(data stored in ACNUC7421 zone)

EMBL: BX571857

ID   BX571857; SV 1; circular; genomic DNA; STD; PRO; 2799802 BP.
XX
AC   BX571857;
XX
PR   Project:PRJNA266;
XX
DT   23-JUN-2004 (Rel. 80, Created)
DT   29-JAN-2016 (Rel. 127, Last updated, Version 8)
XX
DE   Staphylococcus aureus strain MSSA476, complete genome
XX
KW   complete genome.
XX
OS   Staphylococcus aureus subsp. aureus MSSA476
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Staphylococcaceae;
OC   Staphylococcus.
XX
RN   [1]
RP   1-2799802
RX   DOI; 10.1073/pnas.0402521101.
RX   PUBMED; 15213324.
RA   Holden M.T.G., Feil E.J., Lindsay J.A., Peacock S.J., Day N.P.J.,
RA   Enright M.C., Foster T.J., Moore C.E., Hurst L., Atkin R., Barron A.,
RA   Bason N., Bentley S.D., Chillingworth C., Chillingworth T., Churcher C.,
RA   Clark L., Corton C., Cronin A., Doggett J., Dowd L., Feltwell T., Hance Z.,
RA   Harris B., Hauser H., Holroyd S., Jagels K., James K.D., Lennard N.,
RA   Line A., Mayes R., Moule S., Mungall K., Ormond D., Quail M.A.,
RA   Rabbinowitsch E., Rutherford K., Sanders M., Sharp S., Simmonds M.,
RA   Stevens K., Whitehead S., Barrell B.G., Spratt B.G., Parkhill J.;
RT   "Complete genomes of two clinical Staphylococcus aureus strains: evidence
RT   for the rapid evolution of virulence and drug resistance";
RL   Proc. Natl. Acad. Sci. U.S.A. 101(26):9786-9791(2004).
XX
RN   [2]
RP   1-2799802
RA   Holden M.T.G.;
RT   ;
RL   Submitted (23-JUN-2004) to the INSDC.
RL   Submitted on behalf of the Pathogen Sequencing Unit, Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA, E-mail:
RL   mh3@sanger.ac.uk
XX
DR   MD5; 807b54002097b9c6e16c4b4c4a11387b.
DR   BioSample; SAMEA1705922.
DR   EuropePMC; PMC1976330; 17941709.
DR   EuropePMC; PMC2223734; 17951380.
DR   EuropePMC; PMC2238098; 18032620.
DR   EuropePMC; PMC2289816; 18307761.
DR   EuropePMC; PMC2544590; 18772392.
DR   EuropePMC; PMC2812470; 19948800.
DR   EuropePMC; PMC2884548; 20433696.
DR   EuropePMC; PMC2891721; 20487538.
DR   EuropePMC; PMC2900268; 20546576.
DR   EuropePMC; PMC2905362; 20550675.
DR   EuropePMC; PMC2905442; 20661294.
DR   EuropePMC; PMC2953136; 20668131.
DR   EuropePMC; PMC2984443; 21103340.
DR   EuropePMC; PMC3071808; 21494333.
DR   EuropePMC; PMC3088213; 21343446.
DR   EuropePMC; PMC3094309; 21489287.
DR   EuropePMC; PMC3101438; 21422209.
DR   EuropePMC; PMC3406130; 22685157.
DR   EuropePMC; PMC3416385; 22544256.
DR   EuropePMC; PMC3464608; 22823982.
DR   EuropePMC; PMC3486570; 22948864.
DR   EuropePMC; PMC3553917; 23175260.
DR   EuropePMC; PMC3804489; 24205205.
DR   EuropePMC; PMC3828307; 24233583.
DR   EuropePMC; PMC3878137; 24359724.
DR   EuropePMC; PMC3993491; 24501024.
DR   EuropePMC; PMC4036114; 24853639.
DR   EuropePMC; PMC4198549; 24481289.
DR   EuropePMC; PMC4415905; 25769787.
DR   EuropePMC; PMC4417551; 25969751.
DR   EuropePMC; PMC4736648; 26830934.
DR   EuropePMC; PMC4808225; 26856837.
DR   EuropePMC; PMC4904715; 18667559.
DR   EuropePMC; PMC4959656; 27150362.
DR   EuropePMC; PMC5029946; 27648947.
DR   EuropePMC; PMC5116080; 27845328.
DR   EuropePMC; PMC5148004; 27936152.
DR   EuropePMC; PMC5218399; 28060920.
DR   EuropePMC; PMC5736351; 29256859.
DR   EuropePMC; PMC5890767; 29253168.
DR   EuropePMC; PMC5902956; 29661152.
DR   EuropePMC; PMC6066798; 30087657.
DR   EuropePMC; PMC6331205; 30641545.
DR   EuropePMC; PMC6494861; 31043631.
DR   GOA; P0C7Y9.
DR   GOA; P0C801.
DR   GOA; P0C813.
DR   GOA; P0C826.
DR   InterPro; IPR031429; Psm4.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00503; RNAIII.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01492; rli28.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01775; RsaOG.
DR   RFAM; RF01797; fstAT.
DR   RFAM; RF01816; RsaA.
DR   RFAM; RF01817; RsaB.
DR   RFAM; RF01818; RsaC.
DR   RFAM; RF01819; RsaD.
DR   RFAM; RF01820; RsaE.
DR   RFAM; RF01821; RsaH.
DR   RFAM; RF01822; RsaJ.
DR   RFAM; RF01828; SprD.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01858; RsaF.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; BX571857.
DR   SILVA-SSU; BX571857.
DR   StrainInfo; 844898; 0.
DR   UniProtKB/Swiss-Prot; P0C7Y9; PSMA1_STAAS.
DR   UniProtKB/Swiss-Prot; P0C801; PSMA2_STAAS.
DR   UniProtKB/Swiss-Prot; P0C813; PSMA3_STAAS.
DR   UniProtKB/Swiss-Prot; P0C826; PSMA4_STAAS.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2799802
FT                   /organism="Staphylococcus aureus subsp. aureus MSSA476"
FT                   /sub_species="aureus"
FT                   /strain="MSSA476"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:282459"
FT   CDS_pept        517..1878
FT                   /transl_table=11
FT                   /locus_tag="SAS0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0001"
FT                   /db_xref="GOA:Q6GD89"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GD89"
FT                   /protein_id="CAG41773.1"
FT                   /translation="MSEKEIWEKVLEIAQEKLSAVSYSTFLKDTELYTIKDGEAIVLSS
FT                   IPFNANWLNQQYAEIIQAILFDVVGYEVKPHFITTEELANYSNNETATPKETTKPSTET
FT                   TEDNHVLGREQFNAHNTFDTFVIGPGNRFPHAASLAVAEAPAKAYNPLFIYGGVGLGKT
FT                   HLMHAIGHHVLDNNPDAKVIYTSSEKFTNEFIKSIRDNEGEAFRERYRNIDVLLIDDIQ
FT                   FIQNKVQTQEEFFYTFNELHQNNKQIVISSDRPPKEIAQLEDRLRSRFEWGLIVDITPP
FT                   DYETRMAILQKKIEEEKLDIPPEALNYIANQIQSNIRELEGALTRLLAYSQLLGKPITT
FT                   ELTAEALKDIIQAPKSKKITIQDIQKIVGQYYNVRIEDFSAKKRTKSIAYPRQIAMYLS
FT                   RELTDFSLPKIGEEFGGRDHTTVIHAHEKISKDLKEDPIFKQEVENLEKEIRNV"
FT   misc_feature    862..1803
FT                   /note="Pfam match to entry PF00308 bac_dnaA, Bacterial dnaA
FT                   protein, score 681.8, E-value 3.5e-202"
FT   misc_feature    982..1005
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    1744..1803
FT                   /note="PS01008 DnaA protein signature."
FT   CDS_pept        2156..3289
FT                   /transl_table=11
FT                   /locus_tag="SAS0002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0002"
FT                   /db_xref="GOA:Q6GD88"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GD88"
FT                   /protein_id="CAG41774.1"
FT                   /translation="MMEFTIKRDYFITQLNDTLKAISPRTTLPILTGIKIDAKEHEVIL
FT                   TGSDSEISIEITIPKTVDGEDIVNISETGSVVLPGRFFVDIIKKLPGKDVKLSTNEQFQ
FT                   TLITSGHSEFNLSGLDPDQYPLLPQVSRDDAIQLSVKVLKNVIAQTNFAVSTSETRPVL
FT                   TGVNWLIQENELICTATDSHRLAVRKLQLEDVSENKNVIIPGKALAELNKIMSDNEEDI
FT                   DIFFASNQVLFKVGNVNFISRLLEGHYPDTTRLFPENYEIKLSIDNGEFYHAIDRASLL
FT                   AREGGNNVIKLSTGDDVVELSSTSPEIGTVKEEVDANDVEGGSLKISFNSKYMMDALKA
FT                   IDNDEVEVEFFGTMKPFILKPKGDDSVTQLILPIRTY"
FT   misc_feature    2159..2539
FT                   /note="Pfam match to entry PF00712 DNA_pol3_beta, DNA
FT                   polymerase III beta subunit, N-terminal domain, score
FT                   224.5, E-value 1.6e-64"
FT   misc_feature    2564..2908
FT                   /note="Pfam match to entry PF02767 DNA_pol3_beta_2, DNA
FT                   polymerase III beta subunit, central domain, score 222.4,
FT                   E-value 7e-64"
FT   misc_feature    2912..3280
FT                   /note="Pfam match to entry PF02768 DNA_pol3_beta_3, DNA
FT                   polymerase III beta subunit, C-terminal domain, score
FT                   209.8, E-value 4.4e-60"
FT   CDS_pept        3670..3915
FT                   /transl_table=11
FT                   /locus_tag="SAS0003"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0003"
FT                   /protein_id="CAG41775.1"
FT                   /translation="MIILVQEVVVEGDINLGQFLKTEGIIESGGQAKWFLQDVEVLING
FT                   VRETRRGKKLEHQDRIDIPELPEDAGSFLIIHQGEQ"
FT   CDS_pept        3912..5024
FT                   /transl_table=11
FT                   /locus_tag="SAS0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0004"
FT                   /db_xref="GOA:Q6GD86"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GD86"
FT                   /protein_id="CAG41776.1"
FT                   /translation="MKLNTLQLENYRNYDEVTLKCHPDVNILIGENAQGKTNLLESIYT
FT                   LALAKSHRTSNDKELIRFNADYAKIEGELSYRHGTMPLTMFITKKGKQVKVNHLEQSRL
FT                   TQYIGHLNVVLFAPEDLNIVKGSPQIRRRFIDMELGQISAVYLNDLAQYQRILKQKNNY
FT                   LKQLQLGQKKDLTMLEVLNQQFAEYAMKVTDKRAHFIQELESLAKPIHAGITNDKEALS
FT                   LNYLPSLKFDYAQNEAARLEEIMSILSDNMQREKERGISLFGPHRDDISFDVNGMDAQT
FT                   YGSQGQQRTTALSIKLAEIELMNIEVGEYPILLLDDVLSELDDSRQTHLLSTIQHKVQT
FT                   FVTTTSVDGIDHEIMNNAKLYRINQGEIIK"
FT   misc_feature    3912..4526
FT                   /note="Pfam match to entry PF02463 SMC_N, RecF/RecN/SMC N
FT                   terminal domain, score -21.4, E-value 2.5e-05"
FT   misc_feature    3999..4022
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    4242..4319
FT                   /note="PS00617 RecF protein signature 1."
FT   misc_feature    4848..4901
FT                   /note="PS00618 RecF protein signature 2."
FT   CDS_pept        5037..6968
FT                   /transl_table=11
FT                   /locus_tag="SAS0005"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0005"
FT                   /db_xref="GOA:Q6GD85"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GD85"
FT                   /protein_id="CAG41777.1"
FT                   /translation="MTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHH
FT                   LVWEIVDNSIDEALAGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTV
FT                   LHAGGKFGGGGYKVSGGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKE
FT                   VGTTDKTGTVIRFKADGEIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVR
FT                   EDSYHYEGGIKSYVELLNENKEPIHDEPIYIHQSKDDIEVEIAIQYNSGYATNLLTYAN
FT                   NIHTYEGGTHEDGFKRALTRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDP
FT                   QFEGQTKTKLGNSEVRQVVDKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAR
FT                   EVTRRKSALDVASLPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRG
FT                   KILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRT
FT                   LLLTFFYRFMRPLIEAGYVYIAQPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSI
FT                   ARYKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDN
FT                   AVYANLDF"
FT   misc_feature    5148..5579
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase, score 103.9,
FT                   E-value 3.4e-28"
FT   misc_feature    5538..5558
FT                   /note="PS00154 E1-E2 ATPases phosphorylation site."
FT   misc_feature    5727..6239
FT                   /note="Pfam match to entry PF00204 DNA_gyraseB, DNA gyrase
FT                   B, score 321.1, E-value 1.4e-93"
FT   misc_feature    6330..6356
FT                   /note="PS00177 DNA topoisomerase II signature."
FT   misc_feature    6408..6653
FT                   /note="Pfam match to entry PF01751 Toprim, Toprim domain,
FT                   score 41.7, E-value 1.8e-09"
FT   misc_feature    6735..6935
FT                   /note="Pfam match to entry PF00986 DNA_gyraseB_C, DNA
FT                   gyrase B subunit, carboxyl terminus, score 151.9, E-value
FT                   1.1e-42"
FT   CDS_pept        7005..9668
FT                   /transl_table=11
FT                   /locus_tag="SAS0006"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0006"
FT                   /db_xref="GOA:Q6GD84"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GD84"
FT                   /protein_id="CAG41778.1"
FT                   /translation="MAELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPV
FT                   HRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPHGDSSIYEAMVRMAQDFSYRYPLV
FT                   DGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLPAR
FT                   FPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAG
FT                   LILGKSGIRRAYETGRGSIQMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELV
FT                   RDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNLYKQTPLQTSFGVNMIALVN
FT                   GRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIR
FT                   ESDTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELEAI
FT                   LADEEVLLQLVRDELTEIRDRFGDDRRTEIQLGGFEDLEDEDLIPEEQIVITLSHNNYI
FT                   KRLPVSTYRAQNRGGRGVQGMNTLEEDFVSQLVTLSTHDHVLFFTNKGRVYKLKGYEVP
FT                   ELSRQSKGIPVVNAIELENDEVISTMIAVKDLESEDNFLVFATKRGVVKRSALSNFSRI
FT                   NRNGKIAISFREDDELIAVRLTSGQEDILIGTSHASLIRFPESTLRPLGRTATGVKGIT
FT                   LREGDEVVGLDVAHANSVDEVLVVTENGYGKRTPVNDYRLSNRGGKGIKTATITERNGN
FT                   VVCITTVTGEEDLMIVTNAGVIIRLDVADISQNGRAAQGVRLIRLGDDQFVSTVAKVKE
FT                   DAEDETNEDEQSTSTVSEDGTEQQREAVVNDETPGNAIHTEVIDSEENDEDGRIEVRQD
FT                   FMDRVEEDIQQSSDEE"
FT   misc_feature    7101..8447
FT                   /note="Pfam match to entry PF00521 DNA_topoisoIV, DNA
FT                   gyrase/topoisomerase IV, subunit A, score 1062.4, E-value
FT                   0"
FT   misc_feature    7665..7688
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    8517..8666
FT                   /note="Pfam match to entry PF03989 DNA_gyraseA_C, DNA
FT                   gyrase C-terminal domain, beta-propeller, score 58.1,
FT                   E-value 2e-14"
FT   misc_feature    8667..8825
FT                   /note="Pfam match to entry PF03989 DNA_gyraseA_C, DNA
FT                   gyrase C-terminal domain, beta-propeller, score 61.3,
FT                   E-value 2.2e-15"
FT   misc_feature    8838..8981
FT                   /note="Pfam match to entry PF03989 DNA_gyraseA_C, DNA
FT                   gyrase C-terminal domain, beta-propeller, score 55.3,
FT                   E-value 1.4e-13"
FT   misc_feature    8982..9131
FT                   /note="Pfam match to entry PF03989 DNA_gyraseA_C, DNA
FT                   gyrase C-terminal domain, beta-propeller, score 57.1,
FT                   E-value 4.1e-14"
FT   misc_feature    9138..9290
FT                   /note="Pfam match to entry PF03989 DNA_gyraseA_C, DNA
FT                   gyrase C-terminal domain, beta-propeller, score 56.6,
FT                   E-value 5.5e-14"
FT   misc_feature    9291..9440
FT                   /note="Pfam match to entry PF03989 DNA_gyraseA_C, DNA
FT                   gyrase C-terminal domain, beta-propeller, score 61.4,
FT                   E-value 2e-15"
FT   CDS_pept        complement(9755..10585)
FT                   /transl_table=11
FT                   /locus_tag="SAS0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0007"
FT                   /protein_id="CAG41779.1"
FT                   /translation="MGGYITMETLNSINIPKRKEDSHKGDYGKILLIGGSANLGGAIML
FT                   AARACVFSGSGLITVATHPTNHSALHSRCPEAMVIDINDTKMLTKMIEMTDSILIGPGL
FT                   GVDFKGNNAITFLLQNIQPHQNLIVDGDAITIFSKLKPQLPTCRVIFTPHLKEWERLSG
FT                   IPIEEQTYERNREAVDRLGATVVLKKHGTEIFFKDEDFKLTIGSPAMATGGMGDTLAGM
FT                   ITSFVGQFDNLKEAVMSATYTHSFIGENLAKDMYVVPPSRLINEIPYAMKQLES"
FT   misc_feature    complement(9779..10498)
FT                   /note="Pfam match to entry PF01256 carb_kinase,
FT                   Carbohydrate kinase, score 235.4, E-value 8.2e-68"
FT   misc_feature    complement(9917..9949)
FT                   /note="PS01050 Uncharacterized protein family UPF0031
FT                   signature 2."
FT   misc_feature    complement(10265..10297)
FT                   /note="PS01049 Uncharacterized protein family UPF0031
FT                   signature 1."
FT   CDS_pept        10893..12407
FT                   /transl_table=11
FT                   /locus_tag="SAS0008"
FT                   /product="putative histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0008"
FT                   /db_xref="GOA:Q6GD82"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GD82"
FT                   /protein_id="CAG41780.1"
FT                   /translation="MTLYLDGETLTIEDIKSFLQQQSKIEIIDDALERVKKSRAVVERI
FT                   IENEETVYGITTGFGLFSDVRIDPTQYNELQVNLIRSHACGLGEPFSKEVALVMMILRL
FT                   NTLLKGHSGATLELVRQLQFFINERIIPIIPQQGSLGASGDLAPLSHLALALIGEGKVL
FT                   YRGEEKDSDDVLRELNRQPLNLQAKEGLALINGTQAMTAQGVISYIESEDLGYQSEWIA
FT                   ALTHQSLNGIIDAYRHDVHAVRNFQEQINVAARMRDWLEGSTLTTRQAEIRVQDAYTLR
FT                   CIPQIHGASFQVFNYVKQQLEFEMNAANDNPLIFEEANETFVISGGNFHGQPIAFALDH
FT                   LKLGVSELANVSERRLERLVNPQLNGDLPAFLSPEPGLQSGAMIMQYAAASLVSENKTL
FT                   AHPASVDSITSSANQEDHVSMGTTAARHGYQIIENARRVLAIECVIALQAAELKGVEGL
FT                   SPKTRRKYEEFRSIVPSITHDRQFHKDIEAVAQYLKQSIYQTTACH"
FT   misc_feature    10896..12326
FT                   /note="Pfam match to entry PF00221 PAL, Phenylalanine and
FT                   histidine ammonia-lyase, score 734.3, E-value 5.5e-218"
FT   misc_feature    11304..11351
FT                   /note="PS00488 Phenylalanine and histidine ammonia-lyases
FT                   signature."
FT   misc_RNA        12493..12725
FT                   /note="T-box leader as predicted by Rfam (RF00230), score
FT                   85.48"
FT   CDS_pept        12786..14072
FT                   /transl_table=11
FT                   /locus_tag="SAS0009"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0009"
FT                   /db_xref="GOA:Q6GD81"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GD81"
FT                   /protein_id="CAG41781.1"
FT                   /translation="MLDIRLFRNEPVTVKSKIELRGDDSKVVDEILELDEQRRKLISAT
FT                   EEMKARRNKVSEEIALKKRNKENADDVIAEMRTLGDDIKEKDSQLNEIDNKMTGILCRI
FT                   PNLISDDVPQGESDEDNVEVKKWGTPREFSFEPKAHWDIVEELKMADFDRAAKVSGARF
FT                   VYLTNEGAQLERALMNYMITKHTTQHGYTEMMVPQLVNADTMYGTGQLPKFEEDLFKVE
FT                   KEGLYTIPTAEVPLTNFYRNEIIQPGVLPEKFTGQSACFRSEAGSAGRDTRGLIRLHQF
FT                   DKVEMVRFEQPEDSWNALEEMTTNAEAILEELGLPYRRVILCTGDIGFSASKTYDLEVW
FT                   LPSYNDYKEISSCSNCTDFQARRANIRFKRDKAAKPELAHTLNGSGLAVGRTFAAIVEN
FT                   YQNEDGTVTIPEALVPFMGGKTQISKPVK"
FT   misc_feature    12786..12929
FT                   /note="Pfam match to entry PF02403 Seryl_tRNA_N, Seryl-tRNA
FT                   synthetase N-terminal domain, score 68.6, E-value 1.3e-17"
FT   misc_feature    13269..13736
FT                   /note="Pfam match to entry PF00587 tRNA-synt_2b, tRNA
FT                   synthetase class II core domain (G, H, P, S and T), score
FT                   202.6, E-value 6.3e-58"
FT   misc_feature    13566..13640
FT                   /note="PS00179 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 1."
FT   CDS_pept        14724..15419
FT                   /transl_table=11
FT                   /locus_tag="SAS0010"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0010"
FT                   /protein_id="CAG41782.1"
FT                   /translation="MTTHLSFRQGVRECVPTLLGYAGVGISFGIVASSQNFSILEIVLL
FT                   CLVIYAGAAQFIMCALFIAGTPISAIVLTVFIVNSRMFLLSMSLAPNFKTYGFWNRVGL
FT                   GSLVTDETFGVAITPYLKGEAINDRWMHGLNITAYLFWAISCVAGALFGEYISNPQALG
FT                   LDFAITAMFIFLAIAQFESITKSRLRIYIVLIIAVIVMMLSLSMFMPSYLAILIAATIS
FT                   AALGVMMER"
FT   misc_feature    14766..15248
FT                   /note="Pfam match to entry PF03591 AzlC, AzlC protein,
FT                   score 282.8, E-value 4.7e-82"
FT   misc_feature    order(14766..14819,14832..14900,14910..14978,15123..15191,
FT                   15204..15272,15291..15347,15357..15410)
FT                   /note="7 probable transmembrane helices predicted for
FT                   SAS0010 by TMHMM2.0 at aa 15-32, 37-59, 63-85, 134-156,
FT                   161-183, 190-208 and 212-229"
FT   CDS_pept        15416..15745
FT                   /transl_table=11
FT                   /locus_tag="SAS0011"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0011"
FT                   /protein_id="CAG41783.1"
FT                   /translation="MITHMNMLILILLCGIVTLLIRIIPFIMISKVQLPDVVVRWLSFI
FT                   PITLFTALVIDSIIQQTPHGEGYTLNIPYIIALIPTVILSIITRSLTITIISGIVIMAA
FT                   LRFFF"
FT   misc_feature    15416..15517
FT                   /note="Signal peptide predicted for SAS0011 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.880) with cleavage site
FT                   probability 0.549 between residues 34 and 35"
FT   misc_feature    15416..15742
FT                   /note="Pfam match to entry PF06063 DUF931, Domain of
FT                   unknown function (DUF931), score 126.1, E-value 6.9e-35"
FT   misc_feature    order(15434..15502,15530..15589,15623..15676,15686..15739)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SAS0011 by TMHMM2.0 at aa 7-29, 39-58, 70-87 and 91-108"
FT   misc_RNA        15949..16047
FT                   /note="SAM riboswitch (S box leader) as predicted by Rfam
FT                   (RF00162), score 80.12"
FT   CDS_pept        16108..17076
FT                   /transl_table=11
FT                   /locus_tag="SAS0012"
FT                   /product="putative hydrolase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0012"
FT                   /protein_id="CAG41784.1"
FT                   /translation="MTNYTVDTLNLGKFITESGEVIDNLRLRYEHVGYHGQPLVVVCHA
FT                   LTGNHLTYGTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLT
FT                   LRDIVRANERGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSY
FT                   SRAFNEIARQAIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKE
FT                   HFDLNCYLTLLDVLDSHNIDRGRTDVTHVFKNLETKVLTMGFIDDLLYPDDQVRALGER
FT                   FKYHRHFFVPDNVGHDGFLLNFSTWAPNLYHFLNLKHFKRK"
FT   misc_feature    16333..17043
FT                   /note="Pfam match to entry PF00561 abhydrolase, alpha/beta
FT                   hydrolase fold, score 27.5, E-value 3.2e-05"
FT   CDS_pept        17321..18307
FT                   /transl_table=11
FT                   /locus_tag="SAS0013"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0013"
FT                   /protein_id="CAG41785.1"
FT                   /translation="MLNSIKEVKIIAIVKNMGVAYVFSKIQPKATIIATIALVFVALAL
FT                   YLVPGLGLIFALFATIPGIVLWNKSIQSFGISALITVIITTVLGNTFVLSAIILVLIAS
FT                   LIIGQLLKERTSKERILYVTTVAMSLISLIAFMLLQTFGRIPPSASIVKPFKQTLHEAI
FT                   TMSGADANMTQILEEGFRQATVQLPGFIIIITFLIVLINLIVTFPILRKFKIATPVFKP
FT                   LFAWQMSGILLWIYIIVIICLLFTGQPSVFQSILLNFQLVLSLVMYIQGLSVIHFFGKA
FT                   KGLPNAVTILLLIIGTILTPTTHIVGLLGVIDLSLNLKRIMKNNSKK"
FT   misc_feature    order(17435..17503,17546..17641,17678..17746,17882..17950,
FT                   17987..18055,18083..18151,18188..18256)
FT                   /note="7 probable transmembrane helices predicted for
FT                   SAS0013 by TMHMM2.0 at aa 39-61, 76-107, 120-142, 188-210,
FT                   223-245, 255-277 and 290-312"
FT   CDS_pept        18322..20289
FT                   /transl_table=11
FT                   /locus_tag="SAS0014"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0014"
FT                   /protein_id="CAG41786.1"
FT                   /translation="MNRQSTKKALLIPFVIMIITAIVLMGVWFIFNSLIALIASIVLVV
FT                   MIIVSIVLFRQALMKMDSYVDGLSAQISTTNNKAIKHLPIGIIVLDENDHIEWVNQFMT
FT                   DHMEANVISESVNEVFPNILKQLDRVKSVEIEYNQYHFQVRYSENDHCLYFFDITEQVQ
FT                   TNELYENSKPIIATLFLDNYDEITQNMNDTQRSEINSMVTRVISRWATEYNIFFKRYSS
FT                   DQFVAYLNQKILADLEESKFDILSQLREKSVGYRAQLTLSIGVGEGTENLIDLGELSQS
FT                   GLDLALGRGGDQVAIKSINGNVRFYGGKTDPMEKRTRVRARVISHALKDILAEGDKVII
FT                   MGHKRPDLDAIGAAIGVSRFAMMNNLEAYIVLNETDIDPTLRRVMNEIDKKPELRERFI
FT                   TSDDAWDMMTSKTTVVIVDTHKPELVLDENVLNKANRKVVIDHHRRGESFISNPLLIYM
FT                   EPYASSTAELVTELLEYQPTEQRLTRLESTVMYAGIIVDTRNFTLRTGSRTFDAASYLR
FT                   AHGADTILTQHFLKDDVDTYINRSELIRTVKVEDNGIAIAHGSDDKIYHPVTVAQAADE
FT                   LLSLEGIEASYVVARREDNLIGISARSLGSVNVQLTMEALGGGGHLTNAATQLKGVTVE
FT                   EAIAQLQQAITEQLSRSEDA"
FT   misc_feature    18322..18438
FT                   /note="Signal peptide predicted for SAS0014 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.958) with cleavage site
FT                   probability 0.498 between residues 39 and 40"
FT   misc_feature    order(18346..18414,18424..18483)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SAS0014 by TMHMM2.0 at aa 9-31 and 35-54"
FT   misc_feature    19312..19821
FT                   /note="Pfam match to entry PF01368 DHH, DHH family, score
FT                   87.3, E-value 3.4e-23"
FT   misc_feature    20068..20250
FT                   /note="Pfam match to entry PF02272 DHHA1, DHHA1 domain,
FT                   score 41.5, E-value 2.1e-09"
FT   CDS_pept        20286..20732
FT                   /transl_table=11
FT                   /locus_tag="SAS0015"
FT                   /product="50S ribosomal protein L9"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0015"
FT                   /db_xref="GOA:Q6GD75"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GD75"
FT                   /protein_id="CAG41787.1"
FT                   /translation="MKVIFTQDVKGKGKKGEVKEVPVGYANNFLLKKNYAVEATPGNLK
FT                   QLELQKKRAKQERQQEIEDAKALKETLSNIEVEVSAKTGEGGKLFGSVSTKQIAEALKA
FT                   QHDIKIDKRKMDLPNGIHSLGYTNVPVKLDKEVEGTIRVHTVEQ"
FT   misc_feature    20286..20441
FT                   /note="Pfam match to entry PF01281 Ribosomal_L9_N,
FT                   Ribosomal protein L9, N-terminal domain, score 87.6,
FT                   E-value 2.6e-23"
FT   misc_feature    20322..20405
FT                   /note="PS00651 Ribosomal protein L9 signature."
FT   misc_feature    20469..20729
FT                   /note="Pfam match to entry PF03948 Ribosomal_L9_C,
FT                   Ribosomal protein L9, C-terminal domain, score 118.1,
FT                   E-value 1.7e-32"
FT   CDS_pept        20764..22164
FT                   /transl_table=11
FT                   /locus_tag="SAS0016"
FT                   /product="DnaB-like helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0016"
FT                   /protein_id="CAG41788.1"
FT                   /translation="MDRMYEQNQMPHNNEAEQSVLGSIIIDPELINTTQEVLLPESFYR
FT                   GAHQHIFRAMMHLNEDNKEIDVVTLMDQLSTEGTLNEAGGPQYLAELSTNVPTTRNVQY
FT                   YTDIVSKHALKRRLIQTADSIANDGYNDELELDAILSDAERRILELSSSRESDGFKDIR
FT                   DVLGQVYETAEELDQNSGQTPGIPTGYRDLDQMTAGFNRNDLIILAARPSVGKTAFALN
FT                   IAQKVATHEDMYTVGIFSLEMGADQLATRMICSSGNVDSNRLRTGTMTEEDWSRFTIAV
FT                   GKLSRTKIFIDDTPGIRINDLRSKCRRLKQEHGLDMIVIDYLQLIQGSGSRASDNRQQE
FT                   VSEISRTLKALARELECPVIALSQLSRGVEQRQDKRPMMSDIRESGSIEQDADIVAFLY
FT                   RDDYYNRGGDEDDDDDGGFEPQTNDENGEIEIIIAKQRNGPTGTVKLHFMKQYNKFTDI
FT                   DYAHADMM"
FT   misc_feature    20785..21096
FT                   /note="Pfam match to entry PF00772 DnaB, DnaB-like helicase
FT                   N terminal domain, score 169.4, E-value 6.4e-48"
FT   misc_feature    21307..21909
FT                   /note="Pfam match to entry PF03796 DnaB_C, DnaB-like
FT                   helicase C terminal domain, score 482.1, E-value 4.6e-142"
FT   misc_feature    21391..21414
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    21799..21864
FT                   /note="Predicted helix-turn-helix motif for SAS0016 with
FT                   score 1117.000, SD 2.99 at aa 346-367, sequence
FT                   RTLKALARELECPVIALSQLSR"
FT   CDS_pept        22443..23726
FT                   /transl_table=11
FT                   /locus_tag="SAS0017"
FT                   /product="putative adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0017"
FT                   /db_xref="GOA:Q6GD73"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GD73"
FT                   /protein_id="CAG41789.1"
FT                   /translation="MSSIVVVGTQWGDEGKGKITDFLAEQSDVIARFSGGNNAGHTIQF
FT                   GGETYKLHLVPSGIFYKDKLAVIGNGVVVDPVALLKELDGLNERGIPTSNLRISNRAQV
FT                   ILPYHLAQDEYEERLRGDNKIGTTKKGIGPAYVDKVQRIGIRMADLLEKETFERLLKSN
FT                   IEYKQAYFKGMFNETCPSFDDIFEEYYAAGQRLKEFVTDTSKILDDAFVADEKVLFEGA
FT                   QGVMLDIDHGTYPFVTSSNPIAGNVTVGTGVGPTFVSKVIGVCKAYTSRVGDGPFPTEL
FT                   FDEDGHHIREVGREYGTTTGRPRRVGWFDSVVLRHSRRVSGITDLSINSIDVLTGLDTV
FT                   KICTAYELDGKEITEYPANLDQLKRCKPIFEELPGWTEDVTNVRTLEELPENARKYLER
FT                   ISELCNVQISIFSVGPDREQTNLLKELW"
FT   misc_feature    22449..23708
FT                   /note="Pfam match to entry PF00709 Adenylsucc_synt,
FT                   Adenylosuccinate synthetase, score 839.5, E-value 1.2e-249"
FT   misc_feature    22470..22493
FT                   /note="PS01266 Adenylosuccinate synthetase GTP-binding
FT                   site."
FT   misc_feature    22833..22868
FT                   /note="PS00513 Adenylosuccinate synthetase active site."
FT   misc_feature    23166..23198
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT   tRNA            24156..24230
FT                   /note="tRNA Glu anticodon TTC, Cove score 76.88"
FT   tRNA            24238..24310
FT                   /note="tRNA Asp anticodon GTC, Cove score 75.02"
FT   CDS_pept        24924..25631
FT                   /transl_table=11
FT                   /locus_tag="SAS0018"
FT                   /product="response regulator protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0018"
FT                   /db_xref="GOA:Q6GD72"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GD72"
FT                   /protein_id="CAG41790.1"
FT                   /translation="MQMARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIY
FT                   EEEPDIVLLDIMLPGRDGMEVCREVRKKYEMPIIMLTAKDSEIDKVLGLELGADDYVTK
FT                   PFSTRELIARVKANLRRHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIELTHR
FT                   EFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIV
FT                   TRRGVGYFLQQHE"
FT   misc_feature    24936..25292
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 131.7, E-value 1.4e-36"
FT   misc_feature    25386..25616
FT                   /note="Pfam match to entry PF00486 trans_reg_C,
FT                   Transcriptional regulatory protein, C terminal, score 88.5,
FT                   E-value 1.4e-23"
FT   CDS_pept        25644..27470
FT                   /transl_table=11
FT                   /locus_tag="SAS0019"
FT                   /product="sensor kinase protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0019"
FT                   /db_xref="GOA:Q6GD71"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GD71"
FT                   /protein_id="CAG41791.1"
FT                   /translation="MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNNLEKELLDNF
FT                   KKNITQYAKQLEISIEKVYDEKGSVNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIAT
FT                   TKQSNRSLINQKANDSSVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGN
FT                   IYIESKINDVYNQLNNINQIFIVGTAISLLITVILGFFIARTITKPITDMRNQTVEMSR
FT                   GNYTQRVKIYGNDEIGELALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDR
FT                   RGRIRIVNDMALKMLGMAKEDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGL
FT                   IARVNFSTIVQETGFVTGYIAVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIE
FT                   ALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQLSKMDNESDQINKEIIDFNMFIN
FT                   KIINRHEMSAKDTTFIRDIPKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVK
FT                   QNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAH
FT                   NGRIWANSVEGQGTSIFITLPCEVIEDGDWDE"
FT   misc_feature    order(25686..25754,26190..26258)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SAS0019 by TMHMM2.0 at aa 15-37 and 183-205"
FT   misc_feature    26193..26402
FT                   /note="Pfam match to entry PF00672 HAMP, HAMP domain, score
FT                   82.1, E-value 1.2e-21"
FT   misc_feature    26430..26618
FT                   /note="Pfam match to entry PF00989 PAS, PAS domain, score
FT                   40.7, E-value 3.5e-09"
FT   misc_feature    26766..26969
FT                   /note="Pfam match to entry PF00512 HisKA, His Kinase A
FT                   (phosphoacceptor) domain, score 91.0, E-value 2.4e-24"
FT   misc_feature    27099..27440
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase, score 153.1,
FT                   E-value 5.2e-43"
FT   CDS_pept        27463..28797
FT                   /transl_table=11
FT                   /locus_tag="SAS0020"
FT                   /product="putative exported protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0020"
FT                   /protein_id="CAG41792.1"
FT                   /translation="MNNKEHIKSVILALLVLMSVVLTYMVWNFSPDIANVDNTDSKKSE
FT                   TKPLTTPMTAKMDTTITPFQIIHSKNDHPEGTIATVSNVNKLTKPLKNKEVKSVEHVRR
FT                   DHNLMIPDLSSDFTLFDFTYDLPLSTYLGQVLNMNAKVPNHFNFNRLVIDYDADDNIVL
FT                   YAISKDRHDYVKLTTTTKNDHFLDALAAVKKDMQPYTDIITNKDTIDRTTHVFAPSKPE
FT                   KLKTYRMVFNTISVEKMNAILFDDSTIVRSSKSGVTTYNNNTGVANYNDKNEKYHYKNL
FT                   SEDEASSSKMEETIPGTFDFINGHGGFLNEDFRLFSTNNQSGELTYQRFLNGYPTFNKE
FT                   GSNQIQVTWGEKGVFDYRRSLLRTDVVLNSEDNKTLPKLESVRSSLANNSDINFEKVTN
FT                   IAIGYEMQDNSDHNHIEVQINSELVPRWYVEYDGEWYVYNDGRLE"
FT   misc_feature    27463..27570
FT                   /note="Signal peptide predicted for SAS0020 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.846 between residues 36 and 37"
FT   misc_feature    27481..27549
FT                   /note="1 probable transmembrane helix predicted for SAS0020
FT                   by TMHMM2.0 at aa 7-29"
FT   CDS_pept        28798..29586
FT                   /transl_table=11
FT                   /locus_tag="SAS0021"
FT                   /product="putative exported protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0021"
FT                   /protein_id="CAG41793.1"
FT                   /translation="MNWKLTKTLFIFVFILVNIVLVSIYVNKVNRSHINEVESNNEVNF
FT                   QQEEIKVPASILNKSVKGIKLEQITGRSKDFSSKAKGDSDLTTSDGGKLLNANISQSVK
FT                   VSDNNLKDLKDYVNKRVFKGSEYQLSEISSGSVKYEQTYDNFPILNNSKAMLNFNIEDN
FT                   KATSYKQSMMDDIKPTDGADKKHQVIGVRKAIEALYYNRYLKKGDEVINARLGYYSVVN
FT                   ETNVQLLQPNWEIKVKHDGKDKTNTYYVEATNNNPKIINH"
FT   misc_feature    28798..28890
FT                   /note="Signal peptide predicted for SAS0021 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.852) with cleavage site
FT                   probability 0.828 between residues 31 and 32"
FT   misc_feature    28822..28875
FT                   /note="1 probable transmembrane helix predicted for SAS0021
FT                   by TMHMM2.0 at aa 9-26"
FT   CDS_pept        29975..30775
FT                   /transl_table=11
FT                   /locus_tag="SAS0022"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0022"
FT                   /protein_id="CAG41794.1"
FT                   /translation="MSRLIRMSVLASGSTGNATFVENEKGSLLVDVGLTGKKMEELFSQ
FT                   IDRNIQDLNGILVTHEHIDHIKGLGVLARKYQLPIYANEKTWQAIEKKDSRIPMDQKFI
FT                   FNPYETKSIAGFDVESFNVSHDAIDPQFYIFHNNYKKFTILTDTGYVSDRMKGMIRGSD
FT                   AFIFESNHDVDMLRMCRYPWKTKQRILGDMGHVSNEDAGHAMTDVITGNTKRIYLSHLS
FT                   QDNNMKDLARMSVGQVLNEHDIDTEKEVLLCDTDKAIPTPIYTI"
FT   misc_feature    29975..30043
FT                   /note="Signal peptide predicted for SAS0022 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.600) with cleavage site
FT                   probability 0.235 between residues 23 and 24"
FT   misc_feature    30017..30487
FT                   /note="Pfam match to entry PF00753 lactamase_B,
FT                   Metallo-beta-lactamase superfamily, score 60.7, E-value
FT                   3.4e-15"
FT   CDS_pept        30961..33321
FT                   /transl_table=11
FT                   /locus_tag="SAS0023"
FT                   /product="putative 5'-nucleotidase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0023"
FT                   /protein_id="CAG41795.1"
FT                   /translation="MIIYWCMTVNGGNEMKALLLKTSVWLVLLFSVMGLWQVSNAAEQH
FT                   TPMKAHAVTTIDKATTDRQQVPPTKEAAHHYGEEAATNVSASAQGTADDTNNKVTSNAP
FT                   TNKPTTAVSTTGNKRHDVDAQQASTQKPTHTATFKLSNAKTASLSPRMFAANVPQTTTH
FT                   KILHTNDIHGRLAEEKGRVIGMAKLKTVKEQEKPDLMLDAGDAFQGLPLSNQSKGEEMA
FT                   KAMNAVGYDAMAVGNHEFDFGYDQLKKLEGMLDFPMLSTNVYKDGKRAFKPSTIVTKNG
FT                   IRYGIIGVTTPETKTKTRPEGIKGVEFRDPLQSVTAEMMRIYKDVDTFVVISHLGIDPS
FT                   TQETWRGDYLVKQLSQNPQLKKRITVIDGHSHTVLQNGQIYNNDALVQTGTALANIGKI
FT                   TFNYRNGEVSNIKPSLINVKDVENVTPNKALAEQINQADQTFRAQTAEVIIPNNTIDFK
FT                   GERDDVRTRETNLGNAIADAMEAYGVKNFSKKTDFAVTNGGGIRASIAKGKVTRYDLIS
FT                   VLPFGNTIAQIDVKGSDVWTAFEHSLGAPTTQKDGKTVLTANGGLLHISDSIRVYYDMN
FT                   KPSGKRINAIQILNKETGKFESIDLKRVYHVTMNDFTASGGDGYSMFGGPREEGISLDQ
FT                   VLASYLKTANLAKYDMTEPQRMLLGKPVASEQPAKGQQGSKGSESGKDTQPIGKEKVMN
FT                   PAKQPATGKVVLLPAHRGTVSSGTEGSDRALEGTAVSSKSGKQLANMSAPKGSAHEKQL
FT                   PKTGTDQSSSPAAMFVLVTGIGLIATVRRRKAS"
FT   misc_feature    31009..31077
FT                   /note="1 probable transmembrane helix predicted for SAS0023
FT                   by TMHMM2.0 at aa 17-39"
FT   misc_feature    31447..32082
FT                   /note="Pfam match to entry PF00149 Metallophos,
FT                   Calcineurin-like phosphoesterase, score 65.8, E-value
FT                   9.5e-17"
FT   misc_feature    31648..31683
FT                   /note="PS00786 5'-nucleotidase signature 2."
FT   misc_feature    32305..32835
FT                   /note="Pfam match to entry PF02872 5_nucleotidaseC,
FT                   5'-nucleotidase, C-terminal domain, score 221.7, E-value
FT                   1.1e-63"
FT   misc_feature    33208..33312
FT                   /note="Pfam match to entry PF00746 Gram_pos_anchor, Gram
FT                   positive anchor, score 16.5, E-value 0.00036"
FT   misc_feature    33217..33234
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT   CDS_pept        33689..34168
FT                   /transl_table=11
FT                   /locus_tag="SAS0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0024"
FT                   /db_xref="GOA:Q6GD66"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GD66"
FT                   /protein_id="CAG41796.1"
FT                   /translation="MKITILAVGKLKEKYWKQAIAEYEKRLGPYTKIDIIEVTDEKAPE
FT                   NMSDKEIEQVKEKEGQRILAKIKPQSTVITLEIQGKMLSSEGLAQELNQRMTQGQSDFV
FT                   FVIGGSNGLHKDVLQRSNYALSFSKMTFPHQMMRVVLIEQVYRAFKIMRGEAYHK"
FT   misc_feature    33689..34162
FT                   /note="Pfam match to entry PF02590 DUF163, Uncharacterized
FT                   ACR, COG1576, score 332.0, E-value 7.1e-97"
FT   repeat_region   complement(34150..34164)
FT                   /note="DRscc"
FT   CDS_pept        complement(34546..37584)
FT                   /transl_table=11
FT                   /locus_tag="SAS0025"
FT                   /product="putative type I restriction enzyme protein"
FT                   /note="N-terminus is similar to the N_terminal region of
FT                   Escherichia coli type I restriction enzyme EcoR124II R
FT                   protein HsdR or Hsr SWALL:T1R1_ECOLI (SWALL:P10486) (1033
FT                   aa) fasta scores: E(): 2.1e-05, 22.57% id in 762 aa. Full
FT                   length CDS is similar to Caulobacter crescentus
FT                   hypothetical protein CC0623 SWALL:Q9AAH5 (EMBL:AE005738)
FT                   (964 aa) fasta scores: E(): 2.5e-103, 37.74% id in 959 aa"
FT                   /protein_id="CAG41797.1"
FT                   /translation="MISVIKNKEINFEQDIEASLVQYGGWESVRFQDTHYDANIALDPT
FT                   VLLEFVKQTQPKNWKRYVSIYRTNAEQKFLKRLNEEITNHGILHVLRKGIRDRGVSFKV
FT                   VYFQPASSLNTENIKNYEANRFQCVRQFQYSNKYRNTIDMVLMINGIPLVALELKNQYT
FT                   GQNVEHARLQFEQDRDPKELIFQFNSRFLVYFAVDHFNVLMTTKLAKGNTYFLPFDQGS
FT                   NGPGRVGGAGNPSNPSGYPTSYLWENVLTSYQLLDIFERFMNLEEKKKLLIFPRYHQLD
FT                   VVKKLISDTQHHGPGKNYLIQHSAGSGKSNSIAWLAYHLASLHSNEDQPIYSSVIVVTD
FT                   RTVLDRQLQNTLMSFEHTVGQVETIGDNKTSQDLKTAINDQKKIIITTLQKFPVIYDEI
FT                   DNTAGRSFAILVDEAHSSQTGSSAQKLKHALADKEASLKEYQEFEESVEDQSLDDQDQI
FT                   VQTLLSQGQHDNLSFFAFTATPKEKTIEMFGTKQADGSYHPFHIYSMRQAIEEGFILNV
FT                   LQNYMTYNTSYKIAKSIEEDPELPKTEAVRAIAKYQSLHPWVLRQKAEIMIEQFRSVTQ
FT                   KAVQGRGKAMIVTASRLHAVRYMQEFKKYIKEKGYTDMDVLVAFSGTVEDDGIEYTEPK
FT                   MNLTHSGERIQENQLKEAFHSEDFNLLIVAEKYQTGFDEPLLHTMFVDKRLRGVKAVQT
FT                   LSRLNRTMPGKTDTFILDFVNTAEEIYEAFQPFYEATSLKEEININLIYDTQSKLRKFH
FT                   IYNDDDIQTVMKLNRQAKQKQNDQLLGRLSSVLRPVISRYSDLPEDVQYDFRVTLRNFN
FT                   KWYNYIAQIDRTFDKELLEESIFTGFLLKFIPEKQRNYIDIEDKVKLEYYKLQEDFKGD
FT                   IALVNEDVENGQLAHPSEVNATVRPEEEYDSLNEIIHKINERFPNDFTQGDRVLVKNMR
FT                   ETLINNTDAKLVNMAQNNSEEMFANSLFQQQFQDFLIDQYNQGEAAYSKMFSNNRDFYD
FT                   TVYQLLAKDYYRWLRSQKADNFA"
FT   misc_feature    complement(36946..37356)
FT                   /note="Pfam match to entry PF04313 HSDR_N, Type I
FT                   restriction enzyme R protein N terminus (HSDR_N), score
FT                   52.3, E-value 1.1e-12"
FT   CDS_pept        complement(37588..38898)
FT                   /transl_table=11
FT                   /locus_tag="SAS0026"
FT                   /product="putative type I restriction enzyme specificity
FT                   protein"
FT                   /note="Similar to Escherichia coli type I restriction
FT                   enzyme EcoBI specificity protein HsdS or Hss
FT                   SWALL:T1SB_ECOLI (SWALL:P06990) (474 aa) fasta scores: E():
FT                   3.7e-10, 21.44% id in 443 aa, and to Caulobacter crescentus
FT                   type I restriction-modification system, S subunit CC0621
FT                   SWALL:Q9AAH7 (EMBL:AE005738) (450 aa) fasta scores: E():
FT                   9.9e-18, 23.18% id in 440 aa"
FT                   /protein_id="CAG41798.1"
FT                   /translation="MSREMKYSGIEWIGYIPKYWTITKLKNIIDFISGYAFKSELFTIS
FT                   DNNKKVITIKSFNTKEIILDNLSYSNESLKFPTKYLLKNNDILFAMSGGTTGKNLLIEQ
FT                   VDDLYYINQRVGIIRSSFSKFIYYYINTGLFSEYINLFSSGSAQPNISATDIQNFIIAL
FT                   PEKETIKKIEIYINYQLKIISNIIDTTYQSIEELKKYKQSLITEAVTKGIDPNVEMKES
FT                   GNDWIGSIPSNWSVRKIKHDFNLKGRIGWQGLTSNEYQTVGPYLITGTDFKKGIIRWDS
FT                   CVRISEERFEEAPDIHIKENDLLITKDGTIGKVALATNVPKKVSLNSGVLLIREKLKNT
FT                   INKKFMYYNLLSNMFWNWYNSNNQGASTIKHLYQGQFYNYSYAIPLLHEQQQIVQYLDD
FT                   KVSTIDRLIEDKTKVIKELENYKKSLIYEYVTGKKEV"
FT   misc_feature    complement(37702..38199)
FT                   /note="Pfam match to entry PF01420 Methylase_S, Type I
FT                   restriction modification DNA specificity domain, score
FT                   43.0, E-value 7.1e-10"
FT   misc_feature    complement(38323..38841)
FT                   /note="Pfam match to entry PF01420 Methylase_S, Type I
FT                   restriction modification DNA specificity domain, score
FT                   43.5, E-value 5.1e-10"
FT   CDS_pept        complement(38891..40678)
FT                   /transl_table=11
FT                   /locus_tag="SAS0027"
FT                   /product="putative type I restriction enzyme methylase
FT                   protein"
FT                   /note="Similar to Escherichia coli type I restriction
FT                   enzyme EcoR124II M protein HsdM or Hsm SWALL:T1M1_ECOLI
FT                   (SWALL:P10484) (520 aa) fasta scores: E(): 8.6e-16, 23.81%
FT                   id in 504 aa, and to Caulobacter crescentus type I
FT                   restriction-modification system, M subunit, putative CC0620
FT                   SWALL:Q9AAH8 (EMBL:AE005738) (611 aa) fasta scores: E():
FT                   2.1e-72, 42.97% id in 605 aa"
FT                   /protein_id="CAG41799.1"
FT                   /translation="MSEFKRHQQTSINVQKQANLIWNVADILRGLYKPHEYGKVILPMT
FT                   VIKRLHDTLLKTRDKVLKTAENTQSINDVMRERLLKNASGYSFYNTSLYTFETLLADPA
FT                   NIESNFRAYLNGFSENMQDILNNFKFDVEITTMADNDVLFYVIQEFNKADAYLGPDKMT
FT                   STDMGYVFEELVRKFSESYNEEAGAHFTSRDIIYLMTDLLLIEDKDTLFKEHVFKTVYD
FT                   QTMGTSQMLSAMTERIHDMNDTAEVATFGQELNPETYAISKADTMIRGGDPENMALGST
FT                   LTSDRFEGFTFDYCISNPPFGVDWKKDQKAVKAEHELGELGRFGVGLPRVSDGQLLFQL
FT                   NGISKLKETGRMAIIHNGSALFSGNPGAGESLIRQYVIENDWLEGIIQLPNDLFYNTGI
FT                   STYIWIITKDKSPERQGKVQLVDASNMYEKRRKNIGEKRVDISEACREMIVQAYGEFND
FT                   KEYYLGDGTVESKILKNESFGFTRVTIERPQRDENGDIVYKKNGSKSVDTNLRDTEDIP
FT                   LTEDINEYFEREILPFNQDAWMDRKKDKIGYEIPFTRLFYKYTPPEPSEVISERIKQLE
FT                   ESIIKNFQALSGKEVDTNE"
FT   misc_feature    complement(39245..39754)
FT                   /note="Pfam match to entry PF02384 N6_Mtase, N-6 DNA
FT                   Methylase, score 72.3, E-value 1.1e-18"
FT   misc_feature    complement(39776..39796)
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT   misc_feature    complement(39914..40642)
FT                   /note="Pfam match to entry PF02506 Methylase_M, Type I
FT                   restriction modification system, M protein, score -54.9,
FT                   E-value 1.5e-05"
FT   CDS_pept        complement(40866..41087)
FT                   /transl_table=11
FT                   /locus_tag="SAS0028"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Staphylococcus aureus hypothetical 9.2
FT                   kDa protein SWALL:Q93IA3 (EMBL:AB037671) (80 aa) fasta
FT                   scores: E(): 1.1e-24, 89.04% id in 73 aa, and to
FT                   Staphylococcus aureus hypothetical 8.0 kDa protein
FT                   SWALL:Q93ID7 (EMBL:AB037671) (68 aa) fasta scores: E():
FT                   0.0037, 33.33% id in 54 aa"
FT                   /protein_id="CAG41800.1"
FT                   /translation="MNHETTQSDWRTVPNCLASQNYISIVKGLVHHFTAIEDEEILDKI
FT                   YDDFMDDDSITTVLNNDLQTIINHYLLK"
FT   CDS_pept        complement(41101..41604)
FT                   /transl_table=11
FT                   /locus_tag="SAS0029"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0056"
FT                   /note="Similar to Staphylococcus aureus hypothetical
FT                   protein SA0054 SWALL:Q99XD7 (EMBL:AP003358) (172 aa) fasta
FT                   scores: E(): 2.6e-59, 94.61% id in 167 aa"
FT                   /protein_id="CAG41801.1"
FT                   /translation="MNTIKSTIHTEAIFSDDKQHRYLLKKTWDEKKPACTVITMYPHLD
FT                   GVLSLDLTTVLILNQLANSEQYGAVYLVNLFSNIKTPENLKHIKEPYDKHTDIHLMKTI
FT                   SESDTVILAYGAYAKRPVVIERVSQVMEMLKPHKKKVKKLINPATNEIMHPLNPKARQK
FT                   WTLK"
FT   CDS_pept        complement(41620..41931)
FT                   /transl_table=11
FT                   /locus_tag="SAS0030"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0057"
FT                   /note="Similar to Staphylococcus hominis hypothetical
FT                   protein Orf11 SWALL:Q8VUW8 (EMBL:AB063171) (103 aa) fasta
FT                   scores: E(): 1.7e-36, 93.2% id in 103 aa"
FT                   /protein_id="CAG41802.1"
FT                   /translation="MKINRYITKGISKQLSLDLQILLWNMVKDRDNQLNTDYLHIFKLQ
FT                   EDENILSITHEQEQPAYKLEYHYTNYIKNQNALPKKVYVIREDDVDVFYYVMLLPEEY"
FT   misc_feature    complement(41635..41925)
FT                   /note="Pfam match to entry PF06124 DUF960, Staphylococcal
FT                   protein of unknown function (DUF960), score 234.2, E-value
FT                   1.9e-67"
FT   CDS_pept        complement(42024..42365)
FT                   /transl_table=11
FT                   /locus_tag="SAS0031"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0058"
FT                   /note="Similar to Staphylococcus aureus hypothetical 13.8
FT                   kDa protein SWALL:Q9LBZ1 (EMBL:AB033763) (116 aa) fasta
FT                   scores: E(): 3.7e-44, 96.42% id in 112 aa"
FT                   /protein_id="CAG41803.1"
FT                   /translation="MKTTTQELKQYITRLFQLSNNETWECEALEEAAENILPTRFVDHT
FT                   PLAHLTLETYTYYNDELHELSIYPFLMYANNQLISIGYLDHFDMDFLYLTDTKNTIIDE
FT                   RHLLQKGGE"
FT   misc_feature    complement(42030..42362)
FT                   /note="Pfam match to entry PF06106 DUF950, Staphylococcus
FT                   protein of unknown function (DUF950), score 292.6, E-value
FT                   5.2e-85"
FT   CDS_pept        complement(42831..44456)
FT                   /transl_table=11
FT                   /gene="ccrB"
FT                   /locus_tag="SAS0032"
FT                   /product="site-specific recombinase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0059"
FT                   /note="Similar to Staphylococcus hominis site-specific
FT                   recombinase CcrB1 SWALL:BAB83487 (EMBL:AB063171) (542 aa)
FT                   fasta scores: E(): 2.8e-179, 95.01% id in 542 aa, and to
FT                   Staphylococcus aureus cassette chromosome recombinase B
FT                   CcrB or CcrB3 SWALL:Q9R3U2 (EMBL:AB014437) (542 aa) fasta
FT                   scores: E(): 4.3e-163, 85.79% id in 542 aa"
FT                   /protein_id="CAG41804.1"
FT                   /translation="MDKMKKKLVGGYIRVSTERQVEGYSIEGQITQIEQYCQFNGYELV
FT                   DIYADRGISGKSMNRPELQRMLNDAKNGKLDCVMVYKTNRLARNTSDLLTIVEELHRQN
FT                   VEFFSLSERMEVKNSTGKLMLQILASFSEFERNTILENIYNGQHQRALKGYYQGNLPLG
FT                   YNNIPDNKKELMINQHEANIVKYIFESYAKGHGYRKIANALNHKGYVTKKGNPFSINSI
FT                   TYILVNPFYIGKIQFAKYKDWNEKRRKGLNDKPIIADGKHPPIISQELWDKVQSRKKQV
FT                   SQKPQVHGKGTNLLTGIIHCPQCGAPMAASNTTNTLKDGTKKRIRYYSCSNFRNKGSKV
FT                   CSANSVRADVIEKYVMDQILEIVKSDKVLKQVVERVNQDNQVDVAALNHDIAYKQQQFD
FT                   EVNIKLKNLVQTIEDNPDLTSALKPTIHQYETKLNDITNQMNQLKQQQNQEKPSYDTKQ
FT                   IAALLQRIFQNIESMDKSQLKALYLTVIDRIDIRKDENHKKQFYVTLKLNNEIIKQLFN
FT                   NNNLDEVLLSTSSLFLPQTLYFQI"
FT   misc_feature    complement(43989..44432)
FT                   /note="Pfam match to entry PF00239 resolvase, Resolvase, N
FT                   terminal domain, score 109.6, E-value 6.5e-30"
FT   misc_feature    complement(44397..44423)
FT                   /note="PS00397 Site-specific recombinases active site."
FT   CDS_pept        complement(44478..45827)
FT                   /transl_table=11
FT                   /gene="ccrA1"
FT                   /locus_tag="SAS0033"
FT                   /product="site-specific recombinase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0060"
FT                   /note="Similar to Staphylococcus hominis site-specific
FT                   recombinase CcrA1 SWALL:Q8VUX1 (EMBL:AB063171) (449 aa)
FT                   fasta scores: E(): 1e-161, 94.87% id in 449 aa, and to
FT                   Staphylococcus aureus cassette chromosome recombinase A1
FT                   CcrA1 SWALL:Q9S0L6 (EMBL:AB033763) (449 aa) fasta scores:
FT                   E(): 3.6e-161, 94.65% id in 449 aa"
FT                   /protein_id="CAG41805.1"
FT                   /translation="MKQAIGYLRQSTTKQQSLAAQKQTIKALAEKHNIQHITFYSDKQS
FT                   GRTDKRNGYQQITELIQQGQCDVLCCYRLNRLHRNLKNALKLMKLCQTYHVHILSVHDG
FT                   YFDMDKAFDRLKLNIFISLAELESDNIGEQVKNGIKEKARQGKLITTHAPFGYHYHNGT
FT                   FTIDTVKSPTVKAVFNYYLQGYGYKKIAQYLEADDNFINRKPYQVRNIILNPNYCGRVI
FT                   NQYGQYENMFPAIVSTTIYEEAQVTRTQKQVKCKPSENQLKQKIKCPYCHSTLTNMTVR
FT                   KPDHSLRYYVCPQNMNNARFVCEFKGINAQELETSVLATCQDFFQNQQLYSKINHTIQQ
FT                   RLKRQRDIEIKTTLNHEQLIEKLAQGKIDAETFKEQTHSLHQQSKPISSISAYQIRKAF
FT                   QNIIQQRFTLNMLYPYIDEINISKNKSLAGIYFKNEPLNIVKQTMKLSIV"
FT   misc_feature    complement(45384..45818)
FT                   /note="Pfam match to entry PF00239 resolvase, Resolvase, N
FT                   terminal domain, score 56.9, E-value 4.6e-14"
FT   CDS_pept        complement(46015..47784)
FT                   /transl_table=11
FT                   /locus_tag="SAS0034"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0061"
FT                   /note="Similar to Staphylococcus hominis DNA, cassette
FT                   chromosome SCC, strain:ATCC27844 hypothetical protein
FT                   SWALL:Q8VUX3 (EMBL:AB063171) (589 aa) fasta scores: E():
FT                   2.5e-202, 89.47% id in 589 aa, and to Staphylococcus aureus
FT                   hypothetical protein SWALL:Q9S0L7 (EMBL:AB033763) (589 aa)
FT                   fasta scores: E(): 1e-201, 88.79% id in 589 aa"
FT                   /protein_id="CAG41806.1"
FT                   /translation="MSHYIIFEAGPYQLDAKAWRKTFPPKKDGDKEKVVPISSCIVVEA
FT                   KFWHASENTEKIIISNGKDKEHTFESDILTTRNLPSLIKYGHSINESYIRDLSYALQLM
FT                   RDELPTSDLYDGSGIIETPHGYIVMVDTVYTSKQYDQLASLEPIVDSAYLLEPKGTFKD
FT                   WLNMYMNEVKGHLLLELAVIFGISALVTAFLKHKHEVEFAGIIFSFTGQSSTGKSTAAA
FT                   LAVSVAGNPTKGNKTLFRSWNGTRNALEGYLSNNYGIPMVFDELSSATFKDTTGLLYSI
FT                   AEGQGRQRSNVHGEVKTPKNWGTSVISTSEYSIFTDSAQNDGLRVRTIEINEQFTTNAT
FT                   NADNIKKAVALNYGHVLPLVAQYLINREEEVIQWFKDEHHWFKAKLKSEANNTGIRMFK
FT                   RYAVITTSAQILGRVLATNIDIAKIRDYFIDYHTHTVSERSLADKAIEVITQFVAQNRG
FT                   KFSDDTALKNMIENYGLIALKDDYIEVKIIATVFKDMLKEQHFQDVNNVVNALRDKGFI
FT                   ESDRDRITTKRTVKDDYGKKQSLVFYHLKLDSEYASIFGLTKDAEPIKAKINLDNKKML
FT                   ESWKKQNDDLIDF"
FT   misc_feature    complement(46882..47784)
FT                   /note="Pfam match to entry PF06048 DUF927, Domain of
FT                   unknown function (DUF927), score 792.7, E-value 1.5e-235"
FT   misc_feature    complement(47131..47154)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(47784..48080)
FT                   /transl_table=11
FT                   /locus_tag="SAS0035"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0062"
FT                   /note="Similar to Staphylococcus aureus hypothetical 11.1
FT                   kDa protein SWALL:Q9LBZ5 (EMBL:AB033763) (98 aa) fasta
FT                   scores: E(): 1e-34, 88.77% id in 98 aa, and to
FT                   Staphylococcus hominis DNA, cassette chromosome scc,
FT                   strain:ATCC27844 hypothetical protein SWALL:Q8VUX4
FT                   (EMBL:AB063171) (98 aa) fasta scores: E(): 7.5e-33, 84.69%
FT                   id in 98 aa"
FT                   /protein_id="CAG41807.1"
FT                   /translation="MTYEQEDDFKLLKRRILGIGFVLPEGQVFTFHDLNRRANVQCSKA
FT                   VQQNVGRWFAYFVKNAPSVPFIIIGKNTNGHLVYMKVGPNPLQDSNPSKGGVR"
FT   CDS_pept        complement(48253..49740)
FT                   /transl_table=11
FT                   /locus_tag="SAS0036"
FT                   /product="hypothetical protein"
FT                   /note="Poor database matches. N-terminus is similar to the
FT                   N-terminal region of Ureaplasma parvum hypothetical
FT                   membrane lipoprotein UU125 SWALL:Q9PR19 (EMBL:AE002113)
FT                   (394 aa) fasta scores: E(): 0.0071, 23.33% id in 330 aa"
FT                   /protein_id="CAG41808.1"
FT                   /translation="MWFRNFSYFIHKIDSEFILEEYLEDYLPKEYRPNFICGKAQPSET
FT                   IYVSYFINQDEQTVEQHTVECDKTGFFIDEIPKHFIKNKMHYFIDSQSKIDIKDLLNEF
FT                   IDQGTAILNILDLNDLETYFNDYLETINHTTEFAKKIANKAMKEIRKNIELEQIKQQVS
FT                   YMKNADQVSSLESFKDLKHTILKQHRDLSLKNVDDIIISDFLTRYLIYKEKQDSYVKKD
FT                   ISSINKSQYFKKLVIEGLIRERKSNSQYFEIANSIKPSSHNNNSLNQSDEIDQFRQAVI
FT                   GISLNLYDHNDTYFKFIRSIMKKSSRKVNLTIDDIIKSKNNIDKFMKKNKLISNNELFY
FT                   LTTIEDTFHFTLFTAITDLIDKVVNVSSRIIEEASQYDILIALHSLNSLKNELNTIIDK
FT                   HEENLIRFESLINGYVRNTQLKILVRNTIEQHPELTMKIEDSLISNLNDYNISEIYSRE
FT                   TFNNDYNGILDKLMIQVINDFYKLRLKKLNSASKLYY"
FT   CDS_pept        49912..50616
FT                   /transl_table=11
FT                   /locus_tag="SAS0037"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAG41809.1"
FT                   /translation="MKRSVESFSELHQVLKNYRDNSLWLFRGHSNLNWSLVPKAGRAPY
FT                   DKYDDEETFYAWKRQAMIFLKETYSDWDMLTIAQHHGLATRLLDWSFNPLVAAFFAVQT
FT                   YEDCDAVIYAYLKKSDMNMKGATPFKSKWIKKVKPNGLASRVVRQSGIFTIHEPPTNSI
FT                   EANLSEKEELHKIIIKKHYRKKLREELSYYGINELSLFPDLDGLSSHVNWIMEINPYAS
FT                   NNITQELNSINE"
FT   CDS_pept        50640..51482
FT                   /transl_table=11
FT                   /locus_tag="SAS0038"
FT                   /product="hypothetical protein"
FT                   /note="Poor database matches C-terminal region is similar
FT                   to Brucella melitensis hypothetical protein BMEI1674
FT                   SWALL:Q8YF53 (EMBL:AE009602) (250 aa) fasta scores: E():
FT                   1e-10, 32.61% id in 233 aa. CDS contains a coiled-coil
FT                   region, residues 62 to 85"
FT                   /protein_id="CAG41810.1"
FT                   /translation="MSVLETKLKSQMSKSAKIARNMNKLPDEIDRLRKRIERINKKRKP
FT                   TSSNIRDLEKSNKQLVTKQQKLADLQVEYTKIEKKINETKINLQKEQSRNQKKLSSMLD
FT                   KNTKGNEEIMEKLLTNSDQINEISNQIKKAVNQKEIIEYDVFLSHSSLDKEDYVSKISE
FT                   KLIEKGLKVFEDVKVFEIGKSQTETMNMGILNSRFVVVFLSPNFIESGWSRYEFLSFLN
FT                   REINEEHVIILPIWHKVSVEDVRAYNPYLVDKYALNTSDFSIEEIVEKIYQVIVNSKN"
FT   misc_feature    51072..51374
FT                   /note="Pfam match to entry PF01582 TIR, TIR domain, score
FT                   42.5, E-value 1.2e-12"
FT   CDS_pept        51926..52234
FT                   /transl_table=11
FT                   /locus_tag="SAS0040"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches. Doubtful CDS"
FT                   /protein_id="CAG41811.1"
FT                   /translation="MTEINESSLSLKTVYPVGTELSIDEYEIVKNKIMVLGKEKWTNLL
FT                   NEPHYYYLIEDFIETDYKKTSKGGLMGVKYFNVNEILNRDCLTTEQIAKELCNKDWE"
FT   CDS_pept        52820..53458
FT                   /transl_table=11
FT                   /locus_tag="SAS0043"
FT                   /product="putative fusidic acid resistance protein"
FT                   /note="Similar to Staphylococcus aureus fusidic acid
FT                   resistance protein Far1 SWALL:Q8GNY5 (EMBL:AF468686) (213
FT                   aa) fasta scores: E(): 7.8e-28, 43.68% id in 206 aa"
FT                   /protein_id="CAG41812.1"
FT                   /translation="MNKIEVYKFVKVKQLVYQLIKLYRTNDMNSHKTQKDFLLNEINDI
FT                   FKEKDIDISDFITSIDDVKLTKKKAEHLLNELKVYIQDFEIPSSSQLEKIFRKVKKLKR
FT                   PDINLIDTKEISYLGWNDNSSNRKYIVYKNLDDKFEGIYGEISPNKVKGFCKICNQESD
FT                   TSLFLNKTKHNKSSGTYTKKGDYICYDSFKCNQNLDDINNLYEFIVKIK"
FT   CDS_pept        54144..54773
FT                   /transl_table=11
FT                   /locus_tag="SAS0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Xylella fastidiosa hypothetical protein
FT                   XF0543 SWALL:Q9PFW4 (EMBL:AE003901) (222 aa) fasta scores:
FT                   E(): 0.0072, 26.94% id in 219 aa. N-terminal region is
FT                   similar to Streptococcus pneumoniae hypothetical protein
FT                   SP1047 SWALL:Q97QZ5 (EMBL:AE007407) (105 aa) fasta scores:
FT                   E(): 9.9e-07, 38.09% id in 105 aa"
FT                   /protein_id="CAG41813.1"
FT                   /translation="MNLRGHENRLKFLEKYDVTPISHLKLLEGQKKDGEGGRLTDSYYC
FT                   FSYSLKDNSKKVLGTFNCGYHIAEDLLKLSNQDKLPLFNPFKVINKGNQLQGVTNKGNL
FT                   DINRQRKQYNEVALQLSNAINLIIICYEGNIKEPLSTIKYETDKYYYSEPYDSKIKAVN
FT                   TIIGNLFDKKLVEKISEINVNQEIRKFDFSLLTNKIKKYEIQNNFE"
FT   CDS_pept        complement(55452..55880)
FT                   /transl_table=11
FT                   /locus_tag="SAS0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli phnB protein PhnB
FT                   SWALL:PHNB_ECOLI (SWALL:P16681) (147 aa) fasta scores: E():
FT                   0.046, 22.55% id in 133 aa, and to Clostridium
FT                   acetobutylicum uncharacterized conserved protein, phnb
FT                   family CAC3689 SWALL:Q97D00 (EMBL:AE007864) (137 aa) fasta
FT                   scores: E(): 3.3e-06, 31.49% id in 127 aa"
FT                   /protein_id="CAG41814.1"
FT                   /translation="MNFQVSPYFLIIENADGLKRLYEELFGAKTLYIQRIKDRPTDKQL
FT                   NIDKKDLNKIDQCVLQFGDIKIMIADDTEGLPITQGNNISLCITFDHVEETKRVYDQLI
FT                   EKGSEVLKAFSPEFYTEGYGYVRDPYGISLHLFTKRKG"
FT   misc_feature    complement(55473..55604)
FT                   /note="Pfam match to entry PF00903 Glyoxalase,
FT                   Glyoxalase/Bleomycin resistance protein/Dioxygenase
FT                   superfamily, score 14.0, E-value 0.00074"
FT   CDS_pept        55960..56889
FT                   /transl_table=11
FT                   /locus_tag="SAS0047"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Bacillus halodurans hypothetical protein
FT                   BH1889 SWALL:Q9KBN6 (EMBL:AP001513) (325 aa) fasta scores:
FT                   E(): 5.2e-16, 25.71% id in 315 aa, and to Listeria
FT                   monocytogenes hypothetical protein LMO0364 SWALL:Q8YA03
FT                   (EMBL:AL591975) (314 aa) fasta scores: E(): 1.7e-15, 24.44%
FT                   id in 315 aa"
FT                   /protein_id="CAG41815.1"
FT                   /translation="MKKSVRLYHMIEYCNEKRNFKLNDLMSEFNISRSTALRDIKEIEA
FT                   LGVPLYSSTGKNGGYMTIGNRNQTKIAITDEELKALVFTLSSISNVSKLPFQTEYQEIL
FT                   KKLYNNSNKKELINQYNEIFQYFNEDTYQFKSYKIFNEIIRLTIGSKSFKICYSQNYLK
FT                   EQYKGIGILYKNQQWYFVVVNIASKLVKLLNISKIKEVYEMGETKECNEITMQNFQQFM
FT                   VENENTIDIQIRSNIIGLNILKGYLWSDYMIENINEETYLFKSKVNMQDINFIAKLIVT
FT                   CGANVKVEFPISLKKAIKTELTKIINLY"
FT   repeat_region   complement(56986..57003)
FT                   /note="DRscc"
FT   CDS_pept        57181..58476
FT                   /transl_table=11
FT                   /locus_tag="SAS0048"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0025"
FT                   /note="Similar to Staphylococcus aureus region mecA element
FT                   hypothetical protein Orf1260 SWALL:Q9KJC5 (EMBL:AF181950)
FT                   (419 aa) fasta scores: E(): 2.2e-138, 93.51% id in 416 aa.
FT                   Weakly similar to Listeria monocytogenes hypothetical
FT                   protein LMO0304 SWALL:Q8YA57 (EMBL:AL591974) (421 aa) fasta
FT                   scores: E(): 2.1e-18, 27.65% id in 434 aa"
FT                   /protein_id="CAG41816.1"
FT                   /translation="MRHNIFYNRSEFPMIDNFKQVLKLIKEKRTNNVVKKSDWDKGDQY
FT                   KTLVHDKLPKQLKAHIKEDKYSVVGKVATGNYSKVPWISIYDENITKESKDGYYLVYLF
FT                   HPEGEGIYLSLNQGWSKISNMFPRDKNAAKQRALTLSSELNKYITSNEFNTGRFYYAEN
FT                   KDSSYDLKNDYPSGYSHGSIRIKYYDLNEGFTEEEMLYDLKKFLELFNELASKVTKTFY
FT                   DGLVNRIDEIQEDSEIEEIRIAQIDKTLKQVEAPKGVIPKYKKGVSKTTKNDSEIEKSN
FT                   KENKLTGKVGEKLALKYFNDLIDNKIDEDKKEQFRNILNDNPGSQHGHGYDLVAFDPTN
FT                   TDEAIEKFIEIKTSISSNIEEPFFMSLNEMFALKEYKKKYLILRIFNVSGEEPQFYFID
FT                   PYANYSEFKDVDDLIDKVFNVEAIQYKVFGEK"
FT   CDS_pept        complement(58948..59577)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SAS0049"
FT                   /product="putative transposase (fragment)"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0082"
FT                   /note="Similar to the N-terminal regions of Streptococcus
FT                   agalactiae putative transposase OrfB SWALL:Q93EY9
FT                   (EMBL:AF329275) (253 aa) fasta scores: E(): 1e-32, 48.62%
FT                   id in 218 aa, and Streptococcus dysgalactiae putative
FT                   transposase SWALL:Q9L442 (EMBL:AJ250837) (259 aa) fasta
FT                   scores: E(): 1e-31, 47.7% id in 218 aa"
FT                   /db_xref="PSEUDO:CAG41817.1"
FT   misc_feature    complement(58951..59310)
FT                   /note="Pfam match to entry PF00665 rve, Integrase core
FT                   domain, score 34.9, E-value 2e-07"
FT   CDS_pept        complement(59745..59855)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SAS0050"
FT                   /product="transposase (fragment)"
FT                   /note="Probable gene remnant. Similar to internal regions
FT                   of Bacillus halodurans transposase SWALL:Q9JWP9
FT                   (EMBL:AP001518) (94 aa) fasta scores: E(): 6.6e-09, 63.88%
FT                   id in 36 aa, and Staphylococcus aureus hypothetical protein
FT                   SWALL:Q99WI5 (EMBL:AP003359) (98 aa) fasta scores: E():
FT                   8.4e-09, 75% id in 36 aa"
FT                   /db_xref="PSEUDO:CAG41818.1"
FT   misc_feature    complement(59766..59831)
FT                   /note="Predicted helix-turn-helix motif for SAS0050 with
FT                   score 1445.000, SD 4.11 at aa 9-30, sequence
FT                   KPRNEIIREYDLTPSALGKWIK"
FT   CDS_pept        60231..60956
FT                   /transl_table=11
FT                   /gene="seh"
FT                   /locus_tag="SAS0051"
FT                   /product="enterotoxin H"
FT                   /note="Identical to Staphylococcus aureus enterotoxin H Seh
FT                   SWALL:Q53585 (EMBL:U11702) (241 aa) fasta scores: E():
FT                   1.2e-84, 100% id in 241 aa. Similar to Staphylococcus
FT                   aureus enterotoxin type E precursor EntE SWALL:ETXE_STAAU
FT                   (SWALL:P12993) (257 aa) fasta scores: E(): 2.1e-21, 37.05%
FT                   id in 251 aa"
FT                   /protein_id="CAG41819.1"
FT                   /translation="MINKIKILFSFLALLLSFTSYAKAEDLHDKSELTDLALANAYGQY
FT                   NHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYY
FT                   KCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELD
FT                   IKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKT
FT                   LKSDDISHIDVNLYTKKKV"
FT   misc_feature    60231..60302
FT                   /note="Signal peptide predicted for SAS0051 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.905 between residues 24 and 25"
FT   misc_feature    60339..60605
FT                   /note="Pfam match to entry PF01123 Stap_Strp_toxin,
FT                   Staphylococcal/Streptococcal toxin, OB-fold domain, score
FT                   129.8, E-value 5.3e-36"
FT   misc_feature    60624..60938
FT                   /note="Pfam match to entry PF02876 Stap_Strp_tox_C,
FT                   Staphylococcal/Streptococcal toxin, beta-grasp domain,
FT                   score 94.0, E-value 3.2e-25"
FT   misc_feature    60690..60761
FT                   /note="PS00278 Staphyloccocal enterotoxin/Streptococcal
FT                   pyrogenic exotoxin signature 2."
FT   CDS_pept        61523..61711
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SAS0052"
FT                   /product="enterotoxin (fragment)"
FT                   /note="Similar to the N-terminal regions of Staphylococcus
FT                   aureus enterotoxin type E precursor EntE SWALL:ETXE_STAAU
FT                   (SWALL:P12993) (257 aa) fasta scores: E(): 1.7e-05, 44.06%
FT                   id in 59 aa, and Staphylococcus aureus enterotoxin type D
FT                   precursor EntD SWALL:ETXD_STAAU (SWALL:P20723) (258 aa)
FT                   fasta scores: E(): 1.8e-05, 46.15% id in 65 aa"
FT                   /db_xref="PSEUDO:CAG41820.1"
FT   misc_feature    61523..61702
FT                   /note="Pfam match to entry PF02876 Stap_Strp_tox_C,
FT                   Staphylococcal/Streptococcal toxin, beta-grasp domain,
FT                   score -16.1, E-value 0.023"
FT   CDS_pept        61852..62325
FT                   /transl_table=11
FT                   /locus_tag="SAS0053"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0098"
FT                   /protein_id="CAG41821.1"
FT                   /translation="MEYKSYNKMSNNILSILLSDKNFDNKMVVSTGSYILSELPCIVAY
FT                   KNNDIAGLLTYKVYDEYIEIISLDSFVENKGIGSHLLDYAEIIASDMSKRSISVITTNE
FT                   NIKALYFYQKNKYRITDVIFDAVTEARKIKPSIPTIDKNGIEIRDEIVLTKYL"
FT   misc_feature    61975..62205
FT                   /note="Pfam match to entry PF00583 Acetyltransf,
FT                   Acetyltransferase (GNAT) family, score 47.7, E-value
FT                   2.7e-11"
FT   CDS_pept        complement(62876..63631)
FT                   /transl_table=11
FT                   /locus_tag="SAS0054"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0048"
FT                   /protein_id="CAG41822.1"
FT                   /translation="MDIVNIVIMLLIGVFGGFISGLVGVGGAIIIYPAILLLPPLFGAP
FT                   AYSAYIASGLTSSQVFFSTLSGSLKARKKTEFSPQLVLYMGGGMIIGSMLGAFLANLFD
FT                   ATFVNTVYIIIALLALTLMFIKVKPSSEKSSFNKYLLVIIGLFIGIISGIVGAGGAFII
FT                   IPILLVLFKLPMNTVVANSIVIAFISSIGAFVIKLIQGYIPLYDALFLIIGSIIFAPIG
FT                   LKLSKKVPNIIQKWIISILIVFAIIQLIL"
FT   misc_feature    complement(order(62882..62926,62963..63031,63044..63100,
FT                   63119..63214,63257..63310,63323..63391,63518..63613))
FT                   /note="7 probable transmembrane helices predicted for
FT                   SAS0054 by TMHMM2.0 at aa 7-38, 81-103, 108-125, 140-171,
FT                   178-196, 201-223 and 236-250"
FT   misc_feature    complement(62882..63625)
FT                   /note="Pfam match to entry PF01925 DUF81, Domain of unknown
FT                   function DUF81, score 145.3, E-value 1.1e-40"
FT   misc_feature    complement(63488..63631)
FT                   /note="Signal peptide predicted for SAS0054 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.967) with cleavage site
FT                   probability 0.592 between residues 48 and 49"
FT   CDS_pept        complement(63631..63897)
FT                   /transl_table=11
FT                   /locus_tag="SAS0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0047"
FT                   /protein_id="CAG41823.1"
FT                   /translation="MTMNYDKKMINRINRIQGQLNGIIKMMEEGKDCKDVITQISASKS
FT                   SLQRLMGIIISENLIECVKAAADDEESSQELINEAVNLLVKSK"
FT   misc_feature    complement(63637..63822)
FT                   /note="Pfam match to entry PF02583 DUF156, Uncharacterised
FT                   BCR, COG1937, score 66.5, E-value 5.9e-17"
FT   CDS_pept        64028..65095
FT                   /transl_table=11
FT                   /locus_tag="SAS0056"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0046"
FT                   /protein_id="CAG41824.1"
FT                   /translation="MKQYGEKFIDEFSKAELEKLAKQGQLIDVRTEEEYALGHINGSIL
FT                   HPVDEIESFNKEKNKTYYVICRSGNRSANASKYLAKQGYNVINLDGGYKAYEEENDSYD
FT                   TQEEYKSIEIKADRKQFNYRGLQCPGPIVKISQEMKNIEVGDQIEVKVTDPGFPSDIKS
FT                   WVKQTRHTLVKLDENNNGINAIIQKEKAKDLDINYSAKGTTIVLFSGELDKAVAALIIA
FT                   NGARAAGKDVTIFFTFWGLNALKKVQTVNVKKQGIAKMFDLMLPKKNIRMPLSKMNMFG
FT                   LGNMMMRYVMKKKNVDSLPTLINQAIEQNIKLIACTMSMDVMGIQKEELRDEVEYGGVG
FT                   TYIGATENANHNLFI"
FT   misc_feature    64064..64324
FT                   /note="Pfam match to entry PF00581 Rhodanese,
FT                   Rhodanese-like domain, score 58.0, E-value 2.1e-14"
FT   misc_feature    64373..64591
FT                   /note="Pfam match to entry PF01206 UPF0033, Uncharacterized
FT                   protein family UPF0033, score 25.4, E-value 8.3e-07"
FT   CDS_pept        65126..66460
FT                   /transl_table=11
FT                   /locus_tag="SAS0057"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0044"
FT                   /protein_id="CAG41825.1"
FT                   /translation="MFFKQFYDNHLSQASYLVGCQRTGEAIIIDPVRDLSKYIEVADSE
FT                   GLTITQATETHIHADFASGIRDVAKRLNANIYVSGEGEDALGYKNMPSKTQFVKHGDII
FT                   QVGNVKLEVLHTPGHTPESISFLLTDLGGGSSVPMGLFSGDFIFVGDIGRPDLLEKSVQ
FT                   IKGSTEISAKQMYESVQNIKNLPDYVQIWPGHGAGSPCGKALGAIPISTIGYEKINNWA
FT                   FNEIDETKFIESLTSNQPAPPHHFAQMKQVNQFGMNLYQSYDVYPSLDNKRVAFDLRSK
FT                   EAFHGGHTKGTINIPYNKNFINQIGWYLDFEKDIDLIGDKSTVEKAKHTLQLIGFDKVA
FT                   GYRLPKSGISTQSVHSADMTGKEEHVLDVRNDEEWNNGHLDQAVNIPHGKLLNENIPFN
FT                   KEDKIYVHCQSGVRSSIAVGILESKGFENVVNIREGYQDFPESLK"
FT   misc_feature    65159..65710
FT                   /note="Pfam match to entry PF00753 lactamase_B,
FT                   Metallo-beta-lactamase superfamily, score 77.5, E-value
FT                   2.8e-20"
FT   misc_feature    66176..66451
FT                   /note="Pfam match to entry PF00581 Rhodanese,
FT                   Rhodanese-like domain, score 42.7, E-value 8.6e-10"
FT   CDS_pept        66479..67672
FT                   /transl_table=11
FT                   /locus_tag="SAS0058"
FT                   /product="putative oxidoreductase"
FT                   /note="Similar to the C-terminal region of
FT                   Schizosaccharomyces pombe sulfide:quinone oxidoreductase,
FT                   mitochondrial precursor HMT2 or CAD1 or SPBC2G5.06c
FT                   SWALL:HMT2_SCHPO (SWALL:O94284) (459 aa) fasta scores: E():
FT                   9.1e-52, 39.36% id in 409 aa, and to the full length
FT                   Bacillus cereus sulfide-quinone reductase bc3512
FT                   SWALL:Q81AP8 (EMBL:AE017009) (399 aa) fasta scores: E():
FT                   3.3e-87, 54.7% id in 393 aa"
FT                   /protein_id="CAG41826.1"
FT                   /translation="MNKHYQIVIIGGGTAGVTVASRLLRKNQNLKEKIAIIDPADHHYY
FT                   QPLWTLVGAGVSSLKSSRKDMESVIPEGANWIKQAVSSFQPENNSVILGDNTVVYYDFL
FT                   VVAPGLQINWSSIKGLKENIGKNGVCSNYSPDYVNETWNQISNFKQGNAIFTHPNTPIK
FT                   CGGAPMKIMYLAEDYFRKHKIRSNANVIYATPKDALFDVGKYNKELERIVEERNITVNY
FT                   NYNLVEIDGDKKVATFEHIKAYDRKTISYDMLHVTPPMGPLDVVKESTLSDSEGWVDVN
FT                   PTTLQHKSYSNVFALGDASNVPTSKTGAAIRKQAPIVANNLLQVMNNQMLTHHYDGYTS
FT                   CPIVTGYNRLILAEFDYNKNTKETMPFNQAKERRSMYIFKKDLLPKMYWYGMLKGLI"
FT   CDS_pept        complement(68339..69325)
FT                   /transl_table=11
FT                   /locus_tag="SAS0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0099"
FT                   /db_xref="GOA:Q6GD38"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GD38"
FT                   /protein_id="CAG41827.1"
FT                   /translation="MKENFWSELPRPFFILAPMEDVTDIVFRHVVSEAARPDVFFTEFT
FT                   NTESFCHPEGIHSVRGRLTFSEDEQPMVAHIWGDKPEQFRETSIQLAKMGFKGIDLNMG
FT                   CPVANVAKKGKGSGLILRPDVAAEIIQATKAGGLPVSVKTRLGYYEIDEWKDWLKHVFE
FT                   QDIANLSIHLRTRKEMSKVDAHWELIEAIKNLRDEIAPNTLLTINGDIPDRKTGLELAE
FT                   KYGIDGVMIGRGIFHNPFAFEKEPREHTSKELLDLLRLHLSLFNKYEKDEIRQFKSLRR
FT                   FFKIYVRGIRGASELRHQLMNTQSIAEARALLDEFEAQMDEDVKIEL"
FT   misc_feature    complement(68375..69283)
FT                   /note="Pfam match to entry PF01207 Dus, Dihydrouridine
FT                   synthase (Dus), score 121.0, E-value 2.3e-33"
FT   misc_feature    complement(68975..69031)
FT                   /note="PS01136 Uncharacterized protein family UPF0034
FT                   signature."
FT   CDS_pept        69634..69837
FT                   /transl_table=11
FT                   /locus_tag="SAS0060"
FT                   /product="hypothetical protein"
FT                   /note="Similar to the C-terminal region of Bacillus
FT                   anthracis hypothetical protein ba2438 SWALL:Q81QI7
FT                   (EMBL:AE017031) (81 aa) fasta scores: E(): 2.2, 33.87% id
FT                   in 62 aa. Weakly similar to Escherichia coli microcin M
FT                   imunity protein McmI SWALL:Q83TS3 (EMBL:AJ515251) (73 aa)
FT                   fasta scores: E(): 7.7, 27.77% id in 54 aa"
FT                   /protein_id="CAG41828.1"
FT                   /translation="MEGLKHSLKSLGWWDLFFAIPIFLLFAYLPNYNFITIFLNIVIII
FT                   FFSIGLILTTHIIIDKIKSNTK"
FT   misc_feature    order(69661..69729,69742..69810)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SAS0060 by TMHMM2.0 at aa 10-32 and 37-59"
FT   CDS_pept        69886..70182
FT                   /transl_table=11
FT                   /locus_tag="SAS0061"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0101"
FT                   /protein_id="CAG41829.1"
FT                   /translation="MATKKDVHDLFLNHVNSNAVKTRKMMGEYIIYYDGVVIGGLYDNR
FT                   LLVKATKSAQQKLQDNTLVSPYPGSKEMILILDFTEATNLTDLFKTIKNDLKK"
FT   misc_feature    69904..70179
FT                   /note="Pfam match to entry PF04993 TfoX_N, TfoX N-terminal
FT                   domain, score 118.6, E-value 1.3e-32"
FT   CDS_pept        complement(70254..71474)
FT                   /transl_table=11
FT                   /locus_tag="SAS0062"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Lactobacillus plantarum transport protein
FT                   lp_0492 SWALL:Q88Z68 (EMBL:AL935253) (403 aa) fasta scores:
FT                   E(): 1.4e-51, 38.02% id in 405 aa, and to Bacillus
FT                   anthracis permease, putative ba2277 SWALL:Q81QY7
FT                   (EMBL:AE017031) (409 aa) fasta scores: E(): 1.2e-17, 20.84%
FT                   id in 403 aa"
FT                   /protein_id="CAG41830.1"
FT                   /translation="MTDLLKIKNFRLFFLAEIISAFGVGISTVGANWYLIDKTNDSQLL
FT                   GIMLALNVLSGFLASPIIGGLADKYNRRNIILITYLLQVILYLLIVIALVMIGFETYLV
FT                   IGFAIVNGIGWTTYMATSRSLVKQILKPDQYTDANSLLEISLQTGMFIAGGLSGILYKI
FT                   NGFTLIIAMTIMMFLISIFMLFRLHVDKPTHSEEESTNSLLQEYLLGWKFLKDNMMIFI
FT                   FGVISIIPMVFTMIFNISLPGYVYNVLKLSSVQFGFSDMLYGIGGLCAGLISAILSKKI
FT                   STKVLIFLLYFILVINSALFIWINSAFYLFIGSFILGYSISSIRIYMNTAIMNTVSDKY
FT                   VGRSFTIWTSISLLLQSFIAPFLGRWINEINDKFGFYIILILSLLIFVTLLLVNKTDKI
FT                   KYAHKEE"
FT   misc_feature    complement(order(70296..70355,70398..70457,70494..70553,
FT                   70563..70622,70641..70709,70752..70820,70920..70979,
FT                   70992..71060,71121..71174,71184..71252,71277..71345,
FT                   71373..71441))
FT                   /note="12 probable transmembrane helices predicted for
FT                   SAS0062 by TMHMM2.0 at aa 12-34, 44-66, 75-97, 101-118,
FT                   139-161, 166-185, 219-241, 256-278, 285-304, 308-327,
FT                   340-359 and 374-393"
FT   CDS_pept        complement(71467..72024)
FT                   /transl_table=11
FT                   /locus_tag="SAS0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacillus subtilis hypothetical protein
FT                   YwqN SWALL:P96726 (EMBL:Z92952) (181 aa) fasta scores: E():
FT                   1.8e-24, 39.22% id in 181 aa, and to Bacillus cereus trp
FT                   repressor binding protein bc5177 SWALL:Q815H5
FT                   (EMBL:AE017014) (181 aa) fasta scores: E(): 1.4e-23, 40.11%
FT                   id in 177 aa"
FT                   /protein_id="CAG41831.1"
FT                   /translation="MTMITCLFGSSRKDGNSAIAVENLLKNLKVNFVNLYQSNIEKVTD
FT                   NRHSKGANFHNDDYEQILIKVLESDIIIFSTPLYWYSMSASLKLFIDRWTESLRDTQID
FT                   NFKEIMSQKKYLILIIGGDNPHTKAQPLVNQFKLIFEFMNITNYRFLIGEGNKPFDILN
FT                   DSQFIEELANINLALKKGDIYD"
FT   CDS_pept        72131..72991
FT                   /transl_table=11
FT                   /locus_tag="SAS0064"
FT                   /product="LysR-family regulatory protein"
FT                   /note="Similar to Bacillus anthracis transcriptional
FT                   regulator, LysR family ba3543 SWALL:Q81YK0 (EMBL:AE017035)
FT                   (297 aa) fasta scores: E(): 8.1e-19, 29.31% id in 290 aa.
FT                   C-terminus is similar to the C-terminal region of Bacillus
FT                   subtilis transcriptional regulatory protein GltR or
FT                   bsu26670 SWALL:GLTR_BACSU (SWALL:P94501) (296 aa) fasta
FT                   scores: E(): 3.2e-13, 27.98% id in 243 aa"
FT                   /protein_id="CAG41832.1"
FT                   /translation="MNLNILKSFLVTSETKNLTKASELLNYSQSTVSTHIEKLERQLDV
FT                   KLFYRKKYGMELTEEGLAYVKYAKVILDSNSEYEREIKGLYNKKVNISINMQESQYLYR
FT                   YYNKISEWLAEHPYVNLKFKSAHSNFYIKEEIANFKSDISLITDEKIINSNLTAIPITE
FT                   ERLIFVTNKEMKDFKLNDIQNHTLLVTEKGCSYREQLEMILYKYSFSTKQMIEFLGIES
FT                   LKKHLKNSGGIALLPEFIVADELENKSLFQIDVDVDIPNLETTLIINPESNKQVLESFV
FT                   KDVFL"
FT   misc_feature    72137..72316
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family, score
FT                   65.3, E-value 1.4e-16"
FT   misc_feature    72176..72241
FT                   /note="Predicted helix-turn-helix motif for SAS0064 with
FT                   score 1766.000, SD 5.20 at aa 16-37, sequence
FT                   KNLTKASELLNYSQSTVSTHIE"
FT   misc_feature    72179..72271
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    72383..72988
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain, score 21.4, E-value 3.3e-05"
FT   CDS_pept        complement(73346..73879)
FT                   /transl_table=11
FT                   /locus_tag="SAS0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacillus anthracis hypothetical protein
FT                   BA1938 SWALL:Q81RU9 (EMBL:AE017030) (182 aa) fasta scores:
FT                   E(): 1.8e-27, 45.05% id in 182 aa"
FT                   /protein_id="CAG41833.1"
FT                   /translation="MHAMQYHVKLPSDYNMEIIRDRVRLNGYKTDGFKNLIIKAYLISQ
FT                   TTTNCITNTYSPLYLWRSSEGMTEFIFNGFYDNVISSFGWQNINIGVIYSMNITDSVKH
FT                   SLYALEEYIDIFPTLSLKEIEIKKLFRIFDNAVAEIIIYNPDKWKFVKYSFIENLPKSL
FT                   NPNIKIYDVLYISQ"
FT   CDS_pept        73979..74713
FT                   /transl_table=11
FT                   /locus_tag="SAS0066"
FT                   /product="LysR-family regulatory protein"
FT                   /note="Similar to Bacillus anthracis transcriptional
FT                   regulator, LysR family ba1937 SWALL:Q81RV0 (EMBL:AE017030)
FT                   (262 aa) fasta scores: E(): 2.5e-11, 28.9% id in 256 aa.
FT                   C-terminus is similar to the C-terminal region of Bacillus
FT                   subtilis transcriptional regulatory protein GltR or
FT                   bsu26670 SWALL:GLTR_BACSU (SWALL:P94501) (296 aa) fasta
FT                   scores: E(): 5.7e-06, 26.05% id in 238 aa"
FT                   /protein_id="CAG41834.1"
FT                   /translation="MNFNDLEIFITVCEEASINKAAIKLRYAQSNISQRISKLENELGV
FT                   VLLFRNQKGAKATKAGEEFLAYSKKVLRDTETIKNKMKNNTMSILCSELLFNYLSESEE
FT                   IMMSNNSINFISSGNIRKAIEKNNYDKVISFIKINDSNYRLSNVDTMKVTLYSNGSNYD
FT                   KEALLINKDEFCPLRKITLDNKLDSQRVMEIDSLAAIINLVKQGKGKALLPMTFENKRD
FT                   IVQDISKIFEVNYYTYNHIMHH"
FT   misc_feature    73985..74164
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family, score
FT                   62.3, E-value 1.1e-15"
FT   misc_feature    74027..74119
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   CDS_pept        75138..75749
FT                   /transl_table=11
FT                   /locus_tag="SAS0067"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0102"
FT                   /protein_id="CAG41835.1"
FT                   /translation="MNDMLISLVIPVFALLVIGGIIWMIIEGIVHISKKNKAIDNFFNQ
FT                   VNKVSETYKFATTFLFLILATAGISQFYLYYIVSALLFWLVILTFGIAGIIFLMPYGLC
FT                   FLPFYKQKKKKQTFKKYMVYTTIGLSICLGLSLVLVHTTKIYMDEGGVRYYYGSFVMKQ
FT                   AGGYAYLALAVLSTLLIVAKKATNKNKEIETVDNTNIMER"
FT   misc_feature    order(75147..75215,75300..75368,75396..75464,75498..75566,
FT                   75624..75683)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SAS0067 by TMHMM2.0 at aa 4-26, 55-77, 87-109, 121-143 and
FT                   163-182"
FT   CDS_pept        76016..79168
FT                   /transl_table=11
FT                   /locus_tag="SAS0068"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0103"
FT                   /protein_id="CAG41836.1"
FT                   /translation="MSQLLNDTLSAWLLIESLSPGEVNFTAEDILSAEHFKNGAKQAQL
FT                   QSFDEYFEIWNAERFIISEEKSETGELIFKFYRHCFRYNEINLKIQDIFDDYSEIHNPN
FT                   GTHCYGYTFNTDKHGKVIVDSIHIPMIMSALKEIEKNKNANIEEKFNDSVEKFVQKVKE
FT                   ILADEPINEFKLKKMDKAYDEYFSVLNSKKDGLFGHYVAIEYVKDSDLPQPEFNSFFIS
FT                   DIEKARKSPNQTLIDYIEGVEESQRIEVDENKEMFDKFLHPSRLPDGRWPSQTEFRLSL
FT                   MQQLAVNQITSGNERISSVNGPPGTGKTTLLKDIFAHLVVERGKELAKLNNPKDAFVKT
FT                   KIHETDDKYVYLLKESIAKYKMVVASSNNGAVENISKDLPKIEEIIRNPEKCKFPKYEQ
FT                   NYANLAHELKDFAEIAEDLIGESAWGLFSGVFGKSTNINQVLSHMLKQDANDIGFAKLL
FT                   QNENNRMSYNELMSEWQSHQRAFLEELRHVEMLKEESIRAYDVYKNCESFSKIEQVINS
FT                   EKTSIEEQVYHLDNETLRDNKEIEDLDNRINYIVKQIETLNELIKSIKESNKGFINKLK
FT                   AMFNSEEDESYKDHNKEKQQLLTQQLELEKCKKNKHEDLVSKLKEKEKLIKQLTKVQLQ
FT                   LDELNSQLQELEAYRIESKITIPEKDFWSDNNYDERQVTNLWTSDELQYRRAMLFLRAM
FT                   ILHKLLLIANNTTIYYAINDFKDRRKLIDANPDKVHNAWNVMHLIFPVVSTTFASFKSM
FT                   YGGIPKDFIDYLFIDEAGQAIPQAAVGALYRSKKVVAVGDPIQIEPVVTLESHLIDNIR
FT                   KNYHVPEYLVSKEASVQSVADNANQYGFWKSDATDSNQKTWIGIPLWVHRRCLKPMFTI
FT                   ANQIAYNNKMVLPSNITKVGKTGWYDVKGNAVQKQFVKEHGEKVVGLLADDWIEAIKEG
FT                   KNEPSSFVISPFSAVQQQIKRMLKQQLPTRIDIERTKINQWVDKSIGTVHTFQGKEAQK
FT                   VYFVIGTDNTQDGAVNWSCEKPNLLNVAVTRAKKEFYVIGDMQRIQMKPFYETIFKERN
FT                   VK"
FT   misc_feature    76919..76942
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        79225..79707
FT                   /transl_table=11
FT                   /locus_tag="SAS0069"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0104"
FT                   /protein_id="CAG41837.1"
FT                   /translation="MEKFNNWILNAISGSQTDKNETTEELKGAKFIILYAYSMLVLLAL
FT                   VISNIFIHILEPKLSITTQIIIVLILIEALIGLRFLKAYDVKRGKDKENKKNSKDFVKL
FT                   KSILVAILFTSLALTAGTVADIYGFTDLGNTRSDLIVWSIGGIIFGLVCYTMEDKR"
FT   misc_feature    order(79321..79389,79399..79467,79528..79596,79639..79692)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SAS0069 by TMHMM2.0 at aa 33-55, 59-81, 102-124 and
FT                   139-156"
FT   CDS_pept        join(79912..80313,80313..80897)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="plc"
FT                   /locus_tag="SAS0070"
FT                   /product="1-phosphatidylinositol phosphodiesterase
FT                   precursor (pseudogene)"
FT                   /EC_number="4.6.1.13"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0105"
FT                   /note="Highly similar to Staphylococcus aureus
FT                   1-phosphatidylinositol phosphodiesterase precursor plc
FT                   SWALL:PLC_STAAU (SWALL:P45723) (311 aa) fasta scores: E():
FT                   3.4e-113, 96.79% id in 312 aa. CDS contains a frameshift
FT                   after codon 134"
FT                   /db_xref="PSEUDO:CAG41838.1"
FT   misc_feature    79912..79989
FT                   /note="Signal peptide predicted for SAS0070 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.972 between residues 26 and 27"
FT   misc_feature    79930..79983
FT                   /note="1 probable transmembrane helix predicted for SAS0070
FT                   by TMHMM2.0 at aa 7-24"
FT   misc_feature    80056..80490
FT                   /note="Pfam match to entry PF00388 PI-PLC-X,
FT                   Phosphatidylinositol-specific phospholipase C, X domain,
FT                   score 233.3, E-value 3.6e-67"
FT   CDS_pept        81118..81888
FT                   /transl_table=11
FT                   /locus_tag="SAS0072"
FT                   /product="putative lipoprotein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0106"
FT                   /db_xref="GOA:Q6GD27"
FT                   /db_xref="InterPro:IPR007595"
FT                   /db_xref="InterPro:IPR038641"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GD27"
FT                   /protein_id="CAG41839.1"
FT                   /translation="MMKRLNKLVLGIIFLFLVISITAGCGIGKEAEVKKSFEKTLSMYP
FT                   IKNLEDLYDKEGYRDDQFDKNDKGTWIINSEMVIQPNNEDMVAKGMVLYMNRNTKTTNG
FT                   YYYVDVTKDEDEGKPHDNEKRYPVKMVDNKIIPTKEIKDEKIKKEIENFKFFVQYGDFK
FT                   NLKNYKDGDISYNPEVPSYSAKYQLTNDDYNVKQLRKRYDIPTSKAPKLLLKGSGNLKG
FT                   SSVGYKDIEFTFVEKKEENIYFSDSLDYKKSGDV"
FT   misc_feature    81118..81216
FT                   /note="Signal peptide predicted for SAS0072 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.314 between residues 33 and 34"
FT   misc_feature    81121..81879
FT                   /note="Pfam match to entry PF04507 DUF576, Protein of
FT                   unknown function, DUF576, score 605.9, E-value 2.4e-179"
FT   misc_feature    81130..81198
FT                   /note="1 probable transmembrane helix predicted for SAS0072
FT                   by TMHMM2.0 at aa 5-27"
FT   misc_feature    81160..81192
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        81940..82710
FT                   /transl_table=11
FT                   /locus_tag="SAS0073"
FT                   /product="putative lipoprotein"
FT                   /db_xref="GOA:Q6GD26"
FT                   /db_xref="InterPro:IPR007595"
FT                   /db_xref="InterPro:IPR038641"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GD26"
FT                   /protein_id="CAG41840.1"
FT                   /translation="MIKRVNKLVLGISLLFLVISITAGCGMGKEAEIKKSFEKTLSMYP
FT                   IKNLEDLYDKEGYRDDQFDKNDKGTWIVNSQMAIQNKGEALKIKGMLLKIDRNTRSAKG
FT                   FYYTNEIKTEKYEVAQDNQKKYPVKMINNKFISTEEVKEENIKKEIENFKFFAQYSNFK
FT                   DLMNYKDGDISYNPEVPSYSAQYQLTNDDYNVKQLRKRYDIPTNKAPKLLLKGTGNLKG
FT                   SSVGYKKIEFTFLENKNENIYFTDSLHLKPSEDK"
FT   misc_feature    81940..82029
FT                   /note="Signal peptide predicted for SAS0073 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.356 between residues 30 and 31"
FT   misc_feature    81943..82701
FT                   /note="Pfam match to entry PF04507 DUF576, Protein of
FT                   unknown function, DUF576, score 569.3, E-value 2.5e-168"
FT   misc_feature    81952..82020
FT                   /note="1 probable transmembrane helix predicted for SAS0073
FT                   by TMHMM2.0 at aa 5-27"
FT   misc_feature    81982..82014
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        82989..83753
FT                   /transl_table=11
FT                   /locus_tag="SAS0074"
FT                   /product="putative lipoprotein"
FT                   /db_xref="GOA:Q6GD25"
FT                   /db_xref="InterPro:IPR007595"
FT                   /db_xref="InterPro:IPR038641"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GD25"
FT                   /protein_id="CAG41841.1"
FT                   /translation="MKRLKKIVLCISFLFLTIFIGGCGMGKEAEIKKSFEKTLSMYPIK
FT                   NLEDLYDKEGYRDDQFDKKDKGTWIINSEMATQNKGEALKIKGMVLYMNRNTKTTKGYY
FT                   YVNAIKNDKDGRPQENEKRYPVKMIDNKVIPTKEIKDENIKTEIKNFKFFVQYGNFKDL
FT                   KNYKDGDISYNPEAPIYSAKYQLTNDDYNVKQLRERYDIPTNKAPKLLLKGSGNLKGSS
FT                   VGYKNIEFTFVEEKGKNIYFSDSLDYKKSGEV"
FT   misc_feature    82989..83072
FT                   /note="Signal peptide predicted for SAS0074 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.481 between residues 28 and 29"
FT   misc_feature    82989..83744
FT                   /note="Pfam match to entry PF04507 DUF576, Protein of
FT                   unknown function, DUF576, score 599.5, E-value 2.2e-177"
FT   misc_feature    83007..83066
FT                   /note="1 probable transmembrane helix predicted for SAS0074
FT                   by TMHMM2.0 at aa 7-26"
FT   misc_feature    83025..83057
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        83756..85132
FT                   /transl_table=11
FT                   /locus_tag="SAS0075"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to Listeria monocytogenes
FT                   hypothetical protein lmo2804 SWALL:Q8Y3N1 (EMBL:AL591984)
FT                   (427 aa) fasta scores: E(): 3.9e-10, 25.56% id in 442 aa,
FT                   and Listeria innocua hypothetical protein lin2936
FT                   SWALL:Q926V4 (EMBL:AL596174) (427 aa) fasta scores: E():
FT                   1.4e-08, 24.44% id in 454 aa"
FT                   /protein_id="CAG41842.1"
FT                   /translation="MAKAEYEIDPGKITSNSEETSAISNISYEIENANDNNLDNEKIRG
FT                   QITKLKKGGNFPKNLDYIDSYTDPSTGTTATAFLNKDTGKVTVGMAGTNFHGDQLKRVA
FT                   LSSMSPLLFPPSKQDMKDVRGTMKDGVADLAIGVGMVNYKGKHFANTQQFIENLQKKYE
FT                   IDTVTGHSLGGRDAIFLGLRYNIKNVVAYNPAPLEVKSIRNKFGGQLFRNTTFPDEKYL
FT                   KELMDNYDGDITKVITQKDGLDYLVKRTDHLTCGDVLRINNGQGHAMENFLGEKEQREI
FT                   IEELMLVKGYRDANDKAFKALKKNTEKKLGKIDEIKSKLLQTNGGALSSSQQKLLETLV
FT                   AFSVAEGLSKMVDQELQQLKNMFNLMDEKFEANWKDAQEASDIVGKHLSYPEKVSALDN
FT                   GGVNESKLATEPHNEIKDKLNKITDLSKKYNSYLQQIEKSINEIVAKDQQLAGQIGDLI
FT                   "
FT   CDS_pept        85132..85458
FT                   /transl_table=11
FT                   /locus_tag="SAS0076"
FT                   /product="hypothetical protein"
FT                   /note="Poor database matches. Weakly similar to
FT                   Streptococcus agalactiae hypothetical protein gbs1827
FT                   SWALL:Q8E3D2 (EMBL:AL766853) (130 aa) fasta scores: E():
FT                   5.7, 25.77% id in 97 aa"
FT                   /protein_id="CAG41843.1"
FT                   /translation="MFEEYKKIDDLENAYEIELKRIEREIQNLSDLKYHLRRENEQSYD
FT                   AFLYLKNKMNYSEESNAKVRRLVEEFDYEADTYIRQKELKLEDYKEEIRREYIQQSEKI
FT                   MEAK"
FT   CDS_pept        85462..85773
FT                   /transl_table=11
FT                   /locus_tag="SAS0077"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAG41844.1"
FT                   /translation="MGIPDPLSNPMSDPLLGDSWMVGDLKKRQEKKLITTVIAPEHDEK
FT                   HRENKSKMKKSEKQLINQLINHGHTFKSDFKNVAKGDWVNKAMQDLDKLGNELKKIMN"
FT   CDS_pept        86025..88262
FT                   /transl_table=11
FT                   /locus_tag="SAS0078"
FT                   /product="putative regulatory protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0107"
FT                   /db_xref="GOA:Q6GD21"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GD21"
FT                   /protein_id="CAG41845.1"
FT                   /translation="MQRDYLIRVETESMPDFKRLNGLMIGFVIKGEAHIYDENNMTQCN
FT                   SGDIFIINHRDLYRFQLQQDGIICYIQFQMKYLADKFDDAHCLYFHLTDATTTKNIHQL
FT                   RNIMARLVSTHIRHNELSKLTEQQLVIQLLMHMIHYVPRTYHSNQSILNDDKVNQVCDY
FT                   IELHFHEDLSLSELSEYVGWSESHLSKKFTESLGVGFQHFLNTTRIEHAKLDLTYTDET
FT                   ITDIALQNGFSSAASFARTFKHFTHQTPKQYRGDRPAITENQQSAQHNYHDRELILLLN
FT                   DYIEEMNHFIEDIEKMNYKEIAFKPTNQQLNQFNHIIQVGYLRNLLNTQYQSQLLTCHH
FT                   DFQVNEVLAYDVMPYIMKKLNAPFTYDAEISNIFYDIDLCLDFLLDHNFSLTMHLNQYD
FT                   SRDYIDAFKVFIHHVALHVSHRKDLKFNLYVTTLHNALIEMIDYFKALFPNGGLYIHLD
FT                   QATERHLPLLKRLEPHIDHFVFDANSNDAVDFNKMNDDEFKTASQMIINKTNYFIDLIH
FT                   RHNLKRPLILLNWNTLTGDTFITNGEYFRGGIIIEQLLKLSSKVEGIGYWLNYDLHVSH
FT                   CKNERDYMNSIELFHQYNGKRPVYFTALLFNKLTSNILYSDDTCIVTGTDSNFQILLYD
FT                   AKHFNPYLALDNQMNMRATEMIHLNINALEEGMYKIKHFTLDKENGALFNLWRKHHTIH
FT                   GMDKDSIDYVNRMSFPKLEVYDIDITDTLALNIKMITNGIHLIEVKRYPSS"
FT   misc_feature    86499..86639
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   33.6, E-value 4.9e-07"
FT   misc_feature    86538..86603
FT                   /note="Predicted helix-turn-helix motif for SAS0078 with
FT                   score 1807.000, SD 5.34 at aa 172-193, sequence
FT                   LSLSELSEYVGWSESHLSKKFT"
FT   misc_feature    86655..86789
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   37.2, E-value 4e-08"
FT   CDS_pept        88413..89591
FT                   /transl_table=11
FT                   /locus_tag="SAS0079"
FT                   /product="putative peptidase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0108"
FT                   /protein_id="CAG41846.1"
FT                   /translation="MNQQLIETLKSKEGKMIEIRRYLHQHPELSFHEDETAKYIAEFYK
FT                   GKDVEVETNIGPRGIKVTIDSGKPGKTLAIRADFDALPITEDTGLSFASQNKGVMHACG
FT                   HDAHTAYMLVLAETLAEMKDSFTGKVVVIHQPAEEVPPGGAKAMIENGVLDGVDHVLGV
FT                   HVMSTMKTGNVYYRPGYVQTGRAFFKLKVQGKGGHGSSPHMANDAIVAGSYFVTALQTV
FT                   VSRRLSPFETGVVTIGSFDGKGQFNVIKDVVEIEGDVRGLTDATKATIETEIKRLSKGL
FT                   EALYGVTCTLEYNDDYPALYNDPEFTEYVAKTLKEANLDFGVEICEPQPPSEDFAYYAK
FT                   ERPSAFIYTGAAVEDGEIYPHHHPKFNISEKSLLISAEAVGTVVLDYLKGDN"
FT   misc_feature    88449..89573
FT                   /note="Pfam match to entry PF01546 Peptidase_M20, Peptidase
FT                   family M20/M25/M40, score 376.0, E-value 4e-110"
FT   CDS_pept        89593..90981
FT                   /transl_table=11
FT                   /locus_tag="SAS0080"
FT                   /product="putative transporter protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0109"
FT                   /protein_id="CAG41847.1"
FT                   /translation="MNETYRGGNKLILGIVLGVITFWLFAQSLVNVVPNLQQSFGADMG
FT                   TISIAVSLTALFSGMFVVGAGGLADKIGRVKMTNIGLLLSIIGSALIIITNLPALLILG
FT                   RIIQGVSAACIMPSTLAIMKTYYEGAERQRALSYWSIGSWGGSGICSLFGGAVATTMGW
FT                   RWIFIFSIIVAVLSMLLIKGTPETKSEVTNTHKFDVAGLIVLVVMLLSLNVVITKGAAL
FT                   GYTSLWFFGLIAIVIVAFFIFLKVEKKVDNPLIDFKLFENKPYTGATISNFLLNGVAGT
FT                   LIVANTFVQQGLGYTALQAGYLSITYLIMVLLMIRVGEKLLQKMGSKRPMLLGTFIVVI
FT                   GIALISLVFLPGIFYVISCVVGYLCFGLGLGIYATPSTDTAISNAPLDKVGVASGIYKM
FT                   ASSLGGAFGVAISGAVYAGAVAATSIHTGAMIALWVNVLMGIMAFIAILFAIPNDDKRV
FT                   KDAK"
FT   misc_feature    89593..89715
FT                   /note="Signal peptide predicted for SAS0080 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.950) with cleavage site
FT                   probability 0.596 between residues 41 and 42"
FT   misc_feature    order(89611..89670,89728..89796,89830..89898,89908..89961,
FT                   89998..90066,90076..90135,90193..90261,90271..90324,
FT                   90385..90447,90475..90543,90580..90639,90649..90717,
FT                   90799..90867,90880..90948)
FT                   /note="14 probable transmembrane helices predicted for
FT                   SAS0080 by TMHMM2.0 at aa 7-26, 46-68, 80-102, 106-123,
FT                   136-158, 162-181, 201-223, 227-244, 265-285, 295-317,
FT                   330-349, 353-375, 403-425 and 430-452"
FT   misc_feature    90646..90708
FT                   /note="PS00079 Multicopper oxidases signature 1."
FT   CDS_pept        complement(91468..93135)
FT                   /transl_table=11
FT                   /locus_tag="SAS0081"
FT                   /product="putative Na+/Pi-cotransporter protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0110"
FT                   /protein_id="CAG41848.1"
FT                   /translation="MEMSVTEVIFSFLGGLGIFLYGLKIMGDGLQASAGDRLRDILNKF
FT                   TSNPVLGVIAGIVVTILIQSSSGTTVITIGLVTAGFMTLKQAIGVIMGANIGTTVTAFI
FT                   IGIDLGEYAMPILALGAFLIFFFKRSKINNIGRILFGFGSLFFGLEFMGDAVKPLASLD
FT                   GFKQLMLDMSSNPILAVIVGAGLTALVQSSSATIGILQEFYQQDLISLNAAIPVLLGDN
FT                   IGTTITAILASLAGSIAAKRAALVHVIFNLIGVIIFTIFLPVVIHLISLLQDVWHLKPA
FT                   MTIAVSHGIFNITNTLIQLPFVAGLAWIVTKLVPGKDIADDYKPQHLNKDLVYHAPGVA
FT                   LQETQKELQNVGQIVLSMFEDIREITKDDKKLIKKLEQKHQAVETINDSIRNYLVRIST
FT                   KAITKADVERLAVMFDVNRSILKVAELTEEYVAQLKRQHDEDIRITEDAQRGMDKLFNH
FT                   VAESFDKAIDMLDVYDKTKKDEIVERSRESFNIEHKLRKGHIKRLNRGECTTKGGLLYI
FT                   DMIGVLERIGYHSRNVSEALVGLNDDVPTDEEIATTEI"
FT   misc_feature    complement(order(92203..92271,92329..92397,92440..92508,
FT                   92542..92610,92668..92736,92755..92802,92815..92874,
FT                   92911..92979,93055..93123))
FT                   /note="9 probable transmembrane helices predicted for
FT                   SAS0081 by TMHMM2.0 at aa 5-27, 53-75, 88-107, 112-127,
FT                   134-156, 176-198, 210-232, 247-269 and 289-311"
FT   misc_feature    complement(92254..92610)
FT                   /note="Pfam match to entry PF02690 Na_Pi_cotrans,
FT                   Na+/Pi-cotransporter, score 1.8, E-value 0.00013"
FT   misc_feature    complement(92611..93084)
FT                   /note="Pfam match to entry PF02690 Na_Pi_cotrans,
FT                   Na+/Pi-cotransporter, score 263.1, E-value 4e-76"
FT   CDS_pept        complement(93453..95228)
FT                   /transl_table=11
FT                   /locus_tag="SAS0082"
FT                   /product="putative myosin-crossreactive antigen"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0111"
FT                   /protein_id="CAG41849.1"
FT                   /translation="MYYSYGNYEAFARPKKPENVENKSAYLIGSGLASLAAACFLIRDG
FT                   QMEGSKIHILEELPKAGGSLDGENMPLKGYVVRGGREMENHFECLWDLFRSIPSLEIDN
FT                   ASVLDEFYWLNKEDPNYSRCRVIEKQGQRLVTDGDFTLTKKAIKEILDLCLTNEEDLDD
FT                   VKITDVFSDDFFNSNFWIYWKTMFAFEPWHSAMEMRRYLMRFVHHIGGLADFSALKFTK
FT                   YNQYESLVLPMVEYLKSHGVQFEYGVKVEDIKVDVTTSQKIAREILIHRHGKAESIKLT
FT                   VDDLVFVTNGSITESSTYGDNDTPAPPTDELGGSWTLWKNLARQSPEFGNPDKFCQNIP
FT                   QKSWFVSATSTTNNKDIIDTIESICKRDPLAGKTVTGGIITINDSAWQISFTINRQQQF
FT                   KDQPKNEISTWIYALYSDVNGDYIKKPITECSGNEICQEWLYHLGVPTDKIEDLAKHAS
FT                   NTIPVYMPYITSYFMTRAIGDRPLVVPHQSQNLAFIGNFAETERDTVFTTEYSVRTAME
FT                   AVYQLLNIDRGIPEVINSTFDLRVLMDAIYELNDHQDLREITKDSKMQKLALAGFLKKI
FT                   KGTYIESLLKEHKLL"
FT   misc_feature    complement(93669..95168)
FT                   /note="Pfam match to entry PF06100 Strep_67kDa_ant,
FT                   Streptococcal 67 kDa myosin-cross-reactive antigen like
FT                   family, score 1416.7, E-value 0"
FT   CDS_pept        95579..96052
FT                   /transl_table=11
FT                   /locus_tag="SAS0083"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0112"
FT                   /protein_id="CAG41850.1"
FT                   /translation="MSKIRSFTILSLLIYLAMMCYTVVTYSKLPTKVPIHYNLAGDADN
FT                   FADKWVLLLINSAFIVIWLIFFIAGRYYERFAKWSHYNHTPREIRAIKLFLSTLNLEIM
FT                   SYMSIFTVLEIWQIQHHHQFNLLWFNMIFIIIIGLTLVIFCLLPTIHKMRDSQ"
FT   misc_feature    95579..95659
FT                   /note="Signal peptide predicted for SAS0083 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.971) with cleavage site
FT                   probability 0.606 between residues 27 and 28"
FT   misc_feature    order(95597..95656,95729..95797,95858..95926,95954..96022)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SAS0083 by TMHMM2.0 at aa 7-26, 51-73, 94-116 and 126-148"
FT   CDS_pept        96314..97906
FT                   /transl_table=11
FT                   /locus_tag="SAS0084"
FT                   /product="L-lactate permease 1"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0113"
FT                   /protein_id="CAG41851.1"
FT                   /translation="MTLLTVNPFDNVGLSALVAAVPIILFLLCLTVFKMKGIYAALTTL
FT                   VVTLIVALFVFELPVRVSAGAITEGVVAGIFPIGYIVLMAVWLYKVSIKTGQFSIIQDS
FT                   IASISEDQRIQLLLIGFCFNAFLEGAAGFGVPIAICAVLLIQLGFEPLKAAMLCLIANG
FT                   AAGAFGAIGLPVSIIDTFNLSGGVTTLDVARYSALTLPILNFIIPFVLVFVIDGMKGIK
FT                   EILPVILTVSGTYTGLQLLLTIFHGPELADIIPSLATMVVLAFVCRKFKPKNIFRLKES
FT                   EHKIQKRTPKEIVFAWSPFVILTAFVLVWSAPFFKKLFQPGGALESLVIKLPIPNTVSD
FT                   LSPKGIALRLDLIGATGTAILLTVIITILITKLKWKSAGALLVEAIKELWLPILTISAI
FT                   LAIAKVMTYGGLTVAIGQGIAKAGAIFPLFSPVLGWIGVFMTGSVVNNNTLFAPIQATV
FT                   AQQISTSGSLLVAANTAGGVAAKLISPQSIAIATAAVKKVGEESALLKMTLKYSIIFVA
FT                   FICVWTFILTLIF"
FT   misc_feature    96314..96433
FT                   /note="Signal peptide predicted for SAS0084 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.807) with cleavage site
FT                   probability 0.671 between residues 40 and 41"
FT   misc_feature    order(96347..96415,96425..96493,96512..96580,96692..96760,
FT                   96779..96847,96890..96958,96983..97051,97061..97114,
FT                   97190..97258,97355..97423,97484..97552,97580..97648,
FT                   97847..97900)
FT                   /note="13 probable transmembrane helices predicted for
FT                   SAS0084 by TMHMM2.0 at aa 12-34, 38-60, 67-89, 127-149,
FT                   156-178, 193-215, 224-246, 250-267, 293-315, 348-370,
FT                   391-413, 423-445 and 512-529"
FT   misc_feature    96353..97891
FT                   /note="Pfam match to entry PF02652 Lactate_perm, L-lactate
FT                   permease, score 654.5, E-value 5.7e-194"
FT   misc_feature    97859..97888
FT                   /note="PS00904 Protein prenyltransferases alpha subunit
FT                   repeat signature."
FT   CDS_pept        complement(98235..99713)
FT                   /transl_table=11
FT                   /locus_tag="SAS0085"
FT                   /product="immunoglobulin G binding protein A precursor"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0114"
FT                   /protein_id="CAG41852.1"
FT                   /translation="MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQN
FT                   AFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQ
FT                   QSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQ
FT                   NAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQN
FT                   AFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNA
FT                   FYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDNNKPGKEDGN
FT                   KPGKEDGNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNNKPGKEDGNGVH
FT                   VVKPGDTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQAL
FT                   PETGEENPFIGTTVFGGLSLALGAALLAGRRREL"
FT   misc_feature    complement(98244..98366)
FT                   /note="Pfam match to entry PF00746 Gram_pos_anchor, Gram
FT                   positive anchor, score 43.4, E-value 5.2e-10"
FT   misc_feature    complement(98325..98342)
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT   misc_feature    complement(98388..98519)
FT                   /note="Pfam match to entry PF01476 LysM, LysM domain, score
FT                   59.6, E-value 7.2e-15"
FT   misc_feature    complement(98523..98546)
FT                   /note="Pfam match to entry PF03373 Octapeptide, Octapeptide
FT                   repeat, score 7.9, E-value 1.1"
FT   misc_feature    complement(98547..98570)
FT                   /note="Pfam match to entry PF03373 Octapeptide, Octapeptide
FT                   repeat, score 10.2, E-value 0.24"
FT   misc_feature    complement(98571..98594)
FT                   /note="Pfam match to entry PF03373 Octapeptide, Octapeptide
FT                   repeat, score 9.0, E-value 0.51"
FT   misc_feature    complement(98595..98618)
FT                   /note="Pfam match to entry PF03373 Octapeptide, Octapeptide
FT                   repeat, score 9.4, E-value 0.4"
FT   misc_feature    complement(98619..98642)
FT                   /note="Pfam match to entry PF03373 Octapeptide, Octapeptide
FT                   repeat, score 9.0, E-value 0.51"
FT   misc_feature    complement(98643..98666)
FT                   /note="Pfam match to entry PF03373 Octapeptide, Octapeptide
FT                   repeat, score 10.2, E-value 0.24"
FT   misc_feature    complement(98667..98690)
FT                   /note="Pfam match to entry PF03373 Octapeptide, Octapeptide
FT                   repeat, score 9.0, E-value 0.51"
FT   misc_feature    complement(98691..98714)
FT                   /note="Pfam match to entry PF03373 Octapeptide, Octapeptide
FT                   repeat, score 9.0, E-value 0.51"
FT   misc_feature    complement(98715..98738)
FT                   /note="Pfam match to entry PF03373 Octapeptide, Octapeptide
FT                   repeat, score 8.7, E-value 0.62"
FT   misc_feature    complement(98745..98906)
FT                   /note="Pfam match to entry PF02216 B, B domain, score
FT                   120.3, E-value 3.8e-33"
FT   misc_feature    complement(98919..99080)
FT                   /note="Pfam match to entry PF02216 B, B domain, score
FT                   124.8, E-value 1.6e-34"
FT   misc_feature    complement(99093..99254)
FT                   /note="Pfam match to entry PF02216 B, B domain, score
FT                   124.1, E-value 2.7e-34"
FT   misc_feature    complement(99267..99428)
FT                   /note="Pfam match to entry PF02216 B, B domain, score
FT                   127.2, E-value 3.2e-35"
FT   misc_feature    complement(99450..99611)
FT                   /note="Pfam match to entry PF02216 B, B domain, score
FT                   124.1, E-value 2.7e-34"
FT   misc_feature    complement(99606..99713)
FT                   /note="Signal peptide predicted for SAS0085 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.783 between residues 36 and 37"
FT   misc_feature    complement(99612..99680)
FT                   /note="1 probable transmembrane helix predicted for SAS0085
FT                   by TMHMM2.0 at aa 12-34"
FT   misc_feature    complement(99633..99713)
FT                   /note="Pfam match to entry PF04650 YSIRK_signal, YSIRK type
FT                   signal peptide, score 42.9, E-value 7.7e-10"
FT   CDS_pept        complement(100134..100886)
FT                   /transl_table=11
FT                   /locus_tag="SAS0086"
FT                   /product="putative regulatory protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0115"
FT                   /db_xref="GOA:Q6GD13"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR010166"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GD13"
FT                   /protein_id="CAG41853.1"
FT                   /translation="MKYNNHDKIRDFIIIEAYMFRFKKKVKPEVDMTIKEFILLTYLFH
FT                   QQENTLPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKI
FT                   AERVTLFDQIIKQFNLADQSESQMIPKDSKEFLNLMMYTMYFKNIIKKHLTLSFVEFTI
FT                   LAIITSQNKNIVLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERSTEDERKILIHMDD
FT                   AQQDHAEQLLAQVNQLLADKDHLHLVFE"
FT   CDS_pept        complement(101255..102253)
FT                   /transl_table=11
FT                   /locus_tag="SAS0087"
FT                   /product="putative siderophore transport system permease"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0116"
FT                   /protein_id="CAG41854.1"
FT                   /translation="MTEKINKKDNYHLIFALIFLAIVSVVSMMSGSSFIPLQRVLMYFI
FT                   NPNDSMDQFTLEVLRLPRITLAILAGAALGMSGLMLQNVLKNPIASPDIIGITGGASLS
FT                   AVVFIAFFSHLTIHLLPLFAVLGGAIAMMILLVFQTKGQIRPTTLIIIGISMQTLFIAL
FT                   VQGLLITTKQLSAAKAYTWLVGSLYGATFKDTIILGMVILAVVPLLFLVIPKMKISILD
FT                   DPVAIGLGLHVQRMKLIQLITSTILVSMAISLVGNIGFVGLIAPHIAKTIVRGSYAKKL
FT                   LMSAMIGAISIVIADLIGRTLFLPKEVPAGVFIAAFGAPFFIYLLLTVKKL"
FT   misc_feature    complement(order(101267..101326,101345..101413,
FT                   101456..101524,101615..101683,101741..101809,
FT                   101843..101911,101921..101974,102011..102079,
FT                   102149..102217))
FT                   /note="9 probable transmembrane helices predicted for
FT                   SAS0087 by TMHMM2.0 at aa 13-35, 59-81, 94-111, 115-137,
FT                   149-171, 191-213, 244-266, 281-303 and 310-329"
FT   misc_feature    complement(101270..102163)
FT                   /note="Pfam match to entry PF01032 FecCD, FecCD transport
FT                   family, score 271.5, E-value 1.1e-78"
FT   misc_feature    complement(102158..102253)
FT                   /note="Signal peptide predicted for SAS0087 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.877) with cleavage site
FT                   probability 0.411 between residues 32 and 33"
FT   CDS_pept        complement(102250..103245)
FT                   /transl_table=11
FT                   /locus_tag="SAS0088"
FT                   /product="putative siderophore transport system permease"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0117"
FT                   /protein_id="CAG41855.1"
FT                   /translation="MLLKPKYQIVIAGLCLAIVAILSLMIGNTLVSPGTVIQALFNFDS
FT                   ENDLHDVVTGARASRTIIALLTGAALAVSGLLMQALTRNPIASPGLFGVNAGAVFFVIF
FT                   SITFIQIQSFKMIVVIAFLGAIVVTVLVVALGMFRQTLFSPHRVILAGAAIAMLFTAFT
FT                   QGILIMNETDLQGLLFWLSGSVSLRNIWDIPWIIPLVLILILIAFSMAAHINILMTSDD
FT                   IAIGLGQNIKLIKWMIIMLISMLAGISVAVAGAIVFVGLIVPNISKRLLPPNYKYLIPF
FT                   TALAGAILMIISDIVARIIIKPLELPIGVVTAVIGAIVLIYIMKKGRQRL"
FT   misc_feature    complement(102268..103167)
FT                   /note="Pfam match to entry PF01032 FecCD, FecCD transport
FT                   family, score 333.1, E-value 3.4e-97"
FT   misc_feature    complement(order(102274..102327,102346..102414,
FT                   102457..102525,102595..102663,102736..102804,
FT                   102841..102900,102910..102978,103015..103074,
FT                   103153..103221))
FT                   /note="9 probable transmembrane helices predicted for
FT                   SAS0088 by TMHMM2.0 at aa 9-31, 58-77, 90-112, 116-135,
FT                   148-170, 195-217, 241-263, 278-300 and 307-324"
FT   misc_feature    complement(103153..103245)
FT                   /note="Signal peptide predicted for SAS0088 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.500 between residues 31 and 32"
FT   CDS_pept        complement(103261..104253)
FT                   /transl_table=11
FT                   /locus_tag="SAS0089"
FT                   /product="lipoprotein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0118"
FT                   /protein_id="CAG41856.1"
FT                   /translation="MNKVIKMLVVTLAFLLVLAGCSGNSNKQSSDNKDKETTSIKHAMG
FT                   TTEIKGKPKRVVTLYQGATDVAVSLGVKPVGAVESWTQKPKFEYIKNDLKDTKIVGQEP
FT                   APNLEEISKLKPDLIVASKVRNEKVYDQLSKIAPTVSTDTVFKFKDTTKLMGKALGKEK
FT                   EAEDLLKKYDDKVAAFQKDAKAKYKDAWPLKASVVNFRADHTRIYAGGYAGEILNDLGF
FT                   KRNKDLQKQVDNGKDIIQLTSKESIPLMNADHIFVVKSDPNAKDAALVKKTESEWTSSK
FT                   EWKNLDAVKNNQVSDDLDEITWNLAGGYKSSLKLIDDLYEKLNIEKQSK"
FT   misc_feature    complement(103360..104097)
FT                   /note="Pfam match to entry PF01497 Peripla_BP_2,
FT                   Periplasmic binding protein, score 176.6, E-value 4.2e-50"
FT   misc_feature    complement(104173..104253)
FT                   /note="Signal peptide predicted for SAS0089 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.641 between residues 27 and 28"
FT   misc_feature    complement(104191..104223)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        104484..105464
FT                   /transl_table=11
FT                   /locus_tag="SAS0090"
FT                   /product="pyridoxal-phosphate dependent enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0119"
FT                   /db_xref="GOA:Q6GD09"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR023927"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GD09"
FT                   /protein_id="CAG41857.1"
FT                   /translation="MIEKSQACHDSLLDSVGQTPMVQLHQLFPKHEVFAKLEYMNPGGS
FT                   MKDRPAKYIIEHGIKHGLITENTHLIESTSGNLGIALAMIAKIKGLKLTCVVDPKISPT
FT                   NLKIIKSYGANVEMVEEPDAHGGYLMTRIAKVQELLATIDDAYWINQYANELNWQSHYH
FT                   GAGTEIVETIKQPIDYFVAPVSTTGSIMGMSRKIKEVHPNAQIVAVDAKGSVIFGDKPI
FT                   NRELPGIGASRVPEILNRSEINQVIHVDDYQSALGCRKLIDYEGIFAGGSTGSIIAAIE
FT                   QLITSIEEGATIVTILPDRGDRYLDLVYSDTWLEKMKSRQGVKSE"
FT   misc_feature    104517..105383
FT                   /note="Pfam match to entry PF00291 PALP,
FT                   Pyridoxal-phosphate dependent enzyme, score 271.1, E-value
FT                   1.5e-78"
FT   CDS_pept        105461..106471
FT                   /transl_table=11
FT                   /locus_tag="SAS0091"
FT                   /product="putative ornithine cyclodeaminase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0120"
FT                   /protein_id="CAG41858.1"
FT                   /translation="MNREMLYLNRSDIEQAGGNHSQVYVDALTEALTAHAHNDFVQPLK
FT                   PYLRQDPENGHIADRIIAMPSHIGGEHAISGIKWIGSKHDNPSKRNMERASGVIILNDP
FT                   ETNYPIAVMEASLISSMRTAAVSVIAAKHLAKKGFKDLTIIGCGLIGDKQLQSMLEQFD
FT                   HIERVFVYDQFSEACARFVDRWQQQRPEINFIATENAKEAVSNGEVVITCTVTDQPYIE
FT                   YDWLQKGAFISNISIMDVHKEVFIKADKVVVDDWSQCNREKKTINQLVLEGKFSKEALH
FT                   AELGQLVTGDIPGREDDDEIILLNPMGMAIEDISSAYFIYQQAQQQNIGTTLNLY"
FT   misc_feature    105467..106444
FT                   /note="Pfam match to entry PF02423 ODC_Mu_crystall,
FT                   Ornithine cyclodeaminase/mu-crystallin family, score 178.5,
FT                   E-value 1.1e-50"
FT   CDS_pept        106492..108246
FT                   /transl_table=11
FT                   /locus_tag="SAS0092"
FT                   /product="putative siderophore biosynthesis protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0121"
FT                   /protein_id="CAG41859.1"
FT                   /translation="MQNHTAVNTAQTIILRDLVDALLFEDIAGIVSNSDITKENGQTLL
FT                   IYERETQQIKIPVYFSALNMFRYESSQPITIEGRASKQPLTAAEFWQTIANMNCDLSHE
FT                   WEVARVEEGLTTAATQLAKQLSELDLASHPFVMSEQFASLKDRPFHPLAKEKRGLREAD
FT                   YQVYQAELNQSFPLMVAAVKKTHMIHGDTANIDELENLTAPIKEQATDMLNDQGLSIDD
FT                   YVLFPVHPWQYQHILPNVFAKEISEKLVVLLPLKFGDYLSSSSMRSLIDIGAPYNHVKV
FT                   PFAMQSLGALRLTPTRYMKNGEQAEQLLRQLIEKDEALAKYVMVCDETAWWSYMGQDND
FT                   IFKDQLGHLTVQLRKYPEVLAKNDTQQLVSMAALAANDRTLYQMICGKDNISKNDVMTL
FT                   FEDIAQVFLKVTLSFMQYGALPELHGQNILLSFEDGRVQKCVLRDHDTVRIYKPWLTAH
FT                   QLSLPKYVVREDTPNTLINEDLETFFAYFQTLAVSVNLYAIIDAIQDLFGVSEHELMSL
FT                   LKQILKNEVATISWVTTDQLAVRHILFDKQTWPFKQILLPLLYQRDSGGGSMPSGLTTV
FT                   PNPMVTYD"
FT   misc_feature    106882..108237
FT                   /note="Pfam match to entry PF04183 IucA_IucC, IucA / IucC
FT                   family, score 600.6, E-value 9.7e-178"
FT   CDS_pept        108239..109495
FT                   /transl_table=11
FT                   /locus_tag="SAS0093"
FT                   /product="putative transport protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0122"
FT                   /protein_id="CAG41860.1"
FT                   /translation="MINQSIWRSNFRILWLSQFIAIAGLTVLVPLLPIYMASLQNLSVV
FT                   EIQLWSGIAIAAPAVTTMIASPIWGKLGDKISRKWMVLRALLGLAVCLFLMALCTTPLQ
FT                   FVLVRLLQGLFGGVVDASSAFASAEAPAEDRGKVLGRLQSSVSAGSLVGPLIGGVTASI
FT                   LGFSALLMSIAVITFIVCIFGALKLIETTHMPKSQTPNINKGIRRSFQCLLCTQQTCRF
FT                   IIVGVLANFAMYGMLTALSPLASSVNHTAIDDRSVIGFLQSAFWTASILSAPLWGRFND
FT                   KSYVKSVYIFATIACGCSAILQGLATNIEFLMAARILQGLTYSALIQSVMFVVVNACHQ
FT                   QLKGTFVGTTNSMLVVGQIIGSLSGAAITSYTTPATTFIVMGVVFAVSSLFLICSTITN
FT                   QINDHTLMKLWELKQKSAK"
FT   misc_feature    108239..108406
FT                   /note="Signal peptide predicted for SAS0093 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.803) with cleavage site
FT                   probability 0.509 between residues 56 and 57"
FT   misc_feature    order(108275..108343,108386..108454,108491..108559,
FT                   108728..108796,108902..108970,109013..109066,
FT                   109100..109159,109187..109255,109274..109342,
FT                   109370..109429)
FT                   /note="10 probable transmembrane helices predicted for
FT                   SAS0093 by TMHMM2.0 at aa 13-35, 50-72, 85-107, 164-186,
FT                   222-244, 259-276, 288-307, 317-339, 346-368 and 378-397"
FT   misc_feature    108284..109462
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter, score -84.1, E-value 0.00035"
FT   CDS_pept        109485..111221
FT                   /transl_table=11
FT                   /locus_tag="SAS0094"
FT                   /product="putative siderophore biosynthesis protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0123"
FT                   /protein_id="CAG41861.1"
FT                   /translation="MQNKELIQHAAYAAIERILNEYFREENLYQVPPQNHQWSIQLSEL
FT                   ETLTGEFRYWSAMGHHMYHPEVWLIDGKSKKITTYKEAIARILQHMAQSADNQTAVQQH
FT                   MAQIMSDIDNSIHRTARYLQSNTIDYVEDRYIVSEQSLYLGHPFHPTPKSASGFSEADL
FT                   EKYAPECHTSFQLHYLAVHQDVLLTRYVEGKEDQVEKVLYQLADIDISEIPKNFILLPT
FT                   HPYQINVLRQHPQYMQYSEQGLIKDLGVSGDSVYPTSSVRTVFSKALNIYLKLPIHVKI
FT                   TNFIRTNDLEQIERTIDAAQVIASVKDEVETPHFKLMFEEGYRALLPNPLGQTVEPEMD
FT                   LLTNSAMIVREGIPNYHADKDIHVLASLFETMPDSPMSKLSQVIEQSGLAPEAWLECYL
FT                   NRTLLPILKLFSNTGISLEAHVQNTLIELKDGIPDVCFVRDLEGICLSRTIATEKQLVP
FT                   NVVAASSPVVYAHDEAWHRLKYYVVVNHLGHLVSTIGKATRNEVVLWQLVAHRLMTWKK
FT                   EYANNAVFVDCVEDLYQTPTIAAKANLMSKLNDCGANPIYTHIPNPICHNKEVSYCESN
FT                   NS"
FT   misc_feature    109875..111182
FT                   /note="Pfam match to entry PF04183 IucA_IucC, IucA / IucC
FT                   family, score 601.7, E-value 4.6e-178"
FT   CDS_pept        111202..112980
FT                   /transl_table=11
FT                   /locus_tag="SAS0095"
FT                   /product="putative siderophore biosynthesis protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0124"
FT                   /protein_id="CAG41862.1"
FT                   /translation="MNQTILNRVKTRVMHQLVSSLIYENIVVYKASYQDGAGHFTIEGH
FT                   DSEYRFTAEKTHSFDRIRITSPIERVVGDEADTTTDYTQLLREVVFTFPKNDEKLEQFI
FT                   VELLQTELKDTQSMQYRESNPPATPETFNDYEFYAMEGHQYHPSYKSRLGFTLSDNLKF
FT                   GPDFVPNVKLQWLAIDKDKVETTVSRNVVVNEMLRQQVGDKTYEHFVQQIEASGKHVND
FT                   VEMIPVHPWQFEHVIQVDLAEERLNGTVLWLGESDELYHPQQSIRTMSPIDTTKYYLKV
FT                   PISITNTSTKRVLAPHTIENAAQITDWLKQIQQQDTYLKDELKTAFLGEVLGQSYLNTQ
FT                   LSPYKQTQVYGALGVIWRENIYHMLIDEEDAIPFNALYASDKDGVPFIENWIKQYGSEA
FT                   WTKQFLAVAIRPMIHMLYYHGIAFESHAQNMMLIHENGWPTRIALKDFHDGVRFKREHL
FT                   SEAASHLTLKPMPEAHKKVNSNSFIETDDERLVRDFLHDAFFFINIAEIILFIEKQYGI
FT                   DEQRQWQWVKDIIEAYQEAFPELNNYQHFDLFEPTIQVEKLTTRRLLSDSELRIHHVTN
FT                   PLGVGGINDATTISET"
FT   misc_feature    111583..112941
FT                   /note="Pfam match to entry PF04183 IucA_IucC, IucA / IucC
FT                   family, score 695.8, E-value 2.1e-206"
FT   CDS_pept        112955..113731
FT                   /transl_table=11
FT                   /locus_tag="SAS0096"
FT                   /product="putative aldolase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0125"
FT                   /protein_id="CAG41863.1"
FT                   /translation="MQQLSLKHRLNNGDSVYGIFNSIPDPLMIEVIAASGYDFVVIDTE
FT                   HVAINDETLAHLIRAAEAAHIIPIVRVTAVIDRDIIKVLDMGARGIIVPHVKDRETVEH
FT                   IVKLSRYYPQGLRSLNGGRMARFGRTPLLDAMEMANEHIMVIAMIEDVEGVMAIDDIAQ
FT                   VEGLDMIVEGAADLSQSLGIPWQTRDDQVTSHVQHIFEVVNAHGKHFCALPREDEDIAK
FT                   WQAQGVQTFILGDDRGKIYRHLSASLATSKQKGDDG"
FT   misc_feature    112967..113710
FT                   /note="Pfam match to entry PF03328 HpcH_HpaI, HpcH/HpaI
FT                   aldolase family, score 106.6, E-value 4.9e-29"
FT   CDS_pept        113731..114933
FT                   /transl_table=11
FT                   /locus_tag="SAS0097"
FT                   /product="pyridoxal-dependent decarboxylase decarboxylase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0126"
FT                   /protein_id="CAG41864.1"
FT                   /translation="MRIVQPVIEQLKAQSHPVCHYIYDLVGLEHHLQHITLSLPSNCQM
FT                   YYAMKANSERTILDTISQYVEGFEVASQGEIAKGLAFKPANHIIFGGPGKTDEELRYAV
FT                   SEGVQRIHVESMHELQRLNAILEDEDKTQHILLRVNLAGPFPNATLHMAGRPTQFGISE
FT                   DEVDDVIEAALAMPNIHLDGFHFHSISNNLDSNLHVDVVKLYFKKAKSWSEKHRFPLKH
FT                   INLGGGIGVNYADLTSQFEWDNFVENFKTLIVEQEMEDVTLNFECGRFIVAHIGYYVTE
FT                   VLDIKKVHGAWYAILRGGTQQFRLPVSWQHNHPFEIYRYKDNPYSFEKVSISRQDTTLV
FT                   GQLCTPKDVFAREVQIDAISTGDVIVFKYAGAYGWSISHHDFLSHPHPEFIYLTQTKED
FT                   E"
FT   misc_feature    113800..114552
FT                   /note="Pfam match to entry PF02784 Orn_Arg_deC_N,
FT                   Pyridoxal-dependent decarboxylase, pyridoxal binding
FT                   domain, score 88.0, E-value 2e-23"
FT   misc_feature    114367..114420
FT                   /note="PS00879 Orn/DAP/Arg decarboxylases family 2
FT                   signature 2."
FT   misc_feature    114559..114912
FT                   /note="Pfam match to entry PF00278 Orn_DAP_Arg_deC,
FT                   Pyridoxal-dependent decarboxylase, C-terminal sheet domain,
FT                   score -7.2, E-value 6e-05"
FT   misc_feature    114580..114615
FT                   /note="PS00213 Lipocalin signature."
FT   CDS_pept        114937..115701
FT                   /transl_table=11
FT                   /locus_tag="SAS0098"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0127"
FT                   /protein_id="CAG41865.1"
FT                   /translation="MNHIHEHLKLVPVDKIDLHETFEPLRLEKTKSSIEADDFIRHPIL
FT                   VTAMQHGRYMVIDGVHRYTSLKALGCKKVPVQEIHETQYSISTWQHKVPFGVWWETLQQ
FT                   EHRLPWTTETRQEAPFITMCHGDTEQYLYTKDLGEAHFQVWEKVVASYSGCCSVERIAQ
FT                   GTYPCLSQQDVLMKYQPLSYKEIEAVVHKGETVPAGVTRFNISGRCLNLQVPLALLKQD
FT                   DDVEQLRNWKQFLADKFANMRCYTEKVYLVEQ"
FT   misc_feature    114961..115164
FT                   /note="Pfam match to entry PF02195 ParBc, ParB-like
FT                   nuclease domain, score 33.9, E-value 2.6e-09"
FT   CDS_pept        115897..116304
FT                   /transl_table=11
FT                   /locus_tag="SAS0099"
FT                   /product="putative membrane protein"
FT                   /note="Poor database matches. Weakly similar to Clostridium
FT                   acetobutylicum uncharacterized membrane protein cac0546
FT                   SWALL:Q97LL2 (EMBL:AE007570) (116 aa) fasta scores: E():
FT                   1.4, 25% id in 100 aa"
FT                   /protein_id="CAG41866.1"
FT                   /translation="MSSIIGKIAIWIGIVAQIYFSVVFVRMISINIAGGSDYETIFLLG
FT                   LILALFTVLPTIFTAIYMESYSVIGGALFIVYAIIALCLYNFFSSILWLIGGILLIWNK
FT                   YSKDESTDENEKVDIESTENQFESKDKITKE"
FT   misc_feature    order(115924..115983,116017..116085,116113..116181)
FT                   /note="3 probable transmembrane helices predicted for
FT                   SAS0099 by TMHMM2.0 at aa 10-29, 41-63 and 73-95"
FT   CDS_pept        116354..116980
FT                   /transl_table=11
FT                   /locus_tag="SAS0100"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0128"
FT                   /protein_id="CAG41867.1"
FT                   /translation="MEKNVEKSFIKIGLYFQIAYIVLMAITLCGFVICYGLIFGLFYLL
FT                   SGSTADYSIVTIVISAIISIFVIILSIVPVIVLASDLFKERISKGVILIVLAIIALVLC
FT                   NFVSAILWFVSAISILGRKKLVSTADTTTIQKSKGNANQASHKDTCKKELDSQDMMEHP
FT                   EFKNPTTKNLEGLNEEIHKDEATTKVDSDNTQPPIESKDHVSKKD"
FT   misc_feature    order(116411..116479,116522..116590,116627..116695)
FT                   /note="3 probable transmembrane helices predicted for
FT                   SAS0100 by TMHMM2.0 at aa 20-42, 57-79 and 92-114"
FT   CDS_pept        117192..117968
FT                   /transl_table=11
FT                   /locus_tag="SAS0101"
FT                   /product="putative short chain dehydrogenase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0129"
FT                   /db_xref="GOA:Q6GCZ8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014007"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCZ8"
FT                   /protein_id="CAG41868.1"
FT                   /translation="MTNNKVALVTGGAQGIGFKIAERLVEDGFKVAVVDFNEEGAKAAA
FT                   LKLSSDGTKAIAIKADVSNRDDVFNAVRQTAAQFGDFHVMVNNAGLGPTTPIDTITEEQ
FT                   FKTVYGVNVAGVