcgcgatg aatttaagtg atttgcctgc ccgcgaattg gcccgcctcg     61620
     atgcggtctg cttggaatat gaatcctcgc tgcggcaagt cgccgatgga gagccggcac     61680
     cctcggattt gaccagcatt cagtcgctcg tcgaacgtca cggcggcgag catgcggatt     61740
     tgttgcgttc tgaattggaa gcgattcgag cggaaatcga tggcgaccta ggaattcatg     61800
     gcgattcggg tgaattgacc caggttttgg ccgcttccaa cgacacgccg tctcgggagg     61860
     cggctgcgct ggacacacca gcggttgatg cgatgaagat ggacgattca ttgcgttcaa     61920
     ctccatcggc ggaagcacgc gtgaagaagg cgttggccaa agtcgccagc gatggttcct     61980
     ccgattcgct gccgccactg ggcaccgaaa ttggtcccta ccggttggat ggtgttttgg     62040
     gacgcggcgg catgggcgtc gtgtatcgcg ccaccgacac gagactggaa cgcagcgtcg     62100
     cggtgaaaat gctgtcgatc gacggacatc ccaatttggt tgagcgtttt cagcgtgaag     62160
     ccaaggcggt cgcttcgttg acgcatccca acattgttga gctattcgac gttggggttc     62220
     acgaaggcat gccgtacgcc gtgatggaac atcttcgtgg cgaaacgctg atgcgacgaa     62280
     tggaatcacg acgaaccgat gtggcaccga tcacaacgca aatggttcgg tactggggac     62340
     ggcaattggc tgaggccttg gcaacctcgc acgcgtccgg tgtgatccat cgtgatctca     62400
     agccggagaa cgtgatgctc gttggccgtc gcagcggatc gccgacgcct tcgcccgcca     62460
     acagcaacac gatcagcggt cattcgatag cgatgcagtc atccaacgag acctcgttgc     62520
     cgtcggtcaa gctcttcgac tttggattgt ctcgcgtggg ccgagcggtg ttcggccccg     62580
     gagaatcgga tccggagagt cagcatgagg acgcgggcaa cgacgaggcc aatgaagcca     62640
     agacccgtgc cggcatgatc ttgggcacgc caggttacat ggcacccgaa caggctcgcg     62700
     gcgaaaccgt cacaccggct gccgatgtgt tttcgttggg ttgcgtgttg ttcgaagctt     62760
     tctacggtcg ccccgccttc accggaaaat caccggccag tcgctatgcc gcggttctgg     62820
     aaaagactcc gttgcctgat ccaggccgtc gtcgcgacga catcgccctg gccgatttga     62880
     tcatggcgat gatgcgcaag gtacccgctg aacgtccgac cgcggcaacc gttgtcgcag     62940
     cactctcgag cggtggcgcg atcttgccag ccaatgacgg cgagacgttg gccacgccga     63000
     tggacggcgc gtcgatgaca cagccaattc gcattgccgg cggagtgtct cgtcgtcgat     63060
     ttgtcgagat gattggcgga agttttgccg gcgcgttggt tggtatgtcg ggcttgagtg     63120
     gcaactgggc caagctgaac cggattcgtt ccatcggtgt cctcagcttc acgcccgcga     63180
     cccaggtcga aacaaagaac gaggtcgatc cacagccggc ccgtggacga atgctccagc     63240
     gaggtgagtt gttggccggt ttggttgcca atgaactcag tcgcttggaa ggattgtcgg     63300
     taccgaagta tgtgccgatg acggctagct tccccgatca gtatcgcgac gcggcttcgc     63360
     ggttggaggt ggacgcgttg gtgacaggga ctttcacaga agccaccggt gctcagcctg     63420
     gtttcatgga tgtcaacatc cagatcattt gcgccgaaag cggcacgcaa atttggggca     63480
     aggtcatacg caccagcggt ggcgacaatt tgattgagca aaaccatttg gctcggcaag     63540
     ttgcctcggc gatcaaccga agtctgctgg agaatccaca cgaatcacga cctcgcgatc     63600
     cgggggcgtt tacctgtctg ttgaaaggac gtacgcaagc cgacccagac agcatcgatg     63660
     ggatgcgttc cgctctaaag tgctttgaca gtgctctttc agaagatccc aattacgctc     63720
     ccgcacacgc gggaaaaggg ctgacttctc tgacgctggc cggacgggtc gcggacgagg     63780
     aggctcaaga gctcatcatc caggctcagc gatcaatcga gagcgctttg gagttggaca     63840
     ctaccaatgt ggaagctcgc ttggcttcgg cgatgttgat gtatcaacgg ctcggcgatc     63900
     tgaaaccagc acgcgacatt ttgttggcat tgtccaaaga ggcgaataac tcttggcaag     63960
     tctttcacca actcggttgg gttcagttga tgctctatga ggaaatggca ggcgtcgttt     64020
     cccttcgtcg agcggcttcg ctgcactcaa catcgaagct gttgcagtcc gatctggcac     64080
     gcgcccagtg gtttgttgca aacaagcgtc gtgccattga tgaagccacc ggtgtcatgc     64140
     caaagacaga tgggaatcaa gtcggccccg aaagtttcac tcgcgggttg ctcatcgatt     64200
     tgtacgagca cagcagcgat ttgaaattgg cggcggatct ggatccagga ctcaattggt     64260
     cggaatccga tggcgcggac cgttattggg aactgcgtga ggcgagattg gaaacgcttc     64320
     cctatggtcc ctacggacca acgttgaacg aaaccatttt gcagcttcgt cgaactgacg     64380
     tggtgactcg agaacccgcc gaacaacgat tggcaagatt gctgcaaacg cgcagcccca     64440
     tgttgccgtt gctgttgatc aagcaccctc agtttgactc catacgaacg ttgcctgccg     64500
     ctggggaagc cttccccgtg ctgcgtcccg gcgtcgttta acggacgctc agacgaatcc     64560
     atctccgtag gttatgccag cgcaattggt gtgctgcttg ggcgatcggt tgggatacgc     64620
     ggcaagcgtt gtttgcttgc gtagctacat ggcgttgcca ctaactgctc agcgattttc     64680
     ttgggaggct cgagccagtg cgtcttgaaa ccacagacgc gctcttttgg cgatcgaagc     64740
     ttggtgccag ccaaagtgag cttccaatcg caaacccgcg ggaagacgtt gtgcttcttt     64800
     atgagggagt ttcagcacgc ctcgaaaatg tggctggagc aaacgcatgt tgtcgatcat     64860
     ctcttcgccc aaacgatcat cgttggacga gtcgtcagat gcatcgtcga cgcgaacaac     64920
     caatgggcca ccatgcgtcg ccgccaacga cgcgttcggg actcggtcgg atgcacgcgg     64980
     ttgaagttga tcaagcgtgg cccagaacgt ttgtcgaccg ggtgcaacca agcgaaccgg     65040
     ttggccgatc tgcttgcgaa catcgtcaac ctgtgactga ttgatcaccg ccaagacttc     65100
     cttgtccgtg tcggcagcaa caatcatcaa cacgtcgcct tcgtgaacat acgtgttgag     65160
     tttggaccgc aagtcattcg cgatcacgac tccggtccgg ttcgccacaa cgttcagttg     65220
     atccgactgc gtttgcaagg ttgcgagctt gtcgatgatc gcttggcgat tgtccagcag     65280
     gatcaaccgt tccgattctt cgcgagactc gatcgctttg cgaagtcgaa tgtcgttttg     65340
     cttttgagcg atttccagct ccgcgacgcg ttgtttgagt tcacggtttt cgatcgtggc     65400
     aatcagatcg ccagcttcga cttggtcgcc gccgtttaca ttcaatgcga ccaggaaacc     65460
     ttctgctccg acacggatcg ctgaatcggg atcgtattgc accaccaccg gaacacggac     65520
     cgacgatggg attggcatcg aaaacaacat ccaaccgaag acgctgatcg caatcgcacc     65580
     gagcaccaca cctcggcaaa cttggaacgg ttccgtttgc cacagattac gcatcgattg     65640
     caggaattgg acgagtggct ttccccacca catccaaagt cccaacacgg acagaacgat     65700
     tccggcaccg cccagcatcg ttgacgcggc gatggcgagc gagacacaca cgagaactcg     65760
     ccaagcgaca gcggaccatc cgtaaacgaa gaccgccgag cgccgccaac ccgtgtgagt     65820
     gctgtgccaa gacgcatcac cgagaaacca acggcgaagg aattgtcgaa ccgactgatt     65880
     cgcttcggtg gctaagttcg gcacatccat gaggtccgaa agcatgaagt agccatcgaa     65940
     tcgcatcagc acattcgcgt tgaacaagat ggtcgatagt cccgcggtca agatcacatg     66000
     gtgacaccac catcggatca tgtcgtcttc attgagtatc catcctgcga tcgcaatcga     66060
     agcgacgatt ccttcgatga acatgcccgc tgccgcgacg ccgattcgtg accatcgcga     66120
     aggcaatcgc cagcaactcg aaacgtcgac gtacgccaac ggggtcatca agacccagac     66180
     caagccggct tcccgcacgg atccgccggc gcgatggcag gcgatcgcat gtccgacttc     66240
     atgaatcagt ttcaagccga ttgccgtgaa caacagccag acccaattgg acggatcaaa     66300
     gatcgatgac gcaccagcga tgaattcgga ctgacgggaa gccagtgcaa ccaaggctgc     66360
     ggtgatgagc aatgttccca cgatcaggat cggcgttgaa aacagaaagc cgagcccgcg     66420
     tgaaatgtgt tgcagcagtc cggacgcacc cgggaccggc atcttgatcc aaaacgggtt     66480
     ccatcgtgtc caaatcgatt ttggcgggga gttgtccgcc ggtgtgccgt ggtgcgagcg     66540
     ttctcgacgc ggcggcggtg cgtcggcgaa gtgcgccaga cggtgatcga tcaaccatct     66600
     cgcgattgat tcgcactgcg aggacgaggg tgcagcacga cccatcttcg ccgtgaccaa     66660
     cccgcatgcc tgtgcaatgg tgcgatgccc atccaaggcc gacaaaaacg tgtactcgga     66720
     caaaccaact cgaaagaatt gatgcgtggc aggaatttca atccgataaa tcggttcgcc     66780
     tgtttcgcga acgggccaga ccttcacatc ggcggcgatg cgaatgggtt gttgctgcca     66840
     atcgatggtt cccggatctc gctgcatggt cacacgccca accaacgaag cagcaaattc     66900
     cacgggcgat gaaaaacaat ccatccgatc ggacgcttat tgccatagat cgtcgcccgg     66960
     cctttcatcc ccggtcgcag caatccgtct tgatcgtcca cggtgacttc ggccagaaac     67020
     acgttttcgg aatcacgaat cgttgcggcg gggtggactc gcgtgattgc accgtgcatc     67080
     actcggtccg gcatcgcgtg ggtgtgaacc cgggtcagca tgcccggttg aacgtgagcg     67140
     aagttctctt cagggatcgc gatctcaact ttcatcgaac cgaccggcgc aatttcgaaa     67200
     agcgtttcac ctcgtgtcag cggtgcgccc tcggattgct tccaatcgcc gctgacgatg     67260
     actccatcga tgggactgcg gatttcgagg ttgtccttgc gatggttcag cagttcggtt     67320
     tgcgtcttca gccgatcggc ttccaacgcc gcgatttgac tctttccaaa atcatgcgac     67380
     gccatcgaac ctcggcgttc ctggtcggct tgcccgtgaa gagcacgcaa tccagccagt     67440
     tcgtattcca attcgcgagg gttgattttg gccagcaact gcccctcggt cacggtgtcg     67500
     ccgggacgca ccatgcattc ttgcaacggg ccatcaaacg ggaccgcgat gaagcgacgt     67560
     tggaccggtt gcagttgaac atccgtgcga atgttgtgat gagccggcag gaacatcaac     67620
     aaaatgatcg tcgacaaaac gcaaacggtc gcacgttgcc aagtcgcacg aaacgatcga     67680
     atgccacgca ccaacgatgc ttccacgccc gtcggttgca gacgatgaat gctttgaagt     67740
     ttgcacgaca gcagcggtgc aaacgcgtcc agtgttgcag aggccgatcg ctcgcgtggg     67800
     gcgacgatca acaaaacgcc gaggctattg ccgctcgagt ccgctagtgg gcaagcgagc     67860
     aggttgttcg atccaatggt cttcagccat tgccgcatcg ccatcgtacc gggcgacgat     67920
     gcgacctccg tcgcggcgac tttgctgagt ccatcccgca aacaggcttc ttccgctgcg     67980
     gccaatgttt cgcgaggatg gtcggttgca aatgtcccgc cgccgtgggc atgatcgctg     68040
     atgcacttca gccctgatgc gggacgattc cgccaacaca gaatcgctcc ttctgcctgc     68100
     aaccattcac tgagcgatcg cgttgcgatc gatgcggctt cgtcgaactc ctgacaggca     68160
     tcgagggctg actgaagttc gatcgccgcc gccaatgtct cggcgcgttg taacaattcg     68220
     tgatgtgaat cacgaccggt cgcgtccggc gaaagtgacg atgcggtgaa cacgtgctag     68280
     cgcaacgcag gcgagagaat gacgggggcg tcgctgatgc gagcctttga ttggttggtt     68340
     ctcgcggacg cttccaaatc caaccagcaa acaacgccgc tgcgaatcgt acgtttttcg     68400
     tttggtagaa caacgcggac gcggacggta ccggattcgg ccgtggcaac gggcgagatg     68460
     tattccaacg ttccaaaaac cgtcgctcga gatccaccca cgcgaacgac gacagattgg     68520
     ccttcagaca aactgtcaat tcgtcgcagc ggcaccgaga aaacggcttt caatcgatcc     68580
     aattggacca gctgcagcag aatcggatcg gtcggtgaga caaattcgcc aacctctttg     68640
     gccagtgcca cgacgacccc gtcggacggt gccaggatgc ggcgttgctc cagttggcaa     68700
     atcacacgtt ggtattcgag agcgcgaacg gaaagttctt cggtgacgct ttgcagtcga     68760
     gcgagtgcct gacgatgatc gttttcggcg cgttcgagtt ctcggggtgt cgcgttgccc     68820
     tgcgtgaaca gacggcgata gctttggact tgttgttcgc ggatgacgac ttccgcttcc     68880
     gcagcagtct tgccaccgat ggcatctttt gcggcccgcg aaacatccag cgtttttcgc     68940
     agcaacgcat catcgagttg tgccagcact tgtccttcgc gtacctcggc tccctcgcga     69000
     gctttcagtt ccgtgatcac tcccatttcc gatgacgaaa cttggattcg tcgatacggt     69060
     tcggtaaacg cttcgtattc gtccgccgac gcaatgcccg gcagacacag gcattgcaaa     69120
     ctcacgatga cgcagagctt tgttatccag tgacggttca tcatcctgca tccaatgctt     69180
     gaaggtgtgg ggcgggatca tggttcgatt gggctttgcg aaccaatccg caatcgcgtt     69240
     catccgcttc cagcaattgg cgtcttgccg cggcagctcg tttggcttgc cgtgtttgga     69300
     tcgatgcgat ttgagactct acagaaagtg attcgatttg ttcggcggcg atggcacgtc     69360
     ggatagcacg acccacccaa ggtgccgatt ggctgaccaa gttgtcttcg gcggacaaga     69420
     aatggcgact gctgcctggg tcgccacaac gagcacaccg accgatcaat tgccgatcga     69480
     cacgcgagga gcgatggtgc tcggctacga tcacgtgcag tccgcccttg gcggccactt     69540
     cggggttcaa acggatgtca gtgccacgcc cggccaaatt cgttgcgaca gtgatcgcat     69600
     gcggttgtcc cgcctgagcg atgatctcag cttcctcggc gttttgcagg ccgttgagca     69660
     gctcacaaga aagaccttgc cgacgaactt cttctgcaac ccggtgactg gtttcgatgt     69720
     ccagagtgcc taccaaaacg catcgcccag agtccgctat ccggcgggct tcgttggcga     69780
     tggcggcgaa tttttgtttt gcggtgagcg taacgtgcgt cggatgaacg atgcgtttcg     69840
     atggcaaccg aggttggacg gtttggacgt tcagtccgta aaccgatttc aattcttcgc     69900
     ggcaatcacc cgccgttccg gtgactccgg ccaaatagtc gtacgatcga tagaaacgtt     69960
     gacgtgtgat ttttgcgagc gattcgctct cacgctggat cggcaattct tcttttgctt     70020
     caatggcttg ttgcaatccg cctgaccagg tgcggtcttc gtaaatgcga ccggtggatt     70080
     ggtcaacgat ccggacggac tcatcctcaa tcacgtaatc gatgtctcga cgaagcaaat     70140
     gggttgcttg caatgcaagt tcaacgtact catgccatgg tcgacgtagc gaagcgtcgg     70200
     accagtcttc caccgcttcg taggcacgat tcagtcccgt gtcggtcaat tcgatttgtt     70260
     gaccggtcgc taggaagtct tcctcgccat gcagcgatgt tgccgttttc aatgcgtgtc     70320
     gatggaccgc ggcgtcatcg gcctcgcccg gcagagttcc tgacaacaac agcggcgaca     70380
     gagcatcgtc aatcaggaca tgatcgatct catcgaccaa cgcaaccgcg agccctcgct     70440
     gcaaacgagg cgtggatgat tctgaattca atcttcgaag caacgtcgat ccggggcgct     70500
     gacgtgccgc cgtgtccatt gccaattgat cacgaaggta atcaaaacca aacgcgtgac     70560
     cgggcccata ggtcacgtcc gctcggtaag ctgcatgcgc ggcgtcggcg gatgagtcct     70620
     cgggcaaaca gctggatttg acaccgagta gcgaccaagt ctcgcggagt tgttcgtgat     70680
     cacgttgggc caagtaagcg tttggcgttg cgatgtgcac gcctcggcct ggcaaagcag     70740
     cgatcaacga cgaaacaaac aacgcgtagg tctttccttc gccggtttgc atttccgcca     70800
     cgccgccccg tcgtgagatc catcccgagg acacgatcaa accagcacgc aattgcactt     70860
     cgaaaagctc aatgtcgtga gttgctcgaa tcgcatcggc ggccaagatc aaagcgtccg     70920
     ccaagcactc acgccagatt gcatccaact ggttcgatga gtcacgagtc tggtccgagg     70980
     tcgcttccag caatttgtac cgcagcgttt gccagcgatc ttgcaaatcc tgtttcgaat     71040
     tcgcggaccg attcgagatt tggtcgcatg cggactgcag aacggtttcg atgtcgaccg     71100
     cgggacgatc agtgaatcga ccgagttggg tgagcgatgc gaagcgggtt gcggatgcga     71160
     aatgagatcg ccatcccgag ttggattgga gaaggctcat ggtgagttcc actcctccgg     71220
     cgttgggagg atcaattctt cactctcgat catccctccg aacggttcgg tttcgtcagg     71280
     caggaatacc gagacattgg acggtaccgg tgaaacatct gcgacgttgc aaaccagcag     71340
     cacgcccatc gctttgcgaa gggtaaccca tgacaacgcg tgagcgacct gcgaccgtac     71400
     cagactgcgt tcttcatccg ccaagcgttc ttgcgcgtcc agtaagtttt cgatcagaag     71460
     aatcgcgttc tcgtttggat cgggcaggtg cgtccaacgt tgccgcaaat aatcgacttc     71520
     gcgagcggca gccatcgtcg actgttgttt ggcgatcaat tcgttgaaca acgtttgagt     71580
     ctcgcgaacg gcgatttcga cttccgtcat tgccgcttcg gtcgtctgtt gaaactcggc     71640
     gtacgatcgt gtccattccc atcggttgcg tcgcaaacgg gcttggttgg ctcggttgcc     71700
     ccacgggcgt tcgaagatca aaccggcgga atatgttgga ccgccttcgc tgaattggcg     71760
     accgattgct ccgaatgtgt tggtgcctga atccaaaccc gatacgtaag aactgagcag     71820
     caaatccagt cgcggcaaaa cttgattgcg tgcggcaccg acgcgtgtcg acacagcatg     71880
     catttgttgc aggctttgca cgatgtcggg acgattgtcc aacgccgtca gagtcgcatc     71940
     tcgcgtgctc aactcgatcg actgcatcag cggacgctca acgggcacca tttcgtattg     72000
     agcgaactgg gcgaattggc gatcaccagt caacaaacgc aattttgatt gagcgttgcg     72060
     gattcgggtt tcgatgcgga ccaaatcggc tcgccgtttg gccactgcaa cattggcacg     72120
     caggatttgc cgttgttgcg aatcgaccgc gccgcgagct tgcaggaccg tttgcatctc     72180
     ctgtgcactg gcgagtaaac gattgcgttg cagccattcg gcgcgggctt ggtaaagttc     72240
     ccagtacgcg gtggtgacat cgaccaagtg cgtctgaatt tcttctcgca cttcgctgtt     72300
     ggtgatttgt gcgtcgatct ttgcgaggat gactcgcgtg cgattgaccg ctttgccgtg     72360
     gtcacgaagc aacggttgag agaaattcag ttccaaccgc gacgttcctt gcgggttggg     72420
     ggtcagaaac gtcgagttgt tgttctgaaa gccaccacgc tgcacgactt ccaggttccc     72480
     gccaccggtc agcttcttac gtacacccgc cgatgaggca aacaggttgt ctcggaatcg     72540
     ttccgattgg tcgcccgtgg tcaattcact gccaaccgga tcgttcgtat cggtgtagtt     72600
     ggcatccaaa aacgtcagcg gatcgaactg ggcgtcggcg atcacaatgt cggtcattga     72660
     gatctgaggt tccgtcagca agctgcggac atagggcgag gcaatcaacg ccgtctgggc     72720
     caatcccgag gcatcgacgg aggtgtgttg ttcggccaaa ccgagtggct gcgtgacgtc     72780
     ctcgtcccac caaacgactt gcgggtcgag ctgactgatc tgacctgcga tggatgatcc     72840
     agacgacaac gccggtgaat ctttgaacca acagtttcca tcggcctccg ctatgagctc     72900
     gttttcaagg actcgatcgc gataccggtc gacttgatga gcgtaggggc cactcgagat     72960
     ggcattgggg atcggtaaat gaaccgcttc gtgagatcga taggtggtcg aaaccgaatg     73020
     aggcgaatgg ccatcggcgt gaccgggcgt ttctgcccat agtgccaagt gggatgggcc     73080
     aaccaggatt cctgccagaa tgatcgatcg aacccatcgg cgtctggatg aagtgagtgt     73140
     gcgtaccgtc cgccgaagct tgcgcgagcg caagccatca atgatggcgg tcgtcggttt     73200
     cacaatttgt ttcatcaatt cgatcgggca ggttggatct gaaggaaggt tccttctgca     73260
     atccagacac ggggcatttg ggagatcgac cggactcagt cagcgaatca gccgcaaaga     73320
     ggcattcagc ccgcacgacc ggaaccgagc gccgaatgag cgttgcaagc cgcacagatt     73380
     ctccagctga caaagaaaac taggcttccc caatcagttt tcacggccag gtgttgtttt     73440
     gtcgcctacg tttcggcgga cgaccggccc acaccaatgg gctgtaccgt gaacagacgt     73500
     gcctcgaaga cgttgtccct tgttcgagcg ccgttgtgcg aggtatctga tgtcaaaatt     73560
     cgcgaatcac tggtggcagc gatgctgtct gagggtggat catgtcgcga cattggcaca     73620
     gcagtccgtg cgggcgcgtc ggccggtggc actcggcaaa cgattgccaa agatcggcac     73680
     gcttgagcca atggtgttgt tcagtgccac gcccattgat ccggcgatga tggacgcctc     73740
     cgcgggcgaa ggagcggcga ccgcaacggt gatggaaatc cctttggatt cggaagctga     73800
     atctcagcag agcaacaccg catcgagtgt ccaaaaccct gatcagcaat cggcatccgt     73860
     tgccagcgaa atcatcatca ttgatgcctt gacgccggac ctggaggcgt tgctcgaaga     73920
     cctgcgtttg catcgcgaag gcagcgaagt gatcgttctg gatgcgaacc gagacggggt     73980
     cacacagatc actgaaattt tggagtcacg aaccaacgtt cgtgcgctgc aaatcatttc     74040
     acactccgaa cacgcttcgg ttcgcttggg gaatctttgg ctcggggcag agaacctgga     74100
     cgcctacgct ggtgacatcg catcgtggca gcatgcgctg acatccgatg ccgacatcct     74160
     gttttatggt tgcgatctcg cgaccgatgc aaatggtaga acgctggttg attccatcgc     74220
     ggcgctcacc ggtgcggatg tcgcggccag cgacgatgac accgggcacg cacgctacgg     74280
     tgcggattgg gatttggaat acgcgaccgg tgtcatcgat gcggacatcg tcgtcagtga     74340
     atcctttcag gagacttggg gacacaaact cgcgacgatc acggtgacca cttggttgga     74400
     tgaatcgaac aacaacggtg aaacctcgct tcgcgaagca atcacgcagg cgaacgccgg     74460
     cgccggtggc gacaccatcg tcttcagtgc ctccttggac actccgaccg ttttccaact     74520
     cactcgccaa caaaccgaag acgatgcgaa ctcctacggc gacttcgaca tcctgaaaga     74580
     tctcaccatc gtcgggcacg gcatgaacat caccatcatt gacgcggacg atctgagtcg     74640
     gatctttgac gttcatggcg gaacattgac attgtcggat gtaacgttgc agggcgggaa     74700
     tgcctcgggc gacatgggcg gtgcgatccg agttgaggct ccatctgcgg ggctgaattt     74760
     gcagcgagct ttgttgacca gcaacacggc gacggaaggc ggtgcgattg gcaacaaggg     74820
     aacgatcgag ttgaccgacg ttgcgatcat cggcaatggt ggtgtgaatg gctatgcgac     74880
     caatacgggc ggcggaatca caaaccgagg agcggcgacg cttaaccggg tcactttgtc     74940
     gggcaacgtt gcgacggccg ggggtgcgat ctttgtcgaa aacagtgcga cttcgctgtc     75000
     actgacgaat gtgacggtga gtggcaacac gggtgccaat gcgggaggtg gtctctacac     75060
     aaaggtgaat gccgagatca ttcattccac attcactttg aatacgtcca acattggcgg     75120
     gggcatcttt gtcgaagctg gcaccacaac cgttgccaac acgatcgtct ctggcaacac     75180
     ggccacctct agcaatccag acgttcatgg ggcattcacc tccaacggcg gaaacctcat     75240
     cggcgatgtt ggatcggcga gcgggtttgg ggggcaagac tttattgggg tggcggcgaa     75300
     tcttggggca ctggccagta atggtggcta cgtacagact cacgcattgc aagctggcag     75360
     tgccgcgatt gatcaagcca ttgctgagaa tgccgtcgcc attgacgcga ggcagttttc     75420
     aacgttggat ggattacctg atgttggagc cttccagcgg cagggcggcg tcatcaaccg     75480
     cctcttttgg atcgatcacg atctgggcac cgttcaatcg gccgcgttgg atggaacgaa     75540
     cgtgcaaacc ttggtgagcg gtctgtcgaa tcccgaagag ttgtatgtcg attctgtgaa     75600
     tcaacatctc tacttttcag aagccggtga gaaccgcatt cgacgagtga atttcgatgg     75660
     taccggcctg gtcaatgtgt tgaccgggct tgtagctcca caaggcatgg aagtcgactt     75720
     agtcggtgga aaaatttatt gggtggaaga cggtgccgga tctcacaatg aagttaaacg     75780
     agccgacttg gatggtagca atgtcgaaac gctcgcaacc atcaccgctt ttttgaacct     75840
     gaccattccc gacgacattg aactcgatct tgtcaacggg cacgtttact ggtccgacga     75900
     gttgacgctc gaaatcaacc gcatggattt agatggatcg aatcgcgtca cagtgatctc     75960
     gtcggacaag ggtgtgcgag gaatcgcgat cgattcagtc aacaacaagc tgtattacgc     76020
     tgtcggtgct tattccaatg gtgaaatcag acgagccgat ctagatggtt ccaaccgaga     76080
     aacgttgatc gattctggtt tggatgggcc gaatggaatt gaagtcgatc ctgcgtcagg     76140
     aaaaatctat tgggcggaca gcgggttgcc ccagatttcg atggcagacc tcgatggttc     76200
     taacgttaca aatctgggaa ttgcaggtct tcaacagcct catgggctcg ggttaggcgc     76260
     ccaagataca aacacgtccc cgatgcatat cgggttccgg ccctctgacg ttgtcgaaaa     76320
     cacggacacg tctgctgggg tttcggtagg aacactgtca acgttggata ttgatgaaga     76380
     cgaaacgttt acgtacacgg tcaccggtgg tgccgatgcc gccaaattca cgatcggagg     76440
     cgggaattca gacgagttga ttttaaccga tggggtgttg gactacgaaa atcaatcgtc     76500
     ttacaccgtg gtcgtgaatg ttgaggattc tgctggcaac aacaccacgc aaacaatcac     76560
     gattcgagtc gccaatcaag cagagattga tgggctttgg ttcaccacgg acaacgatgt     76620
     gagtgagtcg ggtgttgccg gtctaacaaa ctggggcgaa gaccaggtca ttcaaatcag     76680
     cgacccaggg ttgacgctgg acgggaacgg aggcaccacg tcgggaaccg cgtccacagt     76740
     cggctttcgt ctagagaact ttatcagcga taccaatgtc ggcatctccg gaatgcatgc     76800
     ggtctggtcc ggtctgagtg tcgggtcggg ggccaacagt tttgaattgc tggccggtga     76860
     cctgatcttt tcaatcgaca agagcggcat tgatttttct agcgaaacgg aacccgacaa     76920
     ggaatttgat cgtgaagatg tgatcgtgtt ccgggcatcg acgccgggtg actactcctc     76980
     aggtgacttc tttttcttgc tcgacgatcc gcttgatgga gatgacattc gaggcatctc     77040
     gctggtcgag agcgaaggcg gcgtcaccgt gggcgacacg actcttgctc aaggcacgtt     77100
     cctgttttct cattccggtg gcagcgagca tgaccgtgtg atcacctacc acgccgatac     77160
     ggtgggcgag tccaacacgt cgggcaccga gacggttttg attgagggca gcgacggggg     77220
     caatcttggc ttcaccgaga agatcgtagg gctgcatcta gttgaatcca gcacaacgat     77280
     cgggggcgtc gccgtcacag cgggcgatct gttgatctcg gtccacgccg gtagcgaagc     77340
     aaacacaacg atcggtggcg tgaccggcac caaccaagat gtctttcgct tgaccatgac     77400
     gtccactcgg attggcggaa gcaattccgt ggccaatgtc gagttgctgt ttgatggatc     77460
     ggatatcggt ttggatcaac tggatgatca agaaatcaac tcactgactt ttgctgttgg     77520
     aacttctccc aacacgccca tcggagcgat ttctgatgcc gatgcagatc ccgacagtgt     77580
     cgacgaagac gccgaaatcg gagacgcggt cggaattcag gccttcgcga ccgactcgga     77640
     cggcgaagcg gtcacgtata gccttatcag cgatcccgat tccaaattcg cgatcgattc     77700
     caatacgggg atcgtgacgc tggcggccac gttggactat gacactgcga cggagcatag     77760
     tttcaccgtt cgtgcgacca gtgcagactc ttcatttacc gaagagacgt ttacggtcca     77820
     ggtcattgaa gcgaacgaag cgccctcttt gaccgtgact tcggtgctag gttcgattgc     77880
     cgagaatgcg gatttgaccg gtggggtgca cgtggccaat gtcacgctta ccgatgatgg     77940
     aattggcacg aatacctact cgttgacggg agatgatgca aacctgttcg agctgcgtga     78000
     ttccgacacg aaactgtatt tgaaggatgg ggtgagcctg gatttcgaca ccaatagcgt     78060
     gttggatgtc acggtctcgg tggatgacaa cacggttggt ggcacccccg atgacagcgc     78120
     atcgttctcc atgacggtga cggacgtgaa cacagctccc gttgtgagcc tgagtcaaag     78180
     cggaacatcg cttgcggaat cgaccgcgac gggttcacgg atcaagatgg ctgacatcaa     78240
     cgtgacggac gatggcaccg gaaccaatgt gctgtctttg tcgggcgacg acgcgaatct     78300
     ctttgaaatc gttggaacgg agttgttttg gaaaggtgac gctccgctgg acttcgaaac     78360
     gcaaccctcg ttggatgtga cggtaaacgt cgatgattcg acgttgggta gcggaatcga     78420
     ttcctcaacc gacttcacgt tgacggtgac cgacgtcaac gaagcaccca gcgtgagctt     78480
     ggccaacatc gtgacaacga tcagcgaagg tcaagacttg tcctcgggca tgaaagtggc     78540
     agacatcgtg gttgacgatg atgatctggg gctcgaaaca tattcgctat ccggcgatga     78600
     ttccgctttg tttcggatcg acggaactga agtctggttg attaacaacg ccacgctgga     78660
     tttcgacacc aatagcgttt tggatgttac ggtctcggtg gatgacaaca cggttggtgg     78720
     cacgcctgat gacagcgcat cgttctccat gacggtgacg gacgtgaact cggctcccgt     78780
     tgtgagtctc agtcaaagcg gaacatcgct tgcagaatcg accgcgacgg gatcacggat     78840
     caagatggct gacatcaacg tgacggacga tggcaccgga accaatgtgc tgtctttgtc     78900
     gggcgacgac gcgaatctct ttgaaatcgt tggaacggag ttgttttgga agggtgacgc     78960
     tccgctggac ttcgaaacgc aaccctcgtt ggatgtgacg gtaaacgtcg atgattcgac     79020
     gttgggtagc ggaatcgatt cctcaaccga cttcacgttg acggtgaccg acgtcaacga     79080
     agcacccagc gtgagcttgg ccaacatcgt gacaacgatc agcgaaggtc aagacttgtc     79140
     ctcgggcatg aaagtggctg acatcgtggt tgacgatgat aatctaggcc tcgaaacata     79200
     ttcgctatcc ggcgatgatt ccgctttgtt tcggatcgac ggaactgaag tctggttgat     79260
     taacaatgcc acgctggatt tcgacaccaa tagcgttttg gatgtcacgg tctcggtgga     79320
     tgacaacacg gttggtggca cacccgatga cagcgcatcg ttctccatga cggtgacgga     79380
     cgtgaactcg gctcccgttg tgagcctgag tcaaagcgga acatcgcttg cggaatcgac     79440
     cgcgacgggt tcacggatca agatggcgga catcaacgtg acggacgacg tcacgggaac     79500
     caacgtgctg tctttgtcgg gcgacgacgc gaatttgttt gaaatcgttg gaacggagtt     79560
     gttttggaaa ggcgacgctc cgctggactt cgaaacgcaa ccctcgctgg atgtgacggt     79620
     gaacgtcgat gattcgacgc tgggtagcgg aattgattcc tcaaccgatt tcacgttaac     79680
     ggtgaccgac gtcaatgaag ctcccagttt ttccatcgtt gatccgatca cacttgttgc     79740
     ggaggacgag gatctctcgg gcggcttgaa ggtcgctgat ttggacgtca ccgacgatgc     79800
     acttggtgcc gaaacgttct cgttaagtgg tgatgatgct gcattgtttg aagtgatcgg     79860
     caccgaattg tggttgcgag ctggaatcac cctcgatgcg atcacaaatt ccaacttgga     79920
     cgtgaccatt gatttggacg atgcgagtct cggtggtggt tccgaggaca ccaaatcgtt     79980
     gcaaattcaa gtcaccacaa ccaacacacc gccaacgctc agcgattggc aagacaactc     80040
     gctggccggt caaacggtca ccgtgcccgc atccgttttt gacggtctat ccaacgatgt     80100
     ggacgggcaa atcctcacgg ctcatttaag tgccggcccg ctggttggaa atttgaatat     80160
     gcaagccgat ggcagcttcg tattcacacc gcccccagga ttcattggtt caatctcctt     80220
     cgaatggacc gcgtttgatg ggcggcaaca cagtgccgcg gcgacggtga cgttgacatt     80280
     cctgcccgta ccagtcgtgc cgacttcacc cgcaccgacg ccaccggagg acacatccgg     80340
     atccaattct gacgcgaccg atggggattc caaagattcc aacagcgatt cagatagcgg     80400
     cgacaattcc gaagacagtt ccaatgattc ggattcggaa tccgccaacg aaggcgactc     80460
     agcagaagtt ctcgtcggca tgccgaacgc ggccacaacc aatccggatg gaaacgcaca     80520
     gcaatcgggg caatccggtg gtgctgaaga agcatcgacg gaactcgaac ggatgaatgc     80580
     gagtgtcaat gaagcgagat tggcacaaga ggccgctgaa cgagaattgc aaatcgaaag     80640
     aaatcagctg gggctgacgc aagcgggcgg tcgagtccag cgtttggatt tggactttga     80700
     tttcggatcc gacggcgtcg cgatgacatc catcgactat gccctgatga ctcaaccagg     80760
     cgagatgtgg gatcagctgg acagttatca gcaaagggtc aattctcaaa tcaatgggga     80820
     cctgattgtg gttggtaccg ccggtgcggc ggcatccagt gtgactgtcg gcgttgtggc     80880
     ctgggcctta cgcagcggat tgttgttgtc aggattgatt gcccacatgc ctgcctggag     80940
     cgcggtcgac ccgttgttga tcatgcaagg attctctgga aacggtgacg gagaaacact     81000
     cgaagaactc atggaccgcc acgacaaagc gatgacagac gaatgataag tctctatcag     81060
     cgtattccga ttcgcattcg gatttcactc ggtttggttg gtctgatggc cggcagtttg     81120
     ctggtcgcca gtgctgctgg attctttccg aacgaacagg aagaaatcct tcatggacgt     81180
     gcgcgcttgt gcgaaacgct agcaatcagt ggaaccgcga tggccagtca cggtcaggta     81240
     gactcattgc gggtcacgat ggaatcggtc gttcatcgag acccccaaat cttgtcgatc     81300
     ggattggtat cgagcgaagg tcaattgctc gtgtccgctg gtgagcacac tgagttttgg     81360
     gacgacagtc tggaagacga tgtcaatcag atgaaagtcc ccgtgttccg gtacggaaaa     81420
     caatggggcg aaatgcagtt cgcgtttgca tcaaccggtg gtttgttcgg tctgaactat     81480
     tgggctcctg cttggttgtt gatcgtcttg attcccgctt gtttgattca gttttcgttc     81540
     ttcttgaaga agacgctgga aagtttggat ccgtcagggg ccgtcccgac acacgtcgaa     81600
     aatgcactgg atacgatcac ggtcggattg gttctgctga actccaaagg ccgcatcctg     81660
     tttaccaacc gtcgtctgaa ccaattgctg tcgcaagaat cagcggattt gatggggaag     81720
     aagattgacg atttggaatg gcagatgatc gccgacaccg gtgctgtgct gccatgggaa     81780
     gaagcgaaac aaaatgacga ttcggtcatg gatcgaattc ttcaattcga taacaacggt     81840
     cgcatgctga ccttcagcgt caattgcacg cccatcgccg ggcaaggtta tctggtgacg     81900
     ttcgaggaca tcacgctgat cgaagaaaac aaggtcgctc tcgcgaaagc tcgtgatgct     81960
     gccgaaaacg ccaacgcagc caaaagtgat ttcctggcca atatgagtca cgaaattcga     82020
     acgccactca atgcggtcct cggtttcact gatgtgctgc gccgcggatt ggtgtccaac     82080
     ggtgacgaag ccgttgacca cctgaacatg atccatcgct cgggtgcgca cctgttggaa     82140
     ctgatcaacg acatcctgga tttgtccaaa attgaatcgg ggcacctgca aaccgagacg     82200
     atcgacacca gcctggacga catcgtcacg gatgtggcga acacgttgaa ggtcaaagcc     82260
     gacgagcaaa acttggcgtt gaaggttgat ttccgaactg ccatcccaag aacgatccag     82320
     tccgatccaa ctcgattgcg gcaggttatc acgaacttgg ttggcaacgc gatcaagttt     82380
     accgaaagcg gatctgtgtc gattgtcacg tcgctattga agacgccatc caatgcgttg     82440
     gaaggttacg acccaatcat tcgcgtcgac atcattgaca ccggtatcgg gatgacaccg     82500
     gatcagcaag ccaaaatctt tgactcgttt gtgcaagccg acagttcgac cactcgtaaa     82560
     tttggtggaa cgggattggg gctgtcaatc agccgtcgtc tggccgaggc aatgggcgga     82620
     tccctgacgg tacacagcga agtagggatc ggcagtacct tccgcgtgga acttccgacc     82680
     agcattgcaa gcctgcaaga catggtcagt cccgaagaac tggctcgatt ggcccaagaa     82740
     aaatcagccg gttcggtcag ctcggagttg ctgcgactgc ccggcaaacg agtgttggtc     82800
     gtcgacgacg gcgaagccaa ccgtcgcctc atcgaactgg tgctcaaacg cgccggtgcg     82860
     accgtgatga gcgccgaaaa cggtcaggaa gctctggaca tgatcgccga aggaaacgag     82920
     tcgggatatc catacgaatt ggtactgatg gacatgcaga tgcccgtctt ggatggttac     82980
     tccgccacac gattgctgcg tgagcgagaa gacacgacgc ctgtcatcgc actgaccggt     83040
     aacgccatgc ggggtgaccg cgagaagtgc atggatgctg gttgcgatga cttcctcacc     83100
     aaacccgtca acttggacga gttgctggaa atggtttcgc aatacttggg agaggtcgat     83160
     ccgggcacgt tgctcaatac caaaaccatg gcgaacgaaa cgtcctccgc ggcgagcctc     83220
     agcagtgcag gcattctgcc atcgatgcag acaccagtat ccgccgcttc cgcgtctttg     83280
     tcgtcatctg gttcaccagc ggcagcatca agtggtttgc catcttccgc cattgtgcca     83340
     accttgccga tggacgacga agacttccgc gccattgcgg gtgactttgt gtctcgattg     83400
     cacacccgat tggatggcat tgaacaagcg atccaggaat ccaagtttga ctttgtgcac     83460
     ggcgaagccc actggctcaa aggtgccggc ggaaccgtcg gtttggatgt cttcaccgaa     83520
     ccggcacgga cattggaaca agctgcgaaa gatggttcgc ccgacatcgc tcaatcgatt     83580
     ctcaacgaca tccgcgaact gcatggtcga gtggcgatcc cgggaatgga tctgtcaaag     83640
     gaatcgaacc agagcgactc tctcagtccc gcgatcgcat cggtcgatcc agcgaccatc     83700
     atcaacccaa ttcactgtgc gttgccgctg gacgacccag acttccacgc cattgtctca     83760
     gacttcatcg ttcggctcga ccagcgattg gtggacatgc gaaacgagct tcgcgaccaa     83820
     cgctttgatg ctttagaact cagcgcccat tggctgaagg gagccggcgg tacggttggc     83880
     tatggcgacc tgacccaacc atcacgtgac ttgatcgacg ccgcattggc agccaatcca     83940
     gcggactgcg aaacctatct gtcgcaaatt gaatcagttc gtgcacgcat gatccttcct     84000
     gaaccgttgc cacaatcggt ctgagttcac cgtgtgaacg tgctgtcgag aaacgcaatg     84060
     cgagaatcgt cgaacaacgg tttctgctgg cgaggttttc tcgatcggtg cgaccgacac     84120
     aatcgttcgg gtcgttcggg gggcaaaaag caatctccat caattggtgc tggtccgcgt     84180
     tgcgcatcgt accgtgaggc atgtttttga aacgtcctcg acactgctct ttttgaaacc     84240
     gctcccttcg gaccacactt gatgaacgct tccaatacct ccactgatac ggccgtcttc     84300
     agcgcgcccg tcgttcctgg aagtcatggt gttcttcctc aaggaaactc cgccaagccc     84360
     gtcgcggcat tgcccggcaa gatcatgatc gttgacgatg agatcgccaa cgttttggtc     84420
     gtgaagaagt acttggaacg agcgggttat cgagattttg aaacgacgac cgattcgact     84480
     tccgcgtttc gaatcctcga aaccagcatg ccggatgtgt tgttgctcga catcaacatg     84540
     cccaatgtcg atggcatcca agtcttggag cgggtgcgac aggacccacg tttcaaacac     84600
     ttgcccgtgt tgatcctgac tgccaacacg gatgaacgaa tcaaattagt ctgcttagaa     84660
     ttgggcgcga ctgacttttt gctcaaacct gttgacccga tggatttgac acctcgcgtc     84720
     cgcaactcat tgcaaagcaa aagttttcag gatcgactgc agcatcatgc tgccgaactg     84780
     gaactcaaag tcgaacaacg cacacgagaa ctggaagcat cccgccgcga agtcatctac     84840
     tgtttggctc gcgccgccga aatgcgagac aatgacactg gcaaccacgt cattcgagtc     84900
     ggtcgcttcg ccgggatcat cgccgccggg atgggattgc ccgattggtt tgttcgtgac     84960
     atcgaaatgg ccgctcagtt gcacgacgtt ggcaagatcg ccattcccga tgccatcttg     85020
     ctgaaacctg gcaaactcga accagaagag ttcgacgtga tccagaacca cgtcaagttt     85080
     ggccaccaaa tcatccagcc tcataccagc acggatgctc gccgaatgcg aacgcatgtg     85140
     gagcttggtg cagatatgct tagcaacggc agtgcattga tgcgactcgc cgccagcatc     85200
     gcacaaaccc accacgaaaa atttgatggt tcgggttacc cgctcgggtt ggctggcagt     85260
     gacattcctc tcgaaggccg aatcaccgcc gtcgccgatg tgttcgacgc cctgtccgca     85320
     gagcgacctt acaagaaggc gatgccacgt gagaagtgtt tctcgattct tgaggaaggc     85380
     cgcggctcac acttcgaccc cgatgtcttg gatgcgttct tcgattgcac caaagaaatc     85440
     gttcgcgtgc agttggacta catggatcac tgcgaaccta cacccgcacc cgcggcccca     85500
     agcgaatcca acgaataaga atcctaacca acccgaacct ccgccaaccc gtaactcggc     85560
     ggtcccccgc cgagaccacg cgcaccgcaa acccgcagcg tcagcaaggc cacaccacca     85620
     caatcaattg ccattttgca ttgatcactt tgcaatttgc aatttctccg ttttagctag     85680
     ccttcattcc agacgcgaac aaagaacccc gcgtccagct tccgaccaaa ctggtccggc     85740
     aaccggagac gtcccgtatc gaaccgaagc gttcccgctg gttgaacagt ctgaggaatc     85800
     cggtccacca agtacgcctg cacatcgtct tggtcaacgt ctggcgaatg ccctgtgatc     85860
     agcaatcgaa acgcatccgg ttccaacaac ttcaaactgt catcgatcaa cggccacaca     85920
     tcgcgagcta aacgccaagc cttcccactg ggaccatgcc cgtaggccgg tggatccatc     85980
     actatcgtgt ggtaccgatt ttcgcgtcgg acttctcgag ccgtgaactt gaccgcatca     86040
     tcgaccaaaa aacggatcgg tggatcgttc catccgttcg cttcggccgc cgcacgagcc     86100
     gactgaacgt tctgtttggc tgcgtccaca tgcgcgaccg cgaacccagc cgacaccatc     86160
     gccatggtcg atgcaccggt gtatgcgaac aagttgagtg ccttgggacg attgtccgct     86220
     gaggcttccg gcaacgaatg ggttcgcaac caatcccaat tggcttgttg ttccgggaag     86280
     acaccgatgt gtccatatgg agtcggcgcg accggcatac ggaatccgcc acactcgaca     86340
     cagcgtcccg gtttccactc cgcccgatga ttccatcgtt tctctttttc gtcaaaacgg     86400
     ctggccacca ccttccaccg cgcacgttgt ttcgcagcca aaccatccgc tgcaggagac     86460
     ggccgatcga tcagacgtcc ggcgaccagt tccaactttc gcccgccacc aaagtcgacc     86520
     aactcatact gatcgtccgt gcggccgccg ggcttgtgcg aggcatctga ttcagtcgag     86580
     cgagagggat ccggaaaatt catggcgagc agtgtatctg caacgcgtca cttcgtgtcc     86640
     ccagggcaaa tcaattgttc acccccaacc acccccaccc atcttcatcc caacccgaac     86700
     gcgtcagcga gggaccggtc atcgtgcgga aagttccggg cacacccacc agccttcccc     86760
     ccatccagca atcgagtctt gtcacacatc ggcgcggaag ttaatctttc cgccacgaag     86820
     cccctggtac cgcggcgagt cccactcgca gcggctaaag gcccttcggg cgattagctc     86880
     agttggttag agcgctgctt tcacacggca gaggtcacag attcgaattc tgtatcgccc     86940
     atttcggcaa cttgccgaaa acctcgtaaa tcaccggtcg aaacgcctct caggcgttac     87000
     tagttcgtca agctacgcga ctcactttca ccatttgcgg tacagcgtac cgcaaacgat     87060
     tggaactgaa tcgcatgcca agacaaaaag caaagctccc caagtacctc taccacgtct     87120
     cgggccaagc ccgagtctat ctcgatggac ggtacttcta cctcggcacc tacgactcgc     87180
     ccaagagtca cgccaggtac tttgccctct gcaagctgta ccaggacaac ggctgcaaaa     87240
     tgccggagga ctatgagacg catccggacg aggatgctgc cataacggtc aggtgcgtca     87300
     cggcagacta cctccgctac gccgctcaaa aatacgcttc gtcaaagaaa cgctatgacc     87360
     gtcacaagcg actctgtgac ttcgttgatg aagagtatgg ggatcttcca gcagccgact     87420
     tcggccccag gcgactgtcg ctgctgcggg agttactcgt ggcttccaaa aaccttcgcg     87480
     gcagacacaa cacccgtgcc tacatcaacg atcaagtgag gtggcctggg ttttgggggc     87540
     cacgcgtcct cttcttttag caggggacgg ttgattcgaa tcgggtcggc gagagatagc     87600
     cgagcgatga atgaagacgc gatgtgttgt agtaggcaat gaactcagtc agttcactca     87660
     atgcctcgcg atagctctca tattcggtca tctgcagctc tgtcttgatc gttccaaagc     87720
     aagattccat aaacgcgttg tcgtagcagt caccagctcg gctcatgctt tgacgcatcg     87780
     aactgcgttg gatgatcgca cgatatttct tgctggcgta ctgtccgccg cgatcagtgt     87840
     ggtggatgag atttcttgaa ggctgtcgac ttcgaatcgc cttttgaagc gttttgatca     87900
     ccaggctctc ggtcatatcc atttccaagg accagccgat gatccgccgg gaaaagcgat     87960
     ccatgagggt cgccatgtaa gcgaatccgg ttcgtacgat aggaatgtag gtgatgtcac     88020
     ctacccataa acgattcaca ctcgttggct caggctgttt gagcaatagg ttctcgttgt     88080
     agcccagcgt gtgccgactt tcggtcgttc gcggcttgaa cgatttcggc tgcaacgccg     88140
     atagccccgc gattcgcagc agtttggcga ccctttcacg tccgatcgca actccttgta     88200
     gcttcaggtc tgcagcgatc cgtcgggcac cgtagcgtct gcggtgtcga tgaaacgtgg     88260
     tgatcaccat tggcaagaca tccatgtcgc tctgttctct tcggcttgaa ggttcgcttt     88320
     gaaatcgctg aaacgcagac cgtgagaaac caaggatctc accgactgct cgttgcgatg     88380
     ccgtgccatc gcgaataatg ctggccgctg cggaatagag ctggctcact cgtttcggcc     88440
     gaaaatgatc aaagcttttt ttaaaacatc gcgtttcacg ctcgactcgt cgcagttccg     88500
     cctcgagttc ggcaacgcgg ctatcgagca cctcgccaac cggtccggcc gactcgactt     88560
     gctgcttctt ccagcggtaa agcaggttcg ttccagagat tcccaatcgc tcaacaatcg     88620
     atgtcgctga gtgaccgtcg agcagcatgg caactgcatc acgtttgaat tcgtctgtat     88680
     aggtgcgtcg ttcaggatta gctgaaggct tggtctttcg tggcatctgg ggttccttga     88740
     gttcctttca gtttaaggac tcgcgtggcc cccaaaaccc aggccacctc acagttacca     88800
     tcagctacgg ggcggtaacg agttccccga tcaggactta cacctgacta ttcaatcgcc     88860
     tttgcaggcg cactaagatt ctcctccaag gagaaccccc atgcacgaca ccgaagtatt     88920
     tcagcagatt cttggtctac ggtcgccctg gacggttgct gacgtgaagc ttgatctcga     88980
     agccggccag cttgatgtcc atgtcgagca cgctgatggc gagaagtttt gctgtcccga     89040
     atgcgaccgc caacttgcct gctacgacca tgtctcagaa cgacgttggc gacacctcga     89100
     cacgatgcag taccgcacga tccttcatgc gaagccacca cgtgtgaagt gtcccgagca     89160
     cggcgtcaag caagtgaact tgccctgggc cgagaagaac agtcgcttta cagtgttctt     89220
     tgagcggttc gcgatcgacg tcttgctggc aacgcagacc gtctggaatt gcccacgaaa     89280
     agttgacagt gggccggcgc acgtcagact tctctgacag gagaaccgat ccatggacaa     89340
     acgtcgaaca tttagccgcg aatacaagct ggccgcagtc aagaaagtca tcgaacaagg     89400
     cttgtcgtac accgctgtcg ctaaagactt ggggatcggg gacagcttga ttcgcaagtg     89460
     gaagaagtct tttgacgaag acggaacatt ccaggccgaa gtagttggta gccaatccat     89520
     tgaagccgag ctgagacgac ttcgcgaaga gaatcgtcaa ctcaagatgg aacgcgacat     89580
     tttaaaaaaa gcgacggcat tcttcgccaa agaaagtcac tgaggttgaa gttcattgga     89640
     gagtgccgcg atcgctggcc gatcgcagtg ctctgccgaa ccctcgaagt cactcgcgcc     89700
     gcttattacc gattcgccgg tcgcggtccc acagccaccg agatcaagca aacccaaatc     89760
     attcaagccg tcaaggaaat ccgactggaa aaacatcacg atgcgtatgg aagcccgcga     89820
     atgcaacgag caatagtcaa acgcggtgtg gtgtgctgcc gaaataccgt cgccaaatgc     89880
     atgcgtcatg cgggaataca agccaatcgc cgcaccaaat tcagaatatc gaccactgac     89940
     tccaatcatg atcagcccat cgcctcaaat ttgcttggcc aaaacttcac gaccgaggca     90000
     atcaatcgcg tctggctaac ggacatcacc tacatcccaa cccaagaagg ctccacttac     90060
     ctctgtgcat tcgttgacct gcattcccgc aagattgtca gctggaaaac gagccggaac     90120
     atggattcgg aattggtggt cggggcattc gatcaagcac ttacttttcg caagccaaac     90180
     gcgggcctga tcgttcacag cgatcgtggc tcccaattcg cgagcgatca tttccgcaga     90240
     cgcctggcag ccagtgggct agttcaaagc atgagccgtc gcgggaactg ctacgacaac     90300
     gcaccgatgg aatcgttctt caagagttac aaaaccgagg aagcacagca gatttacgac     90360
     acgcacgaac acgccacacg cggcgtatct gactacatcg aacgatttta caaccctcat     90420
     cgcttgcact cgtcgctggg ctacctcagt ccaatcgatt tcgagcaagc gatcaaagaa     90480
     ccgtcactcg taagtgagtc ctgactcaca ggactcaccg tttacctttc ccttaagacc     90540
     ggtccactgt caacttttcg tgggcaattc cagtcaggga gcggcaggta ttttgcgaac     90600
     cagctgggat gagacttggc acatcgtgaa gaaggcattc gcccgtggca aagctcgaaa     90660
     gacggacact gtcgtgcaac gaattggcat cgatgagaaa gcctttcgca agggacagaa     90720
     ctacatcacg ctgatctacg acttggaccg cagcaccgtc gaagcgatct ccgatggcaa     90780
     cgacacagaa gccggaaacg cttgtttttc acagctttca cagtctcaac gcgatggtgt     90840
     cgaggcaatc gcgatggaca tgagcgctgc ctacgtgaaa gccgccaagg caagcatccc     90900
     actggccgaa acgaaaatcg ttcatgaccg ctttcatgtg atgaagcttg ccaccgaagc     90960
     ggtcgacaag gttcgacgcg gcgaacatcg caagctggat gcggagggcg acaaacgctt     91020
     gtcacggact cgctatctat ggctcagtag ccaagagaac ctcagcgagc atcaacgaga     91080
     acgtttcgat gcggtttaca cgcaacaact cgaaaccggc aaagcatggg cctacaaaga     91140
     gatgctccga gacctctggc accacgacga ttcggcgtcg gcaacggtgt acttccgcga     91200
     ctggtacaag cgagtgatcc acaccaagct gacgccattg aagaaggtcg ccaaaacgat     91260
     cgccgagcga ttagccaatg tcgtcagcta ctgtacccac cgaatcacaa acgcggtggc     91320
     cgagggcatg aacagcaaga tcatgtcgat caaacgtcgc gtcggcggct accgaaaccg     91380
     agagaacttc aagaccgccg tctatttcta ctgcggtgga ctcaatctct acccacacta     91440
     aacccagatg gaccttcaat ttctcgacgc tcttcagttc gagaatgatg gagccctcca     91500
     ccaacaaatc gatccgatag ccacaatcca acgccacgtc tttgtagcga acaggctgcg     91560
     gttgctggag ctgaaacaga attgaattct tacggagctc atgggcaagg cattgctcat     91620
     aggcagactc cagcaaccca ggccccaatt cgcgatgcac ttcaatcgcg catccgatca     91680
     ctcggtgaga cagtttatcg aattccattc tctccccccc tcaacccacc gccttccatg     91740
     ctggaaccac cgacgtggat gaatcgattg tcaaattatc gtagcaaatc ttcaaaccac     91800
     gaaggactcg aagagcacga aagggcagca cgaacggacc gatctcttcg atctcaaccc     91860
     cgattccaat tcgaatgcga cagaccgcaa accagaagtc tcagccactt cgcaatcaag     91920
     attccaaaca aaccgatccg tccacaacaa acctgaacct tcgtaccttt cgtgtccttc     91980
     gtggtgatcg cctaggccgg atcaagccgc ttcggcaaat cgacaacaac catcgccaat     92040
     ctagcgggta gcaatcacca ccgactgtca aatcccagag tcagcaacac cgaaggcctg     92100
     tcttaccatt ggacgcgtca gaacgaggat cgtcagcaca cccagaacgg ttccgaatgg     92160
     aaagaagcag cattcgattc cggcaacaac caaacaatag agatggccgt tccgctgcat     92220
     cagctttcgc ccagccagag cgatgcaaga cgccatggtc aatcccacgg caatgaatac     92280
     gagtgggagc acgatgaaca accaccccat gaacgcgggc ggcgtttcgc ccgtcccagt     92340
     tccatcgaac gcccccgtta cgatcccaac gccaatcgcc aaatggatca ccggaaacat     92400
     cgagaacaac gccaacattc cagccacgat gtagtggaaa atggacaaca aacgtagttg     92460
     ttccgcatct tgattgtcat ggtccatcgc cattctccca ctcgttaaaa ctctggtgtg     92520
     tcacgcgagg acgaaccgca ggtgcccctt cagcctcacc ccatcaaata ggctcaatca     92580
     agaaacgagc ggggcgctca ttgatcgtcc catttcaaga accaaatgga tcgtgattca     92640
     gtcgaccaag accatcactg atcacttgac gtcgtcgctc gataccttct tctgaccaag     92700
     atacctcgcc agatcagtcc gatggagatg acaaccaaag cgggcgcgac agcaaaagca     92760
     agccattgag cggttgccgg catgatagtg attccaaaca ggaagacctc tggatcgtaa     92820
     gtcgcatact gacgcccgcc tgaattcgga cgaaacgcgc cggccactcc aaagacgaca     92880
     ccgggactac tgatcacggc cgcactgaga aagaacagac tggctgcaaa ccagtgccaa     92940
     acgggcgcgt ccgacgcttc tttgcgaact tcctcagatg gcgtctgata cggatttgac     93000
     actcacccat cctcggcgac gttgaaaacc tccccaccaa gaggttggag aagacgatgt     93060
     gagtctcatg ccggtggggc ttcacatgcg attcattcgt catcctaaca cgccaatgtt     93120
     tatctggttg tatctgaccc acggcgttca gatgcccatt taacaaaccc tgccgtgatc     93180
     gcccatggca atgtgatgaa cgtcagcccg gttccgcaag cggcgaacca cagccacgca     93240
     gttgtcgccc agctcatgcc gtcagcagat aaatccgatg tctcgcgctg cgtgaaggga     93300
     atcgcgaatt cgatgtagaa cgcgggcact accaaaacca gcacgatcaa tgaccaaagc     93360
     gtgccattgc gaaacccgat aaggaatgca gtggtcggcc gctccgtcgt ctccgcctca     93420
     acatcaacgt caacttccgg tgctgcgtaa ggattgacca tgccaagccc gtaggatttg     93480
     aacgttagtt tcgaaaccgg caattcggat tgtagcgact cgattgggca atcagtacgc     93540
     catcgatgcc tggccgtcac caacaggcca acccaatgcc cactgcagac ggaattgagc     93600
     ttggttgtag gctgtcacgg cttgcagata agcacgacgt gcggactcca aagcctgaac     93660
     cgcctgcagt acctcaatcg gcaacccctc accgtctttg attcgttcca agttggattc     93720
     gtacgaccgt tccgccgtcg caattgcctg ctgtgtcagg tccacttgct gacgccgaaa     93780
     ttcgatctgg ctcgccgact ctgaaatctc cgccgcgact tggtccatca cgcgaagttt     93840
     ttcatatcgt gcttgttgca ctcgcgcgga cgttcgattg cgtgccgctc gttcgcccaa     93900
     cccgaagtta cgaagttccc aagtcaccac ggcatcgaaa tcgtagcgac cgtccacatc     93960
     attcaagtcg ttgcccaaac ctcctccaaa tccgcctgtg ctgtacccca acaaaacgct     94020
     tggaacaaac ggtgcatact tttcgcgttt gtaagcttcg catgcagcgg cgactaatga     94080
     ttgcgactct ttgagttccg gccgcgaagc caagccggtg ctgatcagcg aggctttgtc     94140
     cgcgccggcg gccatcaact ccaatggcac gacggtgacg tccattggta gaagcgtctc     94200
     gcctgaatgc atgctgatgg cttgagcgag ccgtgccgac gcgaccgcga cccgttcctg     94260
     tcctcccacc aatcggctgt cgatcaatcg gagttccgtt tgcatgcgat ccgcatcggc     94320
     aagcatgcct tgtccggcgg ccgcgaaatc ggatgtgatc cctgccaatt ctctcactcg     94380
     ttcacgagac tcttccaaca cgcgagcgtc ttggtaagcc tccaacaatt ccgtgtaagc     94440
     ggtcgcggct tgcaacagtt gctgattcaa aacactcgag gcagcgtgcc cacgagccca     94500
     ggcagctttc tctgcgatct ttggttggaa gattgcatcg gccatgtgga attgagcgac     94560
     caaccccggg cgtgtgttgg tggttccggc accggtggca ccggctccca atccgtactg     94620
     gaacgagttt cgattgacat caacgatgtc tccgttgctg gattggtagt tgccatcgtg     94680
     gcgatggaag ctgaatccgg cttggatgga tggcaaccac aaaacgttgg cctgatccag     94740
     cgccgcataa gcttcacgcg ttcgccactg ggccaatccg accgcggggt gctgagagtc     94800
     aatcatcgct agcgccgtcg gcaagttcat ctgcaccgta tgcggcggaa ccattgccag     94860
     atcggatgag tggtccatcg aatcaacgac aaccggttca ggaggcagcc cctccagtcc     94920
     gctttcttgc acctccaaca cgggtgcact ttcataagca gccagcgaat ggtcgctgtt     94980
     gctggcgacg gctttttcct cgagtggttg caaccgatcg cgtttgccgt cgagcgtaag     95040
     aaccgattcg gccgccgatg cttgatcagc aattggctgc acaacatcac gatgggccac     95100
     cggatcacga tgggccaccg ggcgaatctt ggactcgtcg accgacgatt tttcacgggc     95160
     cgtttccgca tgcaggtcca acgcggcgga cctcgcagtg accgctgatg atgacggggg     95220
     actctgcacc gatgcctggt tcatttgcgc cacacaccca atcgctggaa cggtgctcga     95280
     gagggcgatc agcgtgtata gcaacgaacg ggacatccat gctctcctgg ttcatctgtt     95340
     cggaagacag cgttcgttcg ccttgctcag ctcgtcccga acgcatcagt ttctactaat     95400
     gcacttcggc aaatgatcat ccagatggta acgatcgaat gccttggatt agtcagatct     95460
     aatctgctgc gcatcgaaaa cgctcattgc gcgaactaga ctacatcgac cgtttggcga     95520
     accgcgcccg gtcagatcga ttcttccgat tcctccagtt attccagcgg agccaaggac     95580
     gccagtcctc gagtctcaac atgcttttcg caatcccgcc tcgactcttc cccccgctcg     95640
     cgacggttgc ggcgttgtgc cttctcgctg gctgctctga cgcgaatcgc gtcgccaaga     95700
     aaactcagcc gcagcaggcc acgccggtca aaacggtgtc cgtcactccg accgaggtca     95760
     ctcgaaccag cgttcagccc gcgaccgtcc acgcctacta ccgagccgaa cttcgctcgc     95820
     aagcgtcggg ctatgtcgag tcattcactg cggacatcgg tgaatacgtc gagtccggca     95880
     ccgtcctagc caagatctcg gttcctgaac ggcaacaaca acgccgggtg atggaagcca     95940
     aaatccggcg atcggaatcg caggaaaagc aagccgagtc gcaagtcgaa ctggcccagg     96000
     caagcaaaaa atccgccgaa gccaaactcg cgcaagccaa atcagaagtc gacgcggtgg     96060
     aagcttccgt cgccgccgcc aacgcggaat tcaaccgaac cgaagacttg gtcagccgag     96120
     gttccttgca gaaccgaatg ctggatgaag cccggatgaa acgcgacagt gagtcggctc     96180
     gcaaacaggc agtccaatcg gccgtcgcat ccgcgcaggc agacgtggaa gtcgcatcgg     96240
     caagagtcga gtcagcacga gcagatcttg agaccgcgcg agcggagacc gatgtcgtac     96300
     ggcgcgaact ggatgagctg gacgcatgga tcgactacgc cgaaatcaaa gcccctttct     96360
     ccggcatcat cacggaacga aacatcgaac caggtgattt ggtccgtgcc gctaacgaag     96420
     tcggactcgg caagccgttg tttgtgatca gccaaatcga ccgcgtccgc gtgcaaatcc     96480
     ccgttcctga aaaccacgct cctctggtca gtcccggtga cgaggtcagc ctgacgtttc     96540
     catcctttgc atcggaacca tccatcaccg cgcaggtcac gcgtcgcagc ggaagtctcg     96600
     atgcccaaac gcgaacgatg atggtggaag tcgaaatgga caaccctgat ggcaagctga     96660
     tcccagggat gttcggacaa gcaacgatcc aactggctac gcaagacgcg gccaacatgc     96720
     tccccgcgca agccattcgg ttcgatgagt ctggcaatgc cttcgtgtac gtggttgcag     96780
     gcgacgacac aatttcgatt cgagaaatct caaccggaat ggatgatgga aacttcatcg     96840
     aagtcctcac cggagttgag cccggccaat cagtcgtgga cgctcacttg agccgcttca     96900
     tcgacgggca aaaagttgcc gtcgtgggag ccgctcactg atgtcgttga tccaattttc     96960
     tcttcgcaat cgatttgcgg ttctggccgc gtccattgct ttgtgcgtgc tcggtgcaac     97020
     cgtcatcccg ggtatcacga ttgacatcct tccggacttc aaaaagccgg tggttgtcag     97080
     tttcttctcc taccctggtc ttccgacctt ggacatggag aaatccgtca cctcgcgagt     97140
     cgaacgtgcc ctgacgctgg cgggaaagat cgaacatcaa gaatcgagaa cggttcctgg     97200
     tgcggccgtg atcaaagtct tcttccaacc cggggccgat ccaagctctg cgatgaacga     97260
     catcgtgaac ttggaagcca gtgacatgtt tcacttgcca cccggcatcg agtggccgtt     97320
     cacgctgcga agcgaaccgt cgaacttgcc tgtggttctg gcagcgatct cgggcgaagg     97380
     cctgagcgag tccgaacttt actcgatcgg ctactacgcg gtccgcaaca agatgggcgg     97440
     attgaaaggc gtgcaaatcc ctcacccctt tggcggcaag ttccgccaga tgatggttta     97500
     cgtcgatcca gtcaaacttc aggcctacca catcagtgcg accgatgtgg tcgacgcact     97560
     caaaaaatca aacctggtgc tcgccggcgg caccgcgacc atgggcggaa ctgactacca     97620
     aatccaccct cgaaacacgc tgcccgacat cgaagagatc gcagcgattc ccatcgccgt     97680
     tcgcgacgat cgcccaatct tcatccgaga cgtggcaacg gtgaaggatg atgcggcgtt     97740
     gcaatacaac atcgttcgag tcaacggcaa ccgcagcgtc tattgcccgc tgcttcgcga     97800
     acccggcgaa aacaccatcg cggtggtgga ccgaatctac gacgggatcg cggatgagat     97860
     ccccaagatg aaggaacgtg gtgacatccc cgaagcaacc gatgtgacac tggtttcgga     97920
     ccagtccatt tacatccgca aagcgatgtc gaacctgttg tcgcaaatcg gtctgggttc     97980
     ggttctggtc gcgctcgtgg tgatgatctt tttgcgacgc ttgcttccta ccgtgatcat     98040
     tgtctcgacc atcttgctgg ccattctgat tggtgccttg ggattcgctt tctccggcca     98100
     aaccatcaac gtgatgactt tgggcgggat cgcattggcg atcggcacgg tcgtggatgc     98160
     tggaatcgtg gttgtcgaaa atgtgatccg tcacgggcga atgggcaaat caccgatgga     98220
     agccgcacgc gaaggaaccc aagaggtttc gggggcgatc ctggcgggca ccatcacgac     98280
     tttggcggtt ttcctaccag ccatcttctt aacggggatg atcaagtatc tctttgcacc     98340
     actctcgttg gccgcgacgc tgaccatcgg tgcctcctac attttagcgt tgacggttgt     98400
     ccctgcgatg tgtgccacct tcgttcggga acgtgtccag gcaaaggctt ctggcaaaca     98460
     agccagcgat gagcagccaa cttcgaccaa accatctgga ctgtacgggc gtgtgctttc     98520
     aaccgccatg catgcacccg ccttgtcggc catcgtcatc atcattggcg tgggagcatc     98580
     gtttttgctg cttccgaaaa tcggaaccga gttgtttccc aatgtcgact caggcagctt     98640
     tgaaatccgc ttgaaaacgg tgcccggtac cgcgctgccg aagaccgagg aattggtcgc     98700
     gaagatcgaa gacacgatca aagaagtgat cccatccgag tcgattgaca cgatcatctc     98760
     gaacatcgga ttgccggtcg gaaagggagc cggtttctcc acggttctga gttcgaactc     98820
     cggtcccgac acggcctact tgatcgtgaa cctcaagcag gaaaaccggc gagtcggcac     98880
     acaggaatac attgacactt tgcgtgagca gctgaacgcg aaattcccac tggaacaatt     98940
     catgtttgtc tccggtggca tcgtcaacat ggcactcaac gaaggcgtcc cgactccgat     99000
     cagcgtgcaa atctccgcgg ggacattgca acagtgtcgc gacgccgcgg aacgtatcgt     99060
     gcgagagatc tcgcccatcg aaggcactcg agacgtgcag atcgctcagt ctttggacta     99120
     ccctcaattc gatgtacaag ttgatcgaac gcgggcaaag tatttgggac tcgatcaaga     99180
     aaaagtggcc caaaccgtcc tgaccgcgtt gggatccagc gtcggatact cgccgaccat     99240
     ttggattgac ccaaagagcg gcgtcgactt cttcatggga gttcaatacg catcgaacca     99300
     gttccaatcg ctggatgaac tgcgaaacat gccactgtcg cttgacacac ccgatggtcc     99360
     catcacgatt ccactctcga acatcgccac ggtcaatcga gtcacgatcc caggcgagat     99420
     cgcccactac aacatctccc gtgtcaacga cattcacgtc aacgtcgcgg gacgagacct     99480
     cggaagcgtc gcggcggaca ttgacgccgt gatcgccgac atggaatttg aaaacggagt     99540
     ctccgtcgct cttcgcggac cgattgaaaa gatgcgtggc ggcatgaaca tgctgggtac     99600
     cggactggcc gttgcgacgc tacttgttta cttggtgttg atggctcagt ttcgatcgtt     99660
     cctcgatccc ttgatcatca tgttgtccgt tccgctgggg atcggtggtg tcttgatttc     99720
     cctttatctg acggacacgt acctcaacat ccaatccatg atgggaacgt tgatgatgat     99780
     cggcgtcgtc gtcaacaatt cgatcctctt ggtcgaattc gcgaatcaac gacttgccgc     99840
     tggagtatcc ccacacgaag cagctttgtc cgccgctcaa gtccgcttgc gaccgatcct     99900
     gatgacgtcc ttgactttgg tcgcatcgat gttgccgctt tccttccaac tcgcaccggg     99960
     caatgaagcg atgattccgc ttgctcgcgc gttgctgggc ggcatggtgg tttcgacgct    100020
     gctgacgctg atcttggttc catgcgtcta catgttgcta catcgcaaac aaaccgttcc    100080
     ggtctaaacc attggtattg gcttccagtc tgtgattgca ctgaccacga actgaaggct    100140
     gatccgccat tcaacagcgc aacaaaaaac caccgacacg actgagtcgt gccggtggta    100200
     tgcgttccga acgttggtga cgctggaaaa ttttctatcg aacgaggact tcaaccgaag    100260
     tttcgatcag atcgtcttcc gcttggagcg acgtcttgtt ggggttcgtg atcgtgaccc    100320
     aaccttcagc gtcgggctca gcacggctga ttgccgaggc caatgcgacg gactcttgtt    100380
     gatccaattg gatcgtttcg cccgcgttgt tggcgaaagc ggctggcggc aatgaagctg    100440
     cggcttcgtt gctggcacaa catccgatgt cgcaaccgcc cacgtcacaa ccggaatcac    100500
     aatttccggc ggcacagcag ccatcattgc aacctttgcc acaaccaaag atgccacggg    100560
     cgcgatgacg gcaatccggg caacaggcga tagcggacca atcgtaggtg cagaccgttt    100620
     ccttcttctt gtccgtgacc agttttttga tcgtgcgaac cttgccgcac tttttcagcg    100680
     ggccgcattc ccatggaaaa cgcaggggtg gaatgcagat ggtttcgcat tcaacgtcaa    100740
     agcacgtgac gtccacttct tctttttcga cttcgacaac gcagcgtccg gcttggcaga    100800
     agcagcaggc gggtccgaat gcactggcgg tgcttgagaa gacgaccgaa gcggtcaacg    100860
     cgaacagtcc cagcaacgcg atgcgaccga attgaatgga tcggctcatt tgaaattcct    100920
     ttttcagttc tgtgcggttt gtgtgcgggg ctgaggttca gccccgcaca aagaatggtt    100980
     ttggatcaac gcttcgtttc aatcaactca gaaatcgatc atgaagcgag ttccgaagat    101040
     caggaagttt cccgcgttta cgggtgcgtc gagtggattg tcaccgttgg ccgccaatcc    101100
     actttcgctg atttcacccc aaaccaagtt gttttgaacc ttcgagtaag gagtccagta    101160
     ccagttcaag ccggcggtgt agagatttcc gacgccaccg ttgacaccgc catccgtcag    101220
     atcgaggtgg tcgtatcgga aagcaagctg ccatgctccc caaccattgc cgcgacatcc    101280
     gttgcatcga tcgaccaaaa agaagttctc gtgtggcttc acgcgagaca gcgttcccgt    101340
     tgaccggttg tatggcatgt gctcgccggt caagaagtac gacgcgtaga tgtaaccgcc    101400
     gtggaagaac aggttgtcat ccacgcctgc cgctgggtcc tccacctgca tcggggtcag    101460
     gatgtattcc ccggtaattt gcagggagcc gaggttcagg atgttttcaa atccaatgtt    101520
     ttgataccaa tctgcaccat cgattcgacc ggtgttcaac caacgctgcg agcttcgtgc    101580
     gagaggtcga gtgcggaaac gaccttcgtt gttgttggtg tcattcgccc cggcatttcc    101640
     atctggtttc gcaaccgcac cggccaaacc ccagtgccaa tatccacgtc cgccgctggt    101700
     gtcgtcgtac catggcgatc cccaaagacg cgagtaaccg ccggcttggg ctgagtcacc    101760
     gatgaaacgt ccatccgtgt tgatgttctc aaggttgtag ataccgtacg tccaacagaa    101820
     cgattcctcg tcgttgtggc cgtacatggc caaaccaaag cgacgagcgt cttcgttgaa    101880
     tgcttccaca gccaagggac gttccgcaaa cacgttgtag cgtgaactgt tcaagtgatc    101940
     caaaccgagt ggccgcttct ggttccccag caacaacgtt tggttgttgg gcaggtccgt    102000
     ccaaccgagg taggcgtctt tgatctcggg tgtctgcggg ttgttgaaat ccacctgcaa    102060
     acggtacttc atgttttgtg gaacggtccc cgagatttcc aaccgcagac ggcggaacgc    102120
     ggtgatgttt tctggacttt ggtccggatc gccgccactc tcaattcgat tgatgccagc    102180
     gtcggtgttg gaaaacgacc aatgatcgat gtggactcgg ccgccgatct tgatcgttga    102240
     ctttttcttc ttggccttgg catccgcagc caatccgtct tggtagtccg tccactcttc    102300
     ttccaacgtg tcgagagctt ccaaccgcga cgcgaatgca tccaaacggt cttcgaagga    102360
     ctcatcgtcg gcgagagcat cttgattctg ctcatcatcc gccagcgttt gcaaaccgga    102420
     tggttcttga tcaacatcgg cagcggttga ctgcaaagtg tcttccagca aaccgtcctg    102480
     agcactcatc ggagcggcgc tgtattggtt cgacagcatg ccaccgaatg agttcaacgt    102540
     cggagccgac tcaggtgcaa ccagaacgga gtcgcttcct acttggttcg cgggggtcca    102600
     ccattcatcg gcgttggcaa gcgccccgcc gctggtggcc aaacaaacca acgccgctaa    102660
     ggcttgcctg gcaacgcttc cgccgcgccg catggatgaa gattccatcg aattgagact    102720
     ccgttttctt gatcaatgca tcaaccaatc cttaagttga tgtcgcctta cggagtcttc    102780
     atcgatcgct tattgcggct tgtatggctg atgattgtcg agcggacaaa tctcgatatt    102840
     tcttaacatt tcaatttgct gcattccgac taaccggcac aaccgatcct tggcgtgccg    102900
     gaacaatccc tacaactgaa tcaccgcggc aaactcattt gccaattcgc gagagcgtgc    102960
     aatagtacgc cccaacttca cccgtcggaa ttttgaagac tggagcgagc tggtgtgagc    103020
     ccttggaaag ctcaatttcc atggtcacaa cactgtcacc ctcacccacg gttttgctcg    103080
     cgatgggctt tccatcgacg cgaacttctg ccgactgaac gggaatcgca cgaccgtctt    103140
     gggttcgata tgccgctgac gctcccggca catcttcacc agccggtaca gccgccgcaa    103200
     tcgccacgcc cgattcctca ggccaacgac gcaaagcgac ctcgaacttt ccggcctcgt    103260
     gaacgttgat tgcccagtga ccgttgtgcg tcagttcctg cttcttcgcc ttctttggga    103320
     agaccgcagc tgcggcacgg atggcggatt ggttccatgg tggggcttgg ccgatccagt    103380
     catgagcggt gaacgtgacc acgggatgat cggggtgtcc cacggtcatc tcagtcgtct    103440
     gtgaaaacgt gggttccagc tccgcccacc acgcttcgta gaacgcacgc atcgaagcga    103500
     cttgttcggg atggtcgccc gcgatgttgt tctcctggcc cggatcgttc gcgatgttgt    103560
     acagttcctt cccattgatc aaacgccatt tatcctgcat caccgacgat tgacgccact    103620
     tgattgggtc aatcactcgt tgcgaatcgg tgatcagcat ccggtcgttg aatgacgaat    103680
     ccacctcgtc cttcaacagt gaaacaatcg atgttccgtc gaacttgact gactcaggtg    103740
     cttcgacgcc acacatgtcc agcagcgtcg gaacaacatc aactgcatgg caaagcgtgt    103800
     tgttggttct tgatttagca aagccgccct cggggtagtg catcacaaaa ggaacgcgat    103860
     ggccgccttc gtacgggctg cctttcttgc cacgcatgcc agcgttgtaa accgaggctc    103920
     cacctgcggt cccattgtcc gtggtgaaga tgaagatcgt attgtcatgc acgccaagct    103980
     cgcgaagcaa cttgcgagtt tgtccgacgt tgtcgtcaac gttcgtgatc atcccgaaga    104040
     aggtcgcgac gttatcgttc atctcgggat acatgtcgat gtatttctgc ggggcatgca    104100
     acggaccgtg cggagcattc gtcgcgatgt aagcaaagaa tggctcatcc gcttccacgc    104160
     attcacgaat gaagcgattt ccctctttga aaaaaacgtc ggtgcaaaag ccttccgctt    104220
     tgacggcttt tccgttgtgg aaataagagc catcgaagta agcgttgtcc cagaaatcgg    104280
     gtgtctgccc cacaccgcct cctccgtggc ggtagacctc ggtgaatccg ttgtcttcag    104340
     ctcggtaggg atagttgtca cccaagtgcc atttgccaaa catgcctgtt tggtaacccg    104400
     catcactgaa gatctcacca aaggtcacct cgttgtctcg caacatcgaa cgaccactga    104460
     tggtgtgcca aactccagtt cggttggtcc agtgaccggt catcaacgcc gaccgggtcg    104520
     gcgagcaggt cggcgcgacg tggtagtcgg tcaacacgga agattccgct gccaatgcat    104580
     caatatttgg cgtctggacg actttgtttc cggtgaatcc acaatcgcca taaccctggt    104640
     catcggtgat caccatcacc acgttgggac gatccgccgc gcgaacggaa tgagccagag    104700
     gaaggccctc ccacaacgaa cctgcgaaca caaacgccaa gcaaaacaac caacgtgaca    104760
     tagctgcgac tcaaactgga agggaactgt ggggaaggga agcaaccgta gccgaactgc    104820
     ggcgagtgtc aggtagcaat tccgccttcc catggcgaaa atgcgacgtc tcgaccattc    104880
     gagcggcagc cggctgcaac cgccgctcga attgtgcagc aaatttactt ttgcgactgc    104940
     ttcgcctttg catactcatg cgaaatctcg atcgcctttt ggcgatcctc gtcactgtag    105000
     tcccaaaact cctgcacgac gtcttccacg gcagggtagt gagatccatc gtcgccaact    105060
     cgctcgcgaa gatcggccaa acgctgtttc agctttttcg caacttcggc gtattcagga    105120
     ttgtcgattt ggttgacgac ttccgtcgga tcgttcacca aatcatacaa ttcccaaccg    105180
     ggaggcgttt gttgctttcc ttcgtaattg actccgtagt agtaaatcaa cttgtgagtc    105240
     ttcgtgcgga taccaaggtg ccctggattg tcatggtgag ccatgtgcat ccagtagcga    105300
     taataagcct cctgcttcca tccttccggt tcctgaccgg tctcgcaaat ctcgcgaaag    105360
     cttttgcctt gcatgtactc gggcgtttcc actcccgcga aagccagcat ggtggggccg    105420
     tagtccacgt tttcaacgat cgcattgctg cgtgatcctg caggaacgga cttggggtag    105480
     cggaccaaaa acggcatccg ttgtgattcg tcgtacatcc agcgtttgtc catgtagtca    105540
     tgctccccga gcatgaaccc ttggtcgccg gtgtaaatga tcacagtgtt gtccatttgt    105600
     ccggtctcct ccagcttcgc aaacaaacga gccaggttgt cgtcgacacc tttcacacaa    105660
     cgcaggtagt gcttcatgta gatgttgtat gcctcacgtt tcgcgtcttc gtcgctgagc    105720
     catgaatcga caccgtagtg cgacgcataa ttccgacgtg gattgcggcg gccgatggaa    105780
     gtgccgatgt acggcatcat ttcgtcattg gcaccacgag tcgcgagtga tccaaattga    105840
     ggttggctcc aaaggttctt tggttccgga atcgcgatct cggccaagta ctcttcgtaa    105900
     cggggcgcgt actcaaagaa gtcgtgcggt gccttgtagt gatgcatcaa aaagaacggc    105960
     ttgccatctt cgcgaacttc gtcgaaccag ttcagcgtga tatcggtgat cgcatcggtg    106020
     ctgtgcatgc cttctttctt gatcgtgttc tttggccaag gcttgtctcc ttggattcgg    106080
     aactcgggat cgaagtactt gccttggccg ggcaacacgc agtagtagtc gaacgctgcc    106140
     ggttcggctt ttaagtgcca cttgccaatc atcgcggttt ggtaaccagc cttcttcatc    106200
     tctttggcga gatgctgatt cttgggttca attcggccgt tgagatcaaa cacaccattc    106260
     gtgtgattgt attgaccggt catgatgcaa gcccgactgg gcgtgcagat cgagttcgtg    106320
     cagaacgcat tctcgaacaa catgccttcc ttggccagac gatccaggtt cggcgtcggg    106380
     tccaagtacg caaggcgact tccgtacgcc ccgaccgctt ggctggtgtg gtcatccgac    106440
     atgatgaaca aaatattggg tcgatcgtcg gcgaccaccc agggtgccat tgcgatggca    106500
     atcatccaaa tcagggcacg tgacccaatc aaagtgcgtg acatattcag ttcatctcgt    106560
     ggtggggaag tatggcaggg gttgtcgact tgttgctcag tggcatagca ggctgttcat    106620
     ttagttgcat ctcgaatgat aacaactagc cgtcgggcgc tagccccggt tggcgtctaa    106680
     tcaaccgccg cgaacgcggt acggctcact aaatcaacag cccgataggt gttctcgaac    106740
     cacaggctag aagcctatgc cactttcggt tccgatcatc tcaagcggtc aggcgtttga    106800
     acgcttcgat ggtgtttcgc gcggcggtgt cagaatccgg caacgcgaat gcttcggcac    106860
     acaagtaacc gtcgtagccg atgtctttga gagcctggat gatgggttcg tgattcatgt    106920
     gccccattcc tgcggcttgg cgatttgaat cgacaaagtg aatgtgtccc acgtagccct    106980
     tgccagcacg aatggcggcg gccaggtcag cttcctcgat attcatgtgg aacaaatcgg    107040
     caagcagctt gatgttgtca gtcgacaacg tcttgcaaaa ctcaacgcct tcgtcgaccg    107100
     tgcgaagcag gttggtctcg tatcgattca gcggctcgta gaacaacggc acgttgtatt    107160
     gagcagcgta ggggcccagt tcatcaagcg cctctcgcaa gaatgccaac gcttgatcgc    107220
     gagagatgtc tccgccccat tttccttgca tggatccaat gatggcgggc gcgttgtact    107280
     tgccaccgaa gtcgatcatt tgtttgacaa agtctcgagc ctttgcacga tgatctgctt    107340
     ccgcgtgagt aagactcaaa ccgtgcttga ccattccagc cccggtgcca accgcggcga    107400
     caaccaagcc gtgctcttgg agcagtccct tgagctcagc ctcatccacc gcgttgggtc    107460
     cgggagcaaa aatttcaatg gcatcaaagc cgagtgctgc tgatttttcg caagcgtctt    107520
     tgagaccgtc ccagtaaacg aatggacctc cgcgagcttc ttcgaccaga ctgaccgtga    107580
     tggcagattt aaacgtcatg ttgattcttt gtgggggaga ttggtgggga tggattggat    107640
     gtggcatagc ggactgttga tttgatgagc cgcaccgcgt tagcggcggt tgtcagacgc    107700
     taaccggggc taacgccgaa tgacgcttac ttcaccctcc ctcagggagg gtcggcccgc    107760
     ttcgggccgg ggagggcgaa cctaaaaccc ggtgtgtagc cctcccctcg cttcgctcga    107820
     ccctcccagg gggagggtga atttttaaag taagtgccat tgggctaacg cccttgtgtt    107880
     tcatacttca ctggttggaa gccaatgcca catgtctgaa ctcacgaagc gactggctcg    107940
     tcgttgttct caggtaggcc ttcgatgtag aaccaattgt ggattggttt cagaatctct    108000
     ttgacttcag caaccagcgt ttcgtcgatg ggctcttgcg cccactcaac ccactgagcg    108060
     actcggtttg ggttggccga cccgggaata caagtcgcga aatcttcgtt tgcgatgctg    108120
     aactgaagtg caattttggc gatgtcactg ccgcgatcgg cgcagtgttt ggctgcggcg    108180
     gcagcaacct cacgaacttg cggagttgct ttgtgccaag gtggcaattc cgcgttggtc    108240
     aacagacgcg ccgagaacgg agcgccgttc atcagaccaa cacctttctc ttttgccaaa    108300
     ggcaccaact cgagtgccat gtcgttttgc agcgtgtagt ggttgtacgt cagcaagcaa    108360
     tcaatgtctg tgtttgccat cacgtacttg aacatcttca tcgggtaacc actgaccccg    108420
     acgtatcgga ctttgccctt cgcgatttcg cgtcggatcg cgggaatcgt ttcctcgaca    108480
     atctgcgaca tctcgacaaa ttccaaatcg tgacacagca cgatgtcgag atggtcaacc    108540
     ttcattcgtt caagcgacgt gtcgatgctt tcggtaacgc gtttggcact gaagtcgaaa    108600
     tgctcgccgg tgtaacgccc gagtttggtc cccaggtagt actgatcacg tggaatatca    108660
     ggcaggactc gaccaagcat catctcactc atcccgcgtc catagaacgc ggcggtgtcg    108720
     atgaagttca tgccgctgtc gagtgcgacc cgaacagctt gcaagctctc acccaaatcg    108780
     acgcttcgga actcctgtcc gatcgaagac gctccaaacg aaagcgtcgt gagttccata    108840
     tccgtttggc ctaaacgtcg gcgaggcagc atcttggcag ttcttggggt tagatggtgg    108900
     tggcggattc cagggcgaca agatgcagcg agtgtaacct cgcgttgccg ccgatgccaa    108960
     cgcacccgat cccaaagaaa ccatgcccag ggctatagat tagaacgcca atgccaaggt    109020
     tttacgcttc gccatcgctc tgcccttggg ccatgcaaaa aggccggagg tcgacgcacg    109080
     attgactcgt gcacccacct ccggcctttg tcatcacgat cacgctcgcg gcgtcatcgt    109140
     cacttagcag cctgttgatt tcgtcgcata ccgaatgaca acaatttgcc gataggcgtc    109200
     agccctggtt ggcgtctgac taaccgccgc taacgcggta cggctcatca aatcgacaac    109260
     ccgttcagac tcagcgaaaa ataagtggcc taggcttcca gccttcgatt ctgcgaaaca    109320
     caggcgggaa gcctaggctg cgtctgctgt ccgacacttg tttttcgctc gttgcttcgt    109380
     cgaactaccg caaactggat ccaaacgcgg tcttgagctt gccaaggtac tgatcagctc    109440
     cattgatttc gctcagaatt tttcggctga gatcttctac tgatttgtca gccttggcca    109500
     acaacgattg agcttggttt tgttgtgcaa gcatccactc gttcagctcc aacatctgct    109560
     cacgatgagc ctcatcaacc ttggcagcaa cctttgcttt ggaagcttcc atttggctgg    109620
     cgatggccgt cttggcggcg tcgttgaaga cctgacccag gttggtgttc agcttcagat    109680
     ccaaatcttc ccaagttcca ttgaactcag catcgatctc gacgtggtcc acgttggcga    109740
     gtgattgatt catttggatc gccgccgtcg aagctcccgc gtcgcctttg acatccaaac    109800
     gcatgttgac gccggtttgt ttgctgacca aacgaccttc gagatgttca ccgcggctgc    109860
     tcaactgcac ccatacttcg cgaacgccac ctgcgattgc gactccaacg tctttgccac    109920
     gtcccaagtg aatcgggtcg gcatccattt gaggccagtg aagggtcaga cgatcgagtt    109980
     gctcgccttg tcgacgatcg cgaacgtagt cgacatcaac ggtctcagga ccttccaacc    110040
     gcaagcgagc tcgcgttgga tcggccaaca attctggtgt cggcgtcatg ttctcgacca    110100
     cgcccgtcaa cgtgaagact ttgccgtcgg cacgcatcgt gccgctgacg tcacagtgac    110160
     ggatcatcaa ttccggacgt cgattgcgtc cgaggaagtc atagtcttca ccacgaactc    110220
     gttcggtatc gggtgcaacg acggtgtagt tggcgagcgt acgtccgctg tcgaggtagt    110280
     cacgcaattg cgagagcgaa cgtcgaattt cggcactgac caaatcgact ccaaagtttt    110340
     ttgactcgct caggtcgcct ggcacaaacg cgtcgacctt gtcgaggtca gcttgctttg    110400
     ctttttccaa acgagccaag tcgctcttca tttgatcggg catcgcgttc attgcgttgc    110460
     gcaacgaaat cagctgttca cgagcggctt cggattcagc caacgtgcgc tgcaattccg    110520
     gccaatctcg caatgggttg tcgatcccgc tggctgcttc gcgaatggtt tcgacgcgtt    110580
     tttccagttc tttggtttgt tgaaccaaac gctcgtactc gcttttccaa cgacgtcgaa    110640
     tctcttcccc ggtgcgaacg gtttggagat ccttgcccat cgcttcggca cgagcactca    110700
     gcccgtttgt tgccgacgaa agcaagtttc cgatcatcga aggaccggac gcttccgttt    110760
     cgtccggcgt ttcttccagg tgtccgctcg tttcgcgagt ggttccgatt tgtaaaccag    110820
     cgatgctgcc ttgtcgaatc acccagcgtc gacggagcaa cgcatcgccg tcgatgacca    110880
     agttcaccga gtccgcttgg aaagcgttcc ggaactcttt gtcatcacgt ggatcagcga    110940
     catgcaccga atcgaattgg atctggggtg gaaagaggcc aacgcgagtc gcaccgatat    111000
     cggctcgggc tcccgtcgag gcttccaacc cgcgaaccgt gatgtagctg gccatcgggc    111060
     cgaggcccca aaacagcagc atcaaaatgg tcgcgacaac gataagccgt gtcagtaaga    111120
     atctccaacg aatcatgctg catccttgtc ttgcgaatcg cgcaattgac gaagcagata    111180
     actgagcgct tcatcgattt tatgttggtc gtcgttcgtg gtcagggctg ggcgattgga    111240
     gttgcccgat cccaatgcca cggccttctc gtttgacatc gaatgcagat cggaatccgc    111300
     gtcgaggact tcgatgtgag ttgtgttttg tttggaggaa acgtcgctcg cgggtgcgtc    111360
     aatcgctgcg gaggctcgtt tcgaatcggc acgttcatct cgatatggcg agatcttagc    111420
     caggaccggt tccgcaccat cgacgcggcg aaaatcaaag acgcgtcctg aactggcttc    111480
     ggaatcaaaa gcaatcgcat cgacggtcga cgaatccgat tcctgtgcag tatcaggcgc    111540
     gaagtgcggc tccgatactt tgctgtgtgg cgcgtcgacg aagtgttgct ccgtgttttg    111600
     tgaacgtcgc ttgcgagcgg gtgtcacaac aacatcgtct tccaaatcat cgtcttcgtt    111660
     ccagttgccc gagaccgctt tgaacatcgg ataagaaatt gcaaaggcgg gaaccagcga    111720
     aatcaggccg atcagaaagc ttcccatcac gacggtgttg ttcaggtctg tccaaggcac    111780
     cagcggaaag tcccacgctt gggccatcac ttcggacacg ccttgttgcg agaaaaacca    111840
     ctgggcaaat tgatccgaaa tcggatccaa ccgaggtgca accatcgtta caccgattgc    111900
     cgtcagagcg accatcgcgt ggttgacacg caacatcaga actccgaaca ccaacgcaac    111960
     tgccaacagg ttgccgtgag ggatcaggcc gatgagaagg cccaatgcca atccccaggc    112020
     gagctgagaa ggatatttcc tccccgcgat cgctttgcga agactgctga gcagcttgat    112080
     cgaaaacaga atcataaaac tcggcccacg cggctgatcg atggatgtaa caactggaat    112140
     cctcgtcatc atcggcatct cgaggacaac tatttagtac aaccggcaaa ttcggtgctg    112200
     ccagaccaat cggcgattca tgcatcacaa cgcggcaacg aatggatcgc cctgctctat    112260
     ggactctatt gagtttcaca ggcgttttcc cctgcctttg attgcaagga agctcgcgga    112320
     accgaatccg tttcgctgac atcttgagtc gatctgttac aatgagtttc ccgcccactc    112380
     tccttcccat cttgccattc atcgtggttt ctccacccat gcatttccga ttgctccctt    112440
     ttgatttttt acggtggacg accgtttgtt tgctcgggct aagcagttcc tggctcgtca    112500
     gcgcttcggc cgacgaacct gagatctcgt tcaatcaaga catccggtcg atcctttccg    112560
     agaactgcta cttctgtcac ggaccggatg agaacaatcg ccaagccggt ttgcggctgg    112620
     atgttcgcga ggaagcgatc gactatgccg cgattgtgcc cgaggacgtc gatggcagcg    112680
     aattggtcgc gcgaatcgat catgaagatc cggaactggt catgccaccg ccggattcgc    112740
     acaagacatt gaccgagaaa caaaagcaat tgttgaaggc gtggatcgct cagggtgccc    112800
     cttacgagga acactggtcg ttcagtccga tccagcgccc cgaagtcccc gatctgacaa    112860
     agtgggatga aacggtcgaa agcaatgatg ttcacccggt ggatgctttc atacgcgccc    112920
     gtttgctggc gaagggtcac gatctttccg gtccagcgag accggatcga ttgcttcgac    112980
     gaatgcattt ggatctggtt ggattgccgc caacttggga ggaaacccaa gacttcttca    113040
     ctcgcgttca ggagacgcag gcatccgccg acgctcggtc agcactcatt gatcaacaac    113100
     tgaacgaact attcgaaaac ccacatcacg gtgaacgcat ggcggcgttc tggttggact    113160
     tggtccgatt cgcggacacg gttggttacc acggcgacca aaaccaacac attttcccct    113220
     atcgggactg ggtgatcgac gccttccaaa acaacatgcc gtttgacgag ttcacgatca    113280
     aacaactcgc cggcgacttg ctgccgaacc caaaaacgga tgacttgatt gcgtcaggtt    113340
     tcaatcgact gaacatgatc acccgcgaag gcggtgctca acccggtgag tacttgtcca    113400
     agtatgcgac cgaccgcgtc cgaaccgtcg gcatggcgtg gatggggctg accacgggat    113460
     gcgccgaatg tcacgatcac aaattcgacc cgttcaccgc caaggatttt tattcgttgg    113520
     gtgcgttctt cgcggacatc gaacagtggg gtgtctacag cgattatgga tacacgccca    113580
     accctgactt gaagggatac aacaacaact tcccattccc tccagaaatc gaactcacca    113640
     gccccgcctt gttgcgagag caaacgcaag ccaaacagga actcattcag ctggctcgat    113700
     tgcaattggc ggcaatgccc gacgaccaaa agaccgccgc gaatgattgg ctggcaaacg    113760
     tcaacggttg gctcgaacga gaagccgatg gttggcagtc gcttccgatg gcttccgtcc    113820
     catcgaagga caaaaaagtt caagcatgga cggccaacga tgaatcggtc tcgctcggat    113880
     ctttgtcgcc acagtcaatc caagtcaacc tgctgacggc ggccaaccag tcacctcaaa    113940
     atgtcgaagt ccgcttctac atcgaggaga ccaaaccgcc aacgtcggaa gaatccgggt    114000
     cagaagaacc aaaggacgag aaaaaggaag aagcaaagcg aactcgcacg gacgtttcag    114060
     tttcattcgc ccgagccaac cgctggttgc cctctttctc cagcacggtc gctcagcaaa    114120
     acgttgcttc ccgttggtcc gtcccggcga ccgacgctgc cggacgcgcg gtcaaacagc    114180
     gtccgcatca gttcatgatc gatcaatcca aacacgctga cgatccgatg cgagcggtgt    114240
     ttgagctgtc gggaccgctg caattgaagg aaggtcagtc attgatcgcg gagatcaaag    114300
     gattggctag cgacaccgaa gtgacattcg agtcgtcgcc gttggtccgg ttgcgaccgt    114360
     ttgatgcagc ggaattggag gcgattcaga tctgcgactc aatcagccaa cccaacgcct    114420
     tgttgagctg gatgatgtcc aatcccaaac aagccaaaga tgccggtgcg atcaaacatt    114480
     ggcgtgaccg ctacctcgcc tgccgcgacg ggcggacatg gacgatggtg acgaaagcaa    114540
     ccgagccaat ggaagtgcga gtcttgccgc gtggcaattg gcaggacaaa tccggcgccg    114600
     ttgttgaacc cgccacaccg ggtttcctcg gaagctatgg catcgcaacg gacaaagaag    114660
     cagacaacaa agacgccaat gccaaacgtc tcacccgttt ggatctggct cgctggatcg    114720
     tgcatcgaga caatccgttg acagcccgag tggtcgcgaa ccgactttgg aagcaattct    114780
     tcggcgtcgg tttgaccgcg gcggtcgatg acttgggtgc tcaaggcgac ccgccttcgc    114840
     atccggaact gcttgactat ctcgcgatcg aactgatcga ttccggttgg gatctacggc    114900
     acgtgactcg tttgattttg accagccgaa cgtatcagca ggacagtcgc gttcgaccgg    114960
     agttgtctga aatcgatccc gagaaccgct tgctgtctta ccacccaccg cgtcgtttgg    115020
     aggcggagat cgttcgcgac aacgcgttgg ctgtctcggg tttgctgaac ctcgaaatcg    115080
     gtggcccatc ggtcaaacca tatcaaccgg atggctacta ctcgaacctg caattcccca    115140
     gccgcagcta tcgctcgaca gccggcgaca atcaataccg tcgcgggatc tacatgcact    115200
     ggcagcgaac gtttttgcac ccaatgctcg ccaacttcga cgcccccagt cgtgaggatt    115260
     gcgtcgcgat tcgagccaac gcgaacacgc ctcaacaggc gctaacgttg cttaacgatc    115320
     cgaccttcat cgaagcagcc agcgaactgg cgtggaacat gatcgagcag aaggagtcgg    115380
     atgaaactcg gttgcgcacg atggttcgcc gatcgcttca acgcgatgcg accagcgaag    115440
     agatcgaacg actcacggtc tttttgaatc aacagcgtga gctattcctc gccgacgaag    115500
     ctttgtcggt tcaattgacc agcatcggcc aatccgccac acggcacaac gaatcgcttt    115560
     cgcccgccga tcgtgctgag tgggccgcct ggaccgcgac ggcccgcatc gttctgaacc    115620
     tgcacgaaac catcacccgc tactaagaaa cgtttgggaa taaagtgtca ggtacctttt    115680
     gccggaacgg ctcatggggt gcttcgcaca aaaggtacct gacacttttt cccgctcatt    115740
     gctaagccat cctaaaatca catcatgaat tctttcccaa ccattcagcg gcgtagcttt    115800
     ctcaagagcg gcacgtacag cgtcggcatg gccgcgctgg gttcgatgct cgctcgcgaa    115860
     agccaagcca gccaatcgga ttcgcctcag ccacactttc ccggcacagc gaaaacagtc    115920
     atccacctct gcatggcggg cggacccagc cacgttgaat cgctcgaccc gaaaccggaa    115980
     ctggacaaga tcaacgacca gccttttccg gcttcgatga ccgacggtca acagctcgcg    116040
     cagcttcaag gatcgaaact tgtcgctcgt ggatcctttt gcaaattcaa aaagtggggc    116100
     caatcaggtc tcgaaatcag cgaactgttt ccgaacatcg gatcggttgc cgacgacctg    116160
     tgcatcatcc gatcgatgca caccgaacaa atcaatcacg acccagctca cgccttcatg    116220
     aacacgggat cgatccaaaa aggtcgtccc agcatgggct cgtggttttt gtatggcttg    116280
     ggcgccgaaa ccgattcgct gccaggtttc atcgttttca ccagccaagg ccgtcacggg    116340
     gcgcaacctg tttctgcgcg tcagtggaaa gcgggtttcc ttcctagccg gttccagggc    116400
     gtccagttcc aatcgcgagg cgacgcggtt cattatgttc gtccgcccgg cggcatcacc    116460
     gacacgactc agcgagcgac gatcgaagca gtcaacgcgt tcaaccaaga tttgctagcc    116520
     gatcgcggcg actccgaaat cgcgactcgc atcagccaat acgaaatggc gttccgaatg    116580
     caaacgtcgg tgccggaact cgccgacatg tccgatgagt cgcaagaaac attggacctg    116640
     tacggtgtga ccaagcccgg cgatggatca ttcgccagca actgtttgat ggctcggcgg    116700
     ttggcggaac gcggcgttcg gttcatccag ctctaccatc gtgcgtggga tcaccacagc    116760
     aatctagaag tcggcatgaa ggacagtgcc aaagcggtcg accaagcttc agcagcgttg    116820
     attcaagacc tgaaacgtcg cggcatgctc gacgacacgc tggtcatctg gggtggcgag    116880
     ttcggtcgaa ctccaatgaa acaaggctcc ggccgcgacc accacatcaa cgcgttttcg    116940
     ttgtggatgg ccggtggtgg cgtcaaaggt ggcatctcgt acggcaactc agatgaactt    117000
     ggctaccgtt acttgaaaga cggcgaagaa actcacgttc gtgatctgca tgcaacgatg    117060
     ctgcacactt gtggactcga ccacatgaag ctgtcggcca agtaccaggg tctcgacgtt    117120
     cgtttgaccg gggtcgaacc cgctcgtgtc ctgaaaccga ttctgaagaa tgcttgatcg    117180
     gatgaatcag acttccgtga acagagcccg tcaaacacgt tcacggttct tcgcctgggc    117240
     tttggccagc acgcttgtcg tgcatgccgc atcggtcgat gccgcggacg acaatgcttt    117300
     gttcaatcaa atgcgaagcg gcggcattgc cctgaccgac gatgtcacat cgcaaattcc    117360
     gagtctcgct ttcgtcgatg cgtctggcga accggtcgtt ccctcagagg tcaaaaagca    117420
     actcgaaaag ttggctcgcg ccggaggaat ccagcgtttt attcgcgact cggttgttgc    117480
     tcccatcgcc atcgacatgg attcgatttc caacgccgag ggtcaacgaa tcgggcatct    117540
     gctggacgtc acctttgttg tgcatgcacc gattgaccta gtcgaagact ccgacacact    117600
     tcagtcgttg ctgggcgtca acaatcaaga agcagaaaca gacgaagccg gtgcggcgaa    117660
     caaggtcacc acggaggaac tttccagact cggaatcgca gtcgactcag aatcggaatc    117720
     gtttggccga gtcagttttc cgttgctcga ccgagttctg atcaatggtg tcattcatgc    117780
     ggaaaccaaa cgccacatcg aaggtaccgc agatgattat gtaaccgtcg catggcaatt    117840
     ggatccacgc tttgagaatt cgtggagccc gatcgaacga aacgatttgg gggaggaagt    117900
     caccggcgac gcgaaaacgt atcgagggct cggtggtttg atcaccgcga cacgattgcc    117960
     agtcgacatc gcgggatccg attctgatgc aaccatcgtg caggccaaat tggtcgttca    118020
     cgaaccggtc gactggttcg gcggtcgcaa ccaattgcga agcaaactgc cgctgatcat    118080
     ccaagaccgc gtgcgtgacc ttaggaggaa gctcgcggaa gttcacgacg cgttgcgttg    118140
     agcgatcctt cgcacaaagt agcggcaggg cgcgagccct ccggttcctc accgggcggc    118200
     tcgcgccgca ccgctaacgg cgtgagacct tgctaacgct gcgggttgtg attggggctc    118260
     cgtaggccag gtcattacct ggcgtctcaa ccgatgcttt ggaacaaagc gagtcgcccg    118320
     gcaacgaatc tgaagttcat tattgaacca ctcgtgaccc cgcctaagtc aaactggccg    118380
     acaagggatc ttcaacacaa tcacaagtac ttggccagct catcgccgcg agtcgctctt    118440
     gcatcgacct tggcggtcac ctcggcgtct tccaccaacg gtggagcatg atgcggtttg    118500
     acgcgcgcgt cgatgaccag tggtccgcga cagccccaat gcttggccac cacttggact    118560
     ccaacaccgt cgacatcaat cgccgggttg ctccgtgtga acgtcaacca caaccaattg    118620
     ttcaacgtcg ctgcggcaaa ttcagaatcg tcacacaacg tgatcaatgg cacgctttca    118680
     agacctggct gatgctccag gtgcgcagtg agacgttgaa cgtcttcgcg cgacgcgtcg    118740
     ccggtgtact tgggccctct tacggcgatc acgcccggca tcactaactg cggatcggaa    118800
     attccatcgg gcagactgag accagatgga atctccgtcg cgagttctcg ggtcgattgg    118860
     cccgtcgccg cgacaaccaa cttggaacct tgattcagtc ctgtgccgct gtagtcgagc    118920
     gtgtcgatcg tcgtcttggt atggaaatgc aaatcgcgac gccaatcaac tcggcgaagg    118980
     atgtgctgga tgaagcttcc aatgtcgtgg attctgatgg aatcatctgg gtcgtccgtg    119040
     atccacaaat acttcgctag cgacaattgc ccgttaccca aaatggcatt tgcctgcgtc    119100
     aacaactcct gaggctcttt cgccttcagg tagggcatgt accgttcgct gccaattgcc    119160
     aacaacaacg gatggacgcc agccgcatcg accgcgtgaa cggctttcac accagggatc    119220
     accgttggaa tgatcgggtc cgtcaattcg tgaatcaact gtccgaatgt cgtgtcctct    119280
     tgcggaggcc ggccgacgac cgtgaacggc caaatcgcat ctttgcggtg ccaaacatgt    119340
     tccaccttca tgaaagggaa aggatgctgc agcgagtagt aacccaagtg atcgccaaag    119400
     ggaccttccg gcatggtcgc ggttggatcg acttgtccca cgatcgcgaa atcagcgtcg    119460
     gcgtaaactg gcgcatggga accgcgaatc atgcgaacac gtcgacctga aagcgctccg    119520
     gcaaacgtca actcggtcag gccttcggga agcggcatca ccgcagccaa gctcatcgcc    119580
     ggtgaaccgc cgacggtgat cgcaacttgc aacgattcgt tgcgatccat cgcggcacga    119640
     tggtgcactc cgatgccgcg atgaatttga tagtgcagcc cgacttgatt ctcagggtcg    119700
     tattcgtttc ccgcgagttg aacgcggtac atccccaaat tgactcgcat caagttggag    119760
     ggagcctccg ggtccgcaga caacacttgc ggcaaggtga caaacgaacc accgtccatc    119820
     ggccatgact tcagcgccgg cagttcactc aatcgacact ggttcgcctg aacggcaccg    119880
     cttcgagtga agcgaggcag catcgtcaac gcggtcatcg gcacacccgc gtatcgcatc    119940
     gggcttttcg gtagcgccga cggatccagt ttgacttcga tcaatcgccg cacacgttcg    120000
     agcgtatcac gaaacaaata gcgggcttgg tccaaggacg caaaaagatt tgacgccatc    120060
     ggaaacttgc agccacggac gttcgtgaac aagatcgccg ggccacctcg cagataaacg    120120
     cggcgttgga tctcggccat ctccaggttt ggatcgactt cgtcatcaac cgtgatcagc    120180
     cgatctccgc tgcgaagatc ttcgacaacg tctcgggtgc ttcgatgttt caacgcgaaa    120240
     actttctgtc gagaaccgga atcgagaggc tcgcgtgagc ctttcaatct ttgctgcaac    120300
     catgatcgcc cgatggcagc cacattttgg tgaacatagc gactgatggt agaccgaagg    120360
     cgagggatgc tgcgaaccgt tttagccttc ggcacaatcg ccgcaaactc tcgggacgag    120420
     cgtccctagg gaacatcggg ttgagccaac ataccgcgac aaccgcctcg catgctgagc    120480
     ggcgatgtcc ccccggttgt ttgaccgtca aagcgatcac cgccacaacg gaccggtcat    120540
     cgagattcgc gaatcggatt caggcgatca tttgaattcg tcttcgaaag cagcgaagtc    120600
     atcgccacct tcggccacaa attctccacc gccgaaatca tcgccatcga cggcaacggc    120660
     ttcaaactcg tcgccttcga cgacttcaat ttcatcgcca tcggccatca tctcttcttc    120720
     acaagcgggc acaacagcgg cggcgggtcg aggcttgcgg tttttcaaac ccaccacgac    120780
     caccgacaga atcatcgcga gcaagaaaac gacccagcaa atgaaataga tcatgggaga    120840
     caggtcagcc ggaaaaagtg aaggtcgtgg agcgaatcga gaaagatgcc ccacatccta    120900
     attgccgctg gtcgagtcgg caaatttggc tccggcaagc gtccgaagcc ccgttttccc    120960
     gtgtcatctc tcccacaatc caccccgtcg ctcatcccaa gcggtctcca gccggagatt    121020
     tcgctcagcg agtgtagctc aggccgaaat ggatgccttg gacgtagaac gtatcgtctc    121080
     gcatcgatgg cgcgggaaga ttgttgttcg cgtcgttgat gtttcggtca aaaatgcccg    121140
     agacctggat cgcgtcggac atggccatca agtggtatcc aatcgtgacg tcgaagtggt    121200
     tgaatcggtg ccaccccaaa ttcacgtcca gttcaggaac ccaaccgaac gtgtcgctgg    121260
     tgaaggtgcc ttcattggtg tccgaatcga cgaacagccc gccgtcttgt ggggtgtcag    121320
     gagggccgac cgttgtgctg ccctgacgat tcgccgttcg acgaacgttg ccgaatgcgg    121380
     ccttggccaa ccagttgaag ctccagcagc cttcgcggta gcgacctgcc aaaccaaatt    121440
     gagctccgtg aaattcgttg gtcgccccga aagaatcacg aattgagatg taattgcccg    121500
     catcggttcc ttcggtcagc gttgaactgg aagaaatgtt cagcccctcg gacaatcgca    121560
     tgtactggta accatacaaa acgtcgaagg tcgttcccaa cccgcctcgc caaaactgac    121620
     gcaccgagat gtcgccacca tgcagttcgc tgtaagcgtc cacgccgacc gcaccaaagc    121680
     gaccattgat ggccggatcc gcgggtgcgt tcgggaagac aaccacgttg gaatcttccg    121740
     cgtccgtcgc aacgttgaag aacggaatcg caagcacatc aaagtttctt tgatcagcac    121800
     caaagctgta attttcatca ccagcgaccc agccacgaaa gaccaggctg cgacactgat    121860
     ggttgtccaa ccacaaacca agcgtcaagc gaccaccggc cgttgcatct ttgaggacgc    121920
     tgtcgtcacc ggccaagacc gttcccgtat ccagggaccc agtgtccggt gcagtgtcgg    121980
     ttgtgaccag agccggcaag cgatcgcctt tgcggaacat gatcatcaac tcggccgatc    122040
     caaaccaacg attcggatca acacagatcg ctcctgcagg cccgcacatt ccgtcgcagc    122100
     caccgtatcc gcaactgtcg cagccatacg attcgaaccc gcaccccgga ccttccagtc    122160
     cgcagccaac gtcgaatccg cacccgcaac cttcgatccc acaaccggga ccttccatgc    122220
     cgcatccggg cccttgaaag ttcatcggtg tgcccgagcc gacgatggtt tcaccggcaa    122280
     aggttggatg ttccatgatc gtgaccgagc cagatgtctt ttgaagcacg cggcctcggt    122340
     gactcgagcc agtcgactgg atgatacgag ccccttcact cggaacgccg tgagggcgaa    122400
     ccgacatggc cgaaacaggc cgaacgattt gtgcgctgga tggttgcgag tttgatccca    122460
     caacttcgcc cagttttcgc aatcgcaaac cgccgggttc atccatgact tgcaggccgt    122520
     caccttccgc ggcggaggcg acttccatgt cgtcgtaaac gacttcgttg atttgaatgc    122580
     gactgagttc cggtgaggaa tcgggataca attcccaatc gcccgttgtc ttctcggcag    122640
     cacttccagg tgtttgatac gttccgcggt ccggcttttt gacacggacc tgagctgcca    122700
     atggtgaaca cgccaggcat gccacaagga cagcacagtt tttcgcaaac cggggaagtc    122760
     ggcgccagat caaagagttc atggggtgtt tcgcttggat tcaatcgtcg ggggtagtcg    122820
     cgaatcagag tggccgacgg gctcggagcg tgctttccac acgccacctc gcgcatcacc    122880
     agatgccacg tgaactggta tcggatggga cgatcgtgac ggttgagccg ttttggcaaa    122940
     ctttgccggt taggccgcag ttacggctga ccggcagttt cacgcgggcg gtgtttcacc    123000
     gaagtcgctg gcgatgattg aagtcgctgt tgatgatttc ggtacccgca aaacaaaacc    123060
     tgcttccgcg gattgaattt gatacgatga atttgcgaac gggacgtctc acaaccgcca    123120
     ccacgttcgc tctcgtcgcc gcccactcac tgccggagtt cacgcacatg cgtttgcgtc    123180
     gaaacagtca tcccgcccgc cggattcatt ccgtcaccgg agtcggtctc gtattgcagg    123240
     cggccatggt tggtgttctc gccatcacag ccatccagcc cgcgaccgcg tgcaccgtga    123300
     tgcgcatgac catccgtggg aagttggtaa tcgcgcgaaa tcatgattgg ccatttggcg    123360
     aggcactcgt gatcaccaac cttcgcggca ttgagaaaac atcgctcgcg ccgatcaagc    123420
     ccgcgacctg ggtttccaaa tatggcagcg tttcgttttg ccaattcggc cgtgagattc    123480
     cgtttgctgg catgaacgag aaaggactga cggtcgactt gttgcgtttg cccggggcga    123540
     ccttcccaga tcctgttgcg gttgaagccg atccaaacct caccgcggtc aacgcgattc    123600
     agtgggtgca gtatcaactc gacaccgctg aaaccgtcgc ggaagtcgtc gacagtcttt    123660
     caaccgtcgt gccgatcccg atgctgccga tggttgaaac cgttcattat tttgtgacgg    123720
     attcgaccgg cgacgttgcc gtggtcgagt tcatcaacgg cagcgcggtg gttcgccacg    123780
     gcgacgatta tcgtctggat gacgggaaac caaagaccca cgcgtgcgtg ctggccaatt    123840
     catcctggga ggattctcaa accgagctgc agaacaactc cagccgaatg cgttacggac    123900
     gtggagttcg cttggttgaa atggcaaatg agatcggagt ggaaattgcc cccatcgact    123960
     acgcgattcg ctgtttgcgt atggtcgctc aagggccgct gactcagtgg aacttggtct    124020
     accaacctga agaacgccgg atccactttc gcacacaaaa ctcgcaacaa caacgatgga    124080
     ttgacctgga tgatctgtcc ttcgaaccgg agcagactcc ccaggcaatc gacattgatc    124140
     gcaacatcaa cggcaacgtt gtgccgcaca tgaaagcggt caccgatgcg gacaacgaac    124200
     gaatcgtgaa tcatgcgttt gatcactttg tgccggcggg tctgcccagc ctgatgatca    124260
     aacagcttct tctggactat ccgagcaagc tccgatcgcc tcaaaccgct ccctgaaatc    124320
     aggttgcgat tcgggaaacg aactttctcg aaaaattctt ccgaggcacc gaaacccctc    124380
     cacggggcca atcgccgctt ttatgaagct gagcggaacg ttaacggcag cggaaagcgt    124440
     cgctcacgca cgcaatttcc ccgctgcgca ccggctgaag aacgctcatt tctgttcatt    124500
     aaaccttcac tttgagcttc gtcgtttctt cacagttgtt tcctagagtc ccgcccaaat    124560
     cactgacggc ggctcatcag caacgacgct tcccgccgtc ttccccccac ataattcgct    124620
     ggaagaaacg aatgacctgc ctgacgaccc aatcgagtcg ccgaacccca gccaccccgt    124680
     gcaccgctcc atccaccgcc cgcccaacca catcgactcg cggattcacg ctggtcgagc    124740
     tgttggttgt gatcgccatc atcggcgttt tggttggcct tcttttgcca gcggttcagt    124800
     ccgctcgcga agctgcacgt cgcatgcaat gcggtaacaa cctcaaacaa atcggcttgg    124860
     gacttcacgt ttaccacgac acgttcaaca agttccccta cggatgggac aaccgaggca    124920
     tgacctggag cggtcacatc ttgcctcaga ttgaacaagc caacctgtac caaaccttga    124980
     tctttcaaga gtcggggctt ggcaactggg gaaccgacga tggccccaat gaagaagcct    125040
     gcgaaaccgt tatcccaacc tatcgttgcc ccagcatggc gctgccattg cacatggatt    125100
     acaacggcat tccacaacgc gtgcccgcca gctatcgcgg tgttgccgga accttggcca    125160
     cgtcggatga caccagcacc gctctgcccg acacgatttc gttggaaagc ttggaccaag    125220
     acggcatctt ctatgcctgc agcaaaacca agttccgcga catcttggac ggcacgtcca    125280
     acacgatcat gatcggcgaa agctacaaca acccgaagtt cgtgaaagac ggacaaggga    125340
     tggattactg gtacatcggt gctccacaaa ccgacccttg tcgttgcgac ggcggaactg    125400
     gcggaacgga attctcggaa gtcgccggcg tcacgatcac tccggtcaac gccgtcatcc    125460
     gtgctccatt gatgagcggc cgattgatgg aactttcgtt cggcagctac cacctcggcg    125520
     gtgctcactt cttgaagtgc gacggctccg tttcattcct aacggaatcg ctggccgaag    125580
     acgtttacga cgcactgggc tcacgtgatg gcggcgaaat ccccggcgaa atctgattcg    125640
     ccgatcgacc ttcacgttcc acattacaac acattgactt ttcaatcatg gctatgaact    125700
     cagcaatcca acaagcgatg gctctgacat cggtcgcctg cctcgcgctc actttggcaa    125760
     ccaccactgg gtgcggacca agcgcccaag ccgactacgc atcgatcgga ttggttccga    125820
     tcacaggcaa cgtcaccttg gacggtcaac ctcttgaagg agccgtcgtg atgttcgaat    125880
     cgcccgatac gacgttctgt tacggaacga cggacgcaga gggcaactac gaaatcaaat    125940
     tcaacagcga agtgatgggt gttccacccg gagacaaaat ggtgcgaatc agcacgacag    126000
     cgtcgacggg tgaggtcgac tccgaaggcg ctgacgaaga tgacgacgac gccgttgctc    126060
     gacgcaaaaa gaaaaagaaa cgcaatccga acgagttggt tcctgaagcc tacaacgaag    126120
     attcgcaaat caaagcgacg atcagcgaca gccaaacggt gtacgacttc gccttgaagt    126180
     cagacggctc accgctttaa gcaggtcggc agcagtgctg gggcgtgtcc catgagctac    126240
     tgcgacgata tcaatcgatt gatctagttg tacgacggac ttcctagtcc gctcgaatcc    126300
     tggacgatcg aacaaatcgc caagatatgc ttgccaacga caacgggtgc ttcccaatgg    126360
     gagcccccgt tcttcgttgg ctgaaatgat tcggcattgt cttgggctgc taaaccttgg    126420
     gatcgaccct gctttgaact gcgtgagttt tgtcccacga cttcgcccca acgggcaacg    126480
     ccgtgaacga tttaggcgac ggtacaaaat cccagttttt gaagtcgatc gcgatcttct    126540
     ttcgtggcgc gagtgacgtt ggggagaccg caacgaggtt tgtctttctt gttcggttta    126600
     tacctcgcct ccttgctcga cttgcgttcg taattatcga tcagcgcatc ccccagcatc    126660
     tccgataagc tcggttcctc gagatcggtc tcgttgagat tctcaagaat gcgttggaaa    126720
     gaacgcacca cccctgcgaa gctgattcgc ccaggcatcg cgaccggatc accccggcga    126780
     cgtttcttcg cgaggtgtac tttcaaggca tacagcttga cgatcagaat actgaggatc    126840
     gaccaatgca actccaccaa cgcccggatg ctctggcggc agcgaagttg ccgtcgtcca    126900
     tacgtttgct ttaggttgcg aaattccagt tcgattcccc agcggctctt gtaaatcaca    126960
     agtgcttgct tgtcggtgag cttcttctca tccaagacgc tcgttaagag aactgccttt    127020
     ttgcggccga gttggatctg aatcatgcga agcttcaggg gacgcatgcc ttcacggcgt    127080
     ttgtccttgg gccagcagta aacaaggttg tcttcgtcag gctcgacatc gtagccgagg    127140
     ctatgcagca agttgacgtt cgcgccaacg cgcacgagaa agtggtgccc cccatcgata    127200
     atgctcttcc aaaattcgta gccaacgaat cccgcgtcac cggtaaacaa cgttttctcc    127260
     gggaattcac cgttttctag catctcttgc acgtgtgctc gttcggacgc attgctaggc    127320
     ccaagtttcc agcaccaagt cagttgcgtg gcaacgtgcc aaatcattgt gatccaaatc    127380
     tggggtaccg gcggtgccgg tggattcttc tcgatggcct gacggcgcat tcctttggtc    127440
     ttcttttttc gataccgagc cgttttcccg tgaccatgat tgggagcgca aaacgctttt    127500
     tcgttactca gtgttcgcgg cgttgtgtct cgagaaccat cgacagccat gacgacccaa    127560
     ccagtcgtcc tccaaagctt gccggcggtt gtctcaattt gcttctgaat ccgagtaagc    127620
     aaaacctcgg acaaccatgg agtccatcga accaacgcct tgatcagtcc agagtaactt    127680
     gaaaatgcga tcctcccgtg gacctttttg cattgccggg tgcctgaatc aaaagcatcc    127740
     ttgagcttgt ccttgtcaga gaagatccac agcaaggctt ggatcatcag agtcattgtc    127800
     ttccagccag tgttgccgtg ggcctgcgtc ggcacggcct gctcatcacc cagcacccaa    127860
     tcgatcgcac tgcggatttc tttggcgttg cgcgtctggg ctttgcgata gtgctgtcgc    127920
     tgagattcgg acttgacctt gcgtttggct cgattgaatt tcctttgtcg agcatgttct    127980
     ttggccttgc ttgattcgtg agaatcgagt ttttttgaca cagccggatc cctttctgac    128040
     tgaagtgttt cagttggttg gtagggggat ccggctttta cacttcaagg gcagttcagc    128100
     aaaacaccac aaatcacggc ctcaaaatcg ttcacggcgt tgcccgttgg ggctcgtgtc    128160
     ggggtctcca caacgaaccc caggcgatgc ctggggctat cttagagctg ccccgttggg    128220
     gcgtaggaca gaacaagtac caacgtcgta acttgcatct caaccctcaa gttttagcgg    128280
     cccaacgctg tcccaatcga ccgtgcaaaa acgtactacg aagttgccgc ttggatcgct    128340
     tcgatcaatg cgtcgggcga ttcatgcgag tatgccacgt cttgcgactc tttcgttgcc    128400
     aacgttttga cttgcaccgc accggcttcc cattcgttcc cgccggcgat gatggcgacg    128460
     gcaaaccctt gagagtcggc gtacttgagt tgttggccaa gcttcttcgg ttccgggtaa    128520
     acctcgacgc caatccctgc atcgcgaagc tgcgaagcca acttcaaata gtcgtcccgg    128580
     tgtcctttgt cgaagaacgg aacaaacacc gcacacggtt tgctgacacc tgacaatcgg    128640
     ccaaggcttt ccagcgcggc gagcaatcga tccagtccga gtgaggcacc gatgcccggc    128700
     agatgttgct tggtgtacaa ccccgccaag ttgtcgtagc gtccgccgct gcaaacgctg    128760
     ccgatgcccg gcaactcatc cagcgtcgtt tcaaagatga ctccggtgta gtaatccaac    128820
     ccgcgagcga tcgagacatc gatcttcaaa cgatccgggc tgactccgga tgccaacgca    128880
     ccgcgataga tttgagtcaa tcgttcgatt cccgctgccg cggtttcatt gccaccggtg    128940
     atctccggca gcgacgccag gatcgactcc gcgtccccat cgcattccgc caatcgcaag    129000
     acggcgtcgg cttgctcggc cgtcacacct gcggattcga ccatctcatt ggccgttttt    129060
     tcacggccga tctttccgag cttgtcgaga cttcgcagca ccggcgtcgt cttgtcggcc    129120
     aatcccaacg attccaatag accggtcaag attgcacggt tgttgatgct gatcgtgaac    129180
     gcgtcgatcc cgatcgctcg caacaacgca tcgatcacgc aaacggcttc gatatccgct    129240
     agttccgacg tcgtaccaat cgtgtcgaag tcacactgca cgaattcacg gtaccggcct    129300
     tcctgtggtt tctcaccccg ccaaaccgga gcgatgtgat aacgcttgaa cggcgttccc    129360
     aacgtgccaa tgtgttgagc ggcgaagcga gccaatggaa ccgtcaggtc aaaacgcatc    129420
     ccgaccggac gaccgccgtt gtcttcgaac gagtaaagct gacgatcggt ttcgtcgcta    129480
     cctttgccgg tcaaaatttc caggtgttcg agcgtcggcg tgtcgattgg agcaaaccca    129540
     aaactgcgaa acacttcgcg agcggtttgc atcaattgtt cccgcgggat catcgcggcg    129600
     ggcaagtagt cgcggaatcc cttcagcgtg cgaggttgaa tcatggaagt cggtgagggg    129660
     tgaatgggaa gaaggaaagt ggagggtgtg agtcgtagcg gaagtcgtca agcctttcgg    129720
     ttggcatcca aatttgccga aactcttgac gagttccgct acccaacaat cgggagtccc    129780
     gtcggacgtc gactgcggat cgaatcgatg tcccggtcgg ctccttcggg gaactgcggc    129840
     ccgaacaaag cgtccgcgta ctcgtcaatc tgctcaggcg tttcgaagta cttctcgtag    129900
     caccaatcgt cctcgaactc acactccttc gtcgtgtatt cgcgacaaat ctgaggccgg    129960
     gtttcgtaga tgccgcatcg atggtcgtcc tgcaggtgtt tgcaagtcgt gtgaacgagc    130020
     aagtaccagg tgtcttcgtc cacgaacacg gtcgctcggt cgtgcagcag ataccaccgc    130080
     atgaagtcga aatcttttcg cgtcaccggt tcgtcgatcg gcagcgcgaa gtacttgcag    130140
     cactttgccg tgcagtgatc acacagattc gcgtcggcgg gaaagtccga tcggcgacgg    130200
     ccattgaccg aaggcggcgt ggcgactggc aacttggatg cggtgggcat gattgggtcg    130260
     aatgtgataa tttgcgattt cgtcgggcca acagtttcct cgcaaaagcc tccacatgga    130320
     agtcgtcatc accgcccttg gtccggatca ctccggtttg gccgatccga tcattcacca    130380
     cgtcaccgca cgaggggctc ggatttccga aattcagatg tacgaccacg acgaggaaga    130440
     actcttcgcg atgctctgcc gcttgcagtt cgatgcgggt gccgatccag cggaactgct    130500
     cgggcaattg caggacgaga tgaaacaaat cggcgagcac accggattgt cgatccgggc    130560
     gtggagcccc gatgctcgtg cgaaccggcc gcgtttggcg gtcgcgtgca cctatgtcga    130620
     acacactccg cgagcggtat tggaagctgt ttcctcgggt caaatcgccg cggaagtccc    130680
     cgtgatcatc tccaaccgga agaaactggg ctttctggcc gatgagttcg aatgtgattt    130740
     ccggatgatc ggcgatggca cgggagccgt cgatgacgcc gcacttttgg ccacgctgga    130800
     cgaatacgac atcgattacc tgatcctggc tcgctacatg cgaattcttc ccgccgatgc    130860
     gtgctggcaa ttcgcgggcg gccggatcat caacttgcac cacggattgc taccaggctt    130920
     tcccggattc cgcccgtacc acgatgccca caatgtccga atgctgacgt ttggcgcgac    130980
     gtgccacttc atcatccccg aactcgacgc gggaaatcag acgatcaacc agcgaacttt    131040
     ttctgtagcc cccggcacgc ctctggagcg gatcatcgct caaggcgaat cagaaaacga    131100
     accggcctgt ttggtcgaag gcgtccgacg ggtcgttgat cgagaggtcc acctgcactt    131160
     ccatcgagtc gtgcctcgca aagatctggt ggcgaaatcc gccgcagcca agtgaatgat    131220
     ttaaccgacg gccgttaggt ccggttctta cacacgaaaa ccggtgctaa cgcactgcgg    131280
     ctaacacttt cagccccaac aaaccatccg tcccgccctc agcgaccgcc actcatcagc    131340
     cgacggccgt taggcccggt tcttacgctc aaaaaccggt gctaacgcac ggcggctaac    131400
     actcccaacc ccaacaaacc atccgtcccg ccctcagcga ccaccaccca tcagccgacg    131460
     gccgttaggc ccggttctca catacagaaa ccggtgctaa cacacggcgg ctaacactcc    131520
     cagtcccaac aaaccatccg tcccaccctc agcgaccacc agccgacggc cgttaggccc    131580
     ggtttctaca ctcaaaatcc agtgctaacg cactgcggct gacaaacctc aacgatcacg    131640
     cgttcatcca accctccgcc cgattctcga tccaccgcat ctgattggat tccggcggaa    131700
     cttgcaaaat tcgcttcagc gacggcgttt cgtccaacaa cggccccaat ccgtctgatc    131760
     gaccggaatg gctccccccg tctaatcgcg caagtctgcc gcaacgcgtg caatgggaat    131820
     gaatttcaat tggcttggcc gcacgaccgg acctgaacca gatcgccccc aagattctcc    131880
     gtgtggcgcg tcgataccca cggcgtctga tgcacgcagt gaccagatgg cctcgttttt    131940
     cgaggaaatt tgccatgtcg aggcggcgtg gcaccatcgg cagcagacct cccgctggac    132000
     gaaaggatgt tgatgatcgg gtactccctc gaaacgatcg atttgccgca actgcgtcgc    132060
     caagtcgaag acaaactgtg cgatctggga caacttgagc cccatcagtt cccgctgact    132120
     cagcgtgaag tggttcggcg gggagcgacc tgcggactct atttttgtct gcacggtcct    132180
     cgaagcgtga agttgaccgc gatcgccgac ctcaaaaccc aatcgctcgt ctattacggc    132240
     gtcgacggag tccgttgcga aacggttccg atggaaaacc tcacgcgggc cgccgcttga    132300
     atccgataga tcaacttctt gtgggtcacc tgccaactga gattcgacgc cggtgaagct    132360
     gatccagaga tcacggatgt cgtttcaatc gcgtcgcgac ggaccattca tccgtgcctc    132420
     gacggtggca aaacgcccaa gttcacacgc gaagtgaaat tccgttttgg atcaagattg    132480
     aaagcggcgt tttcgccata aaacgactgt attttccgtt tcctcggttg tggggggcgg    132540
     tgttaggtcg ttatgattcg cggccttcac cgcgacgggt ttggcatttg ctgcgctcgg    132600
     acgcgacact tcattcctcg acttggagga tttggaccat gcaaacgatt gaattgaaag    132660
     ggtttacgga gcggcaatgg taaagttatt ggtgcgtgat cgggaaacga ttcaggaggc    132720
     agtacgccgg tttagaaaat tggtcgagcg aagcggtatc aagaaagaaa tgcgtcgccg    132780
     cgagttctac gaaaagccga gcgaaaccaa tcgccgtgcc cgcctgcgtg ccgaacgccg    132840
     caacaaacgc acccgcatgt tgtcccgctg attgtcgatt gcacggcagc tttgaccgtg    132900
     cagtggaaac catcagcccc aagtcgttcc gtttcaattg aagcggaacc tgcccgaaaa    132960
     gcagacacca ggtctctcaa aagaccggaa acaaaacaca gaagagtcca tgacttttcg    133020
     acgggcgatt agctcagttg gctagagcgt ctcgtttaca ccgagaatgt cgggggttcg    133080
     agtccctcat cgcccatcaa gccctgcttt tcagcagggc tttttttgtg cgatgacaac    133140
     ttcatctagc gctatcccaa tgcgtcgagc cacgactggg aagccacttt gcatcacgtc    133200
     accctggaac gtcaaagatc gctcccacag ggaccatctt tgagaacgca cctagaacca    133260
     ttgctgctct cggactctgt agtcctcgta gaaactctca tccgacttcg ccaagtagat    133320
     aaaaccttcg acgaaagaga tcgtcgccat cacaaacacc agtaaaagtg gccagatgaa    133380
     gaacattccc ccaatgattc caacgactga gacgctggcc atcagcaacg ctccgcgatt    133440
     caacccaagg taaaacttgt gggagccgta tgcaccaagc aaaaacatcc ccagcaatcc    133500
     agccgtcagc ttcttatcga tgaattcttc tcggaacgga tcgttgaaac gatctagacc    133560
     atcagcaccg acaatcacct cagcggctaa tgtgactagc gacgagcaat tcggacacgc    133620
     ctgaataccg cctgattcag cgaccgagaa ctcgaactcg ctttgacaat cggggcatct    133680
     cactcctgct ttagctgact cggtcacctt gcctgtcctg tcctagttcg cttgatcaat    133740
     gtgaaacagc agcactgttt aaaagaacca ccgtaacaag tcacccacaa aagcaggttc    133800
     tatcacgctc cttttttcgc gagatcgtga ttccctgagg tgccacccgc catttgggat    133860
     ttcctggtgc agacgcgtta ttgcctgtag gccaggttcc acctggcgtg ggtgactggc    133920
     caattgaatt tccacgtcgc tgtcacatgg aatggtgcac acgcctcgtt ttgttccaaa    133980
     acattgcgtg attgccaggt ggaacctggc ctacatttcg agaacccacc cgttgcagag    134040
     gcagggcaga ttaccgaggc cgcgttttta gcattccgaa aggtgccacc cgccatttaa    134100
     gcttttctga tgcagacgcg tcgttagctg taggccaggt tccacctggc gtgggtgact    134160
     ggccgattga atttccacgt tgatgtcaca tggaatagtg cacacgcctc gctttgttcc    134220
     aaaacattgc cgtcgttgcc aggtggaacc tggcctacat ttcgagaacc cgcccgttaa    134280
     agaggccgcg ttttagcggg ttttcgaact gcgcacctct cctgaaacgc agtttggaga    134340
     gagatatata cgaggtcgag cgacgcagtt caggcgtacg cgagggtgag ggctaagcat    134400
     aggaagcggc gcggattgcc ctgccccaga acgagaaaag actgactcac agccatcgaa    134460
     ctcacttcga ctcaggcttt ttgagcatcg cctgcactcg cttctgctct ttggccaatg    134520
     ctgctggcgg gatcgccatc ggctcaaaat tcggtgacgg cttcagactt tcttcatctg    134580
     gaatctcgcg ccaccgcaaa ttgcgatacc aaaccggctg gccatgatcc tgcagccaca    134640
     gctcgccgcc acgaccagtg aggtctccgc cccgaattgt taacagcctc accatctcgg    134700
     cccactttgg atcggtgtag tcaaagtcca ggaccttttg accattgaac caatgctgaa    134760
     tcacggttcc cttgcagacc actcgtcctg aattccactc gcccacaggt cgcgtggcat    134820
     ctttcgaagg ggccatgcaa aagaacaacg aggccgctga ttgccgcggg ttttcaccgt    134880
     acggactgcc cacgttgtcg agcacctgat actcgacttg accaggcctg tagtagacgc    134940
     cgctgttgca cccgtcggac accttccatt cgaaccgaag ctcaaagtca tccgggacga    135000
     gagtacgttt gtacgtcagg gaacctccgc cagccgcacg gaaaaacgct ccatcttcga    135060
     ttcgccaatt cccgctgtgc tcccaaccat cgaaggattt gccatcaaac agttccacaa    135120
     aatctgcggc agcatcggac tgctcggctg atggagcacc ctccgtagcg gtcccaacgt    135180
     tgtctgcggc attcaaaagg cagcacatcc aaacgctcgc ggtccaaatc acggcaccga    135240
     tcaaatgaaa tttccgattg ggcagacacc ggcacttcat cgcaaatcct tggttgcaga    135300
     tagaaaattc aacacctcgc ccactctatc agccctcggc ggtgccgaga agcaaaacgc    135360
     ctcaaggacc tacagcccgg tggcggcgtg gactaggatg tagtaccagc aagcgcatgc    135420
     tgcgtcgcgg ctcttcttcc tccaacgaac gtttccacca tgcctttgtt tgaaatcgaa    135480
     acggacgccc acatcatcat cacttgggcc gaaaacgaag acgacgctcg cgaagtcgtc    135540
     gacgacgcgt accccgaaga tgaattgatg cgtttgacca aacgccctcg cgattcttgg    135600
     gtgatcagca aaggtgcact cggcctgacc gatcgcacac tcgacccgtg catgaccgct    135660
     cgcgaatgcc tcagcaaatc ggccggcgac aaagtcaacg cgattcgttt gtaccgaatg    135720
     gaaacaggtt gcgacctcga acaagcacgc atcgcgatcg aatccaatat ggtaatggga    135780
     tggtagtgga caccgccgag tcctcaccgc ttccatcact tccagattga gattctatga    135840
     tgaatgcagc gtcgcctcct aacccatggc tgtggtttgc gtgggtgatg cttgttccgt    135900
     tgctcgtcgg ctgcgatggt tgtcgccaaa ccgaagaaac ggacctgaag gaagaagtcg    135960
     cgcagcagaa attgccgcca ttcaccatcg gcccagccaa agcgttcccc gccacacgtg    136020
     ccgatgcggg aaccaaaggt gccacggacg gagccgtcaa accggggcac tggttcgccg    136080
     cgggagtgac gttgaaaagc aaccgcgaag acgaacgcgg tgcaatcgtc accgacacta    136140
     aaatcgttcg ccccgtcaac gcgttgaccg accaagtcga acgtttcgaa ttggatgcca    136200
     agatcgctga cgcgtcctcg agaacggttg gcaaatcctt tcgagttcga cgaccggcag    136260
     ttctgccaaa gggccagcgc cgcgaattgg aaacccgagc cttggcgtcg gaggcgggcg    136320
     gcagattgat cgaaggcctc gagttcgatg gcgacttcgt ctcatcacga accggcgctg    136380
     ccgtgccgct gcgaccaagc aaattcgcag cgttgcaacc gcaatcgttt ttctttgtgg    136440
     tgctcaccga acgatccgaa cgtttcaccc gactgcagac ggcggactgg gtcgagccga    136500
     tgagggcgac caacgagttt tatcgaccac gagaaaacta ccgcatcgtc atcccgccga    136560
     caaaaggtgt cctaccacta tccgaaacaa tgctggattg gacatccacc gcggtcctgt    136620
     tttgggacga cctgacatca tcagcactga cgcccggcca gcgaaacgcc atcgtcgact    136680
     ggttgcattt tggtggcacg ctgatcgtca acggcccctc gggagcggac gcgatcgacg    136740
     atccaaaatt gaaatcgttg ttaccgattc aagctgacgg gaacgaagaa ctcaacggcg    136800
     acaacgcgat cgcgtttttg aaatcacacc gggtccagac cgacgaatcc attcccgcga    136860
     tcgaagcgag attgtcaggt gacaacagca cggtctcggt ggccggccaa cccaccgccg    136920
     acgcaacctc attgggcacc ggcgacttgg tataccaacg gagaatcggt cgcggacgaa    136980
     tcgtgcaaag ccgcgtggac ctactgagcg aatggatgac ggcttggaaa tcctacgaca    137040
     gcttcttcaa cagcgtcgtc ctgagtcgac cgccacgtgt atgccaaaaa ctcgagggga    137100
     ctcccgcgtc catgccgcag ccttttctga gcgaagatga aatcgatacc gtttcagaag    137160
     aagagatggc cgcgatcatc gatcaaccaa tggttcagca aaatctggtg ggcatgacaa    137220
     ttgaagatgc tccgcccaca atcaattcgg gcttccgcct tttcgctcga gacatgcgat    137280
     tgggcaagct tccaagcctc gacgaagtca aagacgcatc cgatgaaccg aacggcgatg    137340
     aagcgtcggt tggatcagga cgatccagaa cgagcctggt tcgttccgcc aaagattacc    137400
     gaaaccgtct ggacgaagag gtgatgcagc atccagtcag tggtgtcggc ggctggaaag    137460
     atgacagcgc tttgatgttg tcctttcgca attcgctgca agaacgcatc ggtgtcacga    137520
     tccccgattc gtcgctggtc gtaaaaagct tgctgatcta cctgatcgtt ctcatcccgc    137580
     tcaactacgc cgttttccgt tggatgggac gtcttgagtg ggcttggttg gcaatgattc    137640
     caatcgcatt ggtgggcgca ttcatggtcg cgcgagcggc acaactcgac atgggctttg    137700
     cccgcagccg caacgagctg gcgttcttgg aaatcccacg cgaccacgat cgaggtcacc    137760
     tgactcgcgc gatcgcgtta tacaactcac tcgccagcaa ctattcggtc cagtttgaaa    137820
     accccgatgc ggcgatcacg atgctcgcgt ctcgacgaac cgactcacgc aacgaagcca    137880
     tgttcggctc tgatggcctg acattgcaac ttggttttga tgcaggcccc cggctcgacg    137940
     gaatcgcggt tggcagtaac tcctatggtt ccgttcacgt tgagcagatg gttccggtcg    138000
     gcgggcaaat ttctttgtct caagacggca gcacgcttcg caacgattcc aatttggacc    138060
     tgacggacgt ttacgtcatt cgccaaccta ccggatcaag tgacacatcg aagaccgaaa    138120
     tcgcggtact cggcagtgtc gctccgggag agaatcccaa aatttcgtat cagtccgcgg    138180
     accaagtgag agttccagaa ggcgttgatt cgggtgtgcg acaatgcatg cgaagaattc    138240
     tcaacagtac ctacatcgaa cctggcacaa cacggttgct aggtcgactc gcgaaggtcc    138300
     cactcgatca ggcggacgac gacgaaagtc ccgcatgggg cggtttggaa atccaaccgg    138360
     tctgcaagca agtcgaggcg gacaccatcg tgctggcaca tttggaatac ccggccgtcc    138420
     ccacgcctca acccgacgaa aacttgatgg acgacttccg cagtcgaacc accacgctgg    138480
     aagaagagaa ggccaacaaa gcgaaagaag ccaagaagaa aagcgaagaa gaatccgcgg    138540
     gcactgaagt caccgaagaa tccgacacca cgaaggaaac gccatgatca ccctggaagg    138600
     ctttggcaaa gactatggtg agttcaccgc ggtcgaatcg atcgatttgc aaatcgacgc    138660
     tggggaaacg tttggcttca tcggccccaa cggagccggc aagagcacca cgattcgttt    138720
     ccttgccaca ttgttgcgag ccactcgcgg acgcggtgaa gttgccggat gcgacgtgat    138780
     gaacgacccg atgggtgttc gccgcgcgat tggctacatg cccgacaact ttggcgtcta    138840
     cgacgggatg cgggtgtggg aattcttgga cttcttcgcc gtcgcctacg gtattgctcg    138900
     atcacaacgt ggccccatca tcgacaacgt gctcgaactg ctggacctgg gtcacaaacg    138960
     agacgacttc gtcaacggct tgtctcgcgg aatgaagcaa cggctgtgcc tcgccaaaac    139020
     gctggtgcac gatccaccgg tactgatctt ggacgaaccc gccagtggct tggatccgcg    139080
     tgctcgtgtg gaagtcaaag cgttgctgaa agaactgcgc cggatgggaa agaccattct    139140
     gatcagcagc cacattctca cggaactcgc cgattgctgc acatcaattg gcatcatcga    139200
     gcgcggccaa ctgctaatga gcgggccgat tgaccaggtc tatcgcaaga tccgacgcaa    139260
     tcgaacagtc gaaatcgcat tcaccgagaa cgccgaagcc gggatctcga tccttcgcag    139320
     cagccccgcc cttcgtgact tggagatgcg tccggatcga gtgatcgcgg aactggaaac    139380
     cgatgacgct ggtttgtcga cgttgctcaa tcacttgatt gcgcagggcg ttcaaatgcg    139440
     atccttctac gatcgcgatc cgacgctcga agacgtcttc atgagcgtca ccgaaggttt    139500
     ggtctcatag gccggttgac tatcgcatcg acggcagcaa gccgcggaca acacgaacga    139560
     gcaaactgcc gctggcactc tgctcggttg ggcccgtcac tcttccggag cctctcgacg    139620
     gaagacagca acaatgtcgt cgaccggcac tacgaacaat tgattgtcgt gttccaagtc    139680
     caccgggatc gcattcttcg ggtgaaatag aattttgtcg tactgacgca gcggcaactc    139740
     ttcatcgttt tcgaccacgg cactgatcgt tacgattcga ccggtgatgg ttggaatctc    139800
     ggccgcatca ggcagagcga tcccgccgcg agtctctcgc ttgggttcgt ccttgcgaac    139860
     caaaacgcga tcgccgatcg gttcgacgta ttcgaatact ttcggcgcgg ttttcttttt    139920
     ggccatgtct tatttctttg gtgcacattc agatgaagcg tccgggggga ctgaaacgga    139980
     atcccctaga catcccgcga tacgtcgcca ggatgcccga gtcgagtggg tcaatcgaaa    140040
     aggaccctag cgaccgtcca cttttgagaa aatcattttg ccagcgttgg tttgcagcgt    140100
     gctggtcaca cgcacgtcaa tctcttgccc gattttatga cgcccgcctt cgacaacgac    140160
     catcgtgcca tcatcgagat agccgatgcc ttgctcgggg ccttcaccgg gtttaatgat    140220
     ccgcaatcgg aacgattcat ccggcaagaa gactggccgc aacgagttgc tgatctcgtt    140280
     caagttgatc accggaacac cttggacctt ggcaaccttg ttgaggttgt agtcgccggt    140340
     gacgaccttg ccttccaaat gtttggccaa caaaaccagc ttcagatcga ccgtttgtcc    140400
     tgccagttcg ggcagctctc ggtcgaagat ctgcaagtcc acgttctcgt ccgcacgcag    140460
     ccggttcagc acgtccaaac cgcggcgacc gcgagtgcga cgcaacttgt cgctgctatc    140520
     ggcgatcgct tgcagttcac tcaacgcaaa tcgcggcatg atcaattggt tgtcgaagac    140580
     tcccgtcgcg accaaatccg cgatccggcc atcgatgacg acactggtgt ctagcaccaa    140640
     aggcttgaac cctttgactt cgcgaacaaa ttccacataa ggaatgagga atcggaagtc    140700
     atctttggtc tgcagcaaga ctgacgtgca gacataacac agcaccaacc cgacgaccaa    140760
     ttggaagaca cgcaggttgc tcgtcatctc aatcagcggt gccgctgcga tcgtcaggat    140820
     gaaagtcagc aggacaccga tcagcacccc gaaatacacc gaggtgatgg tgtcgatccg    140880
     cttccgcggc acatagatgt ccagcaccac gatcgccaca gccagcccca tgatggcgac    140940
     aaacgtcaac cacggaaccg cctctgaccc gccgctaggc agggaggtgt tgatgatcgc    141000
     tgaaacgcct ccggcgcaca gcaaaaagat gaatcgcagg acaatcagtg ccatggtggg    141060
     tgcagcgttg gtcaaaacgc cgcttcagca aatacgggga cgaaaagagg gaggctccag    141120
     tgtagatggt accgctggaa cgcccagggg gttcgcctgt gcaggagaac cctaggttaa    141180
     cggttgccac aaatcgattg agtgcgtcca cgggagacaa attgtccgac cggaaccatt    141240
     gatttcaagc tcttccggcg gatcaaaagc atgctctgca ctgatttgct caccaatccg    141300
     acagcggacc attcttggac tgccgcaaga cagaaaactg ctggtcgcag aaccgatcgg    141360
     tcattcccgc caagtactcg cccaccaccc ggtctttcgg ccggtgttcg agtcgacgtc    141420
     ggaaccgcaa cggcaaacgc tcggggtttt ggtgcaatgc ctcaaacagc gtccggactc    141480
     gattcgcggc agcttcccgg accggcatca gccgatcgtg ccggtaaaca gcctcgaaca    141540
     aaaagctctc caattcggct cgttcggatg ccatggtctg cgaatgcccg actcgaatcc    141600
     cagcctgaca ggcggcatcg gcggacaaac cgtccgcgtc ctgcatccgc tcgatcgaaa    141660
     tgtgaagcaa atcgccgacc tgcagatcaa tcagctcgtg aaccaacaat tgacgcagcg    141720
     gcccaacggg caactcgccc gccttttcgc gaacgcgttc tagcgttcgg cggatgatcg    141780
     ccagttcaga caaagcgtcg atcgacaaca atcccatctg caatgcatcg tcgatgtcgt    141840
     gagcgtcgta ggcgattgaa tccgccgcat cgacgatttg gacctccaac aacggtgcat    141900
     gtccaaccgc ggcttcggct ttatgcgcac gggtgtcttg gccggccaaa gtctcctgcg    141960
     acaggttcaa ccctggaaac gcgtggtatc gctgctccag ttcttgaacg atcgtcagag    142020
     cgaattgatt gtgtgaaaaa ccgccgaccg attgcatgca ttccgagaga acgtcctcac    142080
     cacaatgacc aaaaggcgga tgcccgatgt cgtgcatcaa cgcgagcgcc tcggtgaggt    142140
     cttcgttcaa ccggaggact cgtgccaacg tccgagccac cgatgcgact tcaaacgtgt    142200
     gagtcaatct cgttcggtga tacgtgccca tctcaccggt gaacacttgc atctttcccg    142260
     acaaccgccg aaacgcactg ctgtgcaaga tacggtctcg gtcgcgaccg tagggaccgc    142320
     ggtaagcgtg cggttgttcg gggtgcactc gccccgccgt gtcagaactg tgcatcgcgt    142380
     aggacgccag caacaggtgt tcgcgatcgg cgtaacggcg aagatcgatc atcggaccgg    142440
     ctagagacat gagtcgtcgt tccatcaatg ccgaccattg tcggcgattt agttttgtca    142500
     gcgagtaatt tcagtggtcg tagaaagcgg actctcgatc gacacctcca ccatcagatg    142560
     ccaagcgatg gcagattccg tctctaccct cctaacatgc agcacgattc gcgccgcgac    142620
     gacactttgc gccgcattca cgcgacgaat ctcaattccg tccccatcca aacgttgaag    142680
     aaacgggctt gagatggcca tcagcagccg cccagcagcc attttctaac tcgatggctt    142740
     ctaccgggtg gcctgcggcc ggttcagagt agctttcatt gcgccattct cccatagcat    142800
     ctgaccccac cgtcgccttc gcaacgagcc attttggcat gcaacgttct gaccgcggca    142860
     ttttcagcca attttcgcct cgaaaccggt ttcctcacga attcggcggt gaatcgtgca    142920
     ggaaactcgc gagaaagcct cctccccggc agacggggga acatgcgccc aacgaattgg    142980
     ttgctgaaaa caaacatcgg aatagactga gcccgccgaa tcggtgcggt ccctacaaac    143040
     ggttctcgcg tctttttccg acccatcact acgatcggcc ctccacccca ccttgatcaa    143100
     cagcatgact gacccagtaa tcggctccga gtcgcccgtc cccgccgcct cggcgaccac    143160
     caccgccccg atcaccaacc gatttcgtcc agccaaagtc atcatggccc tgccggccta    143220
     caacgaagaa caatcgttgc cggaactgct ggaacgaatc ggcgaagcct tcgcagacag    143280
     cggactgccc tatgaagtcg tcattgtcga cgatggcagc aaagacgaca cggccaaaat    143340
     cgcttcgcag atgtcgtttc aaatgcccat ccatttggtc cgtcacgaag tcaaccaagg    143400
     actcggcgtc accatccgcg acggactcaa agaagcggtc gaccgcgccg gagaacgcga    143460
     catcatcgtc acgatggatg ccgacaacac gcacccacct ggattgatca atcgcatggt    143520
     gcaatcggtc cacgaaggat gtgactgcgt gatcgcgtcg cgattccaaa acggcgcacg    143580
     agtcgttggc gtaccaatcg agcgtcactt cctcagcatc ggggctcgcg tattgttcac    143640
     ggtcctgttc cccacacgtg gtgttcgcga ttacacatcc ggttatcgag cctatcgtgc    143700
     atcggccctg cgagccgcct tcgatcacta cggcgacgac ttcgttggcg agaccggctt    143760
     ttcctgcatg gccgacattt tgctgaagct tcgcaaacaa ggatgcgtgt tcggcgaatc    143820
     gccgctgcgt ctgcgttacg accaaaaggg tggcgatagc aaaatgcaag tcttcaagac    143880
     catttggctg acgctcaaga tgttgggtcg ccaccgtgtc tcaggaacct gattgatgtc    143940
     ggttgcctcc ccatccaacc cggtgtcaga ttcctcctcc acgccccact ccagttcaac    144000
     caacgacggc tctcccagca cacgttggtt ggtcatcggt ggtggcgtca tgggattgca    144060
     ggtcgctcgt gacctgatcg atcgcggtca agaggtcacg attgccgaag ccgcacccac    144120
     cttcggtgga ttgaccagtg cttggaactt aggcgatgtg atctgggatc gcttctatca    144180
     cgtgacgctg ctcagcgaca ccaaactgcg agacctcctg accgaccttg gtttggaatc    144240
     gcaaatggac tgggtcgaaa ccaaaacggg tttctactcg ggtgggcaat tgatctcgat    144300
     gagcaacacg gcggagttct tgaaattccc gccgctgaat ctgattcaaa aactgcggct    144360
     cggcggcacg atcttctacg cctccaagat caagaattgg cgtcgcctcg aaaaactgtc    144420
     cgtcgaaaag tggttgcgtc gctggtcggg caaaggcgtc ttcgaaaaga tctggcaacc    144480
     gctcctgcaa gccaaactgg gcgaagccta caagcaaacc tccgccgcgt tcatctgggc    144540
     ccacaccgct cggatgtaca aagcccgccg aagtggcatg aagacggaga tgttcggtta    144600
     tgtgccaggt ggctacgcaa cgatcctgga caaatgggtt ggctggctga aagagcgagg    144660
     agctgaaaca ctcacgtcat cgccggcacg ccaagtccgc aaactcgaaa gcggtgagtt    144720
     tgaagtcgat ttcggtgacg gccgcacgca gaaattcgac aacgtcgttt ccaccatcgc    144780
     gtcgcccgtg atcgccgaca cggtccccca actttccgac gaagaaaaga aacgacatcg    144840
     cggaatccgc tatctcggcg tggtgtgcgc ttcgatgctg atgaagaaac ccatcagcga    144900
     gtactacgtc accaatatca ccgacacctg ggtcccgctg accgccgtga tcgagatgtc    144960
     aacgatcgtg aatccagaca agcaacttgg cggcaatcac ttggtctatt tgcccaagta    145020
     cttgcccgat gatcacgagg gcctgaacga atccgacgaa gactacaaag agaagtgttt    145080
     gtcgacgctg gagaagatgt acgaccattt ttcccgcgat caagttctcg atttcaagat    145140
     cgcgcgagcg aaatacgtcg cggcactcgc cacgattgat tactcaacgc gtttgcctga    145200
     cattgtgacc agtgtccctg gcttctacgc tttgaattcc gctcacatcg tcaaaggcaa    145260
     cttgaacgtc aacgagacga tcactttggg cgaagaaaag ttcaccgaag aagtctggcc    145320
     cgactaccaa cgtcgcgttg cgaaatgaac tgaccgccat gccacacgcc gctcctcctc    145380
     cattgctcgg cgtgttgcta gccggtggac gttcgtcgcg aatgggaacg ccaaaggcct    145440
     tgctgccaca tccaagtggc gggacgtttc tgacacacag cctggaccga ttgcgattgg    145500
     tgtgtgaaga aaagattgtg gtcagcttgg cctccgaggc ccatcgagcc caagttcaat    145560
     tgccgccgtc ggttcctgcg ttgtttgatt cccagccggc cttggggcca gcgatgggcg    145620
     tgtcggtcgc cctgcaacac gcgtcgtcca acggtttcgc aggttgtctt ttcacgccgg    145680
     tggacctacc tgatttgtcc gtcgacgatc tgctgtcgtt ggttcatgcc tggcgagaat    145740
     cgccgacgca aatcgtgctg gcacagcaaa ccgatccgga acgtctgcag cctttggtgg    145800
     gcatctatcc cgtcgcctgc atggactcta ttcaacgcgt cgtcgaatcc gaacaccgca    145860
     gcctgtatcg ttccctacgt tcgagcgacc accaaaccgt tgcgattccc tccacccgac    145920
     tgcgcaacgt caacacgccc gccgacttgg gccctccttt cgacagcacc tgattgaacc    145980
     aacatgaacg ccactcccaa attcgcgttc gactcacccg aagaagccat tgatgcactg    146040
     tcccgtcgga tcgggacaac cggcgtccag cgagtcgaaa tcggcgaatc acacgattca    146100
     ttgcgatcac tccatcggcg agttctcgcc acaccaattc ttgccgaccg tgacagcccc    146160
     gcggcagacg tttcagcgat ggatggctac gcgattcgcg aatcggactt gctaaatgaa    146220
     gggccgatcg aagtgaccgg cgagagcgtt cccggttcac ctccaccgtc cgcatccgac    146280
     accggcgtca ttcgaatctt cactggcgcg atcgttcccg tcggttgcga tcgagtcatc    146340
     cagcgagaac acaccgacga aaccgcaccg gcttcggcaa gcgactccca ttcgctcggc    146400
     caaatccagt ggaccgatca ggccaagtcg atccccgccg gagccaacat tcgtcgtcag    146460
     ggagaaaacc tttcggcggg ctcgatcgcg gtggaagcgg gtttggaact gacctctccg    146520
     cggctcgctg cattgaccaa ctttggcgtc caacaagtcg acctgcacaa acccgttcgc    146580
     gtcgcggtgt tgacgaccgg agacgaattg gcatctggca ctgccccgga tcaatcgcct    146640
     ttgccaccct ggaaaatccg caacagcaac gcgtccgctt tgctcggatt gttgaccaat    146700
     caaccttgga ttgattgtgc accgccgatg cacgcggttg acgaacccgc cgcacttctc    146760
     acggccgtgc aacatgccat cgagcaccac gatgtggtgc tgatgaccgg aggcgtttcg    146820
     atgggcgact acgattacgt ccctcgaatc ttgcgagaag ccggcgcaga gatcgtcttt    146880
     cacaagcttc cgctgcgacc gggcaaaccg attttaggtg ccgttcacca aagcgactcc    146940
     aagtcgacgc tgatccttgg actgcccgga aacccagtca gcgcaacgat gggagcccga    147000
     cgattcgcga tgccactgat tcgcaaacta gccggcatga caaactggga ggagtttcct    147060
     ccgctggtga cgctcgaaga ggtcagtgag aagacgctgc cgctgcactg gttgcgaggc    147120
     gtccgcctga cacaaccggg ccgtgcggca ttggtgatcg gcaaaggctc gggcgatgtc    147180
     gccacactcg ccggtaccga cggcttcatc gagatgccac ctcatgcaaa tcacgccgga    147240
     ccgtggccgt atttcgcgtg gtgattgacc ccgcgagtat tgacgttaac aaagaaaaac    147300
     gcccgagcat cggaatgctc gagcgttttc gaattcaatc ttggaaacaa aaaatcaggc    147360
     gaactgataa ccttcttcgc cgtgatctga aatgtccaaa ccacgctgtt cgctttcggc    147420
     aggaactcgc agtccgatgc agatgtcgat cagcttcagc aggatcagac ttccgactcc    147480
     ggcgaacacg taggtgacca gcacggcgac aacctgcccg atgaccaagg tgaagtcacc    147540
     gcccgattcg atcaatccga ttggcacacc atcgctgaca tcccaggccg cacgagtcgc    147600
     gaaaacgccg gtcagaattg cgccgagtgt gccgccgact ccgtggacgc caaacgcatc    147660
     caaagcatcg tcataacgaa gtttgtgctt cagcgtcgaa cacgcccaat aacaaactcc    147720
     gcccgccatc gctcccatga tcaaagctgg catgggctga acaaatccag cggccggtgt    147780
     gatgcaaacc aatccggcga ccgcaccact gctggcgccc agaacggtcg gcttgccaag    147840
     gaccagccat tcaagtgtca cccaagcaac cgccccggcg gcggccgaaa agtgagtcac    147900
     ggcgaaagca ctggctgtca aatcatccga tgcaagttca ctgccggcgt tgaagccgaa    147960
     ccatcccacc cataacatcg cggcaccaag tgccgtgtag gtcaagttgt gcggttgcaa    148020
     aggttcgcgt gggtacccca ttcgaggacc gatcagcaac gccgcgacca aagccgagat    148080
     cccgctgctg atgtgaacaa ccgtcccacc cgcaaagtcg agtgctcccc cggccaaggc    148140
     tttgtcaccg gcaaagtacg acaaaggtcc ttcgtcccaa acccagtggg tcagtgggca    148200
     atagatgaat gttccccaaa ggatcgagaa aaccaccatc gcgctaaact tcatccgttc    148260
     cgcgaatgca ccgcagatca gagcgggcgt gatgatgaag aacatgcctt ggaacaacat    148320
     gtgagtcatt cgcgtcatcg cgccttccat cggcgtgatg gctttgccca agtcatcgtc    148380
     ccagtaccgc tggacacctt ccatgaacaa gtagtccgtg ttgccgaacc aaccgcctga    148440
     tccaccgaag gcaaacgagt aaccgtagag tgcccaaagc accgtcatca ttcccatcaa    148500
     gaagatgcac tgcatcatca cgctgagaac atttttgcga cgcaccaaac caccgtagaa    148560
     catcgccagg cctggtgcgg tcatgaacaa caccaaagca caacaaacca gcatccaacc    148620
     gttgtgtccg gccagcaaag cctcatcgac tcccgcttgc aggctttcca atgtcggagc    148680
     ggccggctcc tcggctgctt cgttttcctc cgccggggca atttcctccg ccgaagccga    148740
     cggttcggcc ggtgcagtct cagccgccga ggtatttgcg acctcgtcct gagcccccac    148800
     actggcaacc ggcaggccga ccaggggcac accgagaatg cacgtgagca aacaaacgac    148860
     aaccaacacg cgtgacaaca ttccgggcag gctccagtga aaagtcgatg gggatgatgg    148920
     tggatgaagc gtaatttccg ccacatcacg accagagagg acaaccgcga cttcccgctt    148980
     cgatgggttc gctcccccaa ggaaacggac cgcaatcgac gcgactgacg cgtgcgttct    149040
     tcatgatttc cggtagaata cgatgacggc cgaacccggg acaccctgcc ctttgtttca    149100
     aaggtgtcat cctgctcctt accatgccat ttcgcggccc tcccacccat catgtggccc    149160
     catgcgttcc gtttctttga ttcaccaaag cacgaaaatt gctggttttc tactgctttc    149220
     caccctcgct tcggtctccc acgccgccac ccccgaggaa attgccgctc aaattgaaag    149280
     cttgtccagc gattcatatt tgcgacgaga gaacgccacc gaagcacttt tgaaagctgg    149340
     ccccgccgca attgacccct tggtcaaagt gctcgaacgt ggcgatttgg aaaccactca    149400
     acgggcgatc ggtatcctac aatcgatcgc catggctcgg ccgatcatcg aaggagaatc    149460
     agagcggccc aaattggctc ggttggatcc cgacgaaccg gatgcctggg agacactgct    149520
     gtcgctttcg acaatgggcg gcagtcgtgg cgaaagagct tccatggcgg tcgaagaaat    149580
     cacccatgtc cggcgagccc agacgatcca gacactgtca ttgcaaggtg ccgtgatcgg    149640
     cgtcaaagaa tttgtttacg gtgcaacgag cactctgcaa cgcgtcgtcg aaatcaacga    149700
     ggcgtaccaa ggcgacgatt cgctcttgga actcctacgc tggatcgatc gagtcgagta    149760
     cgctcgcatc gaaggccccg ccattcgcga aggcgtcttg aaaggcatca cccaaatgcc    149820
     cgacctaaaa acgctatcgc tgctctacgg cgacatcaac atggaaacga tgaaggtcat    149880
     cggtgacttg gaatccatcg atcatttgga gtttcgttac gtcacgttga acgacgaaat    149940
     gatcgacgcg atcgcgaagc ttcccattcg cgtttcgttg acgctcaacg gcaccgatgc    150000
     gtcctccgac cgagtggatc gattgcggca aactctgccg ggattgaaga tcgaatacaa    150060
     acgcggcggg ttcttgggtg tccgctgcaa tgacacgttc aacgagtgca tcattcaaag    150120
     cgtcgtcgaa gacagcggag ccgaagctgc tggacttcgt cgagacgacg tgatcatcca    150180
     agccaacggc gaaccggttc gaagattcgc cgacctgcaa gccgtgatca acacgcgaga    150240
     ccccgggcaa aatattcata tcgtttatcg acgactcaat gtcgagtatg aaaccgatgc    150300
     gaaacttggc aaactgacag aacccaactg attcgcgacc aacgcggatt caagttcgcc    150360
     catcggttca cgctcgcttc ttctcctctc gcatccgcgc aacaccatcg ataccgaagc    150420
     tccgcagatc gattccggca attggcaaga ttccaattgg cggtctcgaa tgcgcaagcg    150480
     actgctgagt tggttctcgg acaacgctcg cgaccttccc tggcgacgcg atcattcgcc    150540
     gtaccgggtt tggatcagcg agatcatgtg ccagcaaact caggtggcga cggttctgcc    150600
     gtacttcgaa cgcttcctca gcacctaccc aacgattcgc gatttggcgg acgctgacga    150660
     aagccagctg atgcgaatgt gggaaggcct gggctattac cgccgggcca gatcactgca    150720
     cgccgcagcg aaaaaaatgg tcgaagaaca caacggcgag ttcccggagt ctttcgacga    150780
     tgtgctggca ttgccgggca ttggtcgcta caccgcggga gcgatccagt cgatttctcg    150840
     caacaaagcg tttccaatac tggaaggcaa cacccaaagg gttttcagcc gatggatcgg    150900
     tttgaccgtg ccgccaaccg agaaagtcgc tcaggccaga ctgtgggaat tatccgacaa    150960
     aatgctgcca ccccgaaagg cggacgatcg atccaatggc ccggcgggat tcaaccaagc    151020
     cgcgatggaa ctgggggcac tgatttgttc tccgcgatcg ccaaagtgcg acgagtgccc    151080
     ggtggcgaca atgtgccacg ccaaccaaat ggggctgcaa gacgaaattc cgggcaagat    151140
     cagcaaggtt cagtacgagt cccgaaccga actcgccgtt gtgatttctc gcgacgatcg    151200
     gtacctcgtt cgaacaattc ccgaaggagt tcgcttcgcg ggaatgatcg attttcctcg    151260
     cgcgggtcca ccagaggccg ccgacgttgt cggaatggaa tcctggctgg cagatcaact    151320
     gggcggcgac gtgaggatcg gaatgtgctt aaaaaccatc aaacacgcgg tcactcgcta    151380
     ccgaatgacg ttgcacgttc acatcggcga atggattgcc gatggcgacc gcgtcgcaga    151440
     aagtggaccg atacccgact cctggcaatg ggctacggtc gatgagttgg cggacatgcc    151500
     aatgagtgtg accgggcgaa aaattgtgcg tttactcgac cgtcctcagc gttctctttt    151560
     ctccgaactc tgaaccgccg cgtcgacgtt tgcgttcgaa acgaatcacc tcgttttgag    151620
     tcgcgagccg tgcccaagat gctaaactgt aggtcctgcc tcaaggcgag aaaccaacgc    151680
     gtttcgcacc gccttgccat cggttttccc gctgtcactg ccagccgaga gaacaagccg    151740
     gactcgtccg cccgatgctt cgtttcaacg acgccttccc aaacactttg aatttcacca    151800
     tgaccattca tcgcttcttg atgtgtgccg cggcgacttt ggttgccgcc ggcccaaccg    151860
     ccttcgccgc cgaaaccgtt tcgctcggcg acccaacact caccgctgga atccccggcg    151920
     acggccctct gacgctggaa caagcccaac gttttttggc cgatgacgac aaccacacgg    151980
     aactgaacgt tgaacttccc aaggggctcg atgccgcctc gggcaacatt tatatcccgg    152040
     aagacaaccc gatcacgcga gccaaaatcg agctgggacg tcagctgtat ttcgacccgc    152100
     gcctgtcagc cgacggcacg atctcttgcg ccacatgcca cgcacctgaa accggctggg    152160
     gtgccccgac tcaatttggc gaaggcatcc gaggtcaaac cggcaaccgc aactcaccgg    152220
     tctcgttcaa tcgcatcctc agcaaacatc aattccatga tggacgcgcg gcgtccttgg    152280
     aagagcaagc cgtgggaccg atcgccaacc caatcgaaat gggcaatacc cacgaagtct    152340
     gcgtgaagac actcgctgac aacccggtct acaaagctca gtttgacaag gtattcgacg    152400
     atggtgtgac gatcgataac atcggcaaag cactggccac gttcgaacga gcgatcgtga    152460
     ccgggcccgc tccgtacgac tactacgctc ctttgtcggc gtttgaaaaa acgtttgccg    152520
     aagatttgga atacctcgac gaagagcccg cactcgccga gcaatatgcc aagctgaaag    152580
     aagaagccgc caaaaacccg atgaccgaat catcgattcg cggcatggaa ctgacctttg    152640
     gaaaagccaa ctgcaccgcc tgccacgcgg gtgccaactt caccgacgag caatttcata    152700
     acatcggtgt tggcatggat tcggagaatc ctgacttggg tcgtttcgaa gtgaccaaag    152760
     aagaaaagga tcgcggcgca ttcaaaacgc ccaccatgcg taacgtcgcc gacacgggac    152820
     cgtacatgca cgacggcagt caagcgacgc tggaagaagt catcgagtgg tacaacaaag    152880
     gtggacaccc caacccctac ctcagcaaca agatgaagcc actgaacttg accgaacaag    152940
     agaaagcgga cttggtcgag ttcatgcgtc agggattgca aagcgatttc cccgtcatcg    153000
     aagccggccg tttaccagcc gaaggctgat ccgcaagcat tcaacctgtg gctcggtggt    153060
     ctccaccgag aacgaggtcg tgcagttgtg aaatgctgtg ccagtaaccc cttgagaacc    153120
     ccacccgcgc agcgggagga gtcggaaaga gagcgttcag cgagatttcc gggggagggc    153180
     aacgtgcgcc gtttctcatg ctcggccccc tccctgacgt acgcctgaac ggcgtcgttc    153240
     gacctccccc gaaacttcgt tttgggagag gtacgccgcg tgcaaatccg ccgaaaagcg    153300
     gcacttaaaa actgcacaac caagaatcat ggcggggacc gccgtgctac agcacttcac    153360
     gcttcgcttt gttgcaaagc atcggtgcgg ttgccaggtg agaacctggc ctacttctac    153420
     ttcacagcga aaaccatcga gcctacatga tgtcttcggc gggtttgttt cgccgacgtg    153480
     cgacgccggt gtccaccgca gctttcgcaa ccgcctgagc gaccactttc gcgacacgcc    153540
     ggtcaaacac gctggggatc acatagtcat ccagcagatc cgactcaggg atcgttgccg    153600
     cgatcgcttc cgcggcagcc aatttcatct cgttgttgat cgttgttgct cgaacgtcta    153660
     agaccccacg gaacaaacca gggaagcaca gcacattgtt gatctggttg gggaagtcgc    153720
     tccgtccggt cgccatgatg cggacgtgag gggccgcgtt ggcgggcaaa atttctggat    153780
     caggattggc caaagcaaac acgatcggat cagccgccat cgcagcgacg tcttccgtct    153840
     gcagaacgtt gggtgccgac acaccgatga acacatcggc tccttgaatc acttcagaga    153900
     gcttgcccga cgcaccacgc gggttggtgt tgtctgcaat ccactgcttg gatgcatccg    153960
     gctggctggg ttcgcccgcg tgaatggctc catcacgatc gcaaaccacg atgtctttcg    154020
     caccggagat caacagcaac ttgacgatcg cggttccagc cgcaccggcg ccgttgacga    154080
     cgatgcgaat gtttggaagt gctttgccaa cgcgaagcaa actgttcttc aatcccgcca    154140
     acaccacgat cgcggtgccg tgttgatcgt cgtgaaagac cgggatttcg agttctttgt    154200
     ccagccgttc ttcgatctcg atgcaacgtg gtgccgagat gtcttccaag ttgactccgc    154260
     caaacgtcgg tgccagctga cggacggttt cgatgatcgc ttcggtgtct tgagtgtcca    154320
     agcaaatagg gaacgcgtcg acgcccgcga attctttgaa cagcatcgct ttgccttcca    154380
     tcaccggcat ggcggcgcga ggcccgatgt ttcccaaccc caaaacggcg gaaccgtcac    154440
     tgaccactgc aacggtgttt tgccgaatgg tcaaagcgaa cgacgaatcg ggatcttccg    154500
     cgatcgcatt gcatacacga gcaacgccgg gcgtgtaggc catcgacaaa tcgtcacgag    154560
     ttttgatcgg catctttggc aagacttcaa ttttgccgcc caggtgcatc aggaagacac    154620
     ggtcggaggt gtgcaccacc tcgacctctt ccaccgtgcg aagatgttcc acaatccgtt    154680
     tgccgtggtc gacatcgcga gcgttgaccg tgaagtcacg cgaaattttg ccgccgcgaa    154740
     tgttgacgat gtcgactgcg ccgatcgccc catccgcttc gccaatcgcg gtggtgatct    154800
     tgcccatcgc gccgggcgaa tcggaataac gcaaacggat cgtgatggcg tacgacggac    154860
     tgtgctggtt catcttggcg agtcaccctt caaggctggg gtgtcggcgg tcgggtcaac    154920
     gagcggacct tgtaccacgt cgccgcaatc acgtcattgc cagaggattt ctgccgcgtc    154980
     tttccgccga gctcaagttt cgtagctgat cttgccgtgg cgttgcgagc ggctgatttt    155040
     atccatgcta tagagccccg cgagaacgaa ctcgacgcac gatgctcgca tcgcttcgtt    155100
     ttcgctcgca ttgacctcaa acgcacggtc ccatgctgga ggaacatgct gcaaccgctc    155160
     cgcgtattcg ctgctcggca gcatcgttcc gacttccacg cgaacgccgc cgcggaagat    155220
     ctccgcgatt tccgccagcc cgtgttcttc gatgtattcg ccgaacacag tttgaatggc    155280
     ttccgcgatc accgaatcaa tcacttgctt ctcggtcatt tggtgcgtgc ccatcagatc    155340
     caattccagc ttgccgaggc tgctggcata cagatgcccg aggtcgctga ttcgaggaac    155400
     ggcgggactt tcgccgtgca cgataccgcg ttggcgagcc gaggcgacga tcgtccggaa    155460
     attcgccaac gagaaacgtg ctgacacccc cgacgcctga tcgatgtatt tgctctggcg    155520
     agcttgatga gtgatttcct caatgatttg gtacatgaac agaggcacat gcaccgggta    155580
     aggaccaccc aaatcgtcgc caacctcttg ctgcaggatt tcgattccct gcgtccgttc    155640
     ggacggatag tgagtttgca cgatcgtccc gattcggtcc ttcagctgag gaatgacttt    155700
     gccggatcgg ttgtaggtcg acgggttggc cgagaacaaa atcatcacgt ccagttcgaa    155760
     tcgaatggga tagccacgaa tttggacgtc gcgttcttcc aggatgttga acaaaccgac    155820
     ttggaccaaa tcatccagct cgggcaattc gttcatcgcg aaaatgccgc ggtgcatccg    155880
     cgggatcaaa ccaaacgaga gtgcttcctc ggcactcatg ctgactccgc ccgtcaattt    155940
     tgccggatcg atttcgccaa taatgtccgc gaatttggtc ccgggggaca accgttccgc    156000
     ataccgttcg ctgcgatgcc accacccgat ttggatgtct tccggggaat gctcggcgac    156060
     caaacgctta cccaaggatg aaatcgggtt cagcgggtcc tcgtgaacgg gaagatccgg    156120
     gtgatcgatg aaaggaatcc acggatcgag aaattgaacc aactgccgca tgattcggct    156180
     tttggcttgg cctttttcgc ccatgaacaa catgtcgtga ccggccaaca acgccagact    156240
     gatttctggg atgaccgtgt cttcgtatcc cacaatgccc ggaaacaact cttcacggtt    156300
     ggccagcatc cgcgaaaagt tgtcgcggat ttcttgcttg accgatttgg atttccatcc    156360
     gctctcgatc aattgctgca aattgcgggc ttcgggggca tccatcgtcg ttttcgcggg    156420
     acttggcaca gggctggtca cgtgtgggct ctgggaaaag aggcgtcggt gcagggaagc    156480
     atctcgctgc gatgcatcct atctgattca atcgtatgca accggggagg cccttggttc    156540
     ggacaactcc gccgaatcgg agactctttc cgaattggtg caatccaacc tggaagcgaa    156600
     cccggtgttg caaaaggcca cggaaagcgg gagttttggg tccaggacgc gttgacgaaa    156660
     ccctcaccgg gtgcttatct ttcgcggttt gaaattcgtc cactccaccc attctaagat    156720
     cgcccgttcg cgggcttgtc tgccatggcc gtcccaaaac gcaagcactc caatagccgt    156780
     accggcaaac gccgcgccca cgatcacttg aaaaagcgtc aagtgaccta ctgcccgcag    156840
     tgcagcaccg ccgtgccaac gcacgtcgta tgcccgaaat gcggttatta ccaaggtcgc    156900
     accgtcgttg aatcgactga ccagtagttc caaccgccac agcattctga actgagaacg    156960
     acctgccgtg agtctcgacg cagcgaaacc agcgatcctg tttcccggcc aaggtgctca    157020
     gacgcccggc atgggaacat ggttgtgcgc ggaatacccc atcgccaacg aactgtttga    157080
     cgaagccgcc gatgtcctgg gatacgacct gaaatccctt tgcgcagatg gccccgctga    157140
     aaaactgaac gaaaccgttc acagtcaacc agctttgttc gtcgtcggag tcgcggccgc    157200
     tcgggttcac gatgatctga atccggaact tgcgaaaaag atcgtggccg ccgcgggtct    157260
     cagtttgggt gaatacaccg ccgtttgcta cgccggcgga gtttcctttg ccgatggttt    157320
     gaaactggtt caaaagcgag gcgaagccat gcaggcttgt gccgacgcaa cggactcggg    157380
     catggcaagc gtgctggggc tggacctcga gaaactgaca tcggtttgcg aagagtgccg    157440
     cagcggggac gaaatcctgc aaccggccaa ccttctgtgc ccaggcaaca tcgccgtgtc    157500
     aggacatcgg tcagctctgg aacgactcga acccgcagct tccgctgccg gtgcgatgaa    157560
     ggtcgtgcca ctcagtgtcg ccggtgcttt tcacactccc atcatggatg gcgcagtgga    157620
     acaactcaca cgggctctag aagaggtcga gttgtcggac acgcgaattc cggtgtacag    157680
     caacgtcgac gcgaaaccac acacctccgc tgatgaaatt cgccagttgc tggcacgcca    157740
     agtcgtcaat ccagtccgct gggacgactc catcaacgcg atgctcggtg acggagtgga    157800
     tggtttcttg gaagcaggaa ccggtcgcgt gttgcgagga acgatcaaac ggatcgctcg    157860
     caaaacaccc accgacggtt tcggcgacca gccctgacct ggtgaaatca gatcagatga    157920
     ccctccaagg gcatcgtaca atcgcttacg aacgccaccg acgctggcaa cgacgctagc    157980
     gtttcgccac cattctttcc ccaacctccc aaccccacag acctgccccc atggatctct    158040
     ctctgtcggt tgatttgaaa gatcaagtcg ccatcgtcac cggtgccagc caaggcctcg    158100
     gacgcgctgt cgccgtcgca ctgggacaaa acggagccca tgtggtctgc gtcgctcgca    158160
     atgcagagaa gctggccgcc accgtcgccg aaatcgaagc ggccggcgga aaaggcgaag    158220
     cactgccatg cgacgtcacc gatcgcaaag cggccgcgga agccatcgag ggaactcaca    158280
     aaaagcacgg tcgtctggat atcctggtca acaacgccgg gatcactcgc gacaaactga    158340
     tgcgtggcat gtccgacgaa gaatgggatt ccgtcatcgc caccaacctg acaagttgct    158400
     tcgtgtgctg ccgatcggcc gccggagtga tgcggcggag caagtacggc cgaatcatca    158460
     acatggccag tatctcgggc ctgatcggca accccggtca agccaactac tcggccagca    158520
     aagcgggcat gattggaatg acgcgaacga tgagcaaaga gctcgtctca cgaggcgtga    158580
     ccgtcaacgc ggttgccccc ggtttcatcg cgagcgaaat gacggcggaa cttggcgaag    158640
     tcgttttgga agaagtcaag aaacgaatcc ctgccaagcg agttggacaa cccgaggacg    158700
     tcgccgcggc ggtattgttc ttggccagtc gcgatgccag ctacatttca gggcaaacca    158760
     tcgtcgttga cggtggaatg gtcggctaac ggcatattga cgcgttttag ctgcgtcccc    158820
     tatgttctgc cacgagcggc tatggagtgc cgcctcggtt gtgccctgcc ccacagatct    158880
     gcactttccc ttttcgaatt aactgacatt taatcggagt tacgcccatg gcgtctatcg    158940
     aagaacgcgt ggtcgacatt gtttctgaac agctcggcgt tgataaagac aaaatcaccc    159000
     gcgaaacatc gttcgtcaac gacctcggtg ccgactcgct cgacactgtt gaattggtga    159060
     tggagctcga agaagagttc gacatcagca ttccagatga ctccgccgaa aagatccaaa    159120
     aggtcggcga agcaatcgat ttcatcgaaa aggaaaaagg cgaagacgcc tagttttcgg    159180
     tgaacctgtt tgttggacaa attcacttcg tccaatagca gcgtgaacat gacggaacgc    159240
     ctcgcgggat ctttcttgca agatccgtga ggggctccca accgatggcg gcgaagccgg    159300
     acgcggtttt gcccattgtg aaaatccagc tgtgtgtgct ccagccattc gtgcttgtgc    159360
     ccatgcgttt gtaccgatcg ccggatcctt gtctgccctc actcaaacga gcggcttgac    159420
     acgacgtcaa accatgcgtc acccggcaat gtttcgccaa tcgcaatcat ccgcaacgca    159480
     gactgcatcg ccgccatttc acactgtcaa ttcgttatat tgacaaggtg ctggcggcgt    159540
     tttttgttat gttgcctctc gcgtgtgccg cggtcccttc tctcaacact caaccacgtt    159600
     aattcgtcac cacgctcatg acggacgctt cttcaacgcc ttcttacgat ccttccatgt    159660
     cacgacgtgt cgtgatcacc ggcttgggta ccgtcacacc tttgggctgc gacgtcgaaa    159720
     ctctttggtc agccttgttg gccggaaagt ccgggatcca tgagttgtcc atcatggaca    159780
     cgtcgaaata caaggttcac tttggcggcg acattcctga cttcaatgtt gcggatcatg    159840
     tcgaacccaa agaagccaaa cgtctggatc gtttcactca gttcgccgtt cacgctggtg    159900
     cacaagcggt ccaggattcc ggcatcgact gggaaaaaac cgaccgaaca cgctgtggtg    159960
     tgatattggg ttcgggcatt ggtggcctca acgaaatcga agaacaaatc gagcgaatgc    160020
     tcaacaaggg ccccgaccga gtcagcccgt tcaccgtccc aaagatgatg gtcaacgccg    160080
     ccgggggaaa catctccatc cgctatggac tcaaaggccc caactacgcg gtcgcaaccg    160140
     catgtgccag tgcaaccaac gccatgggag acgctctacg cagtatccgt ggtggcgaaa    160200
     ccgatgttgt gatcaccggc ggaaccgaag ccgcgatcac tcgcatgggc ttggctgctt    160260
     tccaaaacat gaaagccctt tcgacccgca atgacgaacc tcaacgggcc agccgtccgt    160320
     ttgattctga ccgcgatggt tttgtcttgg ccgaaggcgc agggctgctc gtcttcgaag    160380
     aactcgagca cgcgaaagct cgcggtgcaa agatctacgc ggaagtcctc ggctatggaa    160440
     caaccagcga cgcgggccat atcaccgctc ctgatccaga aggattgggt gccgccgctg    160500
     ccatgcgagc cgcgattcag gacagtggcc gcgcggcctc tgaaattgat tatattaacg    160560
     ctcacgggac gagcacacct ttgggtgaca aagcagaaac tcgcgcgatc cacaccgttt    160620
     taggtgacca tgcccaaaac gttgcgatca gcagtaccaa aagcgctctg ggacactcct    160680
     tgggtgctag cggcgggatt gaagcggtga ttctttgcca aacgatccaa aacaatgtga    160740
     ttgccccgac aattaatctc gacacaccag atccaagttg cgatctcgac tatgttccca    160800
     accaaccccg ggaacaaaaa gttgacctgg caatgagcaa tagcttcgga tttggcggtc    160860
     acaacgcatg cgttctcttt ggacggttct ctcatgacgg ctcttgataa tccgaactcc    160920
     gatttgttcg accccaatgc atcgcctcaa gaagacgctg gtcctgaacc agtcgtttac    160980
     ttggtcgatg accaacaagc cgaactggac ctgctacaac gctggtgctc ccaagaaggc    161040
     ttgaagacag aaacgttcaa tcaggcagaa gaccttctca agcttttgca cgccgactca    161100
     cacggttgtg tcgtcgctga cttgcgaatg ccacgcctga gcggcttgga actgcaagcc    161160
     gaaatgtcgc ggcgtgagtt gaccatcccg gtcatcttgg tcaccggcca tggtgatgcc    161220
     gaaaactgcc gagctgcatt ccagcaaggc gtgtttgact tcatcgaaaa aggtttccgc    161280
     cacgaggaaa tcctgcatgc aatcaacagt gcaatccgca aacaccgtcg tgatcgcttt    161340
     cgtcaccaag tccgcaaaga agccttggac ttgctgcgaa agatttcgcc tcgcgaaacc    161400
     gaagtcatgt tgcttctcgc tggtggctca cccctgaagg gcatcgctca ggaactcagc    161460
     atcagcgttc agaccgcatc gaagcaccgc ggcagcatct tcaccaagct caacatcgac    161520
     aacgaagtcg acttgtacaa aatgctgctg gctgccgaag tcaacctgga cgtcggtccc    161580
     gccgcgttga ttccaccggc tccttgatca aagcgttacc aaatccgcgc ggcgagaatc    161640
     ttgatcccgt gcggaagacg ctttcatttc gttgaagaca aactcattct cgccggctca    161700
     ctcagccggc gtttttgctt caccaaccgc tggcaagatc cgcattgttc cgcggactcc    161760
     cggtctcgcg agttgatcgg gattgcgaag agtggcccac atccggacct gcgaattgac    161820
     cggatgaact tcgagtgaca caaacgtcac ctcgccgctc agcacgatgc tttggtcttc    161880
     gccgccaatc gactgcgtcc attcaaattc gacaggccgg cctttcagtt cacctccgtg    161940
     aacacgccca tcaacgaatc cgctcactcg gatcgggtcc aaagaaacaa cacgcagcaa    162000
     cggtgcgccg gcttcaaccc actcgcccac cgagaccatc gtttcggcca cgttgcccac    162060
     gacaggcgaa tcgacacggt gctcggacaa cctgagtttg gccatctcca ccaatgagag    162120
     cttctcgtcc gcttgagcct cggcgacttc caactccttg cgagcttgtt cgatcgacaa    162180
     tccggcttgg tcaatcacca attgcaagcg atcaatttcc gtcgcggtca cgctgttctg    162240
     atagcgttta ttcgcatcga tgctttgctc caactccctc atccgaactt cgcgtgtccg    162300
     ttcggcatat cgctgatcaa catcgctggt cgatcgcaat tcagccgcct tcgcggctga    162360
     ctcggccgcc gccagttcag ccttcgcacg ccggtcgtct agttgaacga ggacatcgct    162420
     tttcgaaacc tgctgccctt cggtcgcggt caccgacatc actcgcccgg cgatcggcgc    162480
     ggccaacgtg agatcggtga ccaacgtcgt ttgggcacct tcgatcacga tcggcttgga    162540
     tttcgcatca tcagccaaca acattgacgc accgccaaat gtcattgtga caaacgctgc    162600
     ggctgccaac gcctgattcg caggcatccg gcgaatcgaa aatgcatccg agcgacgact    162660
     gaataaattc gcgattttga gttcggtgcc agaagcgagc atcgggcaac tctccgacga    162720
     gacatattga gtgaatcaaa ccagtcgcca gtctaattca atcgtctgcg cctgccgccc    162780
     gctttcaaag cccgcttctg atccggcaga aatgccaaac cgggttggga tttgttacga    162840
     tgctcgccgt cggctcacca cctcgatcaa catcctgtga ccgaccgatg aaacaaagaa    162900
     actcattcgt tcttcttgga accgcccccg gaaactgtcg tgcaacaagt caaactcttc    162960
     aaaggtgtgg attccgaatt gcccgaactc gagcggcaaa tcaatcgctg gatccgcaaa    163020
     agcggtgctc gggtcctatc catcaacggt aacctggcgc ccgctcccgc cgccggcagc    163080
     ggcccgatga attcgttcgc cgccggagat gttctgatca tcgtgcatgt cgagatcgac    163140
     acgcctcagg gttgatcagg gttccaaacc gaaatcgcgg atggtcgtca gcgttttcag    163200
     ctcgagccct ttttgagcga atgcctcggc gcctcccgcc aatcggtcga tgatcgcgag    163260
     cacgtactgg acttccagcc caaaggcctg gacagcttcc acggctttca gagcactgcc    163320
     gccactggtg atcacgtctt ccacgatcac aactttttga ccgggtgtga cggggccttc    163380
     gacctgctgt cccatcccgt gccccttcgg ttccttgcgg accatgaagc ctttcagatc    163440
     cacgtcatcg ccaccggcca acgtcacgat cgatgcggtg attggatcgg cgccgatcgc    163500
     cattccgccg acggccgcag gcatgacgcc ggattccttt gcgttggcaa gcacaacgtc    163560
     caacatcgct cgcccaatca agcaagcgcc cttggggtgc aacgtgacgc ggcgacagtc    163620
     caggtaatag ttcgcttttt tgccgcttgc cagcgtgaac tcaccacgct ggagagcttc    163680
     ggtttccatc aaggcgatca acggggcaag gtcacgattg gccgagtcag acgacatcca    163740
     agtattctcc agcgaggaag tgagcggttc aatcggaacg aataccacaa tcgcttcgat    163800
     tcagacaccc gccccaacct atccgagccg tccgacccga caacggttcg aatcacgatg    163860
     ccaaccgggg ccttgcgtgg cgccagcacc agctagaata cccactccac tcaatccgca    163920
     tatcctctcg ccagcgtgct ccatgccttc ctctgttttt cgcggctccc ttcgtttcgt    163980
     ctttgcgatc gccttcgcgg gtgcatcggt ttgcgtgaac caggctttcg tgaccgcgga    164040
     tgaaacgact cagtggttac aactgatcga gcaatccaag tccgagctgg atgcgaatcg    164100
     cttgccatcg caggaacaaa ccgaagtcga agtggttgcg gcgatggagg cagcagacgc    164160
     cttttttcaa cgagtgacag atccatccaa ctacgacgct tggatgaagt ttttggactt    164220
     cggccccctt caatcggcga tcgaaggcca tgaatcggtc gcgaaacgcg gcaacgccgc    164280
     tgtcgagctt tcacaacgcc tcagcggccc cgaagaaggc cttgagcttt cgcgattggt    164340
     cgcactgcga gagtcgcttg atcgctacct agccgcgctc cgctatggag atcccaaacg    164400
     cggtctcgct gtgattgagc ggcaactgga aactctcacc gagattcttt cgcctgaaga    164460
     aatcgacggc gagcaatccg aatccacacc gcgatcgctc gtcgacttgt cgggtgaaga    164520
     agtcgcccaa atcgaatcga tcgtcgaaac gcttgccgca gccaaccaat ccggcgactt    164580
     ggtctcccgc atcacaggac gatactcgtc acccaacctg cgtgcgtttg tggacggtcg    164640
     cgtgattgcc gacgccatca cccgtccggt taacaatcct gaacgagtta acgattgctt    164700
     gctcggcact cgaatcattg gcgatgcacg ggttgtcggc aacgtcaccg gctcactgtt    164760
     gccatccgaa ggcaacgtcc gtttgttgat tcgtctcgat ggacaatttt caacatcgac    164820
     aaaaggttac aacggtccgg tcacactgcg gtcttccggg tttggccaag tctacgcggc    164880
     tcgacaattg gtcatcaccg aaaagcgaat cttcgctggc gagccaatcg caacagccag    164940
     cctttcaacg cagatcaatc aaatcaatca cccgctcaaa ctcgttcgca aaatcgcgtc    165000
     caagaaagcg gctgagatga aaccgcaagc cgaagcgatc tctcgcagaa aactacaaga    165060
     ccgggtgctg gaaggattcc gccaacaaac cgacgaagca tcggctcgca cgttccctga    165120
     tctcgacgca aagatgagtc catggttgcg tcgtctggac ctgcccgcgc ccactcgcac    165180
     catcggatcg accacggatg cggtgcatgt gcaagcgaca atgcggcgac cgtttggatt    165240
     gtcagccgct ggcgaaggcc cgtcgctgtc gatggttcga actgcgacct catcggggac    165300
     ctatcccggt ggatacagcg cggcgatcca ggtgcacgaa agcatcctca acaacaccgt    165360
     gatgaagttg ctcgccgggg aaacgttcac gccagaaaaa ctgcgtgatc tcaccagctc    165420
     gttcggaatc ccatcggaca aagacgacgc gtccgtggaa acggattcca atgacgatga    165480
     gcaagctgaa tcctttgaag tcgacttctc cgggttccgt cccgtctact tcgaagctcg    165540
     cgaccagacg cttcgaattg gattgcgtgg cgatcgattc gcgcaaggcg accgagaact    165600
     cgatcgtcgt ttggaagttt ccgcggtgta tcgtcccgcg attaccggag atggacgcat    165660
     gatcctgatt cgagacgaag acatcgatct gaaattccct ggcggccgtc gcttgacgct    165720
     ttcgcaaacc gcaatcaaag ccaacatcga agagggcttt gacaaactgt ttccgatgac    165780
     gcttcttcat cgcgaatgga cgctgccttc aacgctgcag ctaccagcac tcgcgggacg    165840
     ctccgcgaaa gtcatcggca tcgacgctcg cgacggctgg ctcaccatcg tcgtccgcta    165900
     gttccccacg acggtcaccc aagaccgtcg ccacacattg cccgtacgat ggtcttccaa    165960
     gaccgtcgcc caactgtcca tagaacagtc ggaatgagaa ttgcgtaagc tgcagggatg    166020
     cctccttccc aagccaacgc aatgaatcct accgaaatcc aagccatcga ccccgtctgc    166080
     ggcatgtcgg tggaccctgc caagtcactt tccagtcagc acaacggacg aaccttctac    166140
     ttttgcagtg cgggctgtca aaagaagttc gattcagatc ctgacggtgt gctggaatct    166200
     cgaaagaaag agaacgccga atcggaatcg tctgactgct gcagcactca gcccacttgc    166260
     tgcggcggtg gctcgcacgg caagccccaa accagccagc aatccgacga ccccgaggca    166320
     gtctacacct gcccgatgca cccggaagtc gaacaggttg gcccgggaga ctgcccgatc    166380
     tgcggcatgg atttggaacc caagtttgtc gatccgactt cttcgggaga cgaagcccaa    166440
     tacaacgata tgaaacgccg attctggatc ggcgtcgctc tttcggttcc gctgttgatc    166500
     ttatcgatgg gccccatggt cggtctccca atcaatcgct ggatttcgtc cggcatggat    166560
     ggctggttgc aattcgctct cgcgactccc gtcgtgtttt ggtgcgggtg gcctctgctt    166620
     gttcgtggtg cgaaatcgtt ccgatcgtgg aatctcaaca tgttctctct gatcgcactg    166680
     ggatcattgg ccgcgtttgg cttcagcgtc ctcgcgatct tgcttcccga ctggatcccc    166740
     actgcgttct acgaagccga tcgaccaccg ctgtacttcg aagctgccgc ggtgatcatc    166800
     acgttggttt tgctcggcca agtcctcgaa ctccgagctc gacagcagac cggcggtgcg    166860
     atccgcgaac taatgcaact cacacctgac atcgctcatc gaattgaggg ggaagacgaa    166920
     cgcgatgttt cgctcgacga agtccaatcg ggcgatcatt tgcgaattcg tccaggcgaa    166980
     aagatccccg tcgatggcga agtcattcgc ggttcgtcgc gggttgacga atcaatgctg    167040
     acaggtgaac cggtccccgt tgaaaagaac gaaggtgacg cgttgaccgg tgggacgctc    167100
     aaccaatccg gatcgctgga aatgaccgcc acacaagttg gcggcgatac tgttctgcac    167160
     cggattgtac aaatggtcgc tgatgcgcag cgcagccaag cccccattca gaaactcgtc    167220
     gaccaagtgg cccagtactt tgtaccggcc gtcatcctca gctccattct cgcgtccatc    167280
     gtttggtcaa ttgtcggccc tgaacccgca ctcgcctacg ccttcgtttc cgcaatcgcc    167340
     gtattgatca tcgcttgccc atgcgcactt gggttggcta ctcccatgtc cgtcatggtg    167400
     ggtgtgggac gtggtgcgaa agaaggcgtt ttgattcgcg acgctgaaat cttggagatc    167460
     atggaaaagg tcgataccat cgtggtcgac aaaaccggaa ctctcaccaa ggggcgttcc    167520
     gcagtcacgg ccatcgaaac ccaaggggac tggagcgaat ccgatgtgct ggccatcgcc    167580
     gccgcggtgg aacaatccag tgagcatccg ctcggccgag cgatcgtcga atacgcggag    167640
     gcctccgaca ctcaaagacg tgttgcgaaa gatttccaaa gcacaacagg caaaggcgtg    167700
     gttgcagagg tcgatggcaa acacgttgcg atcggcaatc ccaattggtt ggctgagttg    167760
     aatgtgaccg gtttggaatc cgttcgtgat ccagcggaac aacatcaggc gaacgccgcc    167820
     acggtggttt acgtcgccgt cgatcgatca ctcgccgcaa tcatcgctat taaagatccg    167880
     attaaatcaa gcacgcccga cgcaattcaa gccttgcact ctttgggact gcgagtcgtg    167940
     atgctgaccg gtgacgctcg atccactgcc gaggccgtgg ccaaacaact cggaattgac    168000
     gacttccgag ccaacgtgtc accggaagcc aaacacgact ttgtccaaca actcaaacag    168060
     gagggcaaaa cggttgcgat gtgtggcgat ggcatcaacg acgcgccggc cttagccgca    168120
     tccaatgtcg gaatcgcgat gggaaccggg accagcgttg cgatggagtc agcgggcgtg    168180
     acactggttg gcggtgactt acggggcgtg gtcgccgcga aacaactcag ccaaaaaacc    168240
     atgcggaaca tccgccaaaa cctgtttttc gcgtttgctt acaacgccct gggaatccca    168300
     atcgcggccg gtctgttgta tcccttcttc gggatcctgc tcagccccat gatcgccgcc    168360
     gccgcgatga gtttcagcag cgtctcagtc attgccaatg ctcttcgact gcgcaccatc    168420
     caactgagcg caccgaactg aattgatgat gagccttggg ttcacgttcg gaataagaag    168480
     tccgctacgg ggcagcgcca caccactagg aagttttcgc cgccgcctcg ctatgatcct    168540
     cgttccttcg cctaacttcg ttagcggcag ggcgcgagcc ctccggcccc acacgctgac    168600
     tttgttagcg gcagggcgca agccctccgg tcccgcacgc aactaccaaa ccgacgtcgg    168660
     attcatatag ctgaatcaca acgagttcgc actcgaaccg cctacgtcct gagcttccga    168720
     cgcgtacgtt gtcgcagccg aaagcgaatc ctcatcgaac aagtatctca cgcttccctt    168780
     ccgcgtccac cagcgatcac gcacgcattc ttcagccaca cccaactgac gctcacgctc    168840
     tttcatccgc cgcttgcccc atgacttcaa ctgatctcga acctgctcac cgtcgtagtt    168900
     cggtgccgtc acaacaacat gacaatggtt ggttcgacaa ttgacggcgt gcaaacacca    168960
     acaccgcttt tcgcaatgtt cgcgaacgac ggattcgatc attgttcgct gctctggtag    169020
     caaaaggact gccgaatcaa ccatcttgtc gcgacaccaa tccgcgagcc gaggttgtgg    169080
     cacctggtcc ccacaatgcc atttggtcca gccgcgatca tcacctggca tccaggttcc    169140
     atagcacgtc caagtcaaaa agaatgcgat tgggtcgtct tgcaacctca aactcctcgt    169200
     gaaatgagcc gtccggttcg gacacgttgc tcactcttcg gtgctaccgc cgcgagccgt    169260
     tcgtattcta cctggcaacc aagaactcgt ttccttccgc atggatcgct taaaccgtca    169320
     attgcaaatg cgggggtcgg caccgggtgg cttgcgccac tccgctaata aaatcccact    169380
     cccttcaagt cttcgaccaa ccaattcgcc gcccctgttg gcggttgggc gcgagccctc    169440
     cggttttcaa cacagactga agttcgagcg ttggcttgga tttcggaaca tacagaatcc    169500
     tttcattttt ctctgctcta ttgggtggtt ctaagtcgtc ttctcaacca cgctatcgat    169560
     cttgtcctgc atggattgct cgcgatcagt tcgcgttcca actttgatgc tggtggtgat    169620
     gcgtggcgca ccaaacgcat gaactcgttc gtggcaaagc ttgatcgcgg cgaacacttc    169680
     gtcccaatcg ccttcgatgt tcgttccgta ggcgtgaagc tgatgcttca atccagcctc    169740
     ttgcaacact ttttgacact cggcaacgta tttgcccacc gagactccca cacccattgg    169800
     gacgacgcat aaatcgacaa tgactttcat ctcacttgaa tccctcgccc tttggctcga    169860
     tcggttggtt ggctattgag tttacgcggt cgcgacgcca gcggcaccgc ccatcgtctg    169920
     gcatcctgtg attcatgttt gggacgaaca accagattcg tctgcgttct cgcgaactcg    169980
     acgctatccg cccagaaaag atcggacttt cgagaacggc tcgatttcgc taccgtcgaa    170040
     tcgaaatatg aaagcaaggc tcatttccgg cggtcgtgtc ggaggaatgc aggatgcaag    170100
     accggagcga aaaagtggaa atgaagactt ggttgccagt gtgtctgatc ggcatgctgc    170160
     tgattgttcc ggcgtgtcgc tccacggcac cgtccacccc gccgatcgtt tccgagccga    170220
     cgctccccga tttcccggat gctcagccgg cgaaaccgaa cttcgtttcg ttcgtcgacc    170280
     gacctgagtt gcaagccggc acgggcccga tggactcgga tgcgtccttg gagttcatcg    170340
     aaacaagctc aggtttgaaa tatcggatcc tccgaaaatc ggacggcaaa aaaccgactg    170400
     cctttgacac cgtttcagtc cactaccgtg gctggctcaa caacggaaaa gtcttcgaca    170460
     attcctatga ccgcggtgaa gcaaccacct ttcctttgga cggcgtcatc gccggatgga    170520
     ccgaaggcat gcaactcatc ggtgaaggcg ggatgatcga actgtgggtg ccgtcctatc    170580
     tcgggtatgg cgaacgcggc tcgcccggct ccatccccgc tcacgcgatt ctccacttca    170640
     tcgtcgaact cgaaagcgtg aagtagacga ccgagctgat cgacctacga aaccgcagca    170700
     tagcgagttc cacaaattgg cacgctttgg tcaatcagga tcgtgaacga actcaccgaa    170760
     gcacgcatag gtgctcattc actactccgt gacgcctgca tttgcgcgga tggctgccac    170820
     gatcgcgctg gcaatcgcct gcatcccttt atcaccggga tgagccgcca ctccggcgtg    170880
     ctcaaagtct cgttcggcgc tcgctcgatt cgcctgatcg ttccccaatt cggtgatatc    170940
     gatgaaggtc gcgcccgcag cctcgctggc atgacgcatg atgtcatcct tgaccgaatt    171000
     cggccaaaac gaactgcgaa cgaagatctc tggtttgccg tgttgccgca ccgaatccaa    171060
     caaccctgag aacgcctctg caaacgcaac cttggcttcc tctgtggccg gtgcggtcac    171120
     gttctcaccg atcgccacga tcacaatgtc cgctcgaaat ccgaactcgt ctttaagacc    171180
     ggtcgcgacg tcgaacgtct cgtactctcg ctcaaacgca gcgatgttgc ggaccttgat    171240
     cttcggacga tccccgatcg atttggcaat tctcgctgtt acaaggtgaa catagtcctg    171300
     ctcttttgag ctcgccgcca tcccccagtt gcctttccat ccaatctttt ccgacggtcc    171360
     atggagcgtg atgctgtttc cgagaaacaa aactttcccc gccggcaatt tcccgagggt    171420
     caacgaagct gcatcagagt ccaccgcttt ggcggtggtc gtgagcgtaa tcgcaacgac    171480
     gaaaagcatc catcgacaat tcataaagga actcaaacaa cattggaagg aataactttg    171540
     gcaattggat gaagacgaaa aaacgtgggc tctctcgttc catagtggct agctgcgttt    171600
     tggctagcag cgttcacttc gagatgatca accgcgacaa agttttcgtc gctgaatcag    171660
     ttgtcacatc cagaccggtg gcttggacaa cctcattcgc cggcaacgcc aacgggaatg    171720
     aactgcaccg catccgcgat aacgtagcca tccgaatctt cgttcttaat ctcgacggtt    171780
     gcggatgcct ccagttcaaa ctcaccgagg ttcgcttgac caccggattt tgaatcgcgt    171840
     tgattcacgc gaacctcatg ctgctttccc gaagcatccg tgattgtcac cagcgtgttg    171900
     ctggcacggt ttggatgcac cggccacagc aggttcacct ggtagcgtcc gggtcgtttc    171960
     aatttgcctt catagaccgc aacgcaatcg cctttgctgg cgtcaccatc gtgcaagtag    172020
     ttcatcccga cgcgttgacc cgatgagtta ctgaccatcc aaccgccctc cgtcttggct    172080
     tgtgagttgt caacgacaac gccatcgagt gacttggggt cgatcccggg tttcgcttcc    172140
     ggaccggcgt aggtcagcac ttgtttgtct tcgagcaagc gacttgccag ccgttcgtaa    172200
     tcaacgtttt gaaccgcgac ttggtcgtcg attgcgatga ccgccgcggt cgcggttgtt    172260
     tggccaagca ccatgaacac gggctccatc cggatcgaac caaatgcgat gtgcgttgcc    172320
     gacaagcaaa ccggcaccag tagattggaa acttcacgtc gtttgggaac caacgatcgg    172380
     tagctgatgc cgtacggcgg aaaaccaccg acttgaacat cgccttcgtt gcgtgcatgt    172440
     ccgttctcat cgacatagcg ttgctggttg tgcgaatcca tcgtgtacgc cgccaatccg    172500
     accgggtctt cgaccggcaa accttggcaa tttttctgtg tcatcacgta ctcaccaacc    172560
     atccgtcgag cttcgcgaat gtagagctgg tcttgccagc cgttgccttc ctcaaactcg    172620
     tctttgcaca tcccccaacg agcgacttgt ttgcgaacgt tctcgggaac gcgagggtga    172680
     ttggccaacg tccacatcaa ccctcgttga tagagccgat gagccgcgac gatcttttca    172740
     cgttcctcgt aggtggcctc cggatagtcg tagttttggc ctatgaagtc cgttgaaaaa    172800
     cccaagcgat tgttggtgtc cgtcttgcga ttgggcatgg gggaattgat ccacggtgcc    172860
     gcgttctctc ccgcctcgta gttgcgaagc atcaactcgt accacaacgg ttgataccca    172920
     tccggtttct cgaacgggat gcgattgtcg ggatggtcgg tcaaacacat tcgaaaacaa    172980
     taggcctgta cccgatggtc ggcaccgcct tcttcccccg gtccgtctgg atcaatatgc    173040
     ggtagcaaac cgctgctggc gtcaccggga acgacatacg gatcaatgcc atttcgcagt    173100
     tgatgatgaa tcgccatctt ggtctgcacg ccattgagcg tttcgccata ttgctcgttt    173160
     gcttcgcgtc ccacggtgta actgaccccg gcggcggcca acaaatcgcc ttcgtaagtc    173220
     gcatcgatga acatgcgagc ccgataggtt tcgcccgact ccattcgaat cgcgatgatc    173280
     cgagcgggca ggctacgagt catcatcact gcggaacgat cgagacgctt gccgtagtcg    173340
     actcggatgc catctcgctc aatccaatct tcatagaccg acaacgccgc gctcggttcg    173400
     aacgtccaca tggcagcttc tcccgccgcg gttttcgatt ggcctccgcc gcgatactca    173460
     tccgaccgtt gaaacttcca cgccgacgca tattggtagt acgtcgcgat atcttcatag    173520
     aactctcgag ctatcccacc gatggccgcc ttgttaccaa tgtccgtttg tcccaaaccg    173580
     cccgtggtca gcccgccaac tcgctgactg ggttcgatca cgatcacagt cttgcccatc    173640
     cgttgagcct gaaccgcagc agcgattccg gccgaagtgc caccgtagac gaccaagtcc    173700
     actggctcgg gatccgccgc gccggtcggc atcgaccaaa caagcgtcag cagtaccgac    173760
     agaaagacgg tggtcgctcg tgttatcaaa ctcatgcaaa cgtcctggga aagattgtga    173820
     tcaagagaaa gtcaaggcag tcgattcagc gattcaattc gttgcgagtg aagcagtatt    173880
     cttccactat ttcaccacca atcaggtgtt cctgaatgat gcgttcaagc acctccgggg    173940
     tgcagtcgcg ataccaaaca ccatcgggat agaccaccgc gattgggccg gccgcacaca    174000
     cttgcaaaca attggctttg gtgcgaatga cactggcgtc aggaccaacc aaacagagtt    174060
     ccttcaagcg tcgcttgaga aaattccacg attctaaact ggcgtctttg tcgcagcact    174120
     tgggcttcgt ctgatctgca cacagaaaaa gatgccgctt cgcggtttgg atcccaagct    174180
     tgcccgcgat cgcgcgcaag gattcagaat cgcatggatt gatggcttcc gtcgattcgg    174240
     agttaggttc agaagtcatt ggggctcctt cgatgtcgtc gtttccggct cgggcctcgg    174300
     ttcccaagca tcgtagtgtt tcgcagattg tcccgaccaa tacggcgagg atccccacag    174360
     cgggaccgtg gtcaacatgg attcccatgc tcccagttcg tcatacagtt cgcgaaagcg    174420
     ggatgggttc tgtgccgaca agtcatggct ttccgagaca tcagtggaga cctcaaacag    174480
     ttcggccgga cgatgcgagg gacgcagtag tttgtcagtg ccatccagga tcgcggcttg    174540
     cccctgcaat cgccaataca aacgacgatt gggcggttcg ctgccgtctg ccaaatgagg    174600
     tgccatatca attccgtcat gtgtgccgga caaacgattc atacgtttgc gattcgatgc    174660
     atcttcgtgg gacatgggat ccgcgagtgc caacggctct gcacccgcag cggaacaaaa    174720
     cgttggcagc aaatccaacg aactgaccac gccgtcgtat agcacaccag caggaaattt    174780
     ggccggccaa gtccagatca ttgggacgcg aatcccgcct tctcgcatgg aacctttcac    174840
     acctcgaagg ggtccattcc aactgccgtt gttggtcgca ccgccattgt ccgaaaagaa    174900
     aaccaacaac gtgttttccc actgccccgt ctcttccaag tgctcacgga ttcgccccac    174960
     gccgcggtcc aacgcgtaca tcatcgcggc ataggtccgg cgtttctgat tctgaatgtt    175020
     tgcaaatcgt gccaaatcag cttccgtggc gtgcatcggc gtgtgcggtg cgttgtaaga    175080
     gaagaacaca aaccagggtt ggtccgggtt ggcggatttg tgctgatcga tgaaccgcaa    175140
     accttcgtcg gtgaaaaagt ccgtcaggta ctcgctggaa aaatcgtcca cacgtttccc    175200
     gttccgttcg atgacgtgct tcatcgtcgc aggaaagtag tgatgactgc cggtgagcat    175260
     cccgcaaaaa tgatcaaagc cacggcggtt gggatggtgc atttcgccca ttcccaagtg    175320
     ccacttgcca atcaaagcgg tcgcgtaacc agctgcgccg agatgatccg ccagcgtctt    175380
     ttcgctcgtc ggcaatccaa gcagctcagg ccgagtcgcg taattctcat cggacgcgtt    175440
     caggttgcct tcgtatccaa accgccgagg atcgcggctg gtcagcaatc ccgctcttga    175500
     aggcgaacac accgcactgg caacataggc ttgcgagcac agcacaccgg attcggccag    175560
     tcgatctaaa ttcggtgttt gcaacgtttg gctgcccatg catcccatgt caccgtagcc    175620
     catatcgtcg gccaaaatca caacgatgtt tggcggggtt gattcagcgg cacgcgaagc    175680
     ttcagtggcg aatacaaaaa tcagtggcag aaaaacaaaa cgagaaaccg cggcaaaatt    175740
     ggtcgctggc atgttggctg gggcggggtt cgaactggaa ggcggaaagt cggaggggca    175800
     cagtttattt gacaccaagg cgtctaccca agatgctagc gactccagcg acaaagaaga    175860
     cgaaaaacat ctcttccccg tcgcttcaca ggtgttcatg cttcaacaac aacactgtga    175920
     tcccaccgcg tttcgacgca ccttccccac ctattcaacg caatgtccaa tccatccttc    175980
     ttcgcaaagg ctgtcgctgc cttttgctgt ctcgttgctt cggactcaca cttcgcagtc    176040
     gccgacgcgg agaatcgccc aaacattttg ttcatcttgg cggacgattt ggcgtggtcg    176100
     gacctcggct gctatgggca cccatggcat gacacaccac atttggatcg gttggcatcc    176160
     gagggggccc gcttcactca agcgtattcg cccgcaccca tttgttcggc ctcacgtgca    176220
     tccatcctca ccggcaagac acccgctcga ttgcagttcg aatttgtcac aaagaacgaa    176280
     ccgggacgac agaagatcga tttcccaacg ccgatgtcgg cccctccgtt gactctgaat    176340
     ctgccgcttg aagaacaaac catcgccgag tgcttgaagg acgagggata tcaaaccgcg    176400
     ttcttcggca aatggcatgt cagttctcac catgaacgct atttgggatg gagtccaacg    176460
     cacggtcccg caaaacaagg attcgagttc gcggaagaag actacggagc tcatccttac    176520
     gactggaaac gttcacccgt tgcgacgatc aaagagcctg gcagatttgc tcctgattcg    176580
     atggtccagc gtgtcggtgc ttttcttcgt caggaccatg atcgtccata ctttgcaatg    176640
     gcgtcttcgt tttatgtcca cacacccgtt cgcacaccgt gccaatggtt gcgggaaaag    176700
     tatgacgctc gagttccggc aacttcgaag aagcgaaaca atcgaatcga atacgccgcc    176760
     tttttggaaa cattcgatca tcacgttggt caaattctca attcacttga agcatcgggc    176820
     agagccgatc ggaccatcgt gattttaaat tctgacaacg gtggtcaccc ggagtacacg    176880
     gccaacgcac cactgcgcgg atcaaaatgg aatctgtacg aaggcggaat tcgcgtgccg    176940
     atgatcgtcc gctggccagg tgttgtccaa ccgaagactg aaattgaccg tccggtgatc    177000
     gggtacgact tgctgccaac catggttgct ttggcaggtg gcaatccacc gaagtgtgat    177060
     ggtgaaagct ttgctggatc gttgcgtggc gactctccgc caaccaacga acaacattct    177120
     ttgatttggc attttccgta ttaccatcct gagaatgggt tcgccaaagc gccggactcg    177180
     atcggcatcg acgatttcgc tacgagccgg actcgaccgc agtctgctat tcggcgaggc    177240
     caattcaagt tgttgcaatt cgccgaagac aatcgagttg aactgtacga tctctccaac    177300
     gacatcggcg aactgcatga tttgtccact cagcaagcgg acctcgcatc agagttgcag    177360
     caagagttgc gacaaacgct cacgcggcaa aatgcaagat ttccgatggc gaagtgatgc    177420
     gagcagttct gacaggataa cgaacgaagc agatcggcag gaatgatcgg gtgttacgat    177480
     ttgagccgtt cgggcgtcgg ccccggttgc acgtggaagc aacagggcta tccaaaacag    177540
     ttccaatgcc gaaaaactcc tgcggacctg cttgtcaccc gggaggagcc gccaacctcg    177600
     ttcaaccgtt tcgattgaaa atgatcccgg ctaaacgcgc tgacaatacg atgtcaaagt    177660
     ttgcggccaa tgctggttct gggacccgag caaaccgaac agtgggctcg ctttgattct    177720
     tccgattcaa gcgaatattc ccattgtccc caggatgttt gatatgcgtt tgtgtttcac    177780
     agcgacagct gtccttttcg ccttcacctg caccgtggtt catgcggatc accccagtcg    177840
     aaaaggcctt gccgacaagc acgcaccagc gggcattatg ggcgaccact tgcatcaaaa    177900
     aggcgagtgg atggtcgagt acaagtacat ggtcatgtcg atggaggaca atcgcatcgg    177960
     cgaaaccact gtcagcgacc aagacgcgat tgggccggca ggtgctcccg caggcatcgt    178020
     ggtggatggc atccaaacca acgcgggagc cacgccgacg cagatgacca tggagatgca    178080
     catggcccac atcatgtacg gtgcatcgga tgacgtcacg ctatacacga tgctgatgat    178140
     gcccgcgttg accatggatc acattcgcgg cgatggcaac ccggccggcc gaggtggcga    178200
     attcacgact cacaacagtg gctttggcga caccgcgttg ggcgcactgc tgcgactgta    178260
     cagcaccgat tcgcaagact tactgttcaa cctgggatgc tcagtgccga ctggtgacat    178320
     ctatcgtgaa acgaccgcac cgacgggcgg gctgatgtca caaccgttgc catatccaat    178380
     gcgacttggt agcggcacat tcaacgctcg ccccggcgtc acgtggaagt actttcgcga    178440
     atggtggagc ggtggggtcc agtttcaaac cgatttgccg atcggccgca actaccgcgg    178500
     gtacagcgtc agcgacgaat tccgtttgaa ctcctggacc agcgttctgc tcaccgacaa    178560
     ctggtcggtc tcgcttcgcg gtgagcattt gtggcgtacc gactacgacg gatcggattc    178620
     ttccgcgaac aacctggtga tctccaccaa cgtcgaagag tttcgcggcg gttactggta    178680
     caacctcggc atcggaaccc agttgatggc acacggccac tacttcaacg ttgaatttgt    178740
     tcccaccatc gcacaagacc tagacggaat ccaactcgaa acggattact cggtcatcgc    178800
     gagttggtcc aaggcttggt gaacgaacca agcgaaacgc tcctcagttg gctggtttgc    178860
     gaccgaggaa aaggtagtac ggtgccttca cgagcggcat gtagggcacg ctacccaacc    178920
     gctcctcaca tcgttctatt ttgaattgcc gatgaagcat cgcaagatga tcgctggata    178980
     agtaaacgtt gtccgatgcg aaccagagcg accaaaacgt cctcctcaac catccgtgct    179040
     ggcgactcgg tgcggcagca tgttttcgtg agacgtgaaa gtcggtcacc gcgatcactc    179100
     cgccgggctt gagaatccgc ctggcaatca aaacgctttc gaaccagtcc ggaatcatcg    179160
     tcagcgaata cgaaaacgtg acgacatcga cgctgttttc aggcaactca aactgagtcg    179220
     catccgcgtg atgcagcgtc acattgctaa gctggcgttc ttcgatgcgt tcggacgcga    179280
     tctggagcag cgacggcgac agatcaacca agtgaacttc ggcaagcgac ttggaacgtt    179340
     cttcgatcga gaacaaattg tgtccggtcc cggcaccaat atcgacccac acaccattgt    179400
     cgggaaaatc gacccaagac atcagttccg agcgtccgtg cagcagcctc gcacgaaacg    179460
     aatcatagtg ggacgcttga ccttcgtaga aactttccaa tcgttcgcca tgcgtgttac    179520
     cacgaacggg tcgaaacaac aaatgccaaa gaattttcag atcgtcaaaa cgggacgtcg    179580
     gtttgatggc ctcgctcatg ccgcgactcc agctgccccg cgtgtctcaa cacactcacc    179640
     gacggagtgt ccaaacaaat cagcgatgta gaagctgccg taggtgtgca cccggtcccg    179700
     agcatgcagc gaactcgcca actcatcgtg gtagtgcagc aagtcaccaa gctgaacctg    179760
     gctgccattg tgctgcagca tcaatggatt gacgaagtcg actgccaaag cggcgctacg    179820
     ccacaaaacg cgggcgtccg aggtcgctcg attcaaaatg ctctgccatt ccgatgcgag    179880
     caactcggga taacgatcgt acaaccaatc catgtggtcg agcagcacga atcgcgaaat    179940
     cggctgatcg tgctcagtca agaatccttc cacagtattg gtgtgtgtct gaacacaatc    180000
     caccaaaccg ttcttcagtt ccgtgaagtt ctcttccttc aaatattccg ggcagcaatc    180060
     cggggtgtag ctccctgtca aatagactcg ccaaaagtaa ttgtctcgca gcgggagcgt    180120
     cttgaagaca gcctcgatcc ggtcctgaat gaatccaccg atgccaccgg gataacattg    180180
     gtccaactga ttgcgttggc tgcggggcac gcccaacatc gcaagcgtcg tgtcacgacg    180240
     caaagcccaa cgcagcggtt tgctccagag taaccgattg atctcacgtt tctgatagat    180300
     ctctcgctgt tgatcaaccg attccgcttg cagcaattcc gcaatcgctt ccctcaaacc    180360
     cgcaggacgc ttcaggtaac cgttgaccaa ccaagcaaac agtccggatg tgccgcgaaa    180420
     gtagaagctc tttcggcgag acgtcccatc aaagaagtcc aaacgacgat cccaaatcgc    180480
     acgcgtgtcc ggtgtcaacg caccgcgaac gtgcttgtga tagagcgatt gccaagcggg    180540
     atggtaacca cggccaaaca cgttgaagaa atcgtcataa gtcagacatc gaatcgaggc    180600
     gcacttcaat tccaacaatg cattttgcag cgggttcatg tccaccgcat gaactgactt    180660
     gggtgcctgc agtgcataat ccaacgcatt gcaacccgca gaggtgatca ccaaaacgga    180720
     atcatccggt cccagcgaaa gcgcctgccg gtcaatccga ggatcttccc aacaagtgtt    180780
     gtagacaagg ttcttttgat gaacgacttt gaagcacttg ttgccaagcc agtttgcgac    180840
     catgcgaagt tgtctttcga ttaggtgagt gattaccgag tgaacgagtg catcaggcgg    180900
     cgtaaccgca cgaggaatct tcgccgttga ccgacacgag ttctgttgcg tcggtacttg    180960
     gcgttttgct ggcatcgaaa caacgacgca gcgtttcttc ttgtgtgggc agacgaagga    181020
     ataagtcctc gtcgtagcgt cggaccaaat gcagtcgacc gtcatgacgt tccaccagtc    181080
     cggtgcagtt ctcaacccaa tcacccgtgt tgcagtacca catcgaatcg ctgctcacga    181140
     tgtcaggcgt gtggatatgt ccgcagataa ctccgtcgca ttcgcgttgc ttcgcgtgat    181200
     gcagaatgcg ggattcgaaa tcactgacaa agcgaatcca gcgtttgact cggtctttca    181260
     gaacggaaca caacccatag ggattgcctt cgcttggctg ccatgtccga taacaccaac    181320
     ggttcatgct caggcaggtg tcgtagaacg cagtcgtccc tttggacaac cacggtgcga    181380
     tgctttcgac gcgatcgaag agatcaccgt gagtgatcag aaacttccac cctgtcagtg    181440
     tttgcaaaac gaactcgttg ccaacttcaa accgtggcaa agtcgccaaa caacctgcgc    181500
     gaaaggccgg attacgcagg aacgcgtcat ggttgccggc gacgtagtga atcttcgtgc    181560
     ctcgtcgcgc caagccgatc agatgagcaa tgatctcgtc gcaaacgctc gaccagtgcc    181620
     aacccgtatt gatcttccat ccgtcaatga agtcccccac caaatacagc gattcgggat    181680
     ggaactcacg cagaaacgcc agaaactcgt cggcacgtga atgcttggat ccaagatgca    181740
     catcgctcac caagagggtc cggaccgacg tcggggcgag cctctgcatg ccagcgtcct    181800
     tggcttgaaa gggatgagaa cgaccaaaca agactcaacg atttcctgcg ctgagtgacc    181860
     ggcgagaaac ccggcgtcga tcgaccgttg cttgaaattg atttcgagcg aagactatca    181920
     accgagtgtg acgttctcgt taacgcccga tgcgggttgc aggaaaattc ccgagcaaga    181980
     caaaggctca agttcctgaa ccatttcgaa aacgcaaatc ggcaaggttg cgcaaacatc    182040
     actgcgcata aaaaaatcgc ccgatgtgag acacatcggg cgatcaaaat gctttcctag    182100
     cttccgtcgt cgcgacttag aatcgcgttt gatactggaa gtagaagaag tcggcgtcca    182160
     agtcctgcac accggcggtg gtgctgtagt acttgcccga gttgaagtgc gagtagccga    182220
     tcaacgcact gttgcgtggg ttgagcgcga tctggaacaa gacatcgatc tcatggccta    182280
     gttcgcgatc gcccgcagcg ttgccaggat tgcttggatt catcacgacg ttaaacggcg    182340
     tcgttttttc gtccaacatg aagtagtggt accaaagcac caacttgact ttctcaccga    182400
     agaatggcgt gatgaactgt gcgttgatgt catgaatgtt tcgacgaccg aacaaatcca    182460
     tgaagcccaa gtatttgtga gccaatggga acatgtggtc aaaaccatcg ccaccacgaa    182520
     gttcatcatc accacctgaa gcgtagtcat accagaacca aaacgttggt ttccaatcgc    182580
     tggtcatcgc gacttgacgt cccaagccac cggtgaagaa cccggcgctg tggtcggtcc    182640
     cgtcgctgtt ggttccgaac tgagttccgc cttcgtattc gtacaaccaa tccgaatccg    182700
     ttttgccaac gatacggcta ccaatcgtgt ggtagtcgaa attggtcgtg tcgttgttga    182760
     gacccaggta gtagttttcc cactgaccca accaagtgtc cttgcgcgtc atgtacgcac    182820
     caaagaactg aacatcttgg ttcgtggcat cccacttgtc ttcgtaggca gcggtgcgtt    182880
     tcacggggtg ggtgtagaac gcatcgatcg aaccgtcttt gtttgcgtag gttgcacgca    182940
     caccgtcaaa ggtacgacga gtgttggccc aatccaaagg cgaaatcaat cgctgagcac    183000
     ccaacaacaa ctcttggcgt ccaccgcgaa cagacaagtt gtccgtcagt tgtgcttcca    183060
     agaacaagtt ctgtgcctcg ccacggttct cttcgatcgg acggttgttg aacaactccc    183120
     cgcccgaatc cgcatacaag tactctccgt agaaccggag gttgtccgac aaacgccagt    183180
     tggcaaacat gcggtaacga gtcaaccaaa agttgtcatc gttgccggtg atgcccaatc    183240
     cacggtggtt gttttcgttg tgatagcgaa cacgtgcttc accacccaca tccaacgtgc    183300
     cgttgaacat tcccttcagt gagtcaccga agaaagacgg accgtcgtag catgggtcat    183360
     ccaggtagct gaagtcgttg gcatagaaga cgccttggta ggcacctttc atctttgcca    183420
     tcgcagcttc ctttttcttc tttgtgcagc atccatttgc acagcaggtg cagggagctg    183480
     agtacgaagc gtaggggtcc gagtaggtgg acgaatccac aactggttcc gcgattggcg    183540
     actgcgattc aacaatcgag gaagcagcgg gcgcttcgct cggagaagtc ggcgagggcc    183600
     caggttccgt cagagcccct gagtcctgtt gaaagacgag gacctcaacc ggttcgagac    183660
     cggaagtgtc ttgagcgtga gagtgagtgg aaatggccgc tgttgcgatc gcgatcgcac    183720
     ttagcaagcg gcgtttccaa ttgcgttggg acatggcgtt gtgcctcctt catggagtgg    183780
     gctgtgaatt cgaatcatcc ggatcgattt ggatcgcctt ggttccttcc gcctgagata    183840
     aaggaagtgc aatgaaaacg gagatgaaac gaactcaaca tccaaaactt catagcgacc    183900
     cgttttggct atcggcgcat tcaaagtgat gctgaatcaa caaacgccga gtgtttcaat    183960
     atgcatcccc accgaccgca cccaaacgtt gcaatgatca aagtctccca actcattcag    184020
     caacgcttct gccctgttca cgagtgattg cggtggtgtt ttcgagcaat cactcgcaac    184080
     cgattgggcc gcgattctgg ggttacggtg aggccaaccc cgccaaaacc cgtttaagaa    184140
     tgggcatccc tccccaggca aacacggaca gattccggcc tgaaacagct ctcaaggcac    184200
     gtgcccaatc cgcgtgcaga gtcgctctca gtctgctgaa gacttaagca gacccaacgc    184260
     gaccgacgat ttcccaatcg actgccgaac cgccttggcg cactttccgc tctctaacgc    184320
     cgcctaaggt tcgctcacgc accacaagaa ccagcagcgc acatcgcgcc cctgcatccg    184380
     gcatgacgct tgcgattcgc taaacctgca tcactgatgc cactttattg ctcacggttt    184440
     cagcactctt ctcgacggac agttttctaa tgctttttcg cgttcccggc ttctgcctcg    184500
     aatcacagag cgttccgctc atctccaccg aatcagaatc caattcgcga agcgaatcag    184560
     cgggaacgcg tcaaacggct agctcaagaa cgacgtccgg atccgcgtgg aagaaagcga    184620
     tcaggaccac caacaaactc atgctgcttg gttgtgtcgc tctcgccgct gtcttcaccg    184680
     gatgtgccga ctccggagtg tcactggagg atctcgaagc cgccgctgca aaagtcgaca    184740
     tcagcaaaat tgaagtggac gtcaatccaa ctgagtctgc tgcaatgttg gacttggaga    184800
     aatcggattt gacattcggc ttcatcaaac tgaccgactg cgctcctttg gtgatcgcca    184860
     aagagaaggg ctacttcgac gacgaaggac tgaacgtcac tttggaaacc cagtcgaact    184920
     ggaagatcct tctcgacaac gtcatcaatg ggcaactcga cggcgcacac atgttggccg    184980
     gccaaccgat cggtgcaacg atcggtgtcg gaaccaagtc gccaatcgtg accgcttaca    185040
     gcctggacta caacggcaat ggcatcacgg tcagcaacga agtttgggca cagatgcagg    185100
     agaacgatcc tgaactgaag agccccacac cgaaacatcc catcagcgcc gccagcctga    185160
     aaccgattgt cgaggattac ctgcaagacg cgggcgaacc attcccgatg ggcatggtgt    185220
     ttcctgttag cactcacaat tacgagattc gatattggct ggccgcgtca gggattcatc    185280
     ccggcatgta caccgaatct gacatcaaag gcttcacgga cgcacaggtc aaattgtcga    185340
     cggtgccacc gcctcaaatg cctcagaacc tggaagcgga catcgtcaaa ggttactgcg    185400
     ttggcgaacc gtggaaccaa aaagcggttg tgactggcat cggtgttcca gtcaccacga    185460
     actacgacat ctggaagaac aaccctgaaa aggtcttcgg cgtgaccgga gaatgggcgg    185520
     agaagaatcc acaaactcac ttggccgtga tcaaggctct gatccgtgct ggcaaatggc    185580
     tggatgccac cgatgactcg ggcaaattgg tcaatcgcga agaagccgtc gaaatcctca    185640
     gccgcaaaga ttatgtcggt gcggagaaag aggtgattgg caactcgatg atgggcacgt    185700
     ttgtcttcca atccaccgac gttcgcgaga tgcccgactt caacgtgttc ttcaaacacg    185760
     aagccagcta cccgcactac agcgatgcga tttggttcct cacacagatg cgacgctggg    185820
     gacaaatcac agaatccaaa cccgccagtt ggtacgccga aacggccaag aagatctaca    185880
     agcctgagat ctatcgccaa gccgccgagc ttctaatcag cgaaggcaaa ctcgatccaa    185940
     atgaaatccc ggctccggac tacgacggtt accgcgcagt cacgaccgag ttcatcgacg    186000
     gcaacaaata cgacgcgaaa gatccgattg gctacatcaa tagctttgaa attggcaaca    186060
     aggatgacga gtccttggcc aagaagtagc cacgacattc gggctctcac cagcccacat    186120
     cgaattccct cattgcattc aacctttcac cattttctgg acgcattccc tgatgaattg    186180
     gcgtggcaat cttctccgtt tctgcgacgt ggccggactt ccgattctcg aaccgtttgt    186240
     tcgcttggca gcaggcgagg acaaacgcga acagtgcatt ggcatcgcga aattcatttt    186300
     gctgccgatc gtggcggtca gtgtgtttct gttgctttgg gccggggccg catccaccgt    186360
     cgtgacagac agcgccaaac tgcctagccc gcaagcaact tgggccgccg gcaagcaact    186420
     gatcacgatg cactacgatc aacgcgccgc tgacaaggca gccaagcaag aaaagctgac    186480
     cgaagcggtg cagttgttgg ccgaggcaaa tgcctacacc gctgccgcca ccacggaatc    186540
     gggtcaaacc caaacccttc tcgagaacaa agcgttgtcg ttgaagaagc gagccgtcgc    186600
     ggccgccaac ttcacgccat cgagtgcccc gacattcatc gaccaaatct ggacaagtgt    186660
     caaaacggtg ttcttcggtt tcttcttagc aaccattgtg gccgtgccgg tgggcgtgct    186720
     ctgcgggatg agcccatggt tcaacgcggc aatgacaccg ttcattcaga tcttcaaacc    186780
     cgtcagcccg ctggcttggt tgcctttggc gttcatcgtc atcatgtggt actacgccgg    186840
     ctactccagc ggcgaaacgt tcttcaacaa agcgtttctg atttcagcat cgacggtttg    186900
     tctgtgttcg ctttggccca cattggtcaa cacaaccctc ggcgttgcca gtgttgacaa    186960
     ggacttcatc aacgttgccg acgtgctgcg actttcttgg tggcaacgtc tgaccaagat    187020
     catcttgccc gccagcctgc cactgatgtt cgccggcatg cggatcagcc tgggcgttgg    187080
     ttggatggtt ttgatcgccg ccgacatgct cgcccaaaac cccggactcg gaaagtttgt    187140
     ttgggacgag ttccaaaacg gtagcgaact cacgtacgcc cgcatcgcct tcagcgtgat    187200
     cgtcatcgga ctgatcggat tggtcttgga ccgcatcatg atcttcttcc gcaacttggt    187260
     cagcttcggc aatccatctc ccgtttgatt ctggatgtct cggtttcttc tctttcttca    187320
     tccatcggtg caaacatgag cgcagttctc gaaacatcac ccacgatcaa acgccgagcg    187380
     atctcgtcgg cccctaagcc gatcctacag atgcgtggag tctgcaaggg ctatggcagc    187440
     ggtgtgacgc gaaacgaagt cctgcagaac atcaacctca acattcgcga gggcgagttc    187500
     ctggcggtgg tcgggttcag cggcagtggc aaaaccacgt tcacgcagtt gttggctgga    187560
     ttgatctcgc ctgacaaagg cacgatcacg atgaatgacg aacctgtcaa aggaccgtca    187620
     ccagaccgcg ggatggtgtt ccaaaactat tcgctgctgc catggttgac cgtccgaggc    187680
     aacatcgcac tttcggtcaa cgcggttttc aaagaatggt cacgtgaaca acgccgcgac    187740
     catgttgaaa aattcatcga catggtcggt ctgagtcacg ctgctcatcg ccgacctcat    187800
     gagctctccg gtggaatgcg tcaacggacc agcctcgctc gaacgttggc actcaaaccc    187860
     aaagtcttgt tgctcgacga gccactctcc gcactcgacg cactgacacg tggccaactc    187920
     ggtgacgaaa tcctgaagat ctggagcgaa gagaaacaga cgtgcgtgat gatcaccaac    187980
     gatgtcgacg aagccatcat ggtcgccgac cgaatcgtac cgctgaaccc gggccccaat    188040
     gcatcgcttg gtcccgtgtt caccgtgggt atcgatcgac ctcgcaacaa aaccgaactg    188100
     aatgacaacg aagagttcaa agggcttcgc aacgcagtga ccaactactt ggtcgctgtt    188160
     cggcaaaagg ctcgtcgcga cgagatggcg gccaatccga cccaagcatt ccgtttgccc    188220
     gaaatcgaac cttccgattt gacacgtcca acacgtgccg tcttcaacac cggcccccgt    188280
     taatcgcacc agcatccatt gcgttgatcg aaccggtcga cgttttggaa tgggcatcct    188340
     ccgacaactt ccaccttccc actcagtgca ccgaacatgc gcggctacgt tgaaatgttt    188400
     cgtctcggca agacttacga cacccacaat gggcccgtcg tgattgtcga ggaattcgat    188460
     ctcaaccttg aaaaaggcga atatgtgtcg ctgctcggtc actccggttg cgggaaaagc    188520
     accgtcctga ccatggtcgc gggactcaac ccaatcacca ccggcggcgt tgcgatcgac    188580
     ggtcgagaaa ttgacgggcc ggggccggat cgcggtgtcg tgttccagtc cccgtgcttg    188640
     atgccgtgga tgacggctct cgagaacgtg atgctcggtg tgaatcaggt ttacctgcaa    188700
     gccagcaaga gagatcgccg cgatttggcg tcctactacc tcaacttggt cggattgggc    188760
     agcaacctgc acaaacgagc caaggatctc agccaaggca tgcagcaacg tgtcggcatc    188820
     gccagagcgt ttgctctgcg tcccaaaatg ctgctgctcg atgaaccatt cggcatgctg    188880
     gattcgctca cacggatgga gctccaagag attcttctgg agatcctgat ccgcgacaaa    188940
     gtcaccacgg tgatggtcac gcacgacgtt gacgaagcgc tcttcatgag cgatcgcgtt    189000
     gtgatgatga ccaacggacc gagagcaaaa gtcggtgcga tcttcagcct tcccttcgat    189060
     cgtcctcgcg tccgtgccga tgtgctcgac catcccgagt actacgactt tcgcggcaaa    189120
     atgatccagt tcctcgaaga tcaagaccac aaaaaactaa gggccgacgc ggaaaaacgt    189180
     gccaaggccc aagaagaact cgcaaccgcc gatgccactt aaagggttgc caacatgaca    189240
     tcgatttcag ttcccgcacc atccaacgct tccatcactt tgcgtcactc actgcccccg    189300
     ctcgccgtat cagatcaatg ctatctgcaa ggcatccatg tttgcgaagt cgttgctccg    189360
     ggtgagttca ctccggactg cgattcgagc gcactgccaa tcgctcaaca atgcttgcat    189420
     gaatcagacg cggtggtcgt gcaagacccg gcgttgctgc cgacggaagc tgccgcggcg    189480
     atagcgattc ccgttcactt tgatggtgcc attcagtcgg tcatcgtctt cttcgcgaaa    189540
     gcacctagcg aagcgatgcc cgatccagtc ggcgtgttcg aagtttggcg tccggtcggc    189600
     ccctacgacg aagtcgcttt gcgagagggc tactacggaa agctggaacg ttttcaaaac    189660
     gtcagctcgt tcgttcgttt cgaaaaaggc aacggacttc ccggcgtggt ctgggaacaa    189720
     ggccgggctc tcgctcaaga cgatctggca aaccacatgg gattcctgcg agcggccggt    189780
     gcgtccgcgg acttactcaa tgccgcggtt ggttttcctg ttttcgctga ccaatacctt    189840
     tcgacagccg tcctaattca atccaaacgt tccccgatgg cccgagcgat cgaggtttgg    189900
     aacatcgatg gcaaagaatg cgaactgacc agccaagcgt atggcgaagt cgaaaacgcg    189960
     tttcgatttg acaccggcac tcgtgtccct ctgacaaccg gaattttggg tttggtcgcc    190020
     gaacaccaac gcgttgtttt gctcgaagac atggaagcgt tgctgctcac acggcccgcg    190080
     gaacgagtca tgccgtgccc aaccgccggg ctcgccattc cgtttttcga cggaacccat    190140
     ctcagctcca tcaccgtttt gatgttctga tccatatgtc cagccttctt ccaaccgaac    190200
     cgaacttcgc ccatcccgat ggtgctgcgc ccggcgtcgt cacgtcgccg ggtttgccga    190260
     tcgaaggaca aggcgactcg ttcgatttgg tcagtctctt gttgcaagag cagcaaacgc    190320
     tgaccgcggt ggaagacttt gccgccgcac acgactccgg aaccgcagaa gacaacgttg    190380
     cggatcagcc agcacaagct cggtactact ccaagctaat gcccgccagc ccgccggggc    190440
     cgggacaaca gttcgccttc gatgtcaatc tcgacacctg cagtggctgc aaagcctgcg    190500
     tggtggcttg ccacaccatg aatggcttgg acgaaaccga aagctggcgt cgtgttggaa    190560
     cgctggttat cggcgagacc gaacccgaag ccattcccgc cgcgattgga gtgcaacatg    190620
     tcacgaccgc gtgccaccac tgcgaagatc ccggctgcct gaatggttgt ccggtcaaag    190680
     cttacgacaa agatcccgaa accggaatcg ttcggcacct cgacgatcag tgcatcggtt    190740
     gcaagtactg cacgatgatg tgcccctacg aagtgcccaa gtacagcaag cgattgggca    190800
     tcgttcgcaa gtgcgatatg tgtcaccaaa ggctctcagt tggcgaagcc ccggcctgcg    190860
     ttcaatcatg tcccaacgaa gccatcgcga ttcgcgttgt cgaccaacaa tgccaagaag    190920
     tctctgatga ggaacgcttg gtcgccggtg cgccgctttc atccatcacc cggccaacca    190980
     ctgtcttccg cagcaacgac ccaaccaaac gttttcaggg agtcgcgcaa gacaatggca    191040
     tcgatgaacc cgccgaagat cactggccat tggtcggatt gctgatcgcc actcaagtcg    191100
     gcgtggggat gttgctgacc gaacgagtgc tggccgcgat cggctggttg gctggttcac    191160
     cgatgccaac ggagacgact cgctggaccg cgacagttgc cttgatggtt tcgatgatcg    191220
     gcatgaatct cgccccactg caccttggtc aacccctgcg atcctggcga attttcttgg    191280
     ggctgcgaac atcgtggctc agccgcgaag ccgtcttgct gggcaaattc gttggtgttt    191340
     tgaccatggc ggtggtcgcc atgtggctac ccgccgtttc cgaatacttg cccgattggg    191400
     tttccatccc tgcttgggtc cccggcatgg ttttgctcgg tgcaattgtc tttggagtcg    191460
     caggattgtt cagcagcgcg atgatctaca tcgccaccaa acgcgttctt tggcgatttg    191520
     accgaaccat gattcgcttc atgggaaccg cagtggtcgg cggtgtggca gccagtgccg    191580
     ccgtgatcgc cgcgacatcg gatcgaagca actccgtcac ggtcctgctc ggcctggcaa    191640
     cgttcgcttt gattgcgaaa ttggtttggg aacaaagcat cttgctacgc agtgaaccag    191700
     gttcgtccaa cgaccaatgg gaccgacgca gtcaacgctt ggtgcgtcat cacctttcca    191760
     aatggagttt gagtcgattg gcattgggat atgccggctt ggcattgctg gttgtctctt    191820
     ccgcgttggc gattgccggt tcatcaatgt tgctcaccgt cttcgccgcg gccgcaacga    191880
     tgcttttggt ggcaggagaa accactgaac gattgatcta tttctcaagt gttgttcatg    191940
     atcgcatgcc ggggaccctc cgatgagtat ctcaatcaaa gacaatcgga acgacgccgg    192000
     caagacattt cagttaccga ccttgttgca acgacgcacc gggccgatga ctcgcgagtt    192060
     ggttctgcgt cccggcgacc atggactggg gatgacccat gattcgatgg ctgcggacac    192120
     gaccaccacg gcgacctgtg gtttctgcgc caccggttgc ggattgcgat tgcatttaaa    192180
     agatggcgaa gcgatcgggc tgacccccga gaccgcatac ccggtcaacc ttggaatggc    192240
     gtgccccaaa ggctgggaag ccctccgagt cttggattcg cccgaacgag ccacgctgcc    192300
     gctgcttcgc gatgaaacag gaaagctttc tccgatcgaa tgggatgatg ctttcagcaa    192360
     gttttgcgat gggatgaagc aggtccaatc cgaacacggt cccgagtcca tcgcgtttct    192420
     atcgacgggc cagattgctt gtgaagagat ggcgttcctc ggcgcactcg cgcgttttgg    192480
     aatggacatt cgacactgcg atgggaacac ccggcagtgc atggcgaccg ctgtcacggc    192540
     ttacaaagag tcgttcggat tcgactcacc gccgtacacc tacgacgact tcgaacaaag    192600
     cgattgtttg gtattcattg gtgccaatcc gtgcgtcggg cacccgatca tgtgggaacg    192660
     cgtgctccgc aatccccaca accccgaaat catcgtcatc gatccgcggc gtacggaaac    192720
     cgccgccgcg gcaacacaac acctgcaact gcggcccaag aatgacttgg cattgttgta    192780
     cgcgatcaca aacgaattga tcctgcgtga ctttgtcgaa cacgacttcg ttcaaaatca    192840
     cacgcaagga tttgaagagc ttcgccaaca tgtttctcag tacgatctcg cgaccgtctg    192900
     cgaagaagca ggattggctg tcgaagacgt ttcagcagcg gtggaagcga tcggacgcgg    192960
     ccgtgccgtt tcgctttggt ggaccatggg agtcaaccaa agttaccaag gcacacgcac    193020
     cgcccaagca atcatcaaca tcgcgttgat caccggaaac atcgggcgtc ccggcacggg    193080
     agccaacagc atcaccggtc aatgcaatgc gatgggttcg cgattgtgga gcaacaccac    193140
     caacctgttt ggccatcatt ctttcaccga agaatccgat cgccgaaagg tcgcagaagc    193200
     actcaacatt cccgtcgaaa agattccgtc caccaccagt tggaaatacg accggatcat    193260
     tgaaggcatc cgcaacggtg aaatcaaagg cctatgggtc gtcgcgacca accccgcaca    193320
     cagttggatt gaccaaggcg acgttcgcga actatttgac cagttggatt tcctggtcgt    193380
     ccaagacatg tacaagacca ccgagacatg ctcgcacgcg gatctgattt tgccgtcggc    193440
     gggctggggt gaaaaagaag gcactttcat caacagcgaa cgccgctatg gattgctgaa    193500
     gaaagtccgc cacgccccgg gccaagctct cgccgacttc caaatttttc gagggatcgc    193560
     acaccgttgg ggagtcggag agatgttcgc cgaatggaca tcgcccgaag cggttttcca    193620
     gatcatgcag cgtgccagtc gcggacaacc aagcgacatc agcggcatcg aaggctacga    193680
     acagatcgat cgctgcggcg ggatccagtg gccgtggtca gccgaccatg ccagcggtgg    193740
     ttttgaacct gaacaacaac gacgactgtt cgccgatggt cgattctttc acgaagaccg    193800
     ccgggctcga ttgattgtcg atgatgtttc acccatgcca gaaccggccg gcgaggacta    193860
     cccaatcgtt ctgctaaccg gtcgcggaac cgtcagccag tggcacactc aaacgagaac    193920
     gcgacagagc ccgctgctca ggtcgctgta tcccaaccaa ccctacgtcg agatgcatcc    193980
     tcgtgatgcg gcggaattgg acgtcgagca cggcgacctc gttcgcgttc ggtctcgacg    194040
     cggacatgcc gacgcgacgg cgtgcttgac ccactcggtc cagcccgggc aagtcttcat    194100
     gccaatgcat tacgaatgca ccaaccagct caccctttct cactttgacc cacacagtgg    194160
     ccaacccagc tacaaggact gtgcggtccg catcgaaccc gttttgacaa gcgaccatga    194220
     ctgatcaaca ggactccaaa ccgttctcag acgaacaaca gcaatatctc gccgggttca    194280
     cattcggtgc cgatgtcgct cgcgcggtcc aaggcctgcc cgtcatctct ggttcgggcg    194340
     gtcaaggaac cacgctcgcc atcggcggcg gatccacgac cgtcgatggc gaatcagtgc    194400
     ccacgggtcc cgatcgtttt gccttcgaag cccaatcggc ggtgctcgcg gcaggaaaga    194460
     aactgtcgaa agaagaacag gccaaacgtg acaagaaccc gctcgacatg tgggacgaaa    194520
     tgcaggctcg cagcgatgcg ggcgaattcc ccaaaggcac ggatgtcttt ctgcaaaagt    194580
     tccacggact gttctatgtc accccagcgc aagacagctt catgtgccga ctgcgcctgc    194640
     ccggcggtca aatccaagct tggcaattgc gtggcctggc cgatctggcg gaccaatccg    194700
     caggcccgta cctggacctg accacccgcg gcaacgtgca gttgcgtgag atcccggccg    194760
     accaagccat gaacatcttg ttcggaaccc gcgagctgaa catcgtgccg ctgggcagtg    194820
     gtggcgacaa cattcgaaac tgcaccagca gtgcgatgtc gggattggat gcggacgaac    194880
     tgatcgaaac attgccgctg gccatacgca tgcatcacta catcctcaat caccgagaga    194940
     tgtacgggtt gccacggaag ttcaacatcg cttttgaagg cggtggccga attgcttcct    195000
     tggaagacac caacgacatc gggttcaaag ccgttcgcgt gctggatgag aacgcatcgg    195060
     acgacttgcc cgccggcgtc tacttccagc tttgtttggg tggcatcacc ggtcacaaag    195120
     acttcgcccg ctacaccggc gtgctgctgc gtgaaagcga atgtgttgcc gtggcagccg    195180
     cgattgtccg agtgttcatc cgcaccggcg accgcaccga tcgcaagaaa gcacgtctga    195240
     aatacgtgct cgacgatatg ggattcgaga aattcatcgc agaagtcgaa gccgaaatgg    195300
     gtcgcacgct cacgaaagtc gatgtcagtc gcttgaccgt gcaagacatc gaggaccgaa    195360
     gtgctcacgt cggagtgttc ccgcagaagc aacctggact gaactcgctc ggcattgtct    195420
     tccctgttgg gcggatgacg accgaccaag cgcgtgcact cgccgatctt gctcttcgct    195480
     attccaacgg cgacattcgt ttgaccgttt ggcaaaactt gatattgacc aatatcaccg    195540
     acgcggatct accggccgtc caagccggaa tccgcgagtg cgggctggac tacgaagcca    195600
     attctgttcg agccggcttg gttgcctgca ccggcagtgc cggttgcaaa tttgctgggg    195660
     caccgaccaa agcgaatgcc attgagatcg ccgagcgagt cgaaagcgtt ttgacgcttg    195720
     accagcccat caacattcat ttgaccggtt gccaccacag ttgtgctcag cactacatcg    195780
     gcgacatcgg cttgattgcc tgccaagtcg aagttggcga cgacatggtc gatggctatc    195840
     acatttgtct tggtggtgga tggggttcac ggcaaggaat cgcacgagag attttcaagt    195900
     cggttccgtt tgccgaagtg cctgatttgg tcactggcat cttgtcgagc tatcaacaga    195960
     accgcgtcga ttcaaacgag tcgttcaacg acttcgcggg ccgcctcagc gatgaggaac    196020
     tcaaaagttt ggtcgccacc ccgtcagtcg tttgttaacg aacggtcgcg atgggcgtca    196080
     cgaaaacgcc tgatccattt caaccttcca accacgtttc gattcattcc caggattgat    196140
     cccgatgtcc agctacattc cagaaaccgc cccattcaat gaacaacagc gagcttggtt    196200
     gaacggcttt ttcgccggtc tgacgggcat ccaagagtcg gccggtggaa gtgtcgcgac    196260
     cgcgatggcc gctggactgc cctcggccga ggcacctgtc gaagaagagg aggactttcc    196320
     ttggcacgac gattcactcc ctatcgttga tcgaatggaa ctcgccgaag gcagaccgct    196380
     cgaccgaaag ttgatggccg ccatggctca gctcgattgt gggtcctgcg ggtacgtttg    196440
     ccaaacgtac agcgaagcga tcgcgtcagg cgaagaaccc aacgtctcgc tttgcagccc    196500
     cggcggcaaa gaaaccaaac agatgatcaa aaagcttctt gccgaagccg gcgacagcgt    196560
     caaagcctcc accaacggca acggatccgc aaccaatggt gtcgcgacca acggagccgc    196620
     cgcttggtct cgcaaaaatc cctattccgc caacttgatc gaatcccgcc cgctcaatca    196680
     ggaaggctcc gcaaaagaca cacggcacgt cgcgatcgac ctcgtaggat ccggtatcaa    196740
     atacgaagtc ggcgacgcgt tgggaatcta cccgaccaac tgcatcgacc tgtgcacgca    196800
     aatcattgat cgtttggccg cggactccca cgtgaaagtg gcaacgcctc aaggcaacac    196860
     gaaaccgttg ctcgaagcat tgcaagaaga ttgttgcttg aaagaccctt ccgatgaact    196920
     gcttgagctg ttggtcggac ggacacccaa cgcggacgcg caagcaacgc tgaatcatct    196980
     gctcgccgaa ggcgttccgg aaggctttga tgtgctagac gtcttggaag tcgccggcga    197040
     atcaacgatc accgcgaccg aattcattga gtgcctcgat cctctgaacc ctcgcttgta    197100
     ttccatcgcc agcagcatga aagcggtcgg cgaccaagtt cacttgaccg tcggcaaagt    197160
     catctacgaa cgcgaagaac gcgttcgcaa gggcgtcgcg agcaccatgt tggcggaccg    197220
     agttggcacc ggagaaagca tgcgagtctt cgtgcaaccc aaccatggtg gattcaccgt    197280
     tcccgccgat gaaaacgcac cgatgatcat ggtcggtccc ggtaccggaa tcgccccatt    197340
     cgtcgcgttc ctacaagaac gtgccgctcg caagtcgccg ggcgacaact ggttgttctt    197400
     tggcgatcaa cacgaagcat acgacttctt gtatgaatcc gaattgaccg agtacgttca    197460
     ctccggtgtg ctttcacgac tggacaccgc cttcagtcgc gacggcgaca cgaaggttta    197520
     cgtgcaagac cggatgcgag agaacgccgc ggaactctgg gcatggttga accgcggtgc    197580
     tcacttctac gtctgcggtg acgcaacccg catggccgcc gacgtcgaac gagccctgtt    197640
     gcacatcatc acccaagaag gcggcatgtc agaagacgaa ggcaaagcct acttgaaaac    197700
     catgacgagc gaaaaacgat acgtccgcga cgtgtattga tcgtcggcat cagccgacgg    197760
     ccgttaggcc cggtattcga cgtaagtctc actgtggcga tccaaggacg actcactgaa    197820
     aaagttaaat taacaattgt aaattgtaaa cttctgagct gagcagtcga tttcgatagc    197880
     gtggtgattt gacaccgcct tcgaaacgcg ctgtccgcct aacaacaaaa tatcgcgagt    197940
     ggcgaagggt tctgatatcg aagcttttga ttcgcgaact caatcaccaa accaatttca    198000
     tctttacaat tgtcaattta actttttcaa tacccacgct cccaaacacc ctgtcaccta    198060
     aaccttccga agcaggtgca tgccctcgcg gccccgatag gtcagcagca gcgcaccgac    198120
     cgagcctcga gcatccacga cggtttcgaa gaactcgttt tcgccgggcc atgggaatgc    198180
     gaagaagagg tcgaagtctt cgatctcaaa tccgatctcg tcgtagatgt caccttcttc    198240
     ggtgtcgacg ttgcgaacct cgcgagcgat ctcggacaac tcctcgacgc cgcgtggaac    198300
     aaagctgccg caatgaatct gtgcgtcgtt gtcgagtgag tccgcaaccg cctgggccgc    198360
     ttccaccaaa cgtggttcga tctcaatccc cacggcctgc atccctcgca gggacgccag    198420
     cattgcaccg accgcgaaac cggcgccgag ttcgcaaaag cggttgcctg ccagcaagtg    198480
     gttttgctcg atccacgtca tcgcttgatc tagcaaatga aaatcgcagg tgacaaagtt    198540
     ttcgatcacc gattcgtccg ccaacatgaa cgcctcgatc gcgtcgttgg ccgaatcaat    198600
     caggtgctcc gccgaatcgt ggtacggaag agttttgatt gagtccggaa tctcaatttg    198660
     ctgccacgcc atccaatcgc tcctgatgca aactcggtga acttcaaaga gcttggatgc    198720
     gttgaccgtc atcgctcaac gcgaacattg gggtctcgtg ccccgcgacg acttggtgga    198780
     cctgttcgac ggtgatcgat ttcccagacg cgttggcgtt ggagaccaat tcgtcaaccg    198840
     aagcgaaacc gtcggcatcc agattcaagc cgatggattg cggcgcgtgc cgcaggatga    198900
     aggtcaggta tttgctgatt cgcgtgagtc gtttgttcat tccgcccagt ctaaacaccg    198960
     gcggcttctc cgtcgccggg tgattcgtca acggaatcac atttctgagc agaccgtttc    199020
     gtccgacatc caggatcagg cggttccgcg aagtttcgcg ggggtatcgc acaaatcgtt    199080
     gtagtgatga gccgtgcgtt cgacggtgaa tcgaatttgc tcttcgctgt gttcactggt    199140
     gatgaagaac cgcaatctcg cggccgactc atccaccgcc ggatacaaaa tcggttggac    199200
     gttgatcccg tccttcttca gccgattact caatcgaagt gcgacgagac tgtttccggt    199260
     gatcacggga accacgggag taccgccact gtcaccggtg tccaagcccg cttcacggct    199320
     cagattcagg aacaactcgc tgttgtggcg aagccgctcg acccgttggg gctcacgctc    199380
     caacacttcc aacgaagcga tcgcggcggc gacttgccca ggaggcatgc caacgctgaa    199440
     cacgaatccc ggagcggtgt atcgcagcaa ctccaccaag gcttcactgc cggcaatgta    199500
     gccaccacag gaggaggccg atttgctgag tgtgcccatc caaatatcga catcgcgagc    199560
     gtcgaatccg aagtgttcgg cgatcccatg accggtcgcg cccatggttc caaagctgtg    199620
     tgcctcatcg accatcagca tcgcacggtg acgttttttg acctcaacga acttcggcac    199680
     atcggcgaaa tcgccgtcca tgctgtagac accttcgatg atgatcaaag ttcggcggta    199740
     ttgaccacgc agcgcggtca gcatcttgtc gagagcttcg taatcgttgt gtgggaaggg    199800
     acgacgtttc gctccggaca gcaacgcacc ttggacgatg ctgttgtgcg aaagtgcgtc    199860
     gtgcaggatc aagtcgccgg gcccgacgag gtgtccaatc gtcgtttcat tggtcgagtg    199920
     accaccgacc atcgtgatgg aattgtcgac tccaacccac ttcgcgattt tgcgttcgag    199980
     ttcaccgtgg atcggctttt caccgctgac caaacgactg gccgaaacac tggttccgta    200040
     tttcgtgatc gcgtcggcgg cggctttgga aacctcagga tggccgctca aacccaagta    200100
     gttgtagctg gcaaagctga tcaatgactt tccatcgaca atcgttttgt cgccgaccac    200160
     gcaatcgtga acggtaaagt atggattggg gacaccagtc aattgcatct gacgcatcgt    200220
     cgatttcaaa cgtcgatact cagcgaactg agtcacgtcg tcttcgggtt cgacttgagg    200280
     cgtttgcatg acccgagcga gtgggccttc gccgtcggtg ctggagcgac cgttcgcgtt    200340
     tgtgttgaca aggtcgtcgt caccgtctcg ctgcgtgtcg cctcgtccgg ccaagaactg    200400
     ttcggcgcga ccgagagctc ccgcaggcag atagcgttcg accgcggttg cgatttggcc    200460
     gatcgtttca atttcatcca gcacttgttc cgggaaccga ccgccaaagg tgcgttcgag    200520
     gttcctggca atttccaaac gttccagact atccagcccg agatccaaga cgatgttggt    200580
     ttccggattg atcgatcccg ctcgttcacc cgcgatggct cgcacgtgcg acacgattgc    200640
     ttcagcgacc accggatcag cgaccgaatc caaaccgctc gcgtcagaag ccgcggcagc    200700
     tttcatcatg gtttcgccag ccaaaccggc gttgtgcaac gaggattctt cgccgcgaat    200760
     ccattgggcg atgaccttca gctctttgtc tcggacggcg tgcaaacacg cgtgtcgctg    200820
     gatctttccg ctactggttt tggggacgga actgttgcga accaagtaaa tcgcatcggg    200880
     tggaagatcg tgttcctcgg tcaccgcacg acgaatcgat tgcaggtgat cgtcccaatc    200940
     caagtctcgt ttgcggacgg tttccgcaac gatgatcagc ttctcacgac cggtctcggt    201000
     ttcgtcgctg tcggcattca tcgcgaaggc ggcaacggaa ccggcttgca cgacgtcgct    201060
     ggcatgctcc accgtggctt cgatgtcctg cggataacga ttgacgccgc ggacgatgat    201120
     catgtccttc aggcgtccgg acacatacag ctgtccgccg tacaagaaac caaggtcacc    201180
     ggttcgcaaa aacggccctt cgccttcgga cgtcatcgcg gcgaaggtct tggccgattg    201240
     ttctcggcgt tgccaataac cacgaccaac cgatggactc tgcacccaaa tttcgccgat    201300
     tgcgtcggag ggcaacgttt ggcgagtgtc gggatcgacg atcaacacgc gttcgccggg    201360
     aaggactcgg ccgcacccga ccaattctcg ggtcgctcgc gcggaggatg ttttcgagtc    201420
     atcttcatcg tccgattgtt ttgccaaatc cgcaggcaca tcaacggccg gacgaacggc    201480
     cttttcatca agtgccggcc cgtcaaattg ttgcagcacg ggacgaggag agatcggacc    201540
     accggtaacg atcagcgtcg tctcggccat cccataacaa ggcaaatgcg aactgtggcg    201600
     gaaaccatac ttttcaaatc gcttgctgaa cgcgtcgagc gtcgacgaac gaacgggctc    201660
     ggctccgttg aaagcaatct cccaagacga cagatcgacg ccttcgagtt cttcgtcgcg    201720
     aattttgtcg acgcacaatt ggtaggcgaa gttgggaccg ccgctgatcg tgacttgatg    201780
     acgggcgatc gtttgcaacc atcgactcgg tcgctgaagg aacgccatcg gactcatcag    201840
     aatgttgtgg cgtccgacga acatcggcat caaaacaccg ccgaccaacc ccatgtcgtg    201900
     gtaagtcggc aaccaagacg caccaatgat ggtcgactcg ggttcaaacc cgtgcagaat    201960
     caactcactg ttggcgatca agttggcctg agtcagcatc acccctttgg gtgaccctgt    202020
     cgaaccggat gtgtactgca acacaccgag agcttcactg cgaagttttg ggcatcgcca    202080
     gtgggtcgca tcgcgtttgg tgggcaagtc ggttcccaac aactgcacac cgaccaaatc    202140
     ctcgtgcagt tcgttgccgg aaagttgatc gacgacggaa ctggtcgaca aagcccatcg    202200
     ggcgtcggca tcgaccacga tggaacgaat tcgagatgcc ttgcggttac gacgaggcgg    202260
     gtaggcggga accgcgatcg caccggcggc gtgagtcgcg aaaagaccaa tgacaaaatc    202320
     cagtccgggc gggtagagca gcagcactcg gtcaccagcg cggatgccgc aacgaccctg    202380
     caaatacccc gcgagaccgc ggacctcttc ccacaattca gcgtacgaaa gcgtttggtc    202440
     ggaaccttcc ccgtcggtga acgtgaacgc gggagcatcc ggccggacct gcacccagtg    202500
     gcgcaagacc gagacaaagt ggtcgtgagg aggcgtttcg tttttgaaat actgttggag    202560
     gtccaccgat tcaacctgtt gcaatgatgc cgtcgcagaa caatctcgtt ctctcttgac    202620
     cgtaatcttg gacgctccat gaccagtcat gcggtgcgga ggggcaatca gtcattgttg    202680
     caatgatgca ccaacggcgc cgatcggcca agggtcggcc ctccaccgac tcgtccaacg    202740
     gtccggcgga gggggtcatg accatcgcgt ctctcggctg gatcggtctg cggcgacaat    202800
     tcaagatcga gttgctaccc cgctataatg gcctattgcg ggtgcccaac gccacctgac    202860
     attgacgaaa aacaaccacg ttgtctgctc agcaaccttt cggttacacc aggcgacttc    202920
     tcacgctcca atttccgatc gaactgcccc tttcgaacat gagtacgcca aagatgaagg    202980
     atttctacga ttgcgtggtg attggtggag gcccggccgg tggtgctgcg gcttcgattg    203040
     tggctgattc cggcgtcagc acgctgttga tcgagcgaga tcctgtgcct cggtttcacg    203100
     tcggcgaatc gctgatgccg gagtgctatt ggcctctcga gcgactcgga ttgatcgatc    203160
     aagtcaaacg atcgggatgg caggccaaga aaagcgtgca gtttgtcacg catacaggca    203220
     aagaatcggc cccattcttt tttcgcgaac acgatgaacg cgagtgcagc acgacttggc    203280
     aggtcgaacg cagcgaattt gacaaaatgc tttatgaccg agcctcggag ctcggagcgg    203340
     actgttttga ccaaactcga ctgatcgacg ttcaaacaga acccggcgaa acagaggacc    203400
     aaccgatcgc acgtgccgtc gtcgtacgga ccgccgatgg caccgaaaaa acgatcggct    203460
     gcaaagtcgt cgtcgacgcg acgggccagc aagcgttttt ggctggaaag atgggtctga    203520
     aagaaatcaa tcctgaccta aaaaaagccg caatctggac gtattaccgc gatgccgttc    203580
     gcggtgaagg cgacaacgat ggcgcaacca tcattctgaa caccaaatcg cgtgattcct    203640
     ggttctggtt catccctcaa tctcgcggga tcaccagcgt tggatgcgtc ggcgacaacg    203700
     actaccttct caaaggccgc ggaactcccg aagaaatttt tgaggaagaa ctcgccaatt    203760
     gtcctgggct tcaaccacgg ctggccaatg cgactcgcgt gggcaaaatc acgaccgcca    203820
     aagaattcag ctacatgacc cgccgacact ctggcccggg atgggtgtta atcggcgacg    203880
     cactggggtt catcgacccg gtctactcct ccggcgtcta tttcgcactg gaaatgggtg    203940
     ttcgtgccgg cgacgcgatc gtcgaaggac tgaagaaaga cgacctgtca gctgaacaac    204000
     tgggaaaatg gaccgacgat ttcaaggaag gagcttccaa ggtccggcaa ctcgttcacg    204060
     ctttctacaa caaagatttc agcattgggc ggttcatgaa ggaacacccc gagtatcgcg    204120
     gcaacgtgac ggacttgctg atcggccgtg tcttccacga agatgcgggc aaaatgtttc    204180
     cggcactcga tcgttccatc gagatggctc gggccgatgc catgtccaag gccgattcga    204240
     tggccgaaac caaacccatg tcgacttaat gtcccaatct gacaacaaca ccgcttcgat    204300
     cctcagcccc aacgaacttg gccaattgca cctcgacatc gcgatcgctc atgatttgac    204360
     ggaacgctac gaaggcctga tcttcgactg tgacggaacg ctcaccaatt ctatgccgct    204420
     tcattacctg gcatggaacg agacaatgac tcgtcacggc atcgattttc cggagtcgcg    204480
     tttctacgcg atgggcggca tgccaagtga aaaaatcatc gccgtgctga gttcagaaca    204540
     aggcgtttcg atcgacgttg atctggcgac agaagaaaag gaagcaaact tcatcgctcg    204600
     cattcccagc gttgaacgcc tggaacacgt cacagacatc gccgaacggc acctcaatcg    204660
     aatcgccatg tccgtcgcca gtggtgggat gcgagacatc gtcgcggacc aactgcgaac    204720
     gatcggtgtt gccgattggt tcccggtcct cgtgggcagc gaagacacgg aactgcacaa    204780
     acctgaaccc gacgtgttct tgtgtgcagc cgagcgaatg ggcgtggatc caaaacgatg    204840
     tttggttttc gaagacagcc cactaggctt cgaagccgcg aaacgagccg gcatggattg    204900
     ggttgacgtt cgcgtcgacg cttaagatct gcggtgcacg gcgtcttcaa agcgttgcac    204960
     ccaacgctgc tactcgtttc caaaagcttc atcggctcca aacgtttcat cggtcaacgt    205020
     ttttaaatgt tggcccgcgt gatcaacggc gtcgcagatc gaggcgtcca tttttgcagt    205080
     gcgggcactt cagtttgccc cgaccgctgc acgtcggaca acgtttcttt ttcacaacgg    205140
     gagcgtacac gtcaccgcca atccgtgacg aagagacgac ttcctgtttt cgataagatt    205200
     gagaaccgtt cacacagttc ggacaatcct ggtacgacga gccgatgcag gaaacacacc    205260
     aagtgttctc gatcatcagc gactcgctgg ggccggtgcc gtcggccaca tcactgaaca    205320
     gaccacttcc ggatttcagc ccccaaacaa aaacgggcac caccgacgct ttgggatcaa    205380
     atcgtttttc aatgggttga tcatcaacgc tggtcagtga agtagttcgc acgttgcggt    205440
     tgaaccaaga ccggatcatc cgagcaccaa aggctcggcc actcgtttcc aattcgtttt    205500
     ccgacatggc aaaaacgatt ccgtggacag ccttgtcgtc actcatcaac ggaccaccac    205560
     gatttccgcc cgttgtttcg ttggaaacat tctgaacgcc ttgatgatcg ggctcactca    205620
     aaatttcccc ggtgaactcc cgcactccct gcttcaccaa gttctgtccg gggtcgtaac    205680
     catacaacgt cagatcggtc gcttttgctg gtgtgtcgtt cgcaatgcac agcggtgcca    205740
     aatccaatcc aggtacgtgc aatgcggcca gttcagcatc ggaagaacca gcacggtgtg    205800
     gaatgattcg aaaccgtgtg accgttccga tggtttcgtt ggtgcgaatc acgatgccac    205860
     ttcgagctga aattcgcggg gccgtcatca agcagttctt acacgtcaaa gctttgaaga    205920
     tgccgtgctg atacgatccc acggttacca tcttgggacc ataaccatcg gtgttcgtaa    205980
     tcacgtccgt cgatgtcagc acgattcccg gtgcaacgac gaaccccgtt ccgatcgaga    206040
     ccaattccat gaacacactg gggctgtcca gaccttcgac cttgcggttt cctgcgccgg    206100
     cttcaatcgg taaatcaaag tccaacgtgt agtacaagct ctcgttcaag ttgggtttcg    206160
     aagtactgac atctgcggat gccaatgtgg ccagcaattc actgcgcaat cgcggtgcca    206220
     gttcaatcaa accggtccgc atcgaatcgg tttgcgccag caactgcatg ttgtgctcaa    206280
     gcaccgctga cacaacgttg gacgattgca ctcccgcgat aaacgacgat gcggcagggt    206340
     tggcttcctg ttgcttcaaa gccaccacac ccaggttgtt gcgagccgat gccagcgtca    206400
     tcgagtgacg tcccgccatc acttcttgct gagcctcgat ccgtttgacc gcttgcatca    206460
     gcaaacgctt ggcaagttcc aagttgttct cgccttcgga caaacccaca cccgcccaaa    206520
     ttcccgcgta aggactttcg ggaaccgctt tgtggatttc cagcaacaaa cgactgacag    206580
     cctccggtcg ctcgtacatt ccaggtagat gttggcgaat catctggaat tgtttcgcat    206640
     cacgctcgtt gaaccagatc tgcattgcct gcaaacgcga ttcgggcgtc aaactatcca    206700
     gcgaaacttc caccggagac cgattgcctt cgacctgcag aacgaccttg gaatcgtcta    206760
     cacgtatcaa ctcggcttcc acgctcgaac cagcgcgact ttgccaggtc accgggccct    206820
     gcgaccgtcc caccgacggc catcccaatc cggccagcgt cacaagcacc gcgatggcga    206880
     ctgaaaagcg attcaaaaac atatcaagtg ccttgatctg gacatccgca aagcgataaa    206940
     cgacctgctc gcggaagctc cactcggaac tcaacccgcc accggagggc cctctcttag    207000
     agctcactac ctaggggaga aactaacctc ccaagcggat tcgttcaaac tacgttacaa    207060
     attttcgtag caggaacgcc caaaagtccg cccgatgctc ttaggccaac gcgttccgta    207120
     cgaagtacct accggctcca gcggcgaatg actcgcacgc cgtccaagtc gatggactaa    207180
     aatcgcgacc atgagcccat cgcgtattct ccgtctgtta tcgactgaac cgagtcgtta    207240
     tccatcaaga ccccagttct ttttgctcgc cgcggctttg gctttgggaa cccactcgtt    207300
     tgccgtgaac gcgagcgaac cgacgtcgat atccaacccg gagattcaaa ccttcttgca    207360
     aaatcactgc cgcgactgcc acgctgacgg tgcttccgaa ggtggactca acttggacac    207420
     gctaccacga accatcggcg gggctgctga cttggccgtt tgggttcgca ttcacgatcg    207480
     agtccaaacg cgagagatgc caccacccga ttcgtccacg ctcgacgaaa cacgacgaac    207540
     tgatttcatt gccgcgctgg ccactccgct gaaccagcat cacgcatctg aaaaaggcac    207600
     cgtccttcgt cgactgaacc ggcgagagta cgagaacacg ctgaacgatt tgttcggcac    207660
     cgcagtcgaa ctggaaacat tgttgcccgc tgatggacgc agccacgaat tcgacaacgt    207720
     gggtgaatca cttggtattt ccatggttca cctggaacgc tacctcgacg ccgccgactt    207780
     ggtgttggaa tctgccatcg cgaagaccgc cgatcctccg cccgtccatg tgatcgacac    207840
     tcactacgca gaaacccgcg aggccaaaac gcacttaggc aaagtgtgga aacaactcga    207900
     tgatggatcc gtcgtgttct accaaaactt tggttaccca gacggcatgc ttcgaacgag    207960
     tagcattccc gaatcgggac gctatcggat cttgatcacc ggatacgcat accaaaccga    208020
     tcagaagatc ccgttctatg tcggggcaaa aagctttacc cgaggcagcg aacaaccaac    208080
     gctgggctac ttcgacatgc caccgctcag ccccgatggt gaaatgacaa ccatcgagct    208140
     gaccgcgcat ctggaatatc gctacatgct caacatcatc ccgtatggtt tggtggttcg    208200
     cgattacaac attcgcaacg atggcgtgga tgggtacacc ggccccggac tggcaatcgc    208260
     gaacgtgcaa ttggaagggc cattgaagga cgagtttccc tctcgtggcc atcggttgat    208320
     cttcgatgat tggcaacgcg aagaggttat gcccaaccct ccgtccaaac gagagaagtc    208380
     ttggtacaaa cccgagtttg aattgaccag cagcaacccg gacgagtcgc tgcgaaactc    208440
     attgcagcgt gtggcatccg cagcgatgag acgtccggtc aatgcatccg aactgacacc    208500
     ttacatcgag ctttttcgtt ccgagcaaga ccgtggcgca tccaccgaag atgcgttgcg    208560
     aaccgccgtc gccgccatcc tttgctcgcc cgattttttg tattttcgtg aaccgcccgg    208620
     caaactcgat gaccatgcca tcgcgactcg gttgtcgtat ttcctgaatc gcacaacacc    208680
     tgacaaggca ctgctacgcg ccgccgggca aaacgaactg acccgatcaa ccgaatcatt    208740
     actgagtcat gcaaaacggt tggtagctga acccagattt gatcggttcg tggtcgactt    208800
     cacggatgct tggcttaacc tacgagacat tgatcaaacc agccccgatc aaaagctgtt    208860
     tccggaatac gaccggtatc tgcgcgacag catggtcgaa gaaacacgtc aattttttgc    208920
     gaccttgatt cgtgaaaact tgccggtcac gaatttggtg aaatccgact tcgcgatgct    208980
     gaatttacga ttggcaaatc actacggcat cgaaggagtt gatcacgctg acatccgccg    209040
     cgtgcgactt cctaatgatt cggttcgcgg cggtttgctt ggacaagcca gcgtactcaa    209100
     ggtcaccgcc aacggaacga acacgtctcc cgtcgtccgc ggtgtgtggg tgaccgaacg    209160
     cttgctcggc gtgcatcctg caccacctcc gccaggcatc tccggcgttg aacccgacat    209220
     ccgcggggca gcaacgctgc gtcagctgct cgatcaacat cgaagcgaag aatcctgtca    209280
     tgcctgccat gcattgattg atccaccggg tttcgcactc gaaagtttca atcctattgg    209340
     cggctggcgt gatcgttatc gcagtctcgg cgaaggcgaa cgaatcgact tgcgtgtcaa    209400
     caatcgccgt gtgcaatacc gcttggggtt gcctgttgat tccagcggta cgttgccatc    209460
     gggcgaatcc ttcgaaggat ttgacgcatt tcgggattgc cttctcaaag accctgatca    209520
     attggcaatg tcattgatca ccaagtggct gacgtttgcc acggggcgag aaatggggtt    209580
     ttccgatcgg caagaaattg aatctttaac gcggcaatcc gctcagcgag gtcatgggct    209640
     tcgcacgatg ttggcgttgg tcatcgccag cgacattttc cgaaccaagt agcgtctcgc    209700
     tcacttgatt caacgacgct cctaaccttt cacttgaaaa agccatgctg attccctctc    209760
     aaccgatgtc tcgacgacga ctgttgcgat ccgccggtgg tgcggccttg gctttgccgt    209820
     tcttggaggc gatgggacct tcacttggtc gccgtgtgtt gggcaatgat caaagcgtcg    209880
     atgcggagag ggcgccgaaa cggtttgttg ccatctgtgc ttcgcttggt tttcacgggg    209940
     accatttgtt tcccgaatca accggccgcg actacgcgat cacaccttac ctggaacaag    210000
     tccaacgcca tcgcgatgac ttcagtttgt tctcgggttt gtctcacccc gaacaaaacg    210060
     gaaacaacgg tcacgcctcc gagttgactt ggttgaccgc ggcccgacgc ccaggactgg    210120
     caggtttccg aaactcgatc tcactcgacc aactcatcgc tcgagagatt ggactgaaga    210180
     ctcgcttccc gttcctggcc cttacgaccg gcggtcagtc cctttcgtgg acatccagtg    210240
     gagtcgagat acccgctcag cattcccccg ccaaactctt caccgcaatg ttcgtcgatg    210300
     gtaaaccgca cgaagtcgag gcggacctcg atcgactccg ccgcggccgc agtgttctcg    210360
     acacggttgg attgcgagct caatcactca aacgcgaact cggaattcgc gatcaacaaa    210420
     agctggatga atacctgcac tcgatccgag atttagaatc gcgactgcag caatccgaag    210480
     gctgggtccg tcgtcccaaa ccagtcgtcg acgaagaacc cgtatcggac atcaacgaca    210540
     aagctctcgc gattgaacgc caacggttga tgtaccgaat cattgcgtta gcgttgcaaa    210600
     ccgattcgac gcgaaccgtc acgtttcagt tggccgggct gaactcagtt cctcagatcc    210660
     ccggggttca aagcgattgg catggtctat cgcaccatgg caaagaccct gagaaaatcg    210720
     ctgaactgaa acgaatcgaa gcggcagaat ggggagcgtt tggcgaattc ctcgatcaat    210780
     tgaaatcgat cgaggagcac aatcgatcac tgttggatca caccgccgtg atgttcggat    210840
     ccaatcttgg caacgccagt gcacatgatt ggcgaaacct tccaatcttg ttggccggcg    210900
     gcggctaccg acacggcaag tacgtcgcac acgacgcggc gaacaacaca ccgctttgca    210960
     acctgtacgt cgacctcgcc caacgcatgg gactcgaaat cgacgccttc ggatcgagca    211020
     cctccgccgg catcaaaggg ctcgagtcca ccacgtagcg gaccacatca cgcaacgcct    211080
     gcagcacggt gggccccacc gtaaacacgc aaggtgcagt gcaggtctcg gtggaagacc    211140
     accgagctac agactgcaga tcaactcaag aacctcagcg tccgaggttc ttgttcatgt    211200
     tggtcttgta ctgctcaact cctggttgcc cgtaagggtt gatacccagc aagcgacctt    211260
     cgatcacggt tgcgatcatc agcatttgaa acaactggcc caacacgtgc gtgtcgatct    211320
     gcggcaagat gatatcagtc gtgggacgtc catccgcatg cagagcatcg ttggtgcctt    211380
     tgatcgccgc cgccatgata tcgggcagag ttttttcagc gatgtcgttg agcgtgtctt    211440
     ggttgcgttg cgagtgaccg acggccaatg aatcagtccg ttgcgattcc acgatcacgt    211500
     tgttgaacac tttgtcattt cgtccctgct gatgctgctg gtgacggctg tgcagatcgc    211560
     gagtgttcag ggttgtcagc ggcgttaccc ccttgccatc tttgccgttg gactcagcca    211620
     gcaattggtc gtaccacagt ccaaccgact cgagagcttt gctccaaaca ctcatcactc    211680
     gaatggactt gtcgcggtgt tgcgacagca agtgattcac ggcgacgtac tgcatcacca    211740
     cgttgtcagc gtagtccgcg gttttgaagt gctcgttcat tgccacggca ccttcgagca    211800
     acttcatgca gtccaaaccg aggaacgcgg cgggaaccaa gccgaccggt gacaggacac    211860
     tgaatcgccc accaacacca tcgggcacgg tgaagatctc atcgcaacca atttcggtcg    211920
     ccaagtcatg caacttgccg ctttcgccgg tcacgggaac gaccaaccgc gacaaccaat    211980
     cctcggcttc cgacccgagt tcggattcca agttggcaag gaattgacgg aacgcgacag    212040
     cggtttccat cgttccaccg ctcttgctaa tgacaatgat cgcgtgccgt ttttcagcgt    212100
     cgctgtccgc gtatccgccc gctcggacac gttgcaacag cgaatcggac gcgtcgttgt    212160
     cgacgttgtt gccctcgaaa tacatccgag gtttgctgcc acgtgcggca cgactcattt    212220
     cgttgtgata tggatcgcag caggcttcca tcatcgctcg agcgcccatg taggacccgc    212280
     cgattcccaa aaccacggct gcgtcaattt ggtcatgcag accattggcg actttgaaaa    212340
     tccgccccaa ctccgatgct tcccgctctt tcgcgtaggc ttccagcatc tcttcgggca    212400
     gccaaaagaa ccgagcgtcc agcggctgtt tgtcagcagg aatgtcgccc gattcgtatt    212460
     gtttctgatc ggtttcgacc atctcagtcc gaagggtttc catctggccc ttcaacgaat    212520
     cgatttgtgc ttgagtgatc ccgtagtcgt cgttgatcga tccggaagcg tcgaaacgga    212580
     gcaagctcat gatgggttcc gtgcagaaaa atggagaaga gtttcgaatg tttggattga    212640
     attgaatgac accgcggtgc ccacgagcga gatgatactg gatcgctcgc ctctgggcag    212700
     ggtgcgagag atttgcaccc cgccgcaaac cttcgtgacc tcagaaaaag aaaatgcttg    212760
     cgggcgacgc gcacggagaa gtaacatgaa gagcaggcgg atgaacaatc gcgattgcga    212820
     tgcgagtcgg ccgaaccttt tcttttggca attgcctttc attcattccg gcgagtcact    212880
     tcgagatgat tcactacaca tgtgatcgat gtcgacaagt aattgacccc acacaaagct    212940
     ctcgatacac gattgcgatc gaggtacaaa agttggaaga ggagtggaac gacgacgaag    213000
     ccgtggatca cctggacgct ttgcaccaag cgatcgaagc ggatgaggcg gaagacgaac    213060
     tggtcgaact gatcggccac gacgccgcgt cgccacgcaa cgagagcgaa ccagaatgct    213120
     ttgcggaacc aacgatcgaa ttgcacgacg cgcccatctc aacgggcgaa accgtttcgc    213180
     aatcgtttga tctttgcgaa tcctgttacc gtcgctatcg cagcaaccca ttgggtcgcg    213240
     agcgaaatct caagttgcat ttcagcaaca actgaagcgg tgctcagttc ccaaaaggat    213300
     cggaaccaaa tgggtagtcc tttggctgtt ccgcgggcgt tgtggtctcc gaaggcagca    213360
     ccgtcgacat tccctcggga attaaatcgg tgtcgatgac gaacgccttc agtcctgaca    213420
     acgaggacgg cagttcgcga tccatgccaa gttgatcgac caacttgcga cgctgtatcg    213480
     caaactcctg catccgctgc tcgcactggg ccaaccggtt ttcttgtttt agcaactcgg    213540
     tttggtaacg ctggatcact tcccgaggga acgagctgct gcctcgctgg cgagtcaact    213600
     gatttgaaat gcgttcgagt tccgtcacca agtgctttcg cagatccaac aaaccctcca    213660
     gcgtgcgatc cgtttcttcg agttcgcgtc gatccgccag gatgcttcga atcgtttcca    213720
     actgagcctc attccatttg gcttccgcga cccagcgttc cagtgtgccc atcgcgatct    213780
     cgccccaccc gttgggatcg tcggccgtgt gcttcgacac ggtcacaatt tcacgagagc    213840
     ctccatcggg tattttaact cgcaatcgat gccactcatc tgttttctcg acttcgatgt    213900
     ccttgtcttt caaagcctgc aactcgaaag gtcgtggtgg cagtgggact tccaagatca    213960
     cgttccggtc atcaccagag cgatttagaa cgtcgtattg agtcgatcgt tgatgctgcg    214020
     ttctgatcgt gattcgatgc aacttctcat cgatctcaat cgattgctgc tccgaagtcg    214080
     tttcgacagg atgggtcgtg acacgaacac ctccatccat cgcatacccg accaatcgct    214140
     tgaccgatgg agccaaatct ggaagcacga cctcgccgag aatcgatcgc atttgatcgc    214200
     ccgctaaaac actgccgggt cccgagggca acaatgcggg agtgttgttt tcaatttcca    214260
     agcacaacaa cgttgctgtc ggatgatagg actggcgata gacggaaacg tcggtgaccg    214320
     agacgggatc gatcagcgtg tccaacagag cggtcttccc gctatctaaa tcaacggaat    214380
     caaactgcaa ttccaaggtg ctgccggcgg gagcgtccgt ggtttcgttc agcacttggt    214440
     tcaatgaact gccgtaaccg gattcgcctg cgaacagatc cgcagacccc ttgccgcttg    214500
     cacgaccagg catcgcacca aacgatcctc ctcccatgcc gcctcccatt ccaccggctc    214560
     ccatgcccat gcccatcgac aagtccacat ccattcccat tatgcccatg gaaccatcca    214620
     tcccgatcgt ctcctcgcgg atccctggac ctgccaactc gaggtcgtca taagcccgcc    214680
     ccagcgattc actgaaccgt ggcgccatcg ccacctgtcg agatggacgc tgcaattgat    214740
     tcaacctggc tcgcaggacc gaacgcaaat ccatggtgaa cagaacaggg cttccgtcga    214800
     ccagactcag ttcgacgcca tcccaatcga tacccgacgt gttctcgacg atgctgcgat    214860
     gaatcaattg gtcgccttcg atccggtagc tgactttcca catcggcacc gaacgcatca    214920
     aaccgatcgt gacctctcgc tcgggtccat ccccgaacac gaactcgacc gcgtgcgtcg    214980
     ccaattcggc tggccgagct tctttttcca aagcttctct taaacgagat cgaaactcct    215040
     catccacggc gtcgatggac tcaaagccat ccacccacat cgagctcaat cccgtctcgg    215100
     tcaacactgt catgacctca cgctcgattc gttgttcgtc gacgatttcg gtgcgttgct    215160
     caatcgcgac caacgtgcct tcgaccttct tgcccgagtg ctccgtcgca acgatgcgtt    215220
     gccccttcat cgacaccaac aaatcgccaa gcgttcgtgt gttcggtgat gtcgtcggtg    215280
     gatggaccgg atcgcgagat gacaccatcc gaatttcacc cggtgccgca ggatccaaaa    215340
     ttcgagacac acgaatcgct tcgtccagtt cgaactcgcc tacctcgaca cgaaagactc    215400
     tcgcaccgtt gatcttgccg cgaaactcaa accagccttt tccggcggca tgaagcgtga    215460
     ctgagcgaag ccccaaatcg acttcaggag cagcctgctc cgctcgtttc tcgtccgcct    215520
     gattttcacc tgctcgcttg agcggtcgcc cgttcaactc ttgtgccggc aactccggta    215580
     acgatgagac gttgaacaga atcggaaacg cgaacagata caacaacgac ccccgcaggg    215640
     atcgtttcca tacaacggca ttcatgactg atttccagaa gagtcaaaga gaagctcagg    215700
     ctgcgtcgaa cacgtccaca cacacctgcc tcgattctaa accgagacag tgcagcagca    215760
     cgccgagaac acgacgaatc tgagccgact ttcttaggtc tttctggata aaaacatcag    215820
     catcagccgt tcgacttgga cgccgcttcg cgtttcagct cttgaaaacg agcccgcatt    215880
     tcggccaatt gctttgcttg agcgggatcg ttcacaagat cgttttcttc atgcggatct    215940
     tccgagatgt gaaacaactg ttcacggtcg aactcgggcc agtagaaata cttccagtcc    216000
     tttctcacca gagcttccga agtcggaatg aagttcttgt cgcgaatcgt ggggtgttcg    216060
     tagaagaact cctcacgcca atcgccttgc tcagcgtcgt tggcaccata caaaaccgac    216120
     atgtcgcggc cttgcatgga ttcaggaacc tccgccccaa ccgcgttcaa gatggtcggc    216180
     gccaaatcaa cactcagcgt gaagtcttca ttggtcgaac cgtgcttgtc tgcggacatt    216240
     cgtgggtcac gaatgatcaa cggcacgcga atgctttctt ggtggggata ccacttatcg    216300
     gccaacccgt gttcagcatg gtagtaacca ttgtcggtcg tgaagatcac caacgtgttg    216360
     tccagcacac cctgcttttc caactctttt agaatccgac cgcaagtcga atcgacttcc    216420
     gttgccaaac ggtagtagtt cttcatcatg atttgatatt tctccggcgt atcaaaccgc    216480
     cagtgataac ggttgcgacc ttcattgccg tcgttggcaa cgaactctgg caagcgatga    216540
     aaggactcgt ccgtcgcgtt tgccggaacg gggatctcaa cgtcttgata cagatgcatg    216600
     ctttccggtt gcggcaaaaa ctgctgcgga tttccgtcct cagcatgcgt cgcgaaaaaa    216660
     gcaaccgtca gacaaaacgg ttggtccttt ggacgcttgc ccaagaactc caacgcatcg    216720
     ttttcgtttc gctgcgtcac atgcaccttc gatccatcag gcatcttgaa ccagtgcctg    216780
     ccgtagtaag aacgcccgaa atcgaacttc tcaccgggga actttccgtt gtgccatttc    216840
     ccaacgtgcc cgacgtagta cccgttgtct cgcaggatgc ccggataggt ttgttgccac    216900
     ggtgtttcga acggtttgaa accatcgcaa ccgtgcgagg acatccactg cccggtgaac    216960
     aagcacgctc gactgacacc gcaaatggat gtcgtcacgc agttctccgt gaaccgcatc    217020
     ccttcgctcg caagtgcatc caacgttggt gtcttcacaa ccggattccc ggcgactccc    217080
     agcgtgtcat gacgccaatc atccgcatac aaaaccacca cgttcatcgg agcgtcggac    217140
     gcttttgctg attcgtccga atcggcactg accggggacg agaggctgcc aaccagcaac    217200
     gccgcaaaaa cgctcaggcc gcatgctgga gaaacgtgac ggaaccaaac ctttcggcac    217260
     caacttggaa tcatgatgtt ttgacaggag ggaggttttt cgaggggtga tggccacgga    217320
     cgtggtcggg cgagatagag taacagcttt tcacaataaa aatgcacttt tgcggcgaga    217380
     acctcgatgc gattcccact caacatgcga tcaacgttcg ccattttatt catcatactt    217440
     ctcggctccg ccgcttgcgt ttcgtcatcc tcggcggaaa ccaaaacgcc tcccaatgtg    217500
     ttgatcctgt acgccgacga cctggggtac ggcgacctga acctgcagaa tgccgaatcg    217560
     aaaatcccga caccgcactt ggatcaactc gctcgatcag gcatgcggtt cacggatggc    217620
     cactcatcat caggaatctg cacgcccagt cggtacgcat tgctgaccgg acgccatcac    217680
     tggcgggatt tccatggcat cgtcaacgcc tttggtgaat ccgtttttga acccgaacaa    217740
     ctgacgctgc ccgagatgtt ccaacaacac ggctatcaaa ccgccgcgat cggcaagtgg    217800
     cacctcggat gggactggga tgcaattaaa aagcccgacg ccaaaacctt cggagaagga    217860
     cgaaaaaaag gatacggacc agaagcgttt gattggacaa aatcgatccc ggacggacca    217920
     cttgctcacg gatttgattc gtactttggt gacaccgtga tcaacttccc tccttactgt    217980
     tggatcgaag acgacaaagt cgtgaaggct cccgacacga tcatggacac cgcgaaatgg    218040
     aaaccaatca aagaggggaa ttgggagtgt cgccccggcc cgatgacatc agattgggat    218100
     ccgtatcaaa acattcccac cacgaccgca cgtggcgtgc aattcatcga atcgcaaaaa    218160
     gaaagcgacc aaccgttctt tctttacttt gctttcccgg caccccacgc accgatcatt    218220
     cccaacgatg agtttgacgg tcgctcgggt gctggtccgt acggtgacta cgtttgcgaa    218280
     accgatgatg cctgcggcaa actgctgcga gcactgaagg aatcaggaca gagtgaaaac    218340
     accatcgtga tcttctctgc cgacaacggt cctgaacgtt atgcctatgc tcgcgacgaa    218400
     aagtacgacc actggtcgtc gcaacctttc cgtggattga aacgtgacct gtacgaaggt    218460
     ggacaccatg tgcccttcgt cattcattgg ccgggcgtga ccgactctgg atcgacttgc    218520
     gacgcattgg tatcacaagt cgacatcttc gcaacgctgg cggagatgct cgggcattcg    218580
     atcccggatg gacaagccaa ggattcacgc agcctgatgc cgctgctaaa agaacccaag    218640
     caacaacatc gtcagtcgct ggtccaaaac actcgcgtcg atgtatatgc gattcgcgat    218700
     ggcaagtggt tgttgatcga tgccaagagc ggctatgtca gcggccgcaa caaaggctgg    218760
     gaatcacgcc ggcaaatccc tgctgacgac aaactaccgc acgagctcta cgatttgtcc    218820
     gtcgacattg gtcaaagcga aaacgtcgct ggcgaacacc ctgaaatcgt cgagcgaatg    218880
     aaagcgttgc tgcaaaccat tcgcgaagac ggctatcccg aatagcattg ctctgcagca    218940
     attcggtgaa tgccgaacta ctcagcgagc tgtttcagtt tgtcctgagc ggctttggaa    219000
     tcgattgctt cggcggcgat ttcaacgcct tcggtgagcg atgaaactct acctaccaaa    219060
     cgaagcgccg cggcacatcc cgctaacacc gtgtcgcgat gcgatccggg gctgcctcca    219120
     aaaaggttgc gaatgatctc agccgattcc ggtggatcgg ccgcggcgag tgcgttctgg    219180
     tgaaccggag tcagcccaaa atcggccggc gtccaggtat ggttttgctg agtccccgat    219240
     gcgacctcga tgcatgacgt ttcgccatcc aacgagactt catcttgtcc atcctgagcg    219300
     tgcaagacat agcttcgctg cgtgtcgagt tccgccagtg ccgctgcgat cttttgctgc    219360
     gtttcggggg cagcggtccc gagcaattgg tgtgtcgcac cggccggatt gcaaagcggc    219420
     ccaagcaagt tgaacaacgt cggcacggcg agtttgcgac gaacggaaac aacatgacgc    219480
     atcgcgggat gcagcttggc cgcgaagcaa aagcaaatgc caatgtcgtt gagtcgtcga    219540
     gaaacttgat cgggttcgga ttcgattttg acgcccaaac attccagcac atcggccgat    219600
     ccagtcttgc tggtcgcacg tcgattgccg tgtttggcaa ccgcgactcc acatgccgat    219660
     gccaaaatcg caaccgcggt ggagatattg aaggttcccg atccgctgcc acccgtgccg    219720
     catgtgtcca gcagaacgtc atgttcgtga tcgatccgag tcatgtgctt tcgcatcgcc    219780
     cgcgccgcac cgaccaactc gctcaccgcc tcgccttttt cgcgaagtgc gagcaacaac    219840
     tggccgactt cttcttcgtt ggcagcacct tgcaacatcg cgtcgatcaa ggcgccggtt    219900
     tgctccgccg ataaatcgtt gccacctcga gcatgggtga tggcatccga gaaagagagc    219960
     gaagggtcag tcgaagaatc agtcatcagc ctggcaggac aagagcatca aagcgtgctt    220020
     tcgcaacgcg acgttgggtt gaacgcccca agtgtaactt gccgccacga ttcgaaggag    220080
     ccagcatgaa acgccttcat cccgcttcat tcactgagag acttgacccg ctgctcgatt    220140
     tcttctcgat ccatttgtcg ggactcagcc ggaaactcat acggcatcaa ataccaatct    220200
     tcggtgaagt cagctcgctc tcctggggac aagttttctg ctggcccgat gggttctaat    220260
     tccaccaagt ccttttccgg gtaccagacc gataccgtca gccccgccaa ttcgttgtac    220320
     gaccgttcag ggaatgtcgg aaaacgcttt acaaacaatt ggtccgtcgg tgccaaatac    220380
     gccagccacc ccgcatggct gtcaaaaccc aatttgggaa attccggcgt cgccgaaata    220440
     acaaccgtat cctcatcgac gtgaatattg ggctcggtcg gccgtgaacg aatcaatccg    220500
     ttctcgtagc ggacgtaccc gttcgggaaa cgcaccggtc ccgatcgagg gaccaaaacg    220560
     attcctccac cgaccgcaaa agttcggctc caatggcaca aactgaccgg gcgatcggat    220620
     tcgtttgcga tcgtttgggt gcatctgagg tgagaccccg tttcgtccag ctcaaaaatt    220680
     cgcgtcagtc gggctcccga ttttggatcg tactggctcg tcatcttcac cgtgcgatcg    220740
     gcaacgattt ccgctgtcca ccgaccgttc caaagcacat tgcctcgttg aacaaccatt    220800
     tcgggaccga tgtcgaatcg tccggccgat aactgaccac gtcgatccgt ttgacctttt    220860
     tcaaattgtt gcagcgtcca acctgcgtcg tcgggatcca ggtacagcac attcgtaccg    220920
     tcgaccgaat actccaacac tcggccaccc gcggcgggac aaagcgtcac caccgcatca    220980
     ccgttgctga ggcgaagaca atcgtcatag ccgtgaaacg acacgactga aacaccgtcc    221040
     gccgcggttg ctccggcggc aatggtcagc cccacgccga acaaggttgc aatgacaacg    221100
     gtggcaaacc ccgtttgcgt ccgttggagg ctggatgatg aagtggacac gtgggtctcg    221160
     attcgaaaac gctgattaga aacacaatcg agattcgatc agtggaagaa acttctccca    221220
     cgttgcctca tcgtatccaa tccaactcca ctccggtgcg attcgcgaca cgaccgcggc    221280
     gagggtctcg cccggccacc gtgaagaact tagactggat ggcatgagca gaaagatcat    221340
     catcgactgt gaccccggaa tcgacgacgc cattgcaatc acgatggcgt tgtttgatcc    221400
     acgactcgac gttgtcgcga tcactcccac cgccggaacc gttgacgcgg cccaagcgag    221460
     catcaatgcg atgggaatcg tcgatttgct cgatccggct cgatacccac aattgggaac    221520
     cgcggtcgcg ccaaccgatc cgccaatgct ggacgacagt catctgaacg gcccggatgg    221580
     attggcggga ttgaactttc cttcggcgac tcgccaaaac gatcattcca gcgacaagtt    221640
     gatggcggat ttgattcgac gccatcctga cgagatcacc atcgtttgct tgggaccgct    221700
     gaccaacttg gctcgcgttt gccgcatgga tcctgccgtg ttgccgttga ttgacaaagt    221760
     tgtcatcagt ggcggagcgg tctcgcacag cggcaatgcg acggcggttt ccgagatgaa    221820
     ctttttcttt gatccgtcca gtgccaaaca agtcatcgca tcggcaacga cgaagagctt    221880
     ggttccactc gatgtgaccg acgcggtcac cttcggcgtg gacctgcttg aaaagttgcc    221940
     tcctgaaaca acacgtgcgg gagccctgct gcacaagatc ctgccttaca aatttcggat    222000
     ctcgcatcaa aaactgggac gcgaagtcat tccattgcaa gacgcgaccg cgttgatctc    222060
     agtcattgaa cccgagatgt ttcagtggga tgaaatggcc ggcgacgttg aagtcaatgg    222120
     cgccctgacc cgcggcatga ccgttttcga ccggcgtcta cgaccggagt ggagcgtcaa    222180
     catggaagtg gctcgtcgag ccagcatcac cgatgttcga gatgccatcg tgcgtagcat    222240
     tcgttacgcc ggccaacaaa cccgctaggt caacacttcc aatggaatgg atgttgatgg    222300
     cgctggtatc cgccggattg ctcggggtct acgacctcgc caaaaaactg gccgctcgcg    222360
     aaaacgcggt gccgatggtc ttgtttgcct ccgcctgcgt tgcgacggca atttggggac    222420
     cgctattgat cgctcaacaa ttcaccggtg atgcctttcc gatcgagttt ttgaaggtcc    222480
     aaccgctgac ctggactgat catggcaaac tgttggcgaa aagcgtgctc gtcggagcgt    222540
     cttggacgct cgcgttgttt gcactgaaac acctgccgct gtccatcgcc gcaccaattc    222600
     gatccaccag tcccgtgtgg acgatcgtca ttgcaatcgg tgtgctgggc gaacggcccg    222660
     cgatgatgca atgggcaggc atcgcgatcg tcgtcgcttc gttctggttg ttttcaacac    222720
     tcggtaaatc cgagggaatc aaattcacga ccaatcgttg ggttggatgc atgctgatag    222780
     caacactgct gggatcgttc agttccatct acgataaata tctattgcaa ggcgctggtt    222840
     attcaccagc gaccgttcaa gcttggttca cgatttacat gttgccggtg atgaccccgc    222900
     ttgcactgca ctggtggttc aaccgacgac gaatagcgcc acgcggtgaa aacgtggatc    222960
     gagcgacatc agaggacttg tcaccaacgg agactgctag caagacgaca gcacgttcct    223020
     ccacgatcgg aacggcaagg ggaaccattc ctggttcgtc cacgtccaag tttgagttcc    223080
     gaacggcggt ttggtgcatc agccctctgc tgttagcagc agacatggtc tacttcaccg    223140
     ccatggcgaa cccagatgcc atggtttctg tcatttcgac gctgcggaga tgcagtgtcg    223200
     ttgtcgcgtt ggtattggga gcatctcggt tgggcgaagt gaaccttcaa cggaaggcat    223260
     tctgcgtggc tggaatttta ttgggtgctg ctatgatcct tctggggaaa tgaacccctt    223320
     caattgtcgc gatcggtaca ttcttccccc ctgttatttt ttagcgttcg acgaaaccac    223380
     aatcccaagt caagatagtg tccgacgctt agtgttaaag tgtccccgca gcccatgtgt    223440
     cagctgctgg tttacgtttg gtgacatgga agccgccgcg acggtatgaa tggtatgcct    223500
     gcaaccacac gctacgaacc tgttccgacg atcacttatc tcggagagga atccagccaa    223560
     tgcgatccaa aactggtttc gcgttacgat gagctgacgc gtcgacgcaa aatcaactgg    223620
     accggtcact acaacctacg ccgcatgttg ggccgtggtg gtcagggcga ggtttatctg    223680
     actgagcacc gaggcacgga cggattcacc gttcccgtgg cgatgaaaat cttctcgcct    223740
     gaacgcttcc ccgacgctcg ttcgtatgac gaagcgatgc aacgtatcgc gtcgattgcc    223800
     gctcgcattg cgttgatcca gcacgacaat ctgctggacg ttcaaaactt cttcgaacgc    223860
     gatcgcatcc gtgtgatgct gatggaatgg gtcgatggat acgatctccg gcaattggtc    223920
     atgcccaagt gcctggaatt gttgcgtgac cacatcacac ccaagcggtg gaaatacatc    223980
     aacgatgtga tcatcaccga aggcccggaa caatctcgtt tcaaacccgg cgtcgccgtc    224040
     gcgatcgttc gcgaatgctt ggctgcgttg gcggcacttc accgtgatgg aattgttcac    224100
     ggcgatgtca aacccgccaa cattatgctc aaacgcagtg ggcacgcaaa actgatcgac    224160
     atgggttcgt ccatcgatta tcgcaacccg cccaaagatc gcgaatgcac tccgctgtac    224220
     gcagccccag aagtcctcga caacctcgac gcaactccac gcagcgactt ggccagtgtc    224280
     ggatacgtgc tggttgagct gttgtccggt ttcaatccgt tcaacaacac gaagaatctt    224340
     ggcgagcttc tgcaggcaaa acgcgaactc ccgatgaatc tggaacggat tcttcccgag    224400
     gaagtgctgc gaaacgcttt gttgatgaat tttcttcgag gcctgattgc ccccgatcca    224460
     acgcttcgat tcgtcagcgc tgaggcggct gagcacgtcg aacagggtgc agcggcattc    224520
     catcgacagc tcatcattgg caatatgtcg acggaatacg acaatgacat tcgcttgtgg    224580
     ttggaagagc ttcgccggtt ggaaaacgac tgacggcttc cgacccatcg gaccgcctcc    224640
     aaccaacccc caagacaaac tccatggaca gtgcccactt gaggctggcc gtcgacgcgg    224700
     cgcgtgccgg tgccgctgaa ttgatgtcgc gacgcgatca ccgtgttgtg agtgagaaag    224760
     gccccaaaga tctggtgacc gatgccgact tggcatccca aaaagccatt cgcgacatgc    224820
     tggtcggggc ttacccagac tatgccttcg ttggtgaaga agagggcgaa aatgatccgc    224880
     ccgccagcgt gcgagccggt gaccctgatg ctccgccttg ctgggtggtc gaccctttgg    224940
     atggaacggt caatttcgtt caccgcctgc aaagctttgc ggtatcgatc ggcctgtacg    225000
     cggctggcaa gatgcggttg ggtgtgatct acgatccgac gcgagacgaa atgttcaccg    225060
     cgattgatgg acaaggcgcc cactgcaacg accaaaagat gtccgccagt ggttgcaccg    225120
     cgatcgagga aagcttggtc gcgtgcagtt ttcgagcggg tgtcaccgct gactcgcccg    225180
     aagtgacgcg ttttgtaaag gtactcgaga agtgccgctc gttgcgacgt ttgggttcgt    225240
     gcgcgctgaa catgtgctac gtcgccgatg gtcgactgga tggatactgg gcgaccaatg    225300
     tcgccgcctg ggattctgcc gccggcaccg tgatcgctcg tgaatccggt gcgattctag    225360
     aaggctacgg tggcgaggaa ttcgatgact ggaaccccaa gttttgcgtt tcggcaacgc    225420
     ccgaactgca atcgcttttg acaaagcaac tgagaggcac atgatcatcg atcccaacga    225480
     cgtatcgatt ggcgcggtct atgaatccat ggtcgcgttg atcacgccgc ggccaatcgc    225540
     atgggtttca acgctgtccg ccgacggaat cgcgaatttg gcaccgtaca gtttcttcgg    225600
     cggcgttggg gcgaatcctc ccacggtgat gttttgtccg gtcaaccgtt tggacggaac    225660
     tcctaaggac acactcgcca atgttcgcgc aaacggccaa ttcgtggtca acgtggtcac    225720
     cgaagagttc gccgaaacga tgaagcaatc cgcagcagac gttcgccccg acgaggatga    225780
     attcgttctg actggtttgc agaaagctcc ttcggtcaaa gtcgaagtgc cgcgagttgc    225840
     tgatgtcgtt gcagcgatgg aatgcgagat gttgacgtcg atgcaattgg gaccgggacg    225900
     cggcggagcc aacttggtcg ttggacgcat tgtttcgttt tacgttgccg attccgtcgt    225960
     cggaaagaac gggctgcctg atcccgaaca gatcttcaca attggtcgaa tgggtggtcc    226020
     gaggtacaca cgcacacgag atcgtttcga ataacgattc attgcaatca ggaatgtcct    226080
     ggcaaatagt cctggttcat cggggttgct agcgaagtca attgataaag cgcacaaagc    226140
     aacccagtga tcaaatcaat cgactcccac ccaagtctat tggtttggag catcgtcgca    226200
     ttgatagtaa gatagttcat cccgcctacc caacctccct ccttcttggg ttcctagatg    226260
     atctggaacg tcttcgcatc ccgtcgcacg attggatggt ttgctgcttt gttgctttca    226320
     tgcattgctt tttcgggcac tgcatcagcg gaagaaacag cttcgaaagc cgagatcgat    226380
     tttgcacgcg acattcgccc gatcctttcg gatcattgct tcgcatgtca cggtcccgac    226440
     gaacacgatc gccaagccgg cgtgcgtttg gactctgccg aaggaatagc agatgtcatc    226500
     gatcaagaag aatggcaggc aagtctattg atcgagcgaa tcgcgaccga cgattccgat    226560
     atgatcatgc cgccggaaga cttccacaaa ccactgtcac ccaagcaaat tgagttgctc    226620
     aatcagtggg tctccgaagg tgcggtttac gcgtcgcact gggccttcgc gacgcctcgc    226680
     cgccacgaac ttccttcgga ggagggtgtc gtttcgtccg acgttgatcg catcgatcaa    226740
     tggattgatg ttcaactaaa atcgttgggc ttgtccgccg cagactccgc tgaccgacga    226800
     tcacttgctc gccgcgtttc gttcgacctc actggactgc cgcccaaact agaacgagtc    226860
     gaagcgttcg ttgctgactc atcgccgaac gcctacgaaa actatgtcga cgaattgctg    226920
     gcgtcgccgg actacggcga acacatggcg aggtattggc tggacttggt tcgctatggc    226980
     gacacacacg gattgcactt ggacaactac cgtgaaatgt ggccctaccg cgactgggtc    227040
     atcgacgctt tcaatcaaaa catgtccttc gatcaattca tcactcggca attggccggt    227100
     gatttgttgc ccgaaacgaa cgaggccgaa acgcttcgca atcaaattgc cagcggattc    227160
     aaccgactga acgtgacgac caacgaaggc ggctcgatct acgatgaagt cttcgctcgc    227220
     aatgtcatcg atcgcacgga ttcgtttggg acaatctttc ttggcttgac cacgggatgc    227280
     tccgtttgcc acgaccacaa atttgatccc atcacgcaga aggactactt cgccctgtcc    227340
     gcgtttttca attcgttgga cgggcgagcg atggatggta acaacaaagc tcatccgcca    227400
     gtcgtgcgtg ttccttctgc cgagcaatca gccgaactga agcaaattgc ttccgacctc    227460
     gctgaactaa aggccgaaat ggccggaccg ctactggaag tcgacgccgc ccaactgcaa    227520
     tggcaacaaa cgctggctgc gagtgaagag tcctttcacg cgaacctgat gccggtcgaa    227580
     gtcaccacaa aaaacgatgg aaagttcaaa cagaacgaag acggatcggt ggagtgggac    227640
     ggcacgcctc ctgcaaaaga cgtgatgcac atcatctcgt cgctgcccgc cggtacttgg    227700
     cggatgctgc aactgcacgc caaaacagac gaggaacatc cgcgagtcgg aacggcatcc    227760
     aaccagaacg ccgtgctcag cgaaattaaa attgagacgc gacccgacga ccaatcggaa    227820
     tggaccgaag tgccaatccg ttccgccaaa gcaacccgcg aacaatccgg cgacgaattc    227880
     gcggtgacca aggcgatcga tggaaagatt gacgcgaaaa ccggatgggc cgtcggtggt    227940
     cacgaagcaa ccggcgaccg aacggcgtgg ttcggagtcc aaaccatcga agctgaaatg    228000
     ggtcagattc gagtgtcgtt gcactatgag tcgcagcacg tttctcacat gcttcgccat    228060
     gtggctttgt ctttgcattc ctcgatggat cagttgcccg aggaccaacg tatcgtgctg    228120
     ggcgactcac acctaatcgg gccgctgaaa gtcgaaaatg tcggcaatgg cttgaacaag    228180
     tcattcgcgg gcgaagacaa gaacgagttc gatcccgcca aaaaggtttc ctatcaagac    228240
     caagaccatg aatggcagca tcgaaccgac atcgtttcgg tattgagcaa cgaactgccg    228300
     acaatcaacg attccaccag cgtttccatt ctgcatcaag tcatccgatc gccatcggat    228360
     caatccgtcg aattgatgtt cggaaccgac gaaggcagcg tcctgtttct caacggcaag    228420
     gaagtggcca aacagaaacc aggcaatcgc aaagacgatg acattcaacc gttgtcgcaa    228480
     cgccacaagc tgtcgcttaa aaaaggcgac aaccacctgt tcgttcgaca cgtcaatcga    228540
     agcggacctg cgacgctgac ctatgccatt cattcgccta ccgtccaatt ttcggaaccg    228600
     ttgaagcaac gcttggcaac cttgtcagca ccggaagaat caagcgattc cccaaccgtg    228660
     gattggcgag ccgctcgagc gttttataga gagctcattt gcgagcatcc gagttggatt    228720
     gcattgaacg acatgcacga cggcatgatc gcgatgcgag ttaagatcaa caaacaagtt    228780
     cccacgacat tggtctggaa agaaaccgcc aaacctcgcg acgcgcacat tctagaacgc    228840
     gggctctacg attcgcccgg cgagaaagtc gaacgtgcgg ttccgggctt ccttcccgaa    228900
     ttccctgaag gtgctcccgt cgatcgcctg ggacttgccc agtggttgct tcgagaagat    228960
     cacccgctga ccgctcgcgt tgccgtcaat cgtttttggc aacaactctt tggcaacgga    229020
     ttggtcaaaa gcagcgaaga cttcggcagc caaggtcacc tgccatccca tcccgagttg    229080
     ctcgacgaac tcgcaatcga ttttcgcgag agtggctgga acgtgaaaga gatgatgaag    229140
     cggctggtca tgacggaaac ctatcgccgt gacgccacgg caaccagcaa catgctcacc    229200
     gttgatccga acaaccgata cttcgctcgc gggcctcgct ttcgattgga cgccgagacg    229260
     cttcgcgacc aaatgctttc gctgtctggt ttgctggtca cgactcgagg cggcccgagc    229320
     gtcaaaccgc ctcagccggc cggtttgtgg gaagcggtgg gctataccga tagtgacacc    229380
     gccaatttcg tccctgacga aggtgacaaa accgttcgcc gcagcgtcta cacgttttgg    229440
     aaacgcacca gcgctcctgc tgtgatgtcg acgtttgatg ctcccagtcg tgagtcatgc    229500
     accgctcgcc gcgaacgaac caacacgccg atgcaagcct tgttgttgct caatgaaacg    229560
     caagcgatgc tggccgcaaa agccatggcc caagagatca ccgcatcacc gactccggac    229620
     caatccgact gggaagcgat ctctcgaaaa cgaattcaat cagcgttcga acgcgtgacc    229680
     ttgcgtccga tcgaaacgaa cgaactccga tcgctcgaac ttttgatggc agatttgatc    229740
     gagcactatt cggtccagct tgaagaagcc cgtaagttgg ccgggactcc cgaccctgaa    229800
     ttggccgcat ggaccgtcgt gatgaacacc cttttgaact tggacgaggt ggtttgcaaa    229860
     tgagtcgctc tgaattcccc tgtgaagact ggaacgcact gacacaatca cctttgatgt    229920
     catcggttct gcaagaacgc atgcaacatc tcactcgtcg ctcgctattt tccagcgccg    229980
     cggcgggttt gggtgccgcc gcactcgctt cgatgcccgg gatcggacgt gccgtcgata    230040
     gccaacccgg tgttcctgga caacctggtt tgccgcacca tgaaccggcc gcgaaacgag    230100
     cgatctattt gttcatgtcg ggtgctccca gccaaatgga catgtgggat cacaaaccac    230160
     agatggccga ttggtttgac aaggatttgc ccgagtcgat ccggcaaggc caacggttaa    230220
     ccacgatgac cagcggtcaa tctcgattcc ccatcgcgcc gagcatttac aagttcagcc    230280
     cgcatggcgc caatggaacc atggccagcg aactgattcc gcacatggcc aagaaagtcg    230340
     acgagattgc tttggtcaaa tcgatgtaca ccgaagcgat caaccacgat cccgcgatca    230400
     cctacatctg caccggcaat caacttcccg gcaaagcttc tttgggttca tggctgagct    230460
     atggactggg aaccgaaaac gaagaccttc ccgcgttcct ggtgatgacc gcatcgtgga    230520
     ccggacgcaa acaagcgcag gcactctaca accgtttgtg gggaagcgga tatttgccca    230580
     gcaagtttca aggcgtcgct ttgcgaagcg ccggcgatcc ggttttgtat ctttccaacc    230640
     ctgatggaat tgattccggt gtgcgtcgcc gcatgctcga caccctagcc gaactgaatc    230700
     gcaacacgct cgaccgttgg cacgatcccg aaaccgaagc ccggatcgct cagtatgaga    230760
     tggcttttaa gatgcaaacc agcgtgccgg aactcactga cctcagtgat gaaccgcaac    230820
     acgtgcttga cctgtatggg cctgatgtca ccaacccggg aacgttcgcg aactgttgtt    230880
     tgatggcacg gcggatggcc gagcgtggcg ttcgcttcac gcaaattttc caccgcggtt    230940
     gggaccaaca tggtgcgttg cccaaagatc ttccgaacca gtgccgggac accgaccaac    231000
     catcggccgg cttgctcact gatttgaaac agcgtgggct actcgatgac acgttggtgg    231060
     tttggggtgg agagttcggt cgaacgatct actgccaggg cgcgctcagc aaaaccaatt    231120
     acggtcgcga tcaccatccc aagtgtttct cgatctggat ggcgggtgcc ggaatcaagc    231180
     aaggcgtcgt gcacggcgaa acggatgagt tcagctacaa catcgtccgt gacggagtcc    231240
     acattcgcga tctcaacgcg acgattctca atcagatggg aatcgatcac gaacgattca    231300
     cctacccgtt ccaagggctt gatcaacgtc tgaccggtgt ggaagaggct cgcgtcgttc    231360
     gcgagttgct cgcctaaagc aaaaagaatg agcccgggcc gccaaaggga tcggctgcct    231420
     ggtgctggtc aggcggaagt ttggtcgtcg cgttccaagc gaggtccagc cgatccgatc    231480
     aaattcggaa tcgatcaccg cgtaggcaaa ggaaaccgct caagaccgaa gcgatggaca    231540
     gcaacatcca ctggaacttt gtcaggtgca ggaagtaaag tttcaactcc caccaacaat    231600
     cccagaagta ttcaacgatt gaaaaggcga gcaggaaagc gtccatattg gaactctcga    231660
     ttgcgggtgt ttcacggggt acgtgcaatc aaccgtagtt cgattggttc gcggcgtcgc    231720
     actgttctcc ttggtgcgaa gtagaaacac gcagatgcga gtttcccgca aggtttgacc    231780
     gctaaaatca gtgcaaacag acgtggtttg cggggcgaca aacaaaattt tgggtgaccc    231840
     ctcagaccgg ccttgcaagc aatccgagca tagatatact ccaccccatc gcagcggaga    231900
     tgagactttc ttcatcttct tgcgagcctt tgaagaagat caaaagttgt tttcaaacgc    231960
     tttggttggc ctcttcaagg cgcggtagct caattggtta gagccccgga ctgtcgatcc    232020
     ggaggttgcg ggttcgagtc ccgtccgcgt cgcttcttaa aactctcgtg attcgttgac    232080
     tcaaacgaat acctgccgcc tctggcagag cacgcttttg caagtcctct tgtgggtaca    232140
     tacccgcaag gcattcaaag gtgaggctca tgccacattc ttccggctcg gtgcccaagt    232200
     accgaaagca caaaagcggg caagctcgcg tgacaatcaa cggacgagat tactatctcg    232260
     gtccatggaa aagcaaagca tcgattgctg agtacgatcg cgttatcgcg gagtaccttg    232320
     caagcaaccg aagcccgaac ttcggtctct cctgcgagga gctctccatc gcaatgatct    232380
     tggtggacta cctgcggcat tcgcgcagct actacggctc ggagaaaacc tccgaactcc    232440
     atcggatcaa acctgctctg aagccactga aggaactcta cgccaattca cccgctacct    232500
     cgtttggccc cgagcagttc aaagcagtcc gccaatcgat gatcgcaagc ggcctcacgc    232560
     ggcctggtat caacagccgg atgaaacgaa ttgtccgcat gttcaagtgg gccgctgccg    232620
     aaggaaaact gccgccgtca attcatgagg ctttgcgact gattgcacca ttgaagaaag    232680
     ggcgaactga ggcgccggaa acggatccga tcctgccaat tgagcaatcg attgttgacg    232740
     ccaccctcaa agaacttccg ccaatcctcg cggacatggc acgagttcaa ttactcactg    232800
     gttgccgtcc cggcgaagtc tgccaactga caccgggctg cctcgatcgg tcgggtgatg    232860
     tgtggatcgc gaacgttgcc gaacacaaaa cggactggca cggccacgat cgcacgctct    232920
     tcattggccc gaaagctcag ccgatccttc ttcgctacct cgatcgcgaa cccgacgttt    232980
     atctgttccg cccaatcgag gttgtggagc agttgcgtgc cgagcgtgct gcgaagcgag    233040
     ctacgccacc ttcatgcggg aaccgccgag gccgcaagaa cgatcgcggt gggttgaagg    233100
     gcaagaaagc agtgaagtcg ccgggcgaat gctacacgac agaaagctat cgccgagcaa    233160
     ttcacaatgc gtgcgacaaa gcattcccac ctcctgccga tctctccgaa gaagaagcaa    233220
     agaagtggaa atccgaacac cgctggagcc cgaaccgcct tcgtcacaca cgcggcaccg    233280
     acatccgcaa gcagttcgga ctggaggccg cccaagtcat gctcggccac aagaacgcag    233340
     atgtaacgca agtctacgcc gaacgtgaca tcgccaaagg tatcgaagtc gcccgccaga    233400
     ttggctagca ctgctagatg gaaaatccat gcagcttgta tcgctgcaac tatgctttgc    233460
     gatacaggct gcttcaacaa attgcccttg tccgcaagtg acgcggctta cctggcgaca    233520
     tagtggcttc attagcgaac gaaggcggca aggcacatcc tggcctctaa tttactgctt    233580
     ccaccaacca gtcactgaac agaagatggc gggaaccaga gagcccttaa aaattattgc    233640
     cccgtgcccg cgtccttcca ccacagagac aaacaggtgg tgcagcgttc tcgcagctag    233700
     cgaaacgcac caagacgctc atgcgtcgag cgattgaacg cctgccttca tcagcgtcgc    233760
     tgttgcatca acaaacccaa aacttcattc aacacccaag cgttttcaat gcatctagat    233820
     aaggacgacc gcgagtcact ggaacgcttc atctggagag acctcgttgc tgaattcttg    233880
     gagcaagaag caactcgcca gggcctgcag gagtacattc cagttcgact ccgctgcgct    233940
     cagtctttga agccgatcga gcatctagtc atgctagcta gcttaaagtc ccagaccgaa    234000
     ggtcaggtga gcacaggatc ccttgacatg acgaagccgt tcgaattttc aagccaggac    234060
     cctgtcatct ggtactcatc agagtttgcg gcagcgtacc gcaaactgga aaacgcattg    234120
     aacaaagata ttcagacagc acggaaggcc ggtctcaaac caagagagct cgcgaaaacc    234180
     gaacgagagc ttcgaagaca gttccacaac gactacgaaa tgatagcgaa gaagatctgc    234240
     cagagagcga ctctacctgc tgtcagcaaa gatgctcaag atgtctggtt cgaatggatg    234300
     gatgcgttca ctggcccggc aaccgcactg caccatgaat cgggaggcga gctcctgacg    234360
     caagaggttg actttgtact cagtgagtcc gactcaacca actcgcaatc gggacttgga    234420
     atagctgaca tcctgaaccc tgatgaagac gcaaaaaaac gacgcgaagg acggcgactg    234480
     gctcgcgaat ggaaagcagc gaagcgaatt cccgtagaga gttttgcgac taaataccat    234540
     ctcgccttga aactggcaaa tgccttgctt cctcgaagaa acaaaagggc cgaacggagc    234600
     gagctagctg gagcaatcta cggagacccc aaccacgata cgagcggtac acagatcccg    234660
     tcattgcgga cgaagggcaa ccagttcttt gacatgatgc acattccctg ggcaatcggc    234720
     acggagggag aggacgtttt cctggactgc gactgatttt tttcagattt tgcagccgag    234780
     cttgcccaag ctcgccgtga gctcgcttcc agcttgcgac gtttgctctg ttccgagtgt    234840
     tacttcacta ctcaagtgat ttctcactac ctactcggaa ttgcgacaaa tgcaaaaaac    234900
     caagttcgct tcattgctcc gtgcaataga aaagggagac gagcctgttt catcgctcga    234960
     tgcagacgaa gaagaaaaca agtcccgtcc attactcagt gcaattgaac tagaaaacgg    235020
     actccgcccg cacccgagca cagcaacacg ttggtgctta gaacccaatc gccatggaaa    235080
     cgtgctcaag tcgtggctaa tcggcgggcg ccgaatgacg tccattgccg ccgtcaaaga    235140
     gtacaacgct gcaaacaacc agcagtccat ggcgtcagat tctactgccg cagcatcttc    235200
     gattgctaac tccaagacgc actcgaaagc catgcaagac ctcgaaagcg agggcctgtg    235260
     atgtcaaatc aaactgaaaa aaatggagct gcgcacgaac ccagcaaggc caaggcaaac    235320
     ggtagccaag gtaaaaaaag tgacaccgac gaaatcgtgc aactagggat gcagggcgtt    235380
     gaactgtggc acgacaagag cagtgggcga actttcgcca ctattcaaat tgactcccac    235440
     gctgagaact actgcctcga cagtcaatcg tttcaacgct acctggaaag ccgcttctac    235500
     tttgagcatc aaaaagccgc tccggccaac agcgtcacga acgcgattgc cacgctcaaa    235560
     gcaaaagctc tgttcgaagg aaaagagcat acccctcgcc tgcgagtcgc tggcgatgat    235620
     cactcgattc acatcgacca gggcgatgac atctggcaat caatttccgt tgatgcgaac    235680
     ggctatgcca tcacctccca aacgccggtt aaattcgtcc gtcgatcggg aatgatgccc    235740
     ctccctgtgc cccgcggatg tgacattcaa ctgttgcgta aatacatcaa tgttccgaac    235800
     gaggtttggc cgctaatcct ggcgtggctg ctcgcctgca tgcgtcccaa gggcccctac    235860
     ccagtcctaa ttcttactgg cgaacagggg tctgcgaagt cgacgacggc aaaaatgctt    235920
     cgtgctcttg ttgacccgaa caaatctccg atccgggctg ccccgaaggg tttgcaagat    235980
     ctcgccattg ctgcaaacaa cgcacacgtt cttgcattcg ataacctcag ccacatttcc    236040
     ccttggtgtt cagatgggct ctgtcggatc tcgacgggag gtggctttgc gacgagaacg    236100
     ctctatgcca acgacgaaga gaccatcttc gaagctcaac gtcctatcat cctgactgga    236160
     attgaagacg tcgcttcccg tgcggacctc gctgatcgtg ctatcgtcgt gacactgcca    236220
     acgatttcca gtgacgagcg tcgaagtgag aaagaaatct gggagaactt caatcgagat    236280
     gctcccgcca tttttggcgg cctactcgat ttggtctccg ctgcgattcg cggactgccc    236340
     aacgtcaaac tgaccagtcg cccgcgaatg gcagactttg ctgagtttgc agttgcggca    236400
     gagcagcaaa tgggactgca gaaaggcgaa tggatgaagc tttacttggc gaacatcgac    236460
     agtgttaacc aaggactggt cgacgacagc ttgatcatcc aaaccctcct gccagagctt    236520
     agtactgacg ttttggttaa aacgccaacc gagtggctgg aaaccctgaa cgattccgcg    236580
     tcggacgaag tgaagcgtca aaagaaatgg ccaaagtccg ctcgccagct tagcggagaa    236640
     ctgcgacgct tggcaccggt gatgcgccgt gccggcatcg aaattgactt cgagaccttt    236700
     tcaacacagg gccgaaccaa gatttcaatg cacctggaag aagagcccga atcgcaggag    236760
     ccgcggggtc gcgacgtcga cggggtcgat gacctaggat tctgatggta ccaaccgtag    236820
     ggaactagca ggtagccgac tgcgtcgtga acctattgca gtttccacac gatgttcaaa    236880
     tccaaaacgc ccacagcgga gcaatcccct gcgggcgttt ttcgttttta gacctcaaca    236940
     acgaatccgt tgttggtcag tttcgcggcg aggttgcagc acgaacaatt gatgaactgc    237000
     gtctcacccc gagtaaactt gccgtagttg ctgatgcctt tttcgtcgtg caggtgtccg    237060
     aaggcgtgaa tcttgggttg gattcgttct tcgacgtgtc gacgcaaggc agcacaaccg    237120
     acttgaacga gtgctttcga ttcgatgtcg tgcgttagat ccaagacgcc tttcggcgga    237180
     ccatgagtga tcagaatgtc cacattgtcg ggaactgatt gccaaacgag atcaagctgc    237240
     ccacgcttct tcatgtatgc ccaatcgtga aatcgaggcg tgtagggcga gccaaacagt    237300
     ttgagcccgt tcaactccat ggaatcatgg atcagaaaac gaatgccggg atagtcatca    237360
     gggcggatga gcccctattc catcgcggta gagtgattgc ctggcacgaa caccttggtc    237420
     gcaacgtcca actccgaata ccactcaaag aatggcctcg cttccggttc attcatccaa    237480
     gcattcccat gcgtcgactc gtcgccgcaa tggatcacta aatcgacatt gggaacggtt    237540
     agctcccgat gtcgattgtg agtgtcagaa atgaaccaaa tcttcattcg ctagtcgcca    237600
     cctttggcga ggaatcggtt tgagatcgtt ttgaacgaga tacgatcgtc gccactaccg    237660
     taaacccaga ccagcccctg gcgttcggtt ttgggattga gcacgctctt tccttcggcg    237720
     gacgcaagca tctcgtcgat actctcaagt acagggaagt tgccaccttt cgcagtcgaa    237780
     agccttcacg ctcgtccatc gtcttcagcg acgacttgcg cagaaactcg gactcctccc    237840
     gcactggcaa gaacgagtcg atctcgcaat agatcaccgc gtcgccggca gcgtactcat    237900
     cctccttggt cacacacttc cagccatcaa caacagtcaa ttcaatcatg tccgcgccat    237960
     caatcggccg agtctcaagc accgatcgca tcgccagcag gttcgccaac cacgatcccc    238020
     tagtccgctg gcttgccctg caagtcgacg cacgagcgat tgatcaactg aatgccgtcg    238080
     cgggtttctt cgctgtcgtt tctggtcgac gtgccctgct atttcccctc gataggtttc    238140
     gatagactct gacaaggttt gtgcagttgt cttcccagtc gggtgattgc gagtggaaaa    238200
     gttgagcgat tacgtcaagg tggccgaggc tgctgagatt ctgggggttg cgcaggcgac    238260
     tttaagaatt tgggcggaag acggcaaaat cccgatgcac cgaaacccgg ccaacggcta    238320
     ccgcctcttt cgacgggctg acctcgaacg gttcttggag gaagtcgcaa agccgctcaa    238380
     acctagatag cacgcaattc cctagcaatt tgattagtcc gccgtagggc accctggaga    238440
     cgacacctca atgaagactg tccgcgacgc ctgcgagttg cagcctaacg ccctgaaaat    238500
     tcaacttagc gatcaggtcg agcagctcga tgaactgatc cagaccgaag gtgacggcac    238560
     cgcattcttc tccaagacat tcatcaccga cggaatgcgg gatctgattg acgtcggcat    238620
     gtctcggctg gcaggccagt ccggtgaagc gatcttccac ctcaagcaag cgatgggcgg    238680
     cggtaaaacg cacctcttag tcggctttgg attgttggcg accaacccgg cacttcgcaa    238740
     gacccactgc aatgggtcat cggccgccga cgctttcgcc tgcgccaacg tcgccgcgtt    238800
     caacggacgc aacaaccccg accatttctt ttggggtgaa atcgcacaac aactcggtaa    238860
     agccgagact ttcaacaagt attgggccaa cggccccaag gctcccgatg agaaggcatg    238920
     gctagagctc ctcgacggtg acgatccagt cttgatcttg ctcgacgaga tgccgcccta    238980
     tttccagtac tacgacacgc aaagcgttgg caatggtacc gtcgccgata tcgtcacccg    239040
     cgcattcgcc aacctactga ccgcggccgg aaaaaagaaa aatgtttgca tcgtcgtttc    239100
     cgatctcgat gccgcctacg acaccggtgg caatctgatt caaaaagcgt tgaccgatgc    239160
     acgcaacgag ttgggccgac aagaacgcag catcacgccg gtcgacctat cgaacaacga    239220
     aatctacgaa atcctccgca aacgactgtt ttcgtcgctg cccgatagtg ccgaggtcga    239280
     caacattgct gacgcgttcg gacggaaact cgaagaggcc gcaaagagca aaagcgtcaa    239340
     tcgtggtgcc gaagcgatgg ccgacgaaat ctccgcgacc tatcccttcc atccgcaact    239400
     caagaatgtc atcgcactgt tcaaggagaa cgagaacttc cgacaaacac gcggtctgat    239460
     tgaactcgtc tcgcgtctct tgcgatcagt gtgggaccgg gacgccaacg acgtgttctt    239520
     gatcggccct cagcacttcg atttgtcgat caaagaagtc cgcgaaaaat tgaccgagat    239580
     ttccggcttc cgcgacgtca tcgccaaaga cctgtgggac aaacaaaagt ccgcgcacgc    239640
     tcaagtcatt gacctgcaaa gcggccaaga atccgcgtca caagtcggat cgttgctgct    239700
     gaccgccagc ctttccacgg cagtcaactc ggtcaaagga ctgaccctcg aagaaatggt    239760
     cgagtgcctc gtgtcgccat tgggcgagcc ggccgaattc cgcaccgcgt ttgaggaact    239820
     cgaaaaggtc gcttggtatt tgcaccatac cggtgaaggt cgctactact tcgaccgtca    239880
     ggagaacctg accaagctgt tgcaaagcct ggccgagaaa gcaccgcaaa atcaaatcga    239940
     cgcgctgatc gacaaacggc tcaaggagat gttcaagccg acccgaaaga ccgtctacga    240000
     agaggttttt ccgctaccga agctcgaaga cgttgccgat cgtgttcgca aaggacgtgt    240060
     gctgttaatt gtcagtcccg actcgaaaat tccgcccgaa gatgtccaga aattttttga    240120
     cggactaacg cggaagaata acctttgcat tctgactggc gacaagtccg cgatgggcag    240180
     catcgacaaa gccgcccgtc agttttacgc agccggcgtt gccgacacac gtattcccga    240240
     aggccatcca cagcgaaaag accttgagga caaacaacag tcatatgagc aggatttcaa    240300
     cagcacgatc ttgaacctgt tcgacaaagt cctgttcccg atccagcgca gcggtcaacc    240360
     acccaagctc gttcacaagg cactcgaaac agctcgcgat accagccagc ctttcgacgg    240420
     cgaagagcag atcgaaaaga cgctcacgtc gaatcccatc aaattgtttc tcgacatcga    240480
     agctgatttc gacgcgatcc gcgacaaggc tcaagacttg ttgtggaacg agggacaaga    240540
     cgaagctcgt tgggcagacg ttgtggaacg atcagcagag aagtccggca tgtgctggct    240600
     cgtgccgagg ggactcgaaa gcctgaagtc actcgcctgc aatcgtggac tctgggaaga    240660
     cctgggcaat ggctacatca ccaaatcccc aaaaaagaaa caaacgtccg cgcaagtgac    240720
     gcccgagagc gagcccaacg acgaaggcat ggtgcgcttg cggatttcag cactcaacgc    240780
     cggagccgcc gcccggattc actatgccga agatggtccg gtcagtgaaa agagtcccgt    240840
     gctgcaggac acctacttcg acaccaaggc gatgaaggtg aatcttctgg tcgccgatcc    240900
     atcggggatg tacgagaccg gtgatcctgt catttggcca aacaagctgg tgttgcgaac    240960
     cgaagagatc gggaccggcg atggccgcaa ggttgcctta tacgttgcgc cgcgggggac    241020
     gattcgctac acaaccaacg gcagcgaacc ccgtgatggc acgccctaca cggaaccctt    241080
     tgacatcgag gacggcgatg tactggtgcg cgcgtttgcg gaagttgacg actatccaga    241140
     catttttgcc aagagagatt tcccgttccc tgccgtcggg aaaacgggcg ttcagattga    241200
     tgatgtcaaa ccaggcatca tgatctcccg caccggtcgc aagcttgact cacgaggcaa    241260
     ggtgttcgac ggcttgagcc acgcggccga aaagaaagtc acctttgaag gtgttcaact    241320
     gacgattggt caaggcagcc aagtcatcgc agtcacgatc ggcgaagtat ccaccgaagc    241380
     cgacttcatc gaaaagctac taactcaagt actgaccaaa ttcccagacg acacaccggt    241440
     aaccatgtcg ttccgcaaag gacggttttc atccggccat gacttaaaag actttgcagc    241500
     caagttaggt attgaactta aaaccgaaga catcgagcaa ggatgagcaa aaaagccaag    241560
     accgttgatt ttggagcccc cgacacgttc ggggcacact tgtttcgtgt cgagattccg    241620
     tcttcacgca gcgagtcgat tttgattgtc gaggattatg gctacggtgg catggagaac    241680
     ggatcaccgc aagacgaaga gcgggtgatt ttgaaacgag cggcctggtc cgcgatctcg    241740
     gctgcggcgc gtaccgagtt caacacccgg ctcaaaaccg ccaaggtcac cacgggccgt    241800
     tggcattcgg gcacgaacct agtagatcgc ttgctcggta aagagctttg cgtgttagcc    241860
     tgggccgccg aaacggccaa cgtggatcaa ttgccggtgg tctgtgtcaa atgggccgcc    241920
     ttacgaccag aagaaagatg gtggttgttc gcgatgaccg ttgccgaagc gggacttccg    241980
     gacgacacgc aacgaggatg gcggcgggcg ctctatcacg cactttccga cggcgagaaa    242040
     cccaacccgg ccaagaggcg tcgtcgcccg accgaacgca ccctgatgcc attgttcaag    242100
     gaagctgaat gagcaccaat aagatcgtcc ccttttcact caaagatgcg ccgtcgctga    242160
     tcgagaaact gcttcccgtg caaaagctgt cggcggaatc gtacaaggag caaatggccg    242220
     ggagcggaaa aacgctcacc gctttgggaa gctactggaa aggtcgcaaa ccgctcattc    242280
     tcaacaaggc ctgcatactc ggttgcttgc tgccagcgac ggacgatccc aagcgtgact    242340
     tggagatttt tgagatgttg atggccatgg atgacgaatc gtttgttgcg agatggaagc    242400
     gacgctatcg tccgaaagag attcttgaaa aactcccact cgacaatgtc agagatctct    242460
     tcacgagtga acctgaaggc gttttaccag agtcctcgcc gatcaactgg tctgaggatg    242520
     aatacgaggg tgtccgcgtg caatggcgtg atgaagtttc tgaactatca cgccgtagaa    242580
     ttgaaaagcg gcttcttcca gcgacggtct atagagaacg ggtgcatgtc gcgctccgcc    242640
     cagaagaggt cggcgaagaa gtgcacgaac acatctggtc ttttgttaac tctcatttag    242700
     ggacaacagc cgcgtcattc ccagaactga ccgagcagct cggagtaatg cgatttggca    242760
     atcgtccccg ctttgcagac acgtttagtg gctcaggaca aatacctttt gaggcattga    242820
     ggctcggttg tgatgtacat gcttccgact tgaacccgat tgcgtgcatc ctatcatggg    242880
     ctgcacttaa cgtagttgga ggcaacctgg aaagtcgcga taggctcgtg cacaaccagc    242940
     aaaaacttat tagagaagtg cagcggataa tcgacgacct gggcatcgaa attgacggag    243000
     atggatggac agcaaaagca tttctttact gtcttgaagt gagatgccct caaagtggtt    243060
     ggttggtccc gcttcttcca tcgcgcgtgg taagccgagg aaaaaaagca gtcgcacgat    243120
     tagtccctga ctttgctagc aagcgatacg acatagagat tgtttcgaat gtagaagatg    243180
     atgaactgaa cgcagctgcg atcgggaccg tccattccgg gggacgtgga caagaatcat    243240
     ttatggttca ttgccccgaa aacttggagt atcgcacgaa aatacccacc attcgcggcg    243300
     attaccggac tacagatggc gagaagggaa acaagctgcg gcaatgggca aaggaagact    243360
     ttcagccgcg cagtgatgac atatttcaag aacgcttata tgcaattttt tggatgaaac    243420
     gtaagtcatc tggcaagcga tatgactttg agtttcgtgg aattggaaac gacgacattc    243480
     aacgcgagca gaccgtagtt gaatatgtcc gtagtcgaat tagcaagtgg cagggcgaag    243540
     ggagggtgcc tgacagcagg attgagcctg gtgagaaaac ggacgaacca atccgaactc    243600
     gtgggtggac ccattggcat cacctcttca acccaaggca gcttctggtt tgcgcgttaa    243660
     tcaaggagca cgctgtcggg agccagatcc caagtgtcgc gaatttcttg aactacaaca    243720
     gcaagctttg tcgctgggat tcgaatcctg gaccgggtcg agtaggcaag tcacaaggcg    243780
     tatttgacaa tcaggcgttg aacacgcttt acacatacgc ttgccgatcg tttggttggt    243840
     cgaaagagtt cttttcctcg gactacaaaa cttttccaac tgaattgggg cacattgtca    243900
     aagctgaaag cgcggatcag ctgtcaaccg atcatgacat tttcgtaact gacccgcctt    243960
     atggtgacgc cgtcaagtac gaggaaatcc ttgaattctt cattgcctgg cttcgcaaga    244020
     atccacccgc cgaattcgcc gattgggtct gggacagtcg gcggtcgatg gcgatcaagg    244080
     gcgaggatga ggactttcgt cgcgggatgg tcgctgctta caaacggatg actgagtgca    244140
     tgcccgatta cggcattcaa gtcatcatgt tcacgcacca atccggttcg atatgggccg    244200
     acatggccaa catcgtctgg gcctctgggt tgcaggtcac cgccgcttgg tacgtcgtca    244260
     ccgaaactga aagcgctttg cgggatggca ataacgtcaa aggcacggtg ttgctggtgt    244320
     gtcgcaaacg actgggcaaa cacaagacga ctcgtgatga gttggcgtgg gaaatcgaag    244380
     aagaggttca gtcgcaggtc gaatcgctga cgggattgaa ccaacaggcc aagggcttgt    244440
     accgcgacga gaatgttttt gaagatgccg acattcaaat ggccggctac gccgccgccc    244500
     tgcgagtgct aactcgatac tcgacgatcg acggacgcga catggccagc gaatccatcc    244560
     gcccgcgtgt caaaggggaa gtcacgttcg tggatgattt gatcggctac gcggtcaaca    244620
     cggccaatca atgcttggta ccgcaaggcg tctcgaaatc gcactgggac aagctgtccg    244680
     gtgcggagcg gttttacttg aagatgatcg acatggaggc acgtggtttc aactcaatcg    244740
     acaattacca gaacttcgcc aaagcgttta aggtgaaaaa cttccaagct ttgatggcga    244800
     gccaacgcgc gaagtcagct cgactgaaga gtgccgtcga attcgctcga gccgaaatgg    244860
     gcgaaggatc ggagttgcat caatcggtgt tgcgggcggt tttgtacggc gtcatggagt    244920
     tgaccggtga cgtcgagacc gacgacgtgc tgagccatct gaccatgaac gtgccgaact    244980
     ggtttggtga catgaacgga cgcgagatgg ccaaggaatt cgccgactac ctggccaaac    245040
     ggctcgaaga acttcgtccc gaggaagcgg cctcggctcg ggtgctgcgt gatttgatcc    245100
     ggaaccaacg gatcggatag gggattgtcg tgtagctgat gggatcagct aagggatggt    245160
     ggtggagtag aataattcaa tgtaagcgaa atgatgagaa gatcatcaac cgaaacggta    245220
     ccaaaccatg atccatgaaa tacgcattca gaacttcaaa agcattcaag atgtgacggt    245280
     cgagttttcg gacgtgaccg tcctggtcgg gcgtagcgga acgggcaaat cgaacttcgt    245340
     cgaagcggtg cggtttctgc gtgatttgct gagggggcaa cccggtggtt ccggcggtgg    245400
     tatgggcggc gtctttgggg gtggccagaa tccatttgct ctgatgcgac ctcttcccat    245460
     gacggaagca ccaaccagat tcgaaatatg tttctctgtt cgcagctcga aagagagata    245520
     ccgttacctt ttagacctcg gaaagtcgcc agaacagggg cggtttggag aagagaagct    245580
     gctgcttggt gacacgatcc tgtatcacca atctagcgac aagaacgcca tggcctggat    245640
     ccaggaaccg cgtctggtgg atattccgaa gccgggcggc atcgcattag gccgaatgcc    245700
     atcgttatct gatgtggttg ttgcgtacgc tgcgttgact gaaggcatcg gctgctacac    245760
     gtttcccaat agcgtgatgc tcatcggtgc accggcggaa gcggggcaat cggggtttca    245820
     ggattcaggt gccaattacc tggatacgat gaagaagata gtcagcaatt ttcaagacgc    245880
     ttcggctcgc caacgaatcg tgaagtcgct gcaacgcgtc aacgaaggtg tctcatcggt    245940
     cgaattgaat gatcttcggc aacctcaata tgcgatcgtc ggacatctgt tcaacgacaa    246000
     aacacttgaa ctgaagttgt ctcaggaatc cgagggcttc cgtcgcttct acgcccacct    246060
     gttggcgctg taccaacagc cgcccaagtt ggcgatgctg tttgagcacc ctgaggatgc    246120
     agtccacccc ggtgccttct cactgctggc cgaagagttc ttagcggcac cgatggaagg    246180
     acgtggccaa gtgattttga caactcacag tcctggattg ctggaccgat tcacggcgtc    246240
     gcaaattcgg gtcgttgaaa aggaaggatt ttatacgcag atcggacctc tctccgagga    246300
     gcaacgggcg gctttggaag agagattgac cgatccggga gaattactga ccgttgatcc    246360
     ggcacgacgg cagggaacgt ctgctgttga ggtggttggc gaatgaagaa gatcgtttca    246420
     ttcgttgaag gtgagggcga cgcggaggcc gtcccgtttc tgctgcgcaa gatcctgagc    246480
     agccaacaag cttttgacgc cgtttcgatt gatccatcgc catttcgcat cgggcaagtc    246540
     aacaagctac gtaagaacgg cttccgagac tggcacaaca aaattcgtgc tgcgatgaag    246600
     caaccgaatg tgggcggaat tctgttgcta ctcgatggag acgtcgacct gaagaacaag    246660
     caaccgtttt gcgcgatgac ggttgcgagg gagcttgccg cggaggctct taaggtcggt    246720
     gctggcgcga ccttttcggt ggcatgtgta ttcgcgtgtc tggaattcga gtcttggttg    246780
     attgcggcgg cgccggggat ggggactttg cccgatggac gcgaattgag gctaccggat    246840
     tcgttaccgc caaacccgga agaagcgcca cgggccgcca aggcgtggct caacacggtg    246900
     cttcctggcg gctatcgggc aacgacggac caatcagtct tgaccaaagc gattgacttg    246960
     gaggtgttgc gcgccgcgaa cctgcgttcc tttcgacgct tggagaatgc tctcgctgaa    247020
     ctggtggcag cggtgcgaac cgggaaccat gtcgctagcc ccatgatcgg cgactgaact    247080
     ccatgtctga tatttatcgt ttttcatcgc gtcgcgagcg attagaccat gcgtttctcg    247140
     ctaagcgatt gcagagtgcc aagtcgtaca aacgaatcgc aggatatttc cggagttcaa    247200
     tttttgaatt ggttggcgaa caaatttcgt cgattccgaa ggttcagatc atttgcaata    247260
     gtgaactgga tgccgccgat gtggtgatct cgaaacacgt acgagatacg gcattgaagg    247320
     aacgatggaa tgaagctcca tcggaagtcg aggccctgtt gcaccgagac cggtaccggc    247380
     aattgcattc tttattgact tcaggacaag tggagatccg ggtcgttccc aagcaccatg    247440
     tgttcattca cggcaaggcg ggcgtgatcg aggcgggaga cggatcaaag acttgctttc    247500
     ttggctcgat caatgaaacg aagagtgcgt ttgcacacaa ttacgagatc ctgtgggagg    247560
     atcggtcggc agagggcgtg gcgtgggttg aggaagagtt cgatgcgctt tggtcggacg    247620
     cgtacccgct gcctgacgcg atcatcgagg aggtgaaacg ggttgccgat cgtatcgaaa    247680
     tccgtttcga ggatgtgaag actcaagagt tgccgggtgc ggcgcttgcg gagagtccga    247740
     tctatcgcgg cggcgaacaa ctgcaaccat ggcagcgatc gttcgtgacg atgttcttgg    247800
     agcatcgcga gatctacggg aaggcgagat tgctattggc cgatgaagtc ggtgtgggca    247860
     agacgctatc gatggcggct agtgcgatgg tcgcggcatt gctgggcgat gggccggtgc    247920
     tgatattgtg tccgtcgacg ttgacgcagc aatggcaagt tgagttgcag gacaagctcg    247980
     gagttccaag cgcggtttgg ttgtcgaaca agaagtgctg gagtgatccc aaggggcatg    248040
     tgatcaaaac acgaggtccg gaagacgtcg tgcgatgccc gttccacatc gccatcgtgt    248100
     cgacaggctt gctcgttcac cagacacggg agcgagagtt attgctggag cgtaaatacg    248160
     ggacgctgat ccttgacgag gctcacaagg ctcgacgggg tggtggcgtc gggccgaaga    248220
     gcgggcagcc gaacaacctg ctggacttca tgctgaagat cgggccgaag gttcgcaaca    248280
     tgattttggg aactgcgaca ccgattcaga ccgaggttca agaagtctgg gatctaatga    248340
     gcatcttgaa caagggtgcc gactttgttc tggggcgtga gctttacgga tgctgggctg    248400
     attttcagcg atcgcttccg gtcgtgaagg gcgatgaggt gccggaaacc gaacaggatg    248460
     cgtgggagtg gcttcgcaat ccgttgccac cagcgaaaga agatgcgttg ttcgcaacgc    248520
     tgcggatggg cttgagttta cccgataaca aattcttcac agaccgtggg ttcggatcgc    248580
     ttgagtattt ggaacagcaa gcagtcagcc agtcgctaga accggggttc ttgcagcaac    248640
     acaatccgat cgttcgtcac acggttcttc gtcgccggca aacgcttgag gaagctggac    248700
     tgatggaaag agtcggtgtg gacgttcatc ccgatccaga cgcacccgca acgtcctacg    248760
     ccggcgttgg tttcaacggt ttgggattga tgacgaacca tccgtttgat ttggcctacg    248820
     aagcggcgga tgcctacacg gtcgaactga aaaaacgcac caaagcggct ggtttcatga    248880
     aatcgttgtt gctgcaacgg atatgctcga gctttgcgtc aggcgaatca actgcacgca    248940
     agatgctccg ccaggaagtc gcggatgaag aagagcaacc gatgttgatc gaacagacgc    249000
     ttcaaaacac aactgataag gaagccgagt atctgaacac gatcatcgaa gagctttcgc    249060
     gtgaagaggc tcgcgatccg aagttgaccg cgattcggta tttcctgact cagcatcgca    249120
     cggaggggaa aacttggttg gaacatggtt gcatcgtctt tagccagtac tacgacacgg    249180
     cgttctcggt cgcgcgagaa ctggcgttgg tactgcgtga tgaaccggtt ggtgtctacg    249240
     cgggagccgg aaaaagtgga ttgtttcgca acggggattt tgccaacgtc gagcgtgaag    249300
     agcttaagca tgctgtgaag aaacgggaac ttcgcttact cgtcgcaact gacgccgcct    249360
     gtgaggggct gaatctgcaa acgcttggca cgttgatcaa tgtcgacttg ccctggaacc    249420
     cgtcacgttt ggaacagcgt cttggtcgca ttaaacgctt caaccaagca aggcggacgg    249480
     tcgacatgct gaacttggtc tatcacgaca cacaagacga gcgagtttac caggtgcttt    249540
     cacggcggat gaaggaccgc tatgacatct tcggcggttt gcctgacaca atcgacgacg    249600
     gctggattga agatattgaa cagctcgaag gcaaaatgga cgagtacatc caccttcgca    249660
     aaaaagcacg tgatgttttc gagatgcgat accaagacac tgtcgacgcc gacgcgaatc    249720
     gctgggagac ttgttcccga gtcttatcac gccacgatgt cgttgatcgt ttgtccgagc    249780
     cctggtaaag gagtagcacc atgattgatt gggccaatac cacgaccgat gattttctgc    249840
     aaagcgttcc gctagccgaa gatgatcgct gggagtttaa aagcgcgatg tttctcgaac    249900
     gatctaataa aggcgagttt cagaaagaat tgtcaaaaca agtgtcagct cttgcaaatt    249960
     caggtggcgg taatctcgtc tttggattga gcgacagtag agttcttgag ccgtgcgaac    250020
     aacgtgttgg tcgtcagccg atgaaggatt acctcgcaac gcttgtcgag cagtctgtag    250080
     agtatccgct gcggcaattc aaagtccacc gaatcccgtt cacaggcgac gattccaaca    250140
     gcgtgtttgt cgttgaggtc gatgacagtt tggcagcgcc agaccaagcg aagtcggata    250200
     gggtctacta ctaccgaatt gacgggcaca caaagccagc ccctcatttt tacgttgaat    250260
     tgttacggca acgagagact cgtgcggtct tggaaattca atgcgtggaa tatcacgtgg    250320
     aaaagttcct cggaaccgaa accggtatcg ttgaagtttt gatggtgctt cctattcgca    250380
     atgtctcgtt tcaatcggca acgagttggg gtgtgctcat cgaacacaca agacaagacg    250440
     attcgtggga aatccgtcct actggagaga aactcgacga ggcgagatgt ttcatgggtt    250500
     ctcccacacc tttgttgccg caagcttcca cccgactttg cattccactt cgtggacgtg    250560
     cgtacgatca agcgggagca ttggcggcag tacagaaatt gtggaaaagc gttggttttt    250620
     cgtttcgacc ggtgacgcaa aaccacgtcg gtcaaccgat cgccttcggc gactggccgg    250680
     atcgaatcaa gactgcggtt gcgatgagag agcttgacga acaattgagc gccgtcttac    250740
     cgcgagattg acttccagga aacaacactg tcatacgaat ttcaatactc ggagttacgc    250800
     ccatgctgat gccgcgactg agcgaagcgg acccagcgga atcggcggag ggttcgattg    250860
     atcctttggg gatgtatccg attgccgatg cgttggcctc gcggatggtg ccgggggtgc    250920
     gggagcggca aacgcttccg cgattcctaa ccacgattgc ggtgtcgctt tcgttgtgca    250980
     gtgtttttga tgaggacacg gtcgccgatg atggggtgag cgaaccttgg caggtgtttg    251040
     aatggtatgt cgtcgaaggt ttggctcggg cgacgagcga tccgaagttg ctgcgtggct    251100
     tgccggggcg tgacaaggca gacaaagcga aagccgcagg cgactgtcgg agcgacgtta    251160
     tctcaaggga gcaagaactt tcgattttca cggtatctac cgagcgctgg ccaaggaaat    251220
     cgggatcgaa acgtcggggc gacttggtga tgccggctat gaggtgctgt tggcttgggt    251280
     atccgaacca aacgatgcgt gctcggtcga ctcgatgcca attcggaaaa gatgcttggt    251340
     gatcgagatg tgcaattgaa tgccgactac ctgaatggtc tgaacaaagc cgaacgatgt    251400
     gttcatcggt tcacgatctc gcgtggtcag gagtttgtcg agacggcgga gaaaacgatt    251460
     cacgctttgg ctcgagacga gtggggagga ttgaactcag gtggcgagtt gttggcggca    251520
     atcgtggtgc ctaacgaacc cgccaccgca aaggtgctga aacttgcaag cggtgggtgg    251580
     cgaagcgtgg ctacgccctg gcgctcgatt gttactagag ccttgccccg cgcctcgcct    251640
     acttgcctgt cacggcactt tggtcggcga ctacgtaacg atcattgatg ctttgaaaga    251700
     tttaagacac gtcgacaaaa ttgactgatc cgtcaattga ctcgcgattg ctgccagaat    251760
     ctcgtcgcaa acggcattgg gcgccactct tcaacgagac caaatatcgg cgatgtcacc    251820
     tacgaagtcc aaacactgac acgatatata tcgcgttaga gacagaggtg tgctgcgggg    251880
     tcgctgggtc tgcggcgtgg taacgaggtt cgctaagatg catccgtgga tggcgaaatg    251940
     gttcatccta cggacggatt cgcggaaggt tttcaaggca tgactccggt gcgccaaagt    252000
     cgtttgcgag caatggtact tactgctaag ttgcatttgt caggcgaaac ggagtcaagc    252060
     tctgcagagg tgcaactcga caagggatag cctggccgac ggtgcgccaa tggcgtgact    252120
     tgtccccggc gaacgaagtt tcgtcgggga cttctttcgt caatacctgc gatagcccac    252180
     gaatgacgga cacctcgatt ttgattttag acggcaaggt taaccgtgtg ttctgccttg    252240
     aattggctga gtgatctaca cccgagcgtc tgatgaatct ttcttgagtt ttagaacatt    252300
     tcgacgtcgc gaaacacact catccaggct tcttgaatat cggcaaagaa ttcaaacttg    252360
     gtccattcat gtttgagtga tcggaagaag cgttcctcca ctgcattgtc gaatgcaaaa    252420
     tccaatgcgg ctcatcagac aaatgatgtc attgtctaga gcatcttccg gaactccgaa    252480
     ctcgtgcatc gccagcctcg aacactgtgg tggggaagtt cgccagtcga aggccttcgg    252540
     tttccaatcg ctcgacgcag ggcactagtg accagcggag tggccaggct ctttgacaca    252600
     gaccagccaa cgatcttgcg actgaacagg tccgttacga cggctaggta gccccaaccc    252660
     gagtctgtcg gcaggtaggt accaatcacg aagcgatcga gtctcgacac caacggcttc    252720
     agcggccgcc tcgaaggaat agtcttgatg cgtcacgaga ctgactgcct cctgcttgaa    252780
     ttaattgctg aacgtttggc gagtgtgttt ctctgacata gaggggtact gaaaacagtt    252840
     tggaaaactt tccagatgtc cgccagtcgt gggctatcgc aaccattggc gcaccggaga    252900
     gatgccttaa aaaacctttc cagcacgcaa cctcgtcctt cagataggaa gtgaatcccg    252960
     aatttgtttt ggggaaacga ttctcaatcc cgaatgcagt tcccgatgca ttccaatcaa    253020
     gactctggaa gcgtgcgaac cgatcgaaac gtctgattcc ctgcaaattg agcaacgttc    253080
     gttcctgaat aagcgtgaca caagcggaaa cgacgccgca taagtcgcac accgcaactc    253140
     gccgcggaag gtgagctatc gtcacacgac gtgttccgtt gagttgaaga agccaacccg    253200
     gctggcatgc gcaaagtttg acacattgaa acggacagat cctgggaccg agctctgata    253260
     ccacgttggg gcatgctcgt cggttctacg cttctgggta tttacccaaa gtgattccga    253320
     gaatacccga aatgactgcg tttcattgcg tccgtctgcg ggtatttgca ttggtcaatc    253380
     tcgcgtgtaa actgccgttt agcctataag caaaagcgtg attcttggct atcacgagag    253440
     aagcctgtcg atccggaggt tgcgggttcg agtcccgtcc gcgtcgcttt taaaaagccc    253500
     tgctgtttca gccgggcttt ttttatgcgc ggccgcaacg ccctccggcg tcacccgtag    253560
     ccggattcgc caagaattcg gctccagcct ccccggattt gacccaagac acgatcgagc    253620
     ccacatcgat cgcgtccacg atgattgagc cagctttcga cggtggcagc cggatcagcg    253680
     atcgatggtt gcgacggggt tggcgagaaa ttcttcggga acggcttctg gccattcacc    253740
     cttcatcacg acgttttgaa tcttcgccgg tgcgccgcgg ctagatcgat acagcccgaa    253800
     ttgagtgctg gcgccgggtt cgagatcgcg ttgatacacg agctcttcat tcagatggac    253860
     caacgccttc ccgtcagaaa gctcgacgcg aacatcgttg tacgcattcg atttgagcgg    253920
     caaagatcgc ggaccgcgac ggctgagtgg ttccagtgcg gtgttgtcca ttggcaacgt    253980
     cgtccagtcg tttccgcctg tcgtcagcca ccggactcgc ataccagtcg gttcgagcaa    254040
     gaacgccatt cgcccaacgg ccggatgaac gatggaagcg tcttcgccaa agaaaaattg    254100
     ataggcaatt gattcgccat ccaacagagg tcgctggtat tgcaacagcc cgggttgctc    254160
     cgcttcgtcc gcgttttcct ttgccgtgcc aagcagcacg cccgactgca cttgccaatc    254220
     cagctctctc gcgtttggtg cggtatcctc tggcgagggc tcaaacactg cgccagcgat    254280
     ttggtttcga aacggaggtt gaacttcgtc ataaaaactg gattgccaac ctcgaagctc    254340
     atcaccggca atcaagctga cttgtcgagg aatgatgggc tcgccggtca gcatcacatt    254400
     gcgaaacact ggtcgcttgg tgcccgaact tcgcagaccg atccagggac tcgtttgtgc    254460
     gatctcgtcg tcgaaccaaa tcggatggag gttggattcg aactgactgg tttgtttcgt    254520
     cgatcgaatg gagactcggt tgaagacagg ctgcgatcca gtacgagcga acggggaatg    254580
     ccgattgacg cgttgttgcg agtcggcatc ccaaaccgaa agcgttgtgt tgcgaccggt    254640
     cgcttgaaag tgaagcccgc catagaccag cccaccgtcg gtgccaatgg aaccgccaga    254700
     ttgcgtttcg cagatgaagt caaattcacc ggtcaacggg aatcgacaga acagcacatc    254760
     ggcggttcct cctgccacgt gcaagacatg tcgctcgtga gtcagccaca tgccatccct    254820
     ctgtccgcgt tgaatgtctt tggaggtttg gacggtcgcg ggaacccaaa acttcatcgg    254880
     gttctcgaac aacgtcgccg gtggcgattc accgcgatga ctttgaacgg cgaccgcgtg    254940
     tgcgatccgc aggaaaggac gcatcccgat cgagcgttca tccacggcac ggtccaccaa    255000
     cgaggccaag tgagcttccg cggccgcttg ggtactgtcg tgcagcatcg ccgccgccgc    255060
     gattgccgcg acggtcatgt ctcgcgatgt cagcggcgtg gattcaacgg gcaatgctgc    255120
     ctgagcttcg agaaaggact ttgccatgtc gagatcgccg cgactgccca acaattgggc    255180
     caacaccaac aactcttctg ctcccgacac gttctgttcg tgcaattcct ccagcgtgat    255240
     tcgcaggcga ggcagtcgcc ccaattcatt tgcggcctga accaacgtcc atccgctgca    255300
     aaaaaaacct tccaccggtc cgaccgaagc gacggcaaac gtgttgtctc gaggacgttc    255360
     accgatcgag cgagcgaaga ccttgggcgg ggcgtcggtt gggacaggcg tcgagagcac    255420
     tcgcactcgc ttgcgttgct cggtcggcaa cgtccactcc tccagccatt catattgctg    255480
     atcgctgctt gattgcacca gcgcccgatt caaggctgcc gctgccgagg gcaagtcgct    255540
     gtaaagcatg tcggaaatcg tcagcgaact cgcggactca tcgagctttt gcaatgccgc    255600
     ctctggattg cggtctcgta atgccggcaa cacgagttca gagtaagagg gctttgattt    255660
     cgcgacggat gcctgcccaa acaaatccgt caatcgcgtc agtccatctt gtgccgcaca    255720
     gtgagagggg catgggatca cgcaaaggaa agctgttacg ccaacacatg cgagcgagat    255780
     ccattgcgat gcgaatttga tttgccgtga acacattgtc gagttcattt gaaagtgacg    255840
     gggcgggatg agaatcatgg agtgtctatc agcggaaaaa attgcgaagc gaatcgaaaa    255900
     tactgggggc tcgcgattcc ggctttgcag gaaccggctg ccccatcact ggagcggcga    255960
     gagtgatacc ggccgctctc acgtggattg atttcagcaa gacttcggat gagcgtccgg    256020
     ccccaccggt atgcaaaaca acgcgaactc gtcttggatc gatgggttgc tcggagacac    256080
     gaaccgtccc cagcagcaac gactgctgat catcttcccg tcccgcgatg cagaagcatc    256140
     gatcaccgcg tcgaacgatg cgaaggtagt ccgggttatc aagtggttgg cttccgatga    256200
     tgcgatagat cgatttgccg tcgctgagaa cccgggacat cgctcggctg gcgaccgttc    256260
     cagaatccga tttattcatc atcgcattga cttgggtgct gtcgtcgtca ctccattcga    256320
     tttgcagata caactgcgtc tgctgccctt gaacaggcgt ctccaaatgg acagcatcaa    256380
     aatagaaagc gatgtcgaaa tcaccttcga tcagatgttg cagcgagact cccgcacttg    256440
     tccattcatc cgtccccggg gcgatgacct tcaccccgga tggtgaccgg tgccatgcac    256500
     cccagtgata aattgcgttc ggatcctcag ccgccttggt gaagtcatgc tccaacgtga    256560
     aaggcagacg atcccgttgc tgatctaacg aagccaaaga cgcttcgtgg tcaatttcac    256620
     tcactccttc caagcgttcg gcacggacct gaaactcggt gaacctcgcg ttgactcgcc    256680
     catcgggacc ttgaatttga actccgaact gaatgctcat cggcttcaaa tcttctttga    256740
     caaactcttc ttcgccaatc agatagaagt aatcggagtc gccatcggcg gccaagtaga    256800
     acactttgtc accacgtcgt gacaaacgca gacgtccagc gtcgccatcg cacggaatct    256860
     tgccaaaata gtgacggcgt tgctccccgt tgaccgtcgc cattctcaga cactgcatca    256920
     tttggtcgtt gccgcggtcg ttgacccact gaatcaacgc ggtgtcttcc gcgggcgtgt    256980
     ctgcgaccac gtgcattcgg atgctgccga tcttttcctt ctgtgattca cattgaagtt    257040
     gatcgtaggt gacggtgatg tcaaagtcgc caccgactcg aacgtcagga gccatcaagg    257100
     tcccccggta accggcatca ctggtttgat tgagcaccac tccttcgtcg gtcgccatca    257160
     gcgtttttgc gggatcacct tcgatctgta agaaacggcc tcccaccatc gcatctcgat    257220
     cgatgcgata actcaattcc tgaccaggtt cgctcgccgt ccaatccagt ttcccttcga    257280
     aatcacccgc caactgctgc tcgtctatct cgggcagttc cttgggccaa tcgccactcc    257340
     aacgcgcgtt ccgaactcgc aaagcggact gatcggcgaa gtgaaacagt ccaaagcagg    257400
     gggacagaga attgctttcg atcttcgact cgtgaatcgt ttgaccattt agacgcaaaa    257460
     caacttcgtc gccacgacgt tgaagttgca tttggttcca agctttgact tgcaacggaa    257520
     ccggcggcga gtccttggca ctgacacgtc gctcattgtc cggacgcaag ccacttttgt    257580
     cgtagcgtcc atcggtcaac tgatgctcac tcaccccgtt ttcacgaatg aggtaacacg    257640
     tccgtcccaa ggcagggtga gccgccgatt gatcaccgtc gtaccaaaac tcgtattcga    257700
     tcacaccgtc ttccaccatc ggacggatgt accgcagaag atgctcgaca tgactgcctc    257760
     gaggcagata cgcaatttgc gggtcagtga tctcggtgat caatcctgct gataaatctt    257820
     gaactcgata ggccgaccaa tttgcgagtt gattggaacg attgcctgga tcttggtagt    257880
     aatcgtacca acccaacagt tcggcggact cgaccatttc aatgcggtct ggaatgatcg    257940
     gatcgcccgt gatccgaaga ttgtcgacgc caccttggac gcgatagttt gtccgtaccg    258000
     caatccacgg gtaggcagaa tcgcccaatg gttgacggtg gatttcgcgt ccattgatgg    258060
     atgtcacgac ctcgccatct cgcacctggg cccgcgtccg caaaattccg tagcgatgcg    258120
     tgtcggtgag ttcctcgcca atgcttgtcc gccctagctc ctgacgaacg ttgcccacca    258180
     tgttctgagt gtggttgtaa accaaccctg cgtagtagcc accgaccaac aaatgagcct    258240
     cgcgatatcc gaatccggtt gccatcgcgt cgacggtgta ttcgccgtgc agtggcgact    258300
     gaaagaacag aaaatcgtcg ccgtagttgg actgatttcg atactggcct tggacaacgg    258360
     atggattggg ataagggaat gcgttgccgt gatcaaaggc acgttcaaga cttcccatga    258420
     accattgcgg cgatccttcc atcgcgcttc ccacctcttc gggctcactc aagcgaacct    258480
     gagcggcaac gaggtgacga atccaagcgg ggcgatcgta ttcttttcgg taagcaagcg    258540
     ttgtgaacaa aaccagctca cgaatggcgg ttgttgacgg cttcgattga accgctttct    258600
     cagccaacaa cacgatccca tcccgcgaac gatctagcaa cgcgctgacc gggcggacga    258660
     gattgagcag ttcatccacg cctttctcca ccgccgccac gtcgttcttt tccaacgcga    258720
     tcagaacact catcaccaac tgatcgcatc gatcctctgg cgtcgtcgcg gcgaactgat    258780
     tgatgtcttt tgaaagcgaa tcaagctgat tcgattgccc cgccaagcga atcagttgca    258840
     atgcgggtga gatgaccgcg ggatgctctg gttggtcatc atcgacgtgt ccgaaatcag    258900
     cggtgatgcg aagacgcggc gagtttggcc caggaatcac ccatgacttc aaatattgca    258960
     gacgttcggt cggttcgaga ccttccgcgt gctcgcaaac catcgttcct gattccgaga    259020
     catgatggtc atcaaaaatc caagcgaatg ctcccgcatc cgaccgagcg gcatcatcag    259080
     cttgcgacgg ttggttcgca ttcgcgagca tccaaaacgc gaccagcacg gagacgcttt    259140
     tcaaaacacg ttgattcttt agatcgttca tcatgccagc ttcagcgaaa caagttgcga    259200
     atggagttgt aaattcgcga aggcacgccg tcctgagtcg ggctttccgc tgtctcgtct    259260
     ttcacaggca tcaccatgat tggagcggct atcggattcg ttgccggcgt ggttggatcg    259320
     gtgtggatcg tcatacgctt tagcagagct cgcatctcac cgttattcaa accgccgatg    259380
     aaccaagtct ccgccctggt ggcgacggtc ttgcgtttca gtttgtaagt cgcgaccaaa    259440
     ttttcttctt ctgtaccgtc agctcgatac agatagtaca gagtctgatc cttcagcgcg    259500
     atcctcaact gatcgggcat ctggatggtt agatctcgta gtggctgata gaccgtttcc    259560
     ccatcccgat tgcgtcccac aattcgtggt cgcaattcga ttcttccatc gggtttatag    259620
     cgtacgagga gagtcgcttc ggtgatggtc gtttgcgtgg gagcaatttc ttcggtccca    259680
     atgtccaata aatgcaaacc aatcaccgcc tcggtggtca tgccgcgttc acgattgcca    259740
     actgctttga cgatcgagaa ctccgattga aaatcagccg tcaacgtttg ccacaacggt    259800
     ttaagaatcg cgattctttc ggccgtctcg atgccgccca atgctgtgaa caaaagccca    259860
     tcgctcgttt cggcaatgct ttcaacagga ccatccacaa cgatccaatc accgtcgtcc    259920
     attccctgct tcgacagatt gagatccaaa gcacgcatgc cacgccgagc ttggttgatt    259980
     tcttcaagca tttcgggagt atccgtcaat tgcagatcca ccgtctctgc tcgaatgcga    260040
     aggtccgtcc aggtcccgct gacactcatt ccattgccgc ccacgctgta gttataaaaa    260100
     ccaaatggtg gaaccgggcc cagcggaatt cccgtcgaac caatcaggtg aaactgtgac    260160
     gagtcacctt gagcgaacaa gccgtagatc gttccgcctc gccggaccag acgcaatcgc    260220
     ccggaagtcg aaagctcacg ccgcgtccaa ccacgaaccc acttgtagcc tccacccagg    260280
     tttttcttgt tgtgcgcgaa ggcaatgtca tgcagaccat tgattcggtc tcgacgaatg    260340
     cagacatcca aacaatcgcg atgcccgttg tccagctgga cggtcatccc gagtccgcag    260400
     tgccaagttg gttcctcatc gccaatctgc aggtctttga atccatacgt gatctcgaaa    260460
     tcgccatcga tggtaccgtt caaccggacc gcgactttgt cggaaggcgt tgctcgcacc    260520
     atatgaatgc catcgggcaa tgagaacaat cgatccgccc gcccatcgac atcgaacaat    260580
     tctgctggga caccatttgc aaaatcatgt tcgaagtgtt cgggcagctt ttcggcggcc    260640
     gcttccaatt cctttaccaa gctggacgcg agtttctgtt ccgacacctc cgacaatgag    260700
     tcatgccaat cgccgctcag acgaagattg cgaaccaccg cgcgagtttg atcgcgatag    260760
     tggaacaaac cgaacgtccg tgactcattg ccactgacct gttctttcgc aatgactttc    260820
     ccattgagca atacgacgac gcggtcgccc ttgaaccaca gctcgacccg attccaacct    260880
     tccaccatgt cgggcttccc accgctttcc aacctcattc tgttgtcggg acgaagcggc    260940
     gtctgttgat gcatcccatc ggtggtttga tgaaacgata caccggtgga atcgatcaaa    261000
     aacgctttcc tgccgacaca agggaacacg tcagccgaca ttgcgtcgtg caagaactcg    261060
     tattcaatac gtgcatccca aacgatgggc cggacatagt acaacagttc ctcttcattg    261120
     gaaccaaacc attcgccggt ccggtcgctc actaaagtga acacaccgtc ctcggcttgg    261180
     atgctccaat tccccagccc gttgttcgta tccgcgttgt agtaactggc ccaacctctc    261240
     aacgagacgt cgctcagtaa atcgatcgtt ggaggcgtct ccggacttcc cgcgattcgc    261300
     agatcggcga tgtgcccctt tgaacgacgc caaccgcgga tgcccaccca cggtgccgat    261360
     gcaatgtgcg tcgattcggt atgggtcaga tagccattga agaagtgttc gacttgtccg    261420
     tctgaactgc tcgcccgcaa caggctttcg ccgcccagcg gttcgatcgg tttcgaaacc    261480
     ggcacctccc aattcccctt ggcaaagctg cccacagaag aaacggcacg cgaatcggat    261540
     gggctcacgg caactccacc aaccataagc tcactgaagg cgccgttatg ggtggcgact    261600
     ttcgcgacag cttcaaaatc ccccagcaaa ggactgcgat agacgaggta gtccagttcg    261660
     tgcccagaga ccttctccac accttgatca tgcatggcaa agcgtggcaa aacgtttccg    261720
     cgtccgtgag acgaagcatc cactcggcta aaaacatcaa acgactcggg aacactcgtc    261780
     atcgattcat gcgaccgtgc ggaacaatat cccaacaaca aacacaggta gtccgcggtc    261840
     aggtccagat ttgcatcggg gatgtagtcc cgaagaccag agaacgcacc aaagagatct    261900
     tcgatcacta aatcggtcgt cgatggattc tcagccgccg cccaaagaat gatcaaatct    261960
     tcccaccaca aatcggcagc gttgggatct tgccaatgtc ggttcttagc gaatcgctcg    262020
     atcaaatgat gccgcacacc gttcaggtcc gactcagcga ttgttagcaa tgtcaccatc    262080
     gcttccttcg cccggacctg gtcattgcca gctggattcc attccgcaat tcgttttttc    262140
     agttccggtt cccgccccaa ctccaccgac aaatggacca attcacgagc gggacagtgg    262200
     atccattcgg tttccggata ttccgacaac ggaatccagt ctctcgccgc gacgtcagcg    262260
     gtagctcctg cgggccgagc aatcgagcct ccaagacgta gtccgtggcc attgcccggc    262320
     aagacccatt tcgacagttc ttcgtaccgc tgaggcggat ccagatcatc cattcgtgcc    262380
     agaaactgga ccgcgttgtc ttgaatcgcg ttttcaccaa acaagtgatt cagagccacc    262440
     gaatcatcct tcaccaattc ttcagccagt ggcgtgtccg cgatgcaaac gttgaggctc    262500
     accattagac caacaacgca cgcggacaga cgacaagcgg tctgaagcaa gcttttcgaa    262560
     tcaacagaat gtgtttcaaa ttgcattggg tctcgcgcgg ccaggcttca tcgatagtcc    262620
     cccacttaca gaatgtcgcc gcacgcgaat ggatcacacg cagaaattct caaaaaatgc    262680
     cctcttggtt cgcgaagctc cggaagcgac aaattcatcc aattgattta tagcggaacg    262740
     aaagagccga gggcattttc aaccggtttg tgtcgttctt cttcgaactt gattgggcat    262800
     cgcaaatgat ccggcgcact tgcctccgct atgatggatc ctcctcggaa gcagttttca    262860
     agttttttga ttgtttctgc gcgtgaattc tcgaccaggt tcgacttacc tctgaatgct    262920
     ggtggaccgc gggtccgtga tcctgccgat tggcgagacc gattttgaat aatgctgaac    262980
     ttatcgaagg actgcgaaat cgtgagccaa gtgctgcaca gtatctgaac gattgctttg    263040
     tgccatcgat ctggcggttt gtttattgcc gcgtggatcg tgacgcgcac ttggcagaag    263100
     acatcgtcgc ggaggctgtg ttggcgttga tgtcagcagc ggtctcggac accgacatcg    263160
     aaaatccggg cggatggttg agaaccgtcg ctcaccgacg cattcaagat cattaccgag    263220
     ccgccgctcg tgttcggcat ttgatggaag acgctcaaca tcaaggtgag ccgactgacg    263280
     acaacgatcc cgccactcag cacgatcaaa agatgcgacg cgaaagtgtt cgtgaagcaa    263340
     ttgacacttt gccagaacat taccggcaaa cgctcgaatg gaaatacgtg gaccaaatca    263400
     gcgtcaaggt catcgccgag cgtttggaca cgaccgaaaa aagtgtgcaa ggaactttgt    263460
     tccgagcccg ccaagctctg cgtgatcaat tgaaaaccga gcaaatcgtc ccgcctcaaa    263520
     ccaagtgttc ggggccggac aaagagactt cacgcccaac tcaatcagac gattctccat    263580
     ccctgacatc gccgacacct ccgaaacagg tatcggcttg gttcttcctg taaagacgaa    263640
     gccaggttgc acaggttcgc ttccatgaca tccgaacgtc cacaacatcc gtcgtcgatc    263700
     gacaacgatc cgtccgagtt gcatcgcaac gaagacgatg aatcgtcggt ggcaatgctt    263760
     ctggctgacg cactcgatgc gcctcccgtg ccccgttctt tggtcaagcg tttggatgct    263820
     gagatcaccg aacaatgggg acattcgccg cagctgactc gttctcacgc caccggaacg    263880
     gtcaccctcg ccagtgccaa acgagtgatc aaaacttctt ggtggttggc cggcagcgtc    263940
     gccgcttccg tgatgttgat cgttttcttg accggcggca ccaacaccta cgcttgggcc    264000
     acggtcatgg aagccatgca gcagcatggg ttgatccaga tcgccgacga ggatggaaac    264060
     cgctggctcg atctttcaaa tcaagtcgcg tgtcagcaaa cgcctgaaga aactcgctgg    264120
     gtcgatgtgc gccgacggac ggtaatggtc cgctctcatg atgtggaaac caagagttcg    264180
     acactagcac ttcccggcaa cgcttcaccg accaaggaag agttgttggc aatggtgctg    264240
     ctggaccgtc cgttgacggc ggaatcgatc gagcaattcc gtggcgttcg aatcactcac    264300
     caagagtggg agcaacgacc ggatcgtgga cgcgaaattg tcgaattgca ggtcgaattc    264360
     gcaacccaag acgaccaacg atatgagttg tcgttggaat tggatccaaa atcaaaactg    264420
     ccgctggcca tcaacgtcag cgatccgcca caggatcggt tgaacacgtc ttccctgact    264480
     tacctcaaag aatcaacaac ggaacttcaa acaagattgc aacttgcgtc cgcggatctg    264540
     gatacgccgg ccgacgttcg atcgctcgat cggattgcgg caaacaaccg tgcaagctcg    264600
     cctgaaacga agcttcccgg gatgctggat gactcacctg ccaaggccag aacggacgat    264660
     gatccagcga gcaacgaagt taaaccaacc gttgacgctc gtgattcgat cgtgtcgttg    264720
     ccggttggtc ctgccaacaa gtggcagccc gtgtcggtga tttcgcgaaa cgacgaacaa    264780
     gtcatcgcac gtgcggattt gattttggat gaactttggg ccgagcgaca gatccgtccg    264840
     gtcgaccggg cgactgacct gcaactgctt cgccgcgtct acttggactt ggccggacgc    264900
     acaccaacgg tcacggaagt ccggcgtttt ctcgagaacg attccgagaa tcgctatcga    264960
     gaactggtcg atcatctgct cgactcgccc gactacacct cgcaaatggc agcggtatgg    265020
     cgatcgttct tgattccgga aggagtcgac ttggacgcct ttggaggtcg cgaagcgttt    265080
     gagaaatggc tcgctgaaca gtttaccaat gatgaacctt acgacaaaat cgtccgccga    265140
     ttgcttttgg ccgaaggtcg cttggctcaa tccggacctt tgctgttcta cagtgcgttg    265200
     aagctggacg ccgaccaatt ggccgctcgc acctcacgtg tttttctggg catgcggttg    265260
     gagtgtgccc agtgccacga ccatccattt gaaccatggt cgcaagaaga tttctggagt    265320
     tacgcggcat tcttcgccca gatttcacgt cccaaagcga tgcttgagaa cgtttcgacg    265380
     gtcatgcaag ttcgtgatgt cgatcgcggt gaagtcatgc tgcccgaatc ggaagaggtc    265440
     atttcgccgc ggttcctggg ccaggaatgg gaagaccaag acgactcgca accgcaagcc    265500
     ccacgtcgcc aacggctggc gaattggttg acaggaccga acaacccgta ctttgctcga    265560
     gcaaccgtca atcgggtttg gagccacatg tttggccgag gaatcgtgga tcccgtcgat    265620
     gactttggtg agaacaacct gcccgtctcg gctgacttga tcgacacgct cgccagccaa    265680
     ttcatcgaca gtgattttga tctgaagcaa ctggttcgaa ccatcgctct cactcgcgcc    265740
     tatcagctcg ccagcagctc taaccgcgac gacgattcac ccgatgcgat cgaagagcgt    265800
     ctgacaacgt tcgctcaaat gaatgtcaaa acactgacgc ccgaacaggt ttatgactgc    265860
     atcgcggtgg caaccttatt ggaccaacgg aacgaggcct cggactacac cctcgcccga    265920
     tttggaaaca accaacgaga cacgttcctt cagcaattcg ctgctccggc gacgagccgt    265980
     tcggagtatt tggcgggaat cccgcaagca ttgatgctga tgaacggttc gttgatcggg    266040
     caagccactc acgaacagag cagcggtttg attcgatcgc tcaacgcacc gttcttcacc    266100
     gatgaacaaa gaatcgaagt gctgttcatg gcgacactgt cccgaccacc tcgtccctcc    266160
     gaactcgaat tagtagcgga gttcatccct gccgattcca accgagagca acgttacacc    266220
     gggatggctg acttgttgtg ggccttgatc aacagttccg aattcaccct caaccattga    266280
     cggagcgttt ccatgtcatt tccaaacatg aattcaccat cacgacgccg cttcatgcag    266340
     tcgatggccg caggtatcgg cggagtcagt gcgagcggtt ggttcccagc actcgcggaa    266400
     gcggccgcga atgatcctaa gcgtcgtcgt cactgcattt tattgtggat gagtggtggc    266460
     ccaacgcaaa ccgatacctt tgacatgaaa cccaaccatg aaaatggcgg tgagttcaaa    266520
     gaggtgcaaa catcggctcc tggattgcgt ttcagcgagc accttcccaa gctcggctcg    266580
     atggccgaca aactcgccgt cctgcgtggt ttgtcaacca aggaagggga ccacggtcgt    266640
     gggtcctacc tgatgcgaac cggtcaaaaa ccgatgggcc cggttcagta cccgtgcatc    266700
     ggttccgcga tcggcaaaca gcttgccgag gacacgatga gtcttcccag caacgtcagc    266760
     atcggaacct atcgggcatt caatcaagac gcgtttggtc ccggttttct cgggccgcgt    266820
     tttggaccgc tgttcgtcgg agcgaccgat gtgccgggtg gaatgtcaaa cggagaagat    266880
     ggctatccca acctcaaggt tcagtacttg gatcgagccg aaggcatcga tgccgaacgg    266940
     atggacaagc gattgaaaat ttggcgtcgt ttgcaatcgc acttcgtgac ctcacgccaa    267000
     gccggtgcgg cgggaatgca caacgaagtt tatgagggtg ccgttcggct gatgaacagc    267060
     gatgacgcga aagcgtttga cctatcggac gaacctgaaa agctgcgtga ggcttatggc    267120
     aacaacgtgt tcggccaagg ttgcttgatg gccagacgct tgatcgaacg aggcgttccc    267180
     tttgtcgagg tttcgctcgg aacggacagc acgtcggtcg gatgggacac gcacacagac    267240
     aatttcaacg ccgtgcaaaa tctttcgacc atcctcgaca atggctgggg gacgttgatg    267300
     caagacttag aagaccgggg cttgctcgag tcaaccacaa tcgtgtggat gggagaattc    267360
     ggtcgcacac cagcgatcaa tccaaacgcg ggacgcgacc acttcccgaa tgcttggtcc    267420
     agcgtgcttg ccggcggcgg aatcgccggt gggcaagcgt atggcaagac gagcgaagat    267480
     ggcacggagg tgatcgatgg caagattagt gtccaagact taatcagcac gctctgcaaa    267540
     gcgttgggtt tgggcagtgc acctagcaac atgtcgcctg gcggccgccc catccccatc    267600
     gccgaaggtc gagccattga ggaagtgttg gcatgagtcg tctcggtaat cgaaacgttg    267660
     cgttgatcgc atttgccgtt ctgagtgcgt tcgttccatg ctgcattggc gttgccgttt    267720
     gtgatgacac atcgcaatcg ctcgacgctg agccactggc aagctcgccg gtcaagatgc    267780
     taagcagcag cacgtcagag actcggcagc cgagcatgat cattggagtt cccatcgctc    267840
     ctccggccag tttgccagcc gaaaagctgc ctcagtaccg gatcgaactg ccacgccaca    267900
     acgaagcgga tgagtccttc gcagacggtc aaatccagtt cgccatcacg catccagact    267960
     tactgacgca aatcggtcgt cccttgcgtg tcaaagcaaa ggtccaagtg gatggcaaac    268020
     cattcagtga agttcggtcc gcctacgcaa cgtccgctca aaccgctgag cagccaccgt    268080
     tgatggagca attgtcggat ctagtcgaag cggttgcatc agcgtccgag tccgttgcgg    268140
     acgaaataga agctgcatcc gaggagggga aagaagagaa cgggaatgac gaggatgcag    268200
     atgaagacga cgatgcggac gacacagagg atgaagacgc gacgccgccc atcagtccag    268260
     ctacgttgga tccctaccgc atgaccaccg ccccagacga aacgatgcgt cgattcgcag    268320
     aggcgatcgg tgaggaccta actgatatcg aatcgaattg gttgctgagt cattggacga    268380
     tcggcccgcc gttgctggtg gtccatccct atttccaaag ttttcgatct gatcaacgtc    268440
     ccgcctttga tatcctggac cgagatcgtg acggcaccgt gtcacagcca gagatgttgc    268500
     aatcggtgga atcattcaac aaatgcgacg cgaatcgtga cgaagtcgtc gacgcaatgg    268560
     aactggcaaa cgctgccgac aacctcaagg acccggcaca cattccactt tcaaacggtc    268620
     cgctgctctg gttgcccgat gatttaattg gcgtccaaga aaccgatccg ctgctgtatg    268680
     aactggttcg atcactcgac gaagaccaag acggaaccgt ttctgaatcc gaagtgaatg    268740
     aatggtcggt ccaaccagcc gacatcgaag tgtcgatcaa cttctccacc gcatcgcccg    268800
     agtcggctcg tgtggacgtc gtcagagttg gcaaagaggt ttcggccaat atcgtgccca    268860
     ccacgaatgc caatggaatc gacgtcgcat ttgaagcggt cacgattcgt ttgtgcgggg    268920
     tccaagaaag tccatcgcca gaattcgcga aagcgatgtc gggacaggtt tctctcggag    268980
     cgatcgtgga tggttatccg ctgcttccga atttggaccc gaacgatgat ggtcgattca    269040
     ccattcgcga attgcggaaa ttggaacagc ttctgcgaac gttcgaccgc gatggcgatc    269100
     aatccatcac ccgctcggaa gccgcgtcgc cgattcgtgt ttgcatcgga ctcgggccaa    269160
     ccgcacaccg tgaactggcg aacgtccgag acacaagtca accagagact tcgcccagcg    269220
     tgacggcacc cgaatggttc caaagaatgg accgaaacct cgacaacgac ctatcccgcc    269280
     gagagtttcc gggcaccgac gaacagttcc gttcactcga cgctgatggt gacgaactga    269340
     ttgacgccag cgaagcacaa actttcgaac aatcagccga ataacagccc cccacgaaca    269400
     ttcttttggc cattgaactg gccaacaaaa aactgacatc cattggaaga tccatcggag    269460
     aagaccatgc ccagccgtct tgagaccatc aacgctgtca attcgaacca cacgaacaac    269520
     catgtaaaac aaccggaaat ggatgttgct ttggtggttg atcaaatgca cgagaaatta    269580
     tccgagttgc gtgaacaact ggcgggcgtg atcgtcggcc aagaagaagt cgcggaacaa    269640
     ttgctgatcg ggattctttg ccgcggtcac tgcatcctgc agggcatgcc gggactcgcc    269700
     aaaacgatga tggtgtcgac gcttgcatca ctaaccgacc tgagttttcg ccgcgtgcag    269760
     ttcacaccgg acctcatgcc cggcgatatc accggcacag aagtgttgga agaagatcac    269820
     acgaccggca agcgcatctt ccgctttgtc gaagggccat tgtttggcaa tgtgattctg    269880
     gccgacgaaa tcaaccgcac gccgccaaag acccaaagtg cgttgctcga agcgatgcag    269940
     gaacaccaac taacggtttg cggaaaaacc tacaagcttc cggatccgtt ctttgttttg    270000
     gccacccaaa atccagtcga aacggaaggc acgtatcctt tgccggaagc ccaactggat    270060
     cgtttcctgc tgaaaatcca tgttcgctat cccactcggg atgaagaacg tgaaatcgca    270120
     agacgtcaaa ccaccgatta ctcgttcgaa acgaaaacgg ttctggacgt cgaacagatt    270180
     tcacagatgc aatcgctcgt ccgcagcgtc gtcgtctcgg accacgtcta caacgccgca    270240
     ttggatctcg tgcgaggcac gcgtccggac gaggggagca tgtcggccga actaaagaac    270300
     atggttcagt tcggagcggg cccgcgagcc accatcgccc tgttgatggc ggcgaaagcg    270360
     agagctttgg tcaatcgtcg ttgtcacgca acggttgctg acttggtcgc tgtcgcgaag    270420
     ccggttctgc ggcaccgcgt catcctgacg ttcaacgccg aagccgccgg agtcgacgcc    270480
     gactcagtcc tggagaagaa catcgcacaa actccatcgc taaagaacaa ctcgcccgtc    270540
     gtcagctaac gacctctcgg caagccggca gaagtctttc ggcatcggaa ctgttttggc    270600
     aaaacgccac tgttcccacg tacaaccggg acgaacgctc aaacagcttg cttggttctg    270660
     cccgatcact cccgcgtacc tgtttgcgtc cccatccgtc tttcctacca acgatcgtca    270720
     ccgattcatg cttggactgt ttcgacgtca atccaaattc gacgctcacg ccccgacgaa    270780
     gaagtccggg gctggagcaa gtgatttggt tgatccggtc gtgatggacc aaatcgggca    270840
     cttggaactg ctgtcacgaa cggtggtcga cggattgttg gctggcaaac atcgttcgac    270900
     cacgaagggc gggtgttgcg agttcgctca gcaccgccag tacgcgccgg gagatgagat    270960
     ccgacaaatt gattggcagg tgtacgcccg aaatgatcgc tacttcgttc gacagttcga    271020
     ggaagaaacc aacttgcatg cgatgttggc ggtggattcg agtggctcga tgaactttgg    271080
     gctctcgacg atcagcaaac tcgattatgc acgccgcgcc gcagcgtgcc tggcgagatt    271140
     gttgctgcat cagcgtgact cggttggttt gaccgtcctc cacgaaagca attcgcgatt    271200
     cattcctgcc aagcagcacg ccgcacacct gcgaaccctg atggcggctc tgcagtccgc    271260
     tgatgcaagc ggcgagggga atctaagtca tcaagtccag cactgcgtcg caagacaacg    271320
     acgtcgcggt ttgctggtgt tgctatcgga ctgcttcggc gatctcgacg aattggccac    271380
     ggccctgcgg atcgctcgcg cacggggcca cgatgtggtg gtgatgcaca tcctcgcacc    271440
     ggaagaactg acattcaatt ttcgtcgatg gtccgccttt caatctctcg aaatcgcttc    271500
     gcagcgtctc catttggacc cgcccgcggt gcgtgatcaa tacctgcaac gcatgcgaac    271560
     attccttgcc gacttggaag aaatggtcgt cggtttaggt ggtgactacg tgcggatgac    271620
     gaccgccacg gacctggccg acacgctggg gtggttcctg cgaaatcgaa tggcacgccg    271680
     aggactcgcg acgaatcggg gggcagtggg acgatgagtt ttctcagtgt cgcgttcttg    271740
     tttgcattgc cattggtcgc cgcgccgttg ctgctgcatc tgtttgatcg ccgccgcaac    271800
     gaaacggttc agtggggtgc gatgcagttt ttgatggagg cgtctgctcg caaaaccagt    271860
     tcacgaaagc taaagcagtg gttgctgctg ttgctgcgtt gcttagccat tgccgcattg    271920
     atttttgcat tggctcgacc gctgctgccg accggatatc tcggtggaag tgagcagggc    271980
     gagacgattt tcgtgatcga caattcgatg tccatgtccc gcaaaacgga ctccggaacg    272040
     atgatcgcgt cagcaaccca acatgcggtg gaccaactcg aaaagatctc ggcccgcgat    272100
     gacattcgaa ttctgacaac cgccccgtat ccgacgtggc tccattcagg aacgacgcgc    272160
     ggggaccaac gcaatcgcga atggatcacc gaacaattgc ggagtattga tgccaccgag    272220
     ggacgcagtg atctgcttgc cgctctgttc accgcggtcc aactcgaaca tcaacccaca    272280
     caaaacacca gacgaattgt ggtgctgacc gatggccagg ccactgattg gagaaccgaa    272340
     gacgaagtcg gctggcaacg acttcaatcc gtcctcaatg aaacgtccat tcgcacggaa    272400
     atcgaaacgg ttcgtttgga cgaccagtct cagagaacga acaaaggcaa cattgcggtt    272460
     gattcgatca ctctggatcg aacggtggtt ggttctgaaa caccgatcac ggccatcgcg    272520
     actctacgaa actatgacat cgcgacggtg gatgccgccg aactgacttg gagcgtcaac    272580
     gacgttcccg ttcatcagca aacgatcgct tcgatcgaag gcgagcagtc cgctgaggcc    272640
     aattggaatc acaagtttga cgatcccggg atctatcgat tgagttgtcg tttggatcga    272700
     gacgacgatt taccagccga caacgttgcc agtttgattg tcgaagtggt cgaccgtttg    272760
     cccgttgtcg tggtcgaatc tgcaactgac tacgcagaaa tgcaacaaga ctcgttcttt    272820
     gtgcaagcgg ctcttggatg gatcgatgga caaccgctta acgacacgtc ggtctatgtt    272880
     ccgacattga tcacgcccaa cgaacttcca acggtcgatc tcagcgagca gcgggttgtc    272940
     atcatcccca atctcacgga gttgccttcc gatgctgtct cgcgattgac cgaatttgtg    273000
     tccgatggtg gtggactatg gattggattg ggaccgcgta ccaacgttga tttcttcaac    273060
     catcaactgt tcgccgacgc cagcggattg gctccgcgaa ggcttgacca aatcgtcgat    273120
     gcgtcgccgg caggaactgg caccgacgcg gagcaaccgt tggacattga ggaagattct    273180
     tcgacggatc aacccgttcg gattgatccg tttcgcagcg atcatcctgc gacgcgacat    273240
     ctggcggaca acgcgcaact ggatttgggt gacgcatcca ttcagcgtta ttaccaattc    273300
     agttccgtca atgacgacga cgatgaccgg gcgacgctct tgcgattgag caacgacgca    273360
     ccactcgccg tggaaaactt tgtggggcaa ggccgcgtga tcgtgcaatc cattccgctg    273420
     cggttgcaat ggagtgacct ggctcgaacg cagtcatttg tcgtgatggt tcgcgactgg    273480
     atcgattact tggctcagcc ccgtgcgacg caatacaatt tgcttcctgg ccaacccatc    273540
     gtggttcgag tctcgaagga cacgatgaat tcagacttag cgggcgatct caacacacca    273600
     acgggattcc tgcaaacgcc gggcgatgaa tcaatcgagc tgaccgctca gtatgccgac    273660
     gagggtttcg aatttcggtc cagccaaact cgtcgaccgg gtccatacag attgcaaatt    273720
     ggtctggacg aagccggcgt tccttttcaa gtccagcgtt catcggacga gtccaatctg    273780
     atctcactca gccgtgccgc atggcaacaa atcgccaact caacgacgcc caaggcgtgg    273840
     accgaagatc gcacgccggt cacgagtgca cacaccgatc cagtttggcc gtacttgctg    273900
     ctggcattga ttggactgat caccggcgag ttggttctct caggcatcat ggctcgcgag    273960
     cgatttgggt cggcgggaat tcctgagtca tcggaattgg atgcatcgca cctgagttcg    274020
     tttgggccga ggggattgga cctgacgcca acgtctgtgc aaccaaggtc atccgcagag    274080
     gcggaaacgt tggaggcgac caaccgatga acctcaccga aacctccgcc aacgaatacc    274140
     tctcgtacga acatccgttc aactctggac tgctgttgct gctgggtgtg ggttgcttgg    274200
     gcattctact ttggacactc tatcgagagc gaaacattct gggccgggca acgaccggac    274260
     tgttttcggt tctacgttta ggagccctct gcgttgcatt ttggatgctg ctcgctccca    274320
     ccagcgtcgt cgaacaatcg acctccactc gaaaagccat cgtgttcgtg actgactcca    274380
     gtgcgagcat gaaaacggtc gatccacccg gattgtctga cgattggcgt tgggcgatgt    274440
     caggctctga cgacgacacg caacaaccgt acgctgaacc actcaaactc accgatcggt    274500
     ctctcgcggc gatcggtttc gcaacacaac agatgacctt ggcggtcaca gaactcgatc    274560
     aacacggcgc cgaaacctcc gtcgccgagc gtctgaaatt ggcgaaccag tcgatcgttc    274620
     gggttcgaac tcacctcgag aacattcgcg gctcgctgcc cgcgtccgtt gacagcgaag    274680
     tcgactcttc gcttcgtcgt ttggtcctga tgatcgacag cccggagttt gatgcgttct    274740
     cagaactcac caaaatgctg gagcggaatc gcacgcccaa ccaagccgga tggcgtgaaa    274800
     gccttccaga cttggccgaa cgactcgtca cggctcgccg agtcctccat gaattggcag    274860
     gccaatttga acgtgccatc ggcgatcaat cacaaaacgc accttcgcaa tcgaccgctt    274920
     tcaccgaccg aactcgtggt gatcgggtcg cgaaattcct caccgggttg gaacaatcga    274980
     aattgaatgc gatctccgag gtcgccgaca ttcgctggat ctcgtttgat gacgccgcga    275040
     cggcgatgac gagcgtcgcg gacaccaacg aacgtctggc gtctctcacc gatcaagaga    275100
     attcagccaa aacgaccgat gtcggtgccg cgttgcagtt cgttgaccaa ctgcatcgcg    275160
     atcaacccat cgccgcggcg ttcgttttgt ctgacgtcgc gcacaaccac gctcatgaac    275220
     gagagcccac tgaagttgcc gcccaaatgg attcgactcc cgtctacgtc attccaatcg    275280
     gcaacgattc gcgtttgcga gacatcgacc tgatctccgt gtcggccccc gccgttgcca    275340
     tgcgaaacga cgatgttgtc atcgaagctc acctggggat ctaccaatgc aaaggcgaac    275400
     gatgctccgt ccagttgttg caatccggtg aggtcataga tttccgaaat gtcttgatcg    275460
     attccgatgc ggaaacacga tccgtgcaat tccaacagcg tgtcgcggag attggatcgg    275520
     catcctttca gatcgccatt caaccactcg atggcgaaat gacgacggac aacaattttg    275580
     acgagatcga gatcaacgtc acacgaagcg acatcaaagt cttgttggcc gatgagatgc    275640
     ctcgttggga ataccgatac ttggctcaac ttttccgacg tgatccaaag attgaactcg    275700
     acgaactgct attccgacct cgactgatcg caaccgggca tcgccaagaa gcgggcggct    275760
     ttcccgtcac ggtcgaagaa tggaaccgat acgacgtcgt catcttgggt gatcttcccg    275820
     ttgaacatct gccggttgcc tcgcagactt ctttgctgca atacatgcga acgcgaggcg    275880
     gaacggtcat caccatcgcc ggcgaccacg cgatgcctca ggcatacgtc gaccatccgc    275940
     ttgaagaagc cattccggtt cgaccgatcg accagccaga cgacgccggc cagcaatact    276000
     ccttccaggt caccgaacaa ggtcgctccc atgcggcatt gatgattgct gaaaccgaac    276060
     tggcgaccaa caacgcgtgg gcgtttgtga accagttttc gcctctgcac agcgtttcga    276120
     attggcgtgc tcccgtcccg acggctcaaa gcttgatcgc ggttgtccca cgaggtgaac    276180
     ctctcgcgat gaatgatccc gccctcaaac aatccagctt tctttgttgg caacctgttg    276240
     ggcgtggacg aatcatctac ctgtctggac cggacaccta tcgtctgaga ttccttcggg    276300
     gtgacacgct gcactatcgg ttctggggtc aattgatgcg atgggcgatc gcttcggatc    276360
     tgtcatccgg gaatcaatcg gttcgacttc gcaccgcgaa aacgctttat gaaacggacc    276420
     aatcggttga cattgatgtc gagttattgg atgccgatgg gcaaccagtg attcgcgacg    276480
     tcaccgacac ggacaccctc agtgtccgtt tgtccgttgg tgaggacgta cgcacgatcc    276540
     cgctcgtcat ggacgatgaa cgtcccggac actaccgagc cgacgtccgc gaattggccc    276600
     cgggcgtgta ccaagccaaa ccggaaggct ctttgatcga tgagctgacc gcgatgggat    276660
     ccgacgatga ccaatcgctc aacgaagaag tgatcacgac gttcacagtc caggccgacc    276720
     ttccgaccga gctggtcgac acgcgatcca atctcgtgtt ggcagaccaa attgcgaccg    276780
     tgaccggcgg gcaagttctg ccgcccaccg cggtcgaaga agttttggaa ctcactgact    276840
     tagaacctgt cgtgacgcac agcgttcaac gtcaaccgct atggcaacga tggcgatatc    276900
     tctggctggt gctggggtgt ttgcaagtcg aatggatcat ccgcaagtcc agagggctat    276960
     cctgatcatg tctaccacca tcacatctcg gccattttcg caccgaattc cttcggcaat    277020
     cgaaagcaaa ctgcggcgga tacgactgcg gcatgcaatg ctgatcatcg cgtcggcgat    277080
     ggcattttca atcggtgtgt tgctgctgtt gatgatcccg tcgatgttga tcgattggat    277140
     gtttccattt gcatcgccgt tgcttcgcat cacactgact ggcatcacga ttgttgcaac    277200
     gttgaccacc gcggcctatt ggttgattgg tccgctgcgg caatcttggc aatggctgcg    277260
     agcggccaac gcggtcgatg acaatgttcc ggagttggaa gaacgctggt ccaccgtcgc    277320
     cagtctttcc acgcaagacc gttcgacgat gtccgccacg cagcgtgcaa tggcgaacca    277380
     ggtgaccagc gaagctgtcg cgatggagcg aatggtccag ccccgtcgca tcgccccgcc    277440
     aatcaaaatc cgtccgggcc ttctgctcgc ggcgtccggc atcgtgctct tcgcgatcgt    277500
     gttcgcgatc agccccagcc gcgtttcggt tctgctgaag cggttttggt ttcccacgca    277560
     gaacatcacc gcaacgcagc tcgccagcgt aaccggagaa ccgtttgtcc cccgcggcga    277620
     ctcgatcgaa ttggtcactc gtgccagcgg tgtggttcca tcctctgcca ccatcagtgt    277680
     gatgcagccg gacggtcaga tcgaagagca tcgcctgacc gcggacgaga cctcaccgga    277740
     cacgtggtcc cacaaaatgc gggtggacga ggatgtgtcg taccgagttc gtgcgggtga    277800
     cgcacaaacg gaatggctgc gtcttcaaac gattgatttc ccagaaatcg atcagatcga    277860
     atttggcgtc gaattcccgg cctacaccaa acgtgccccg atcctgctcg accgattgcc    277920
     tcggcgggtc aaagttccgc aggacagcgt gttgcggctc gcgatcaagc cactcgattc    277980
     gctgaaaaag ctttcaatct cgctgacgga tcctgaaatc ccaacacccg acacgaccgt    278040
     gtctgacgac ggcaaaacat cgctcactga catggacatc cgagagctat cacccgaggc    278100
     agacggatgg tatcggctgc agttgccatt gatcgatgac gtgttgctgc gacctacctt    278160
     gctcagtccc cacgacctga ccaaccaacg acgtctgttc tcacgaatcg atgtcattga    278220
     agacaaagca ccggttgccc gagtgatcac gccaaatgac gaaaccgcag tggcggaaga    278280
     tgaaatcatc gagatcaagt tcgaagccca tgatgatcac ggaatcgaga aagccgaatt    278340
     ggtgatctat gacgaatcgc aacgggatgc cgacggcaac gcaaaggtgc tgcatgtcca    278400
     acccattccg ctcggcgacc aagccaacca aaagcatttg atcgcaaaaa ccaagctgga    278460
     cctgaaagaa ctggggctca ccgaaggcca agagatcagc tactccatcc gcgtgacgga    278520
     caacaaaccc gaaacagatt cattggcaac caaacccaat ggccggcaag ccgaaagtga    278580
     atcagctaag agtgaatcat cgaagagcgg ttcacccaag aacgaatcgc tggcgaaatc    278640
     ggagaataca cagaatcctg atgccactcg caaaggcgac tctcctcaat ccgccgactc    278700
     aaagaacagt gactcaaaga acagtgactc aaaactagct gactcgaatc cagctgactc    278760
     catgcaagcc gactcggaaa aagctgaagc gaagcaagct gaagcgaagc aagctgaagc    278820
     gaagcaggct gattcggaaa tggatgactc ggatccggca aaccgcaagt ctggcgaaac    278880
     ccaacccaac gaaaacaatc ctgcaggcga tgaaccttca gaagccgatc cgactgactc    278940
     aaccaacgcc gacctgaagt tggctgatac aggtccggcc gaccgagacg atgcagccaa    279000
     gaacgctggc gatcagcaat ccgatgccaa aacaaaacca gccctcatgg acaccgccaa    279060
     tcagtccatg ccaccggaat cggacaacaa ctcgcagaac agcaagacag aaccatcggg    279120
     tgctgatcgc tcctccaaac ccgccccgaa tgcgatcgcg gcggcggact ctccagcgca    279180
     agcgggtgcc acaaaaccaa aacctccagg caaacccacc aatccatcag gcgatcaacc    279240
     aaggaattcg tccgacgcca agaagtccaa cccaaagaat cctgatgcca acaaaatggc    279300
     tcagtccgat tcgtccaaat ccaaacctca acccaaagta cctgcaacca aagtcgccaa    279360
     agagtcgaaa cctcagccca aggctcctgc aaaacagatg gagtcacaaa attcgactgt    279420
     cagtcatgtg acctcgtcca accgccaacg aaagcaaaag ggccaaaatg cgacgaccgg    279480
     ccggcgtcgg ctcaaaatca ccgacaaatt atccgcgatc gcggaggccg aagaacgtcc    279540
     gggcgacgaa ctcaagatgc gagaatcggt cgtcgagatt gatcagatgc tcgccgaaat    279600
     tgagactgga ttgagaaaac tcgttgagcg aaagatcgcc gactccgatc gcagtgaaca    279660
     gtttcgtcgc ctcgacacgg gtctgggcaa cgtcgaagat ttcgtcgcca agttgagaga    279720
     acagactcgg gagagccaat atgcatttgt tggtttgcag atggtcgaca tcacgcgatc    279780
     gcacgtcacg ccagcccgcg accgagcgtt cgcgggatca caacgtgccg gttcagacaa    279840
     cgccgacgcc acgatgggac tgcagcatgt cgtccgagct cgtgaattgc tgggtgcact    279900
     gctgaaacgg tttgaccgag tcaagcgaga gaagaaactt aagaaagaga tggacgaagc    279960
     gatcaccatc tatgaggtct atttggagaa acgacgccag ttgatgcggg aagctcgaca    280020
     aaaccgcaat ccactggatc gaaagatggc gatcgtcgaa gtcgaccagg cctacttgga    280080
     tcgactggca gaagtcctcg aactacggcg ggccatgatg gacgagtttg cggccatgct    280140
     cggcgacgac ccacgattgc tctcgcgata catggaattg gtgcagcgcc gtcagaaatc    280200
     tcttcggaac gaactttcgg atctctcgca acggcaatac gacctgaccg aagaagtgat    280260
     gaattggctg caaatcgata caacccagcg tcctgacctt tggaccatca tcatcgaatt    280320
     gcgattgagt gccgccgaag atctcgccaa ggacgccgct cagctggctg agcgaattca    280380
     gaaacaactg ccattggagg tcaatgctga atcaggaacg gcagcgaatc tgattcgaac    280440
     ggccaatcaa atttccgcga ccgcgagaaa catccagttt gaagccgacg agctattcgc    280500
     aaattccaat ggcgaagcga agaaccaaga ttcgaccacc ggcgcccgtt cattgatcga    280560
     ccaatgcgaa cgattgttct cgcaattgga ccgattgcaa tttgaaaacg aaggcaatga    280620
     tgcgttggca ctctatgtcg aatctcgcat tcaagaaact cgtgtcgtcg ctgaccaaac    280680
     ggatgtgtgg gccgaccttc atcggaacat tcaaaacaat gactacggcg ggttggttca    280740
     gaccgaacaa taccgactcg cggtctccac tcaattgctg cgagtcgaga tgctggatat    280800
     ggaaccgaac ttgaccgcag aatttctacg gacggtcaac actgacttgc caggcgaaat    280860
     caaagacatg attcgcacgt tgcatcgatt gatggaaacc atcacgtaca accaaatcgc    280920
     agcgtccatc cgatccggcc atcgcaattt ggaatcgggc aacgaacaac aacaattggc    280980
     aaccgaccga ctcaccgaag cggaagaatt gttcgacaaa atccgacgta ccgtcgtgac    281040
     gcatttggac gagtacgacc ctcgcgatcc gaacattggt gatttgcgag atccaacgct    281100
     cgatgaattc ttggcgagac tcgaacgcga acccaacatt gcttctcaat tgggcattcc    281160
     aaatcgtcga acgaaccttc gggtccgggc cgatacgttg ttgtggcaag aatctgcaag    281220
     cggcgcagcg ctggcggctt ctcaagtggc cgcggaccag cgggcaaagc aggcgatgaa    281280
     gatggagaag ccgaagcgaa aaaatcgcaa acccggtgac aaatcatcgg aagaattgtc    281340
     gaaggaacaa cgcgaacagg caaagcaagc gcaagacatg ctcgccaaaa cgttgctgga    281400
     aattgaaaag caaaaagaga acggtgaccc gtcagacgcc gagcgacaac ggcttgatga    281460
     aatggcggaa aagatcaagg gactgatgaa ccaagatggc gacaacgcgt cggccgagcg    281520
     agcttggcaa caaatcgtgc aagccgacga ggccaaggaa ctgatgcaag cgatcgccaa    281580
     cggtgaattc atcgcggatc agcaatggaa ccgtctgctg tcgacactcg acgatggact    281640
     ttggcaagtt cagggcaacc gcccgccgga agcctaccgc aaagcgattg aacagtacca    281700
     agatcaactc cgcgtgttga tgtcaacgat cgattaggtc tgagcatgca aatcccaaac    281760
     acacctgccc ctgacgcgga cacaaccaca cacgaagaag gccgactgac cttgctgatc    281820
     aaacgcttga aacgatgcaa gctcatcgca acgcaaacga cacttgctgc gttgctcatg    281880
     tgcgtcgcga tgcccgctgc cgcacaagac tctccgccgg tgattgccac ctcggcaaac    281940
     ctgagttcgg cgctgccggc gagcgaatgg gctcgcgtgg aatcatccgt tgatgaagga    282000
     ttgaaatggc tggccagtca gcaagccgaa gacggccgat tcccgagtga agaagtcgcc    282060
     cagcctgccg tcacttccct ggcaatcatg gctttcctgt ctcgcgggca cttgcccgac    282120
     aaaggtccct acggcgcgca aatctctcga gcgattgact ttgtcctcag cacccaacgt    282180
     cgtcgtggtt atttttcgct gcaaccggtg ctacctccgg tcggacacct gaaaccgtct    282240
     cagacggtga tctacaacca ttccatcgct ggattgatgc tgggtgaggt ttatggaatg    282300
     ggttccgggg aacggtcgga acggatcgaa gaagccctgc accgtgcact ggtatttcat    282360
     cgcgaagttc aatcacgcac caagggaaaa gaatccgacc ggggcggttg gcgatacgga    282420
     tatcccgaga gccccgatgc ggcgtccgat atgtccgtga ccggttgggc gttgatgttt    282480
     ttacggtctg cccgcaacgc tgaattcaac gtaccgaaac agtactttga cgaaggcctg    282540
     gacttcgtcg agttgtgcta cgaacccgat ccgggtgaac atgagaaagg cgtcttccgc    282600
     tatcgacctc atgcctcgca agacaatcct caaatcactc tcgcgaacac cgcgtccgcg    282660
     acgctcacgt tgatcctggg tggacggcaa aaccacgcga gcattccggt ctcagtgcga    282720
     tggttccgaa cgagaagcta tcccagcccg tggcagaaca actactacta ccttgcgact    282780
     tactacagca gccaagcgat ggcacaggtc ggcggagaaa cctgggaaga aatgtttccg    282840
     cagatcgccg caggattgct gaaggagcag accgaaaacg gtgcgtggcc accgggcggg    282900
     tcgaacgaac aacactttgg ttcgacgtac agcagctcgc tcgccattct ggctctgacc    282960
     cccgcttacg gcttgctacc gatctatcaa cggtagcaaa ccggctcgcg tcgcggtccg    283020
     cattgactca gcaacgcttt gtcccaccat cgaacgaatc ctagaacttg ctgattgcct    283080
     tcagcactgc tttgagctgc tcattttcgg tggtgtccca tgcgacgctg gcgtccgatt    283140
     tcaatttcat caccgcatcg ttggttcgtt gctgaagatt ttctagcgtc gtgtgacgcg    283200
     ttagcacgag ctcattcgaa tccagttgaa attggaccca ctgtgcatca cgttcctgaa    283260
     cggcttcctc tgtcgtgaac ctttggtagt tcgaacgacg ctgcatcgca ggtgtctttc    283320
     gctgcacttc cgaagtcgcc aactcggcga tcatttcgtc ttctccgtcg atcaccttcg    283380
     gatcagcacg tcgactgatg tcatcgtcgc gatcgcccag gtcagcaccg gtttcggcgt    283440
     ctggctcagc agccaatgga ttgtcgaccc ggtagtctcg gtccgggtcg taatcgtccg    283500
     cgtcataaat ggagtcatcc gaataaggca gcgttgccga cagcgtctgg atctcacgtt    283560
     cactgattcg agcacccaaa tcgcgtccgg tgccgagccg gcccgcagcc gaagcaatgg    283620
     caccctccac gccgtcttcc actgcatccg ccatgttggc ctcttccgca ggagtctcat    283680
     cgacgtaatc gtcgacacgg tagttgtcga cgtctatcgg agtgcgggcg gcagtccatt    283740
     catcatcact accaggatca tccacgccgg cgggagtctc ggtatcgaat cgttctaatc    283800
     cattcgcttc cacggcaagt tcacctgtcg ggcggtcatt ggagcgatcg tcgctttctg    283860
     tcttcgtcgc cttcggtgga cgtgtccgtc gcaattcttc agcgagcttt tgcccgactt    283920
     cttttggatc gggcaatcgc tcttcggcct gacgttcgga attggcttgg gaagattccg    283980
     tcaccgggtt gccggattgt tcagcttgtt ggcttcgcag cttccatcca aatgattcaa    284040
     gcgactgctt cacttccgtt gactgccgca ccaatcgctc atacttagcg atctgttttg    284100
     gatcggtcgc acgttgagcc gattcggcgg caagcttgcg gaccaaactg gcatcgctcc    284160
     agatcactcc cgccaatccc cagtcactga ttcgattggg atcatcctgc tcgctcccta    284220
     caacttgacg ttgagcattg gcaggctcgg cagttcgtga gtcttgtgcc gacacattgg    284280
     tcgcagtggt ggtcacacca gccaatagca tggccgccaa caccgaccgt cgccaacgac    284340
     ggcgactcat tgtggatgaa gtggcttggc gttcatcatc ggaatgagct ggctggctac    284400
     cgacttgatt gtgttgcaat gaatacgagc gtgacatgga agagtcctct gtttgattgg    284460
     agcgagcatt gagaagtgac tgaagtccgg ctttcaccaa tcgacccaaa ctgccacggc    284520
     gatcgatgca acgcattttg ctctagcatt cttgcatcgt aagccaaacg gagagtggtt    284580
     tggtgaggaa gctcaaaacg agcttgcaac tcacatgcac gaagcgtgcc aggaaccggc    284640
     agttgtcgca gaagtcatcg atcgcgagat cgctcaatca gttcgtcatt tgacgagtcc    284700
     actcgcgccg accgcgaatc aaccatgctg cctgctatga acacagcccc gaattggatg    284760
     tcgttccgta tgcatgagca aagttgctga acagggcaat ttgctccacc atcagttcga    284820
     tagggcatca gttcagcttg ccactggcgg aaaatgacac acagttaaat ttcattgtcg    284880
     ggcctttctt cgcatggaag caccgcgtcg ctcatcggca cccgatttgc ggtcttcacc    284940
     atcagacgat tgagccattt cattgccaat taagagagga catcgaccgt gatcgcgttt    285000
     ccaaccaaaa cacaattgac tgaactgttg actcatgaga aaggcgactg cgtttccata    285060
     ttgatgggca cctaccaagc cggtcgtgac accaatcaga atcccatccg attcaagaat    285120
     ttggtgcaac aagcgattgg agaactgaag aagaaggaaa gcccgctgct tccacaagtg    285180
     aaggaacttg ccaagctcga gcacgattca actttctggc aaaatcagac cgcgggcttg    285240
     gcgatttaca tcagcgaagg attcgaagaa cgtgtcttgc tgagccacga tcccggcgag    285300
     acagtctcga tcgcctcgga gttcaaccta cggccaatcg ccagtgttgc atgtggtgaa    285360
     acgaatctga tgacgttggc tctctcctgg gaacgagccc gtttgttccg ctcggatggt    285420
     cattccacga tggagatcga agacgacatc ttcccactga caatggacga actcgtcacc    285480
     gcacgagacc cggagaagca gttgcagtat tcgtcacacg aaacactcgg tggcggagga    285540
     tcagaaactg tcatgtacca cgggcacgga aatggcgagg acaagatcaa ggcggatcgt    285600
     agagcctatc tttcgcgagt tggcgagtac gtcgcaaagc gtctctacaa taccgaccag    285660
     caactcgttg ccgtcgcgac cgaagaggta gcgggacatt tcgatgccgc cgctgagtcc    285720
     gtcgaattga ctcagtgcat ccacgtcagt cccgatggac tgagcgattc ccaacttcga    285780
     gctcgtatca ccgcattcgc gaaagaacac aaccaacaca acgatgatgt gatcgcagag    285840
     cggttgggtt ccgccatcgc ggacaatcag gggtccgacg attggaaaca agtcgttctc    285900
     gcggccgtcg aaggtcgagt ggacaccctt ttactcggac aggaccaacc catcgttggt    285960
     cgttgcgatc aatccaatca ccaggtttca ctcgacgacg aaggaaccga cttggtcaac    286020
     accgccgtcc gactgaccct gaaatcgggc ggcacggtcc gtcggctgca aggcaattcc    286080
     accgctcaac ccatggccgc cattttccgc tattgagtcc gcgagcgggc ggccttccat    286140
     tctgctgcag ggcgaggcgt tgagtacaac tttaaatgac cagctcccaa tggccacgtc    286200
     tgtggtatca ccgcaaaaac ggcatcccac gcgagtaaaa tagcacactc aacatgcttt    286260
     ttttcccgca aggcgtcaat cttgattgtc tatgattgac gtcttcgtgg gaccgaaggc    286320
     atcgccaacc ggtttcagcg tcggatcgcg agggcaaacc ctcgctccca aggtttgatt    286380
     tgttggacga agatgccaaa gcagaaagcg gtcgctctcc tcatcgaaac atccaatgct    286440
     tatgcgcgtg gattgctcgg cggaatcgcc tcatacatcc atgagcacga tctctggtcg    286500
     atctacttgg tcgaacaaga acgcggagcg gcacctccga gttggttgaa cgattgggat    286560
     ggcgatggat tgatcgcgcg aattgagaac gaggaaatcg caagttcggt tcgcaacttg    286620
     aagataccag tcgtcgatgt cagtgccgct cgtcgcatcc ccaatatccc ttgggttgaa    286680
     accaacgatg tcgcgatcgg cgagttggct taccaacact tccgcgaacg cgggtttgag    286740
     aattttgcat tctgcggtga gtctcggttc aattggtcga tcctgcgtcg ccaagccttc    286800
     gaggcccgag tgaaagaaga cgggttccaa tgccagtcct tcaatttcaa cgtcgatgac    286860
     cgacgcccac agtcactcaa gcgtgaacgc gatcgcttgg ccgaatgggt gctgtcgctc    286920
     caacatccga ttggagtgtt ggcgtgttac gacatcatgg cacagaagat cttggatgtt    286980
     tgccgtctgc atggcatcaa ggtccccagc gaactcgcgc tgctaggtgt cgacaatgat    287040
     gaacttctct gtgatttgtg cacgccgcca ctttccagtg tcgtcccggc cgctcatcaa    287100
     acgggccgcg aagcagcctc attgctggat gcgatgatgc ggggtgaaga agttcacgcg    287160
     gaaccccatt tgatcgaacc gctcggcgtg gcgactcgtc aatcgaccga tgtgctggcc    287220
     atcaaggatc ctgagattgc cgcggcagtt cgtttcatcc gcgatcattg ctgcgacggt    287280
     atcaacgttc aagatgtggt taaaaaagtc ccgctgtcac ggcgagtttt cgaaagccgt    287340
     ttcctggcgt tgatgggccg cacacctcac caagaaatca cccgccgccg catcgaacgt    287400
     gtgcggtatc tcttgattga aaccgacctc acgctggttc agatttctcg tcgaaccggg    287460
     tttcaaaatc atgaatacat gagcgtcgca ttccggcgag ccatgggcca tccgccggcg    287520
     acctaccgtc gcaaattccg gaagatctaa tcggctgcga aggtctcgga tattcgaaga    287580
     tcactgaagc gagcaaattg ccagcccgga tcttcaactt cactattacg cgcacgatga    287640
     aaacgcggag aggcggagga gcggtgatcg cggaggatat cagtcggccg catgactccg    287700
     cgacctccgc tcctccgttc actccgcgtt tcaaccctcg gaacctgcaa acccatccaa    287760
     gcgaccatct cgcaacagcg aggtgatcgc gagaccactt gcgaagaccg ggtcagggcg    287820
     attcaaccgt gattgccaca aagatgggcg aactgctgtc gtcgcctttg atcagctcga    287880
     tcgtctcgag cggttcctgg cgtttcggcg tcagcttcag gtaacgaacc tgttggccgc    287940
     gaacatcaaa cgcgaactcc gattccggaa catcgacacg gcggatgtag tcggcgaagt    288000
     gcacaccatt gagcaacttg tgatcttcca cttgcccatc ggcataattc agacggatcg    288060
     ttgcggtgtg tgacccttcc gacccgaagg ggaatcccca tccgctgacc gcaccgagaa    288120
     tgtgaatcgc ggacgcactc gcgttgcaaa cgatcggcac ctgctttggc atcgacggtg    288180
     gcttgctgcc ttgtggcccg tgcaacagaa tcacgttggg cacgcgtcca tcttgcggat    288240
     cgaccagggt aaacggcacg ccgttgtgct ttttgggtcc ccaatccgag aagatgattt    288300
     ggtccgggcc gttgtctccg ttgctgaaca tgcctttggt gctgaccgcc gtggcgatcc    288360
     ccgagaacga caatggagtg tacttgcccc gagcggtcag gaactcgagc aagttcgtca    288420
     tctcttcctt cttgatttgg ctttcaaaac cttccggcat caacgattgg ctggaagcat    288480
     tcaattgctc gatttcttcc cgcaagatcg tgtgccgctt ggcttgagcg tcgatcaatt    288540
     cgatcgatgt tcgcgactcg ccaccgagca tgcccgtgaa gacttggcct tcggtcgtca    288600
     acacggcaaa cgttcggaag ttgccttcca cgctttgatt gggatccaag atgtgcgtca    288660
     acagttcttc cttcggatga accgccatgc cggtcaggtc gggaccaaca tcggctcctt    288720
     cgccgctgtg acgatggcag ttagcacaat gcttcttgaa cacttgggcc cccaacgtcg    288780
     cattgccttt cgcgtgagca accggcaacc attcgtgcag caacgccaca cggttcgccg    288840
     tcggaacacc accggacgac ttcagaagct tttcagctcg ctgcttgatc gccttgtcag    288900
     ggtgattgct cagagcttga cgttgatcga gcgaaagatc cgacatacgc agttcccccg    288960
     cttcgatgct gtcgatcaat tccaacgtcg tattgggacg cgaaagcaac acgcgaatga    289020
     tggaccctcg aacagaaggg gttgatgctg ctgtctgttc gatcaaagca ccccccagtt    289080
     cttcactgcg actggatttg agtgcatcca gaatcccagc cgttgcggcg ggcgacgttt    289140
     gcggaccgat gctttccagc agatcgaaaa ccacatcgtc gtcggtcggc tgcatcgcca    289200
     ccaattgacg agccgagctg attcgatcgc ggtcgctgag cgaatcgtct tggaccaatt    289260
     cgagcaattg ctcggccaat tcagcaacct tttcggtcaa cgcatcggtt ccccacttct    289320
     cggacaactg aaccagttga ctttgttgat cgacggagac gtgatcgaac aaggcaacca    289380
     gttgtgactc tgcggcttcg ggaagctcaa cgctgtgatc ctttggccaa cctttcgcaa    289440
     gtccttccaa aacacctgag gcattgcctg tggcagtttt ggcaacggat tggatcaatc    289500
     cttgcaagga ttccgcttcg ggttgcgacc gagcgaagtg ttcgctgatc acgttgagtc    289560
     gaccacgaat ggatcgcgaa agatcgcgtt cgggcgcgga tgccaacacg gccggaagcg    289620
     ttccgccggc gtgcatcgct gtggcacttg tccatgcatc gagcaaccat cgatcgtcac    289680
     ccaggctctt catcgactgg accaatgcac tgacaaccat gtcggttgtc ggcgtcgtgg    289740
     gctctgccaa cttcagcagc gccgccaact ggacttgagc attgctgtcg ctcaggacac    289800
     ccgattcaat cagatgctga atgtcttctt cggagcttcc aagcaccttc actgctgacc    289860
     gacgaacccc ggcactggga tgctgcaacg cttcgcgtac agcggcatcg atggtcgcgt    289920
     tgccgttacc aaccatcccc aagccgtcca gcgtccaaag tgcatgaatg gcaccgggag    289980
     tcaaaccaat cgcgtcctgt tcctggtcgg cgatcaattc caacaaagac gaaacggtcg    290040
     catcgtcgat ctggcccaac tccaccaaca agcgttgagc ttgcgagcga accggcatgg    290100
     cggaatgttt caaaacagcc aacaaacctg gcacatcgtc cgagctcaaa ctcggaacgg    290160
     atactgtctt ggacgcatct ccatcggtga ccaagcgata aacgcgaccg tactttttgt    290220
     ctcgcaggtc agtttcgtaa gcattgccct tgccggtttc aaaaccgtga ggcgttgggt    290280
     tgtgttggat gatgtagttg taccaatcca gcacccacac aaacccatcc ggaccggtct    290340
     ccgccatgat cggcgccgcc cactcatcgt cgctggcgac caagttgaat gggctggtcg    290400
     atttgaatcc ggctccgtcg ggtgtcaaca caaatgtgcc gaccaagtgc cctgtgggtc    290460
     cgcaaacgaa agcggttcgg ttccaccacg cttgtgggta ctggcgagcg gtgtagatgc    290520
     catggccggc cgcggcggtg tatccaccat gctggtccac ctgacgaatg ttcggcgtga    290580
     tcggatcgaa caagtgagtg tccgagatca tgcgcaacgt ttgcggtgac caaccgcgaa    290640
     cttgttcgta gtagcggttt ggaatcggca aaaagttgct ggggtttcgg ttggcggtcg    290700
     atccgaacac caggccttct tcggtgaagc ccaatcccca tgtattgttg tcggtcgctc    290760
     gcatgaactc gactttctcg acccgcaaag tgtgatcgga gaactcgttt ccggcggttg    290820
     atccgtcgat tgcgttcgct tccccgtttg gatcggcgtc gactttgaaa cgccagaatc    290880
     cctgacggaa cccttgttgg cgttcaccgt tgatgaccgg gcgagatgcg ttgtaaccct    290940
     gcatccccca aatccaattg tccaatccgt aacggaaatt gctgacgcca ccgtgagtgt    291000
     cacccaacgc ccaaccggtg atcagggttt ggcggaagtc cgctttgtcg tcgccatcga    291060
     tgtccttcag ataaaccgtc tcttgaccgt cctgaacgag gacgccaccg cggtagcaaa    291120
     ccaacgtcgt gggaatactg agttcctcgg cgaacacagt gaacttgtca gccacgccgt    291180
     cttggtcggt gtcttcgcaa attcgaatgc ggtctcggcc tttacccttg ggttgcaatt    291240
     cgttggggta atccatcgtt tcgcagatcc acaaacgccc gcgttcgtcc caggtcatcg    291300
     cgatgggctt gccaccgatg ccaccttgcg agttgctttc ggggccgcct tcggaagccc    291360
     acaattccat gtgcaatccc ttcggattga catagcgttt gatcgattct tccggtggca    291420
     gcggatcctg catcagcgtt ttcagttcgc cttgttcgcc ccactttttg cccgcggtgt    291480
     agttcggaat tttggccccg acatccgtga acgtgaatgg cttgtcaccc tcgggcagcg    291540
     atgtcatttc gggcaccggg aacgcggccg catcggcgaa ctcgccggct tgttgtggat    291600
     ctttcttcgc cacccagcga atgccacgtt cgaccaagtt tagaaatccg ggattggtcc    291660
     acgttcggct gtcatgtccc caagcggtgt agaagacgcg ccctttgcct tggtcacgaa    291720
     cccaagtcca tggttctcgt ccgttggaat cgacgcggta ttccaagacc gttcggttcg    291780
     cttcgttgtg cagatgatga acgtaggttt catcccaact ttcgaatccg ctgtaaccct    291840
     tcatcacttc gtgattgggc ttgtcaggtg tcgttcggaa aacgcccgtt ccgtgacgct    291900
     ggaattgcgc tcccatcaaa gcaacgattt ctgaattgtt gcggaagcaa tacgttgcgc    291960
     agtgcagcgg cacaaacccg ccgccttctt cgacatactg caacaacgcg tcggcttgcg    292020
     gtttcgcgat ctcatcgatg ttggcgtaca acaccaatgc gtcatattgg ttcagcttct    292080
     ccaaactcag catcgacatg tcatcggtgt aagtcagatc gatgccgttg cgctgcatca    292140
     caggctgtag ctcatcaaac cgaggcttgg gttgatggtg cccgttgtca cccaagaaca    292200
     gcacgttgag tcgttgctgg tcagcggcgg atgcgttcac ggcatgccac gccgaggtag    292260
     acgtccaagt cgcgaggaaa gcgaacgcga taagcaaggt gttcttcata aggttgggac    292320
     gacaacaaat gccgtgatac gaagtgttcg gaaggagatc gacgccgaat cttccatgac    292380
     gaccgcgcgg aacagagcgg tcaaagcggc ggagtgagcc attgtgatgc aaacaacgac    292440
     ttgatgctaa acatagccac gcgagcaaca atgagaaatc acgcacgccg catgtgaaat    292500
     ttcacccggc cgtgcgatcg tccaatgcaa agacggccaa acgaggcgac ccatagaaga    292560
     ccgctgtcac tgggtcagca taacaccaga gcttcgcggc gaagccgcaa ccttccggag    292620
     gattggcttg ttagaacacc ggaatgggtc accaaagcaa tcctcattcg gcctcgacgg    292680
     ttttgcaaac gctttggatc agttggcgaa cagatccgcc aaggttttcg cccaagcgtc    292740
     ccaatcctcc gcggcagctt caaaatcaac tcgcatccaa cgtaccggtt cgctcggcaa    292800
     aaccgctgga gggaacttgc tctctttgct aatcggcaac tgactgcttc gccccatcgc    292860
     cagtcgatct tcaatttcag gagtcatcaa aaagtcagcg agctttccgg ccgcgactgg    292920
     atgtggagcg tccttgagga ttgccaacgt gtttgggatt cgaagcgttc cgggttgctc    292980
     cggttgttga tcgggataaa tgatctcgac tggatacccc aactcctctt cgataatcgc    293040
     gtcatcggtg tcggtcagtc cccaagccac cttgccagcc gaaacggcct gcgccacttg    293100
     tttgttgcct gacaacacca ccgcgttgct gtggatgctt tgcaataact ccaacgtctt    293160
     ctctctaccc atgatgtctc ggaggaccgc gaagtgggtc gccgtggttc cgaacaacgg    293220
     tcgagccatg gcgcagttct gggcccactt aggatccgcc aattcgttca cgcgatttgg    293280
     acgagcgtcc gcatcgggca gcatgtctgt gttgaccagc aacacgcgag cccgtgccgc    293340
     aaacccgcac caagtcccat cgctggcgac catgtcttgc ggccaagtcg aaggcacctg    293400
     ccaatcatga ggctcgagaa tgccaagctt ctgcaaacgc acggtgtgca tgatttcgtt    293460
     gttccaaaac agatcgcatc ttggtgcgtc cgcttcggcg atcaattggt tcgccaaacc    293520
     cactgtcttg gtggattcga tgtcgaactt tccgatcacg cccacttcat tctcggtcga    293580
     tcgctcaaac gccgccaaaa ttggagccgc gaagtcctcg tcgagagccg aatacacgac    293640
     gacgtccgat tcgctacgag acacacaacc ggaacaaaac gatagccaga cggcgacgaa    293700
     aacgagttgc agggcggaaa acgaagcgac gggaacgcag acagttttca atgacacgtg    293760
     aagccgagta cgctggagga atgatggaca agcgtttgca atctcaatta tggcgtgtgc    293820
     tgctcgcgat ggcgatcggt gggatcgttt cgttgacgac cgactcggtc tcggcggatg    293880
     aaaacaactt cgacgaaacc gggttgctga cgcgagaagg tcagcacctg cgactgacca    293940
     gcgacgtcaa cgatgccttg ctgctgaacg atttggttca gtccttcgac gattcggtgc    294000
     cgcagtggtt ggctttttgg ggtgtgcctg aatctcggac cgcgaattgg aagatacaag    294060
     gttacctgat gaggaacgtc gacacgtttc gcaaatcagg agcacttccc gactttgtgc    294120
     cacgatttga ccacggctac tcttccccac acacgatctg gatccgccac caagacacga    294180
     cgtactacaa ccgacacttg attttgcatg aaggcattca ttcgctcgcg ttcgaattgt    294240
     tcggtgccgg tggcccaagc tggtacatgg aaggcaccgc cgaattgctg gcactgcacc    294300
     gcgatcgcgt tcccacgcca tccaagcaac cacgatcgga attgtcactg aacacatccg    294360
     tgctggcaca atcgatggat ccattcacca tcaatcagct gccacgcaac cgtttggaca    294420
     ctccgggatg gggccgttac aaaattattg cccaacaccg agaggcgggc acattgccca    294480
     ctctcaaatc cgttctcaaa ctgccgaccg aactgaacgg agaagtcgaa gcatacacgt    294540
     ggtgctgggc cgcatcgtcg ctgttcacac aatcaccgga atccaacgct gcgtttttaa    294600
     aagcggctcg caaaggttca gatcaaagcg aagcgttcac gtctgagttc tatcgtgatg    294660
     tcgcggaaca gtggcccgtt ttgtcggcgc gttggcgatt gatgatgaac gacctcgact    294720
     atggatttga ttggtcgcgg catcgagtgg agctatccac gtccgatccc cgtgccagtg    294780
     gtgcttcgat ccaaatgaat gtgacgccag atcagtcctg gcaatcggtt ggcgtgtggt    294840
     ttcccaaagg agcccgcctg cgtttcgcgg ccgaaggacg agtccacgtc acgtctgatt    294900
     ggatcagtga acccgcgggc atcacgctgg aatacaaccg cggcaatcca cttggacaac    294960
     tgcaagtctg cgtgcttcca atcgcaacac cggccggagc aacgatccct ggtttggaca    295020
     ttcagccggt catcacgcga gctgatgtgg caagattcaa atccaacacg tcggatgatt    295080
     ccaccaatga ctcggcgccg atgacgggag cgaatgtgat ttcgctcacc gaaccttcgt    295140
     gggtcttatt aagaatcaac ctgcccgccg gtcactctcc gatcgagacg accgccaacg    295200
     cccaagaagc ctaccaagtc caaatcatcc caagtcggtg acagagcttc ttgctcatga    295260
     gccgtagccg gattcgccaa gaattcggac gatcaccatc tcgtacatct gaattctggc    295320
     gaatccagct acgatgtgca catctgaatt cttgcgaatc cagccacgat gtgtcggtag    295380
     gccatgtctc acatggcacc ccagccgatg ctttggaaca aagcgaggcg tcatcgcccc    295440
     gactcgtctc accacccaat tcgcaatttg caacgtccaa tttgcaattc ccccgtcgct    295500
     cactgagccg cgatcgtcac gctatcgagc aaccgtcgca tctccgcgac cgcttcgcgc    295560
     atcccaacca ttaccgatcg actgacgatg ctgtgtccga tgttcagctc cgccatccca    295620
     tcgatcgccg caacaggtcg gacattgacg taattcaatc cgtgcccagc gtgcaaacgc    295680
     atgccggcat cacggatcat cttgccggta tccgccaatc gacgcagttc gtgctgtacc    295740
     gcggcacctc ttgccaacgc atatggcccc gtgtgcaact ccaccgcatc gacttgcaac    295800
     ttcgccgccg cttcgatttg attgggttcc gggtccagga acagactggt cgcaattccg    295860
     gcgtccttca gcatttgaat cgcatcggcg atgcggcctg agtcgccggc gacgtccaag    295920
     ccaccttcgg ttgtcacttc ttcgcgactc tcgggaacca acagtgccca atccggttgc    295980
     acgcggcaac agatcgccaa gacatccgcg gcgcaagcca actcaaaatt cgttcgcact    296040
     tgaaccgtct gcacgaacag ctccacgtca cgatcggaga tatgtcgtcg atcttcgcga    296100
     aggtgaaacg taatgccatc cgctcccccc tgttccgcca gcgacgccgc ggtgattgga    296160
     tccggttcct gccctcgacg agcttgtcga agggtggcga cgtgatcgac gttgacgccg    296220
     agatcaatga agtgcggcat gtgcggcaga aaaaatgaag tggaggaaag ggttgtcgcc    296280
     atcaatcgga catcgaacgt tcagccgatg ggcgctagcc gaatggtgtt agccgaatgg    296340
     cacttacttc accctccctc agggagggtc ggcccgctta gggccgggga gggcgaacct    296400
     aaaacccggt gtgtagccct cccctcgctt cgctcggccc tcccaggggg agggtgaatt    296460
     ggtaaagtaa gtgccattgg gcgttagccc acggtcaccg aatacgatct agttgttcga    296520
     agacatctcg cttaagacat cgtgcaacca aataagttcg gacgcaatgt caccggccaa    296580
     gtcacttcgt ccggctgatt caggcatcac cgaccaagcg taggtttcga cttccaagtg    296640
     cccggtgaat tgaagcggtt gccgacgctt cgatgcatcc gtcagttcca tgatgctctt    296700
     cagcgtgtcc agcacatcgc ttcgtgtggt ttgcaggtgc ccaaattgtt cggcaaaaat    296760
     tggcacgtga aaatgaatca tccaacgttt gtcagccgca taacgacttg gattggcatc    296820
     caaatccgcc agcacagcgg gcaagtcttc ctccaagaca aacttccctg atgccgtcac    296880
     tcggccggtt tgatgaaggt aacgatcttc cgcgaacgat cgcaattgtg tcagggttgc    296940
     ttcgcgatcg gtgtccgcga ttcggctcca atcgaccacg atcgcactgc tgatttgaat    297000
     tttgcccaca acgatcccgg ctttggcata cgctgccaac acatcgtgct gcgattcacc    297060
     catcacagcg gaatggcaaa cgtcgtgaca aacaccgatg taacgacggt gagtcgcatc    297120
     aggcaattgt ttgtcaaacc aatcgatcac cttggccgcg gtgtccagaa tgcatcctgg    297180
     ttcgggttca atcgccaaca cgattcgttt gcccgtgcga tcttccaatc gtcgtagatc    297240
     ttcggccatg cgtcgcaggt tggttcccgc atgatgcaac tggtcatcgg tcacgctgac    297300
     tcggttaccg tcttcgtcgg tcctttgagg ccaaccgatc ggcagcgtgc tgatggtgcc    297360
     caaattcgta tcggccggca gaatctcagc caagatcttc gccaaatctc gggtgtagat    297420
     aattcgttcg tcttcccacc aagtcggtga gtacaccgcg tgcttgacca cgtcttgatg    297480
     aaaattgtcg tgcgggaatc cgttgaacgt gtaggcgagc aagcgtgctt gtttcatcgc    297540
     tgacgtcaac ggtttcagtc cgttgcgtcg caggtccgcg gtcgcttcgg cggacaacca    297600
     caaaccaatc cccaatggcg gtgcggtact gacgatggtc gcgaaattct ttcccgtttg    297660
     aacctttggc gaaccgttct cgtcggagta ctgcgaattc aagatacgac gccgaacttc    297720
     tgcggaaatg ttcagcagat tattcgtcac gccctcgaca tcagctcccg cgtgaatgtt    297780
     ggtgcaatac cccaccgtcc atcggatcga cgagtcggaa tcgttggaac gttccgctcc    297840
     tttggcgccg tccaccgctt tgtcatgtga cttttcgatg accgctgtga cgtcgggaaa    297900
     accggtgggc gttgatgtca tgcttggtga gtgtccagtt tgcgtcgaga ttttgcgtca    297960
     gactgtgcgg ttcgctggcg ggaagggtca tccaactcca atgacgaact gtcctgcaaa    298020
     ggttaagctg cgtgacaaga tttgtcgccc caggtcaacg cggcgagcgg gtcttttcac    298080
     ccttcctttt gctaccattt tgtcacgcca accgaatgcc acacatcacg gccgaaatca    298140
     tttccatcgg cgacgaaatg atcaccggag cccgattgga tacgaacacc cagtggctca    298200
     gtcagcgatt gggcgaattg ggtgttgacg ttcaatttca caccaccgtc gctgacaccc    298260
     tgtcgcacaa caccgacgtt tttcgtattg ccgcacgacg agcggacgtg gtcgtcgcaa    298320
     cgggtggact ggggcccaca cgagatgacc tgactcgtga agccatcgcc gaatcactcg    298380
     gcctgccgct gcaattgcac gaaccttcgc tagagttcat tcgcggcatg ttcaagcgtc    298440
     gcggtcgcga aatgcctgaa cgcaatcatt gccaagccat gttcccgctt ggatccaccc    298500
     ccattcacaa tccgcaaggg accgcgcccg gcatcgacgt gcgagcgact cgagaagacg    298560
     gaacacaatc tcgcatcttc gccctgcctg gtgtcccggc ggaaatgaaa acgatgttcg    298620
     acgaatcggt ggctcccgcc gttctggcgg ccaacgggca acgtcagcac atcgcccacc    298680
     acatcatgaa attttttggc atcggcgaaa gtgacatgga agccaaactt ggcgacatga    298740
     tcgctcgaga ccgtcagccg cgagtcggca tcaccgtcag tgccgcgacc atttcgctgc    298800
     ggatcgtcgc cacgggggac acaccggacg cttgccaagc cgcgattgcc aacacccgcg    298860
     aagagattct cgaaaaagcg ggcgaatact attttggcga cggagaaacg ttcgaacaac    298920
     atcacgccgt catccgacat ctcaacgaag tggggcaacg cttgttgctg gtcgaactcg    298980
     gccgcgccgc accgctgggt gactggttcg ccgcggtttc tgatgagcct gggttcaccg    299040
     cggatgttcc agcattcgtt ggaggaattt ccctcgccaa cctcgacgat ctgcgacaat    299100
     ggaccgggat gcccgacgac gcttccgcgg agacatgctt gaccgctctt cgccaacggt    299160
     tgtcggccga ctgggtgttg ctcgtcgacg aataccccag cctgcatcaa accaacgatc    299220
     atccgctgcc gggaagcgat gtcacgttcc tcgttgcagc ccccgatggc tcgttcccgt    299280
     ccatcactca acacctcgga gctcacccga gcatcttgca cgctcgcgtc gcaaaagcgg    299340
     gtttgttctg gttacgaaag tgttttgtca ccgcctcatc aggagtttga aaccatgatt    299400
     cgatcgatcg ttttggcgtt cgcttgtact gccatgtttg ccagcaacgt tggtgtggcg    299460
     accgcgcaag ctcccacgga atcgactgag aacgcagctc gcgagctgcg tttggccaag    299520
     tacctcagcg gcgcgacgtt cacaggtcac ttcaccgttg atggcaaaga agatcgagcg    299580
     ttgaaacccg agtcgtacac catcaagtcg tgcgagaaac tccccgaagc cgatatgtac    299640
     tcgatgaagg tcgcaatcaa atacggcgac accgatggcg agttcccgat gcaactgaaa    299700
     attctttggt ccgatcgcac gccggtcatc acgatggatt cggtttggat tcccggtctg    299760
     ggaacattct cttcgcgagt cctcattcac gacggacgtt acgccggcac ttggcaacac    299820
     gatgcaaaag gcggccatct gttcggcaaa atcacgccag cgaaagagta atagtcaccg    299880
     tctgacactt gtccaaacga gaaagatcca acagaaatcc ggagcagcca agcgtttcat    299940
     aagccagtct tcaagagcca tcacgccacc accgggctcg ccgacgtgta tattccatag    300000
     cggcaaatgc acaatcggct gaccagacga tcttcctcca tgatggaatg tcaggcttat    300060
     gacgctcaat cgacaaggcc gatctttctt tcgagtccgt ctttctgtct ttttcttcac    300120
     aatcatcttg ggttgtgaag cgaaagccgt tgacttcatc aaagacattg aaccgatctt    300180
     tcaggctcat tgcatcgatt gccatggacc ggatgaacag gaaagccagt ttcgcctcga    300240
     ccgcctggcc gctctaattt ccggtggcaa ctccggcgaa cccgccgttg tgccgggaaa    300300
     acccggcgag agttttctac tgaaactcat tctgcacgaa gaatccggta tggaaatgcc    300360
     gcccgatgat tcgctctcag attctgaaat cgcgtcgatc aaagcgtgga tcgccggcgg    300420
     tgccaagact cccgaaagct acggacctga gaagacggac atcgagctat cacactggtc    300480
     gtttcagccg gtgaaacgtt cgcaaggaag taccatcgat cgtttcattc gagacaaact    300540
     ggtggccaac ggtttgacct tgtcaccgac cgcggaacga agggttttgg ttcggcgatt    300600
     gtatcttgtc atgctcggta tcccgccaac accggagcaa gtcgaagcgt ttgcgaccga    300660
     tgaaagtgac gacgcctggc agaaccttgt cgagcgtgtg ctcgccagtc cgcattgcgg    300720
     cgagcgatgg gcgacgtact ggttggacct ggtgcggttt ggtgagactc acggctatga    300780
     aatgaaccgt gaacgtccga cagcctggca gtatcgcgat tgggtcatcg agtcgctcaa    300840
     tgacgacaag ccctatgacg agtttgtcag gcagcagatc gctggcgatg cactgggagc    300900
     gaatgttgca accgggttct tggttgctgg tccggtcgat caagtcaaag ggtccgatcc    300960
     gaagctgcga cagattcagc ggatgaacga gttggacgac atgatcaaca ccaccggcac    301020
     cgcgttcttg ggcctgacga ctggatgcgc acgatgccac aaccacaagt tcgatccgat    301080
     cagccaacgt gattactact ccatgcaagc cgtgttcgct ggcgtccagc atggcgatcg    301140
     cgcactgcca cccacgccgg aaaccgcgaa acggatcgca tcgcttgatg aggagatctc    301200
     agaactaacc aaccgattga agaagttcat catcggtgat gagtcgaagc cccgtccggc    301260
     agtcaacgca aagcgaaacg aagaggtctt cgaagaacga gacgctcggt tcattcgctt    301320
     caccattcgg aaaaccaccg gcggggaagg gtgcttggat gaactggaaa tctattccaa    301380
     cggactcaat gtcgctttgg cgagcagtgg atccaaggcg atatcgtctg gcgacttcgt    301440
     gcatccaaaa cacaaattga tgcacatcaa tgacggacgt cacggcaatg accacagctg    301500
     gattgtcgat tcatccagtg gcgactgggt acaaattgaa ctcgccgaac caaccgtcat    301560
     cgaccgcatc gtgtggagtc gcgatcgcag cggaaagtac accgaccgat tgccgatcga    301620
     atatcgcatc gactccgcca tggaagccga caactgggaa ttgctaactt catcggctga    301680
     tcgacaaacg ttcaccggca aagaatcagc gagtccaaag tatcagttcg aaaagtttcc    301740
     ctctgcagaa gcacagcaag gacgagtttg gcaaaaccgt ttgcaggcgg ctctcgaaga    301800
     aaagcgacaa ctcgagaagt caacgctcgt ttatgcgggg accttcgtac agcccgggcc    301860
     aactcatcgt ctttatcgcg gcgagccgga cgcgaagcgt gagcaagttg ctcccaacgc    301920
     gatcgaagtc ttcacgtcat tgaatttggc aaccaatgca cccgagcggg accgtcgtct    301980
     cgcattggca aactggatcg ccagcaagga caacccgctg accgctcgcg tgatcgtcaa    302040
     ccgcttgtgg caattccact ttggcacggg aatcgtcgat acgcccagtg actttggact    302100
     caacggatct tcgcccagtc acccggagct actcgattgg ctggccagcg aactgatgga    302160
     ccacaattgg tctctcaaac atatccatcg gctcattctg aattcagaca catggcgaca    302220
     aagcaatcgg cccaacgaag atgccatccg agtcgatgcg acttcgcgat tgctatggcg    302280
     tttccctccg cgacgattgg aggcggaagc cattcgcgat tccattcttg ccgtcaccga    302340
     tgcccttgat cttgaggccg ccggtgggcc aggcttcagc ccgtttgaag tggaactgga    302400
     gaacgtgcgg cactatcacg caaagcaggc gtttggccca gcagattggc gacggatgat    302460
     ctacatgacc aaggttcgtc aagaacgcga gcaggtgttc ggtgcttttg attgtcccga    302520
     cgcaagcatg gtcgtggcga aacgcagtcg ctccaccacg ccactgcaag cgttgaatct    302580
     tctgaacagt cgatttgtca tgcaacaagc cgacctattc gcgaaacgtt tggaaaatga    302640
     atcagacaca ctgtcacatc aaatcacgcg agcttggcgg ttgtgttttc aacgaaagcc    302700
     aaccgatgaa gaactagctg atagcgtcag tttcatcgag caagaaggcg ttcaacagtt    302760
     cacccgtgcg atgctgaatg caaacgagtt tgtgttcatt ccgtaattgg gggcgaggcg    302820
     aagagagtaa atcatgactc cattcctaaa ccgcagacac tttctcactc aagcgacgtc    302880
     tgggctgggc agcatcgctc tggcgagttt gcttgatcag caacgattgc tcgctgattc    302940
     aacaccaatt cgcccgaaca tcgatccggc gaaaccgttt gccagccgac ctccgcacca    303000
     tcctgccgct gcgaagaacg tgctggtgat cttttgcgct ggcgcttgca gtcaactcga    303060
     tacctttgac tacaaaccgg agctgatcaa acgccacggt cagccgatgc cgggtgcgga    303120
     gtccttggtc acgtttcaag gcgaacaagg gatgctgacc aagagtccgt gggcgttcaa    303180
     accacgtggc cagtcgggca agatgatctc ggagctggtg cctcaactcg gggaactggc    303240
     cgacgacatg tgcttcctcc attcgttgac ggggaaaacc aacacgcacg ggcccggcga    303300
     aaacttcatg tcgactggtc aaacgctcga cggtttcccc agcatgggag cgtgggcgac    303360
     atgggccctc ggaaccgaaa ataaaaacct acccgcctac gtcgcgatcg ccgatccccg    303420
     tggcactccg cagtcaagcg tcaacaactg gggacctgga tttctgccgg ccgcctttca    303480
     aggcaccgaa ttcagtgccc tcaaaccgct ggataaccta gacatcccgg cgggtgtcag    303540
     tcccgaaacc gatcgagcaa ctcgtggttt tctagaacgg atgaaccaac ggcatctcaa    303600
     acagtttccg ggtgacaccg aattggcagc caggatttcc agctatcaac tcgcggcgag    303660
     aatgcagttg agtgttcccg aagtcaccga cttatcgagc gaatcgaaga gcaccctgag    303720
     ggaatacgga gccgacgatt cgcagaacat tctgaaggca caattcgcga agaactgcat    303780
     cctcgcgcgg cggctgattg agagcggtgt ccgctttgtg cagctgttca acggcgccta    303840
     tcaaaccggc ggtgaaggtg tgagcaattg ggacggacat aaatcgcttc acgaacaata    303900
     cagcaagcac ggtccggtgc tcgatcaacc ctgcgccgct ctgctgagag acatgaagcg    303960
     gcgtgggctg ttgaaagaca ctttggtcgt atggatgacc gagttcggac gcatgccaac    304020
     gttccaaaaa ggagcaagcg gacgtgacca caatccggaa ggcttcaccg catggatgat    304080
     gggagccggc gtcaaagccc ccttcacata cggagcaacc gacgaattcg gttacaaagc    304140
     cgttgagaat gtcagcaccg tttacgactt ccacgccaca attttgcatc tgttgggttt    304200
     gaaccacgag cggctcacct actatcacaa cggctttgaa cgtcgcctga cagatgtcca    304260
     tggccacgtc ctcaaagaag tcctaaattg aggttcgcga tcggtcttag aagtcgcttg    304320
     tccaagcctc acttccgcgt gtacaccaga accgcgtaag caccgaacga cacttcggct    304380
     ctcgctgcca aaccgtcgta cggttgttcc gttgcatcaa catgttcgac cggatgatcg    304440
     tcgaagtctt gatcgtagcc ggaccaatcg gtgttgagct tcaattgcca atcgcccgaa    304500
     tcgggaaaac cgatttcgta ttggtcccat gaacgattgg cgaagttggc cagcacaacg    304560
     acgtcgtcct gcggatcctc cgcacgccgc acgaacgcga cgaccttgtc attttcattg    304620
     acgtgatgca tcacgatgtg ctgccccgtc aatcccttgg acaaaccgtc attgttcaaa    304680
     cgcaggtgaa tgaggtcgcg gaacagacgc ttgatgcctt tgagtcggcg agttcgttcc    304740
     cactcgagcg gatcagtgtc ttcaaaccaa tcgtcttcca acatctcttg gccttgaaac    304800
     agcatcggaa ctcccggtgc tgtcagtgcc agagccgctg ccaggatcgt ccgttttttc    304860
     gcaaaccgac tttcaggatc ctccgcatca atctcgctgg gaacgcgaga cttgccgttg    304920
     gcaacttcat catgtgattc gctgtagatc actcgctgga aagcgtctcc gttgtatcgg    304980
     tgacacaacg cgtctcgcac cgcccacatg tctcgatgcg catcatcaat ttcttgcacc    305040
     gccgatcgga tcggatggac aaacgccgcg tcccactggg ttgtaaaacc ggcaccgcct    305100
     tgatcttccg tcttggtcaa ccagttgttg gtttgcaggt cttccgcgat caagtagcag    305160
     cccgggaact cgttccgcaa atcacgattg atccactgca tcaatcccca accttccgcg    305220
     atgtcgtcgt ccccgatacc ggagatcgtg cgaatgtagg cggtcatgtc ataacgcaag    305280
     ccatcggcat ggtattcccg catccacatc atcgcgttgt cgtggatgaa ctgacgcact    305340
     tcaccgcgac catagtcggg tcgcgtgtcg ccccaaggcg tgttggaccg gtggtcttga    305400
     tagaagtaga tgccaccctt gtcgttctcg ctccaaccat cgaactgcca caaatccaaa    305460
     tcgctgggac caaagtggtt gtaaaccacg tcgatgatca ccgcaaagcc agcttcatgt    305520
     gccgcgtcga cgaacgcttt caacgcgtcc ggcccgccat aggcttgttc gactgcaaag    305580
     atgtgcgccg ggttgtagcc ccacgataaa tccccggcga actcggcgac cggcatgatt    305640
     tgaatcgcat tgacaccgag ctctttcagg tgcttgaact tcgcaaccgc atcggagaac    305700
     gttcccggtt gatcgggatc gtctcgatga aacgttccga tgtgcatctc gtagatcacc    305760
     aactcgttct gagccggtcg atcaaaggtc gggtgcttcc agtcaaatgt gtctgcgtag    305820
     acgactgcat tgccgatcga attggtaacc tcgcgggcgt acgggtcgat gcgatcatag    305880
     gacttgtcgc ctcggatgat tcgatacttg tattcgtcac ccgctttggc atcggcaacg    305940
     tcgacatacc acgtgccgtg ctcttctcgc ttcagcggcg tggcgtcttc tttccattgg    306000
     ttgaacgtgc ccagcacact cacgctgtct gcgttgggtg cccagactcg gaacgcaact    306060
     ccgtcgtcat gaacgatggc ccccattcct gacttggtga ctgacgactg ttcagtcgca    306120
     ttctcttcca ttccatccaa taacgcagtc tgttccatct cacgcccttc aatgacgatc    306180
     aaacgctgag caactgtccg gcgcagcgaa tcaaccatcg caaaactcaa ccggagccaa    306240
     atttctcaag ccggaccgaa gaaggcaatt ctcgtgccac ggcgttggaa gctgttcact    306300
     tccctgaaat gaggcggatc gcattggtca ttttcgatgc gggtatggca cgtgcaatgc    306360
     ttcgagacat cgggagtgac cgttcgttgt cactttgcaa acaaaactga ttccaaatcg    306420
     gccatcgaga tagcctccgc tggccgacaa accactcaca ccagagatgt cttatgcgtg    306480
     ccctcatctt cgtcgtcgcg atcgttctgc tgatggcagt tgttggttgg ttgcgattca    306540
     catcggacga tggggatcca tctgttcgag tcgacacgga caaaatgaag caagacacgt    306600
     cgtccctcgt cgagacaacc aaagaagccg ctgacggcgc cgccaatgcg atcgaccgtg    306660
     cggcaggaaa catcgacgcc agcattgatc gcgaaccggt ggagaccaac ccgtagtcgg    306720
     agcttcctaa tcagcctgct ccgaagggag cgaaccgccg gacgatctcg cgttccgaca    306780
     cgcgtttcga ctaacggcct gttgatttaa tgagccgcac cgcgttggcg gcggttaaac    306840
     agatgccaac cggggctaac gcccatcggc taattgttgt cactcggtat acgactaaat    306900
     caacaggctg ctaagctctt cgctttgtcc cactgacacc ggaaagcatg gcaagtcccg    306960
     tcgccgatga gctccgccca agcagtctcc aaccagattg atcgcatcta ccgaaccgag    307020
     tcgcgaaaag ttttcgcgac gctggttcgg gtcttgggtg attttgatgt ggccgaagaa    307080
     gccatgcacg atgcctttgc cgctgccatg gagaattggg cccgcgatgg gatcccggac    307140
     aatccaaccg cctggttgat ctcgaccggc cgtttcaaag cggtcgatcg gattcgccga    307200
     cggcgacgtt tcgatgactt gcaacctgaa ctggtgcagc gaatcgacca aattgagctt    307260
     gccaataatt cgctcgccga gcaagacatc caggacgatc gactgagact gatcttcacg    307320
     tgttgccacc ctgcgatcga ccagaaagtt caagtcccgc tgacactgcg agaagtctgc    307380
     gggatgacaa cggacgaaat cgcccgagca ttcctggtgg ccccgtccac tttggctcaa    307440
     cggatcgtcc gaggcaaagc caaaattcgc gatgcgggca ttccattttc gatcccgagt    307500
     ctgtccgaat tgccctcgcg tttagacgcc gtgctttcgg tcatctacct cgttttcaac    307560
     gaagggtatt cggcaacgag cggcgacact cttttgcgaa ccgacctgtc agcggaagcc    307620
     attcgattgg ctcggctgct gttggaactc ctgcccgatc ccgaagtcgc gggactgctt    307680
     gcattgatgt tgctacacga gtcacgtcgc accgcacgag tcaacgaaga cggcgacatc    307740
     gttttgctcg aagatcagga tcgttcgttg tgggatcagg aattgatcga ggaaggcagc    307800
     cagttgctgc agcgttcgct tcgtactcgg cggattggga cctacaccat tcaggcagcg    307860
     atctctgccg tgcacgccga agccgaacga gccagtgcaa ccgactggtc gcagatcgtt    307920
     gctttgtacg atgtgctgtt gcggatccaa ccgtccccgg tggtggaact caatcgtgca    307980
     gtcgctatcg ccatgcgaga cacgccggcg gagggcctga agcatattga agcgatcctc    308040
     gattcaggcc atcttcgtga ccactacttg gcccactccg cacgaggcga attgctgcga    308100
     cggatgggcg aggatgacga ggcaatcaga gcgtttgaac aagcactctc gttggcgatg    308160
     aacgctccgg aacaaagatt cctgcaccag aaactgaccg cattgaaaga caatgccggt    308220
     cattgatcgc gcatgcagaa gcttacgatt gcattggccg tttgggagat cgccacggtt    308280
     ccctcgcaca attcaaaaag gttcgtctcg gtgggggacc accgagctac aggttcagac    308340
     actcaacaac ctgtagcacg gcggtcaccg ccgtgaaatc ctgacttcgg gttccaagca    308400
     aaaatgccag agccaacgac gacatcagcc gtcggccatc agccccggtc cccgagcaca    308460
     acttacatcg ttgcgctagc ccccctccca ccccgctttg cttgctttcg catcaatcgc    308520
     accgagtcaa cgcggctcaa atcaactcgc gcggtgcact accggcagcg gaaacaaggg    308580
     acgaatctcg gccgtgcccc gtcttgctcc ggggatcttc gccgcgaccg agatcgcttg    308640
     atcaaggtcc gcgacgtgaa tcaagaagta accgccgagt tgttccttgg tttctggaaa    308700
     cgggccgtca acgatttctt ggttgccacc acgcacccgc acacaggttg cggtcgtcgg    308760
     cgactgcagc ggtgacgccg cgcgatagct gccttgctcg tgcaattcgt ggcacaagcg    308820
     aattgactct tccaacgcgg cggcgtgttc ttccggtggc caggctcctt cggcagcata    308880
     aagcaggacg atgtagtctt tgccggcatt ggtctccttc gttcgcagcg aactcagatc    308940
     ctcgctcaac gatggcatcg ggatcggcac tggcagcaag ggacgaatct cgacggttcc    309000
     tttcttcgct ggtggcagac gacttgcgat ggcgaccgct tcgtcgcgcg tgggcacgtc    309060
     gatgatgtag tatccgccca actgctcggt ggtctcggca aacggaccgt cagtcacttc    309120
     ggacttgccg tctcgaacgc gaacgctggt tgcggtggcg accgaatgaa gcggcgaaga    309180
     gtcgagccat ttgccgtcca ccgccaactc ttcacagatc gccatcgaat ccagcatgca    309240
     gcgttctcgc tcctcctccg tccagccttc ctccgcccca taaatcatca acatgtattt    309300
     catgtcattc tcacgtcgct tgaatgtgtg tgcgtaaaga gcctgactgg ctgtgatttc    309360
     aacgcgattc ggtggtccaa ccatcagtca cccgctagca acgagtgtgt ttcccactca    309420
     tgaattcgat ccactgaccg ttttcgtctt gcagttcact ggtcatcatc cacgtgtccg    309480
     catccatgat gtggatcgtg tctcgatagt ttgctttccc agacccgtca aatgcagggc    309540
     cacgtgaact cagcagcaat ttcttgccgg actcatccaa gcatccttcg tagggccata    309600
     tgttcgacat catggatccg acgaaagttc cgacgtagcg accctccgcc gtatcaaacc    309660
     ccagcgtcat gattgaagac cacggttcgc cttcggccga ttcaccgccg ctctcgcaga    309720
     tcacccacat gcctcccaac gatcggcagg acatttttcc gtgggtggtc gaattggacc    309780
     catcgggcat tttgcagtcg tggtcgaatt tccattcgcc gagaatttgc tcgagccatt    309840
     ggtgctcgga ttgtggtttg gcaaacataa acagactcta tcctgaaaga agtcggggca    309900
     agcaaaggag tagatcagac aatcgcaacg cgagtttggt gcgtcacgat cacccgttca    309960
     tggatttttg aacgcaggca tgaatcttca aacgcaagac tctgcgccat aggacggctc    310020
     atccaacata gcgggatctt tgatcttcca cgcttcgttg gtcatcggat tgaaaggcag    310080
     cgagacgtgt tcgtgcaaca ccttccactg cccttctttc ttgcgaaagc aaatcgtcac    310140
     cctcatccaa gattggccag cggggtgatc cgccacctcg gtttgaaatt gatgcagtcc    310200
     gtgcacgaaa gcgacatcat cgccgacctc gaatgtcagg tcgtgatgaa ccgatttgaa    310260
     ttcaggaaag tgtggcaagc aaccttccca aagcttgcga atattctgtg gaccaacggt    310320
     cttgtacggt ggaatgccgc cgtacagcac agagtcctcg gtgtagtttg caaccaaacc    310380
     gtcgtagtcg cgagcctcca aagccgtgga ccattgatga atcaaccggc gtagttcggc    310440
     ttctccgtcg cactgcaatt tctgttgaat ggtggcctct tgttctcgca attccggcgt    310500
     catctcgtca ccgaaatctt ccagctcaaa aatcgggcga atctcgatgt ccgagtcttc    310560
     catcatcgga ttggggcagc gacgcaccca atcgatcgct tcgctcatcg aacgaacttc    310620
     ccagatccaa tagccagcaa tcaattcttt tgtttcagcg aacggtccgt cagtcaccgt    310680
     ccgttccgtt ccatgaaagt gaacgcgaac cccttggctg gttggcttca aaccttcacc    310740
     ggctttcatg atcccggcct cgaccaactt ctcgttgaag ttccccatgt cggtcagcag    310800
     tttttcgtcg ggcattttac ccgcttctga actttctgac gccttcacca tcaccatgac    310860
     acgcatcgct gttcctctct ctggaagttt gcttcactcg aaaaatgttc acgcagaacc    310920
     gggcgaaagt ccaaacagct cacaccattt cacccaacaa tcctgccgat ttgttagtta    310980
     gtcgatcgcg ttcgtcaacg atcgacatca gccgcaaaaa gaaagcaaac tttttctaca    311040
     aatcgagttc                                                           311050
//

If you have problems or comments...

PBIL Back to PBIL home page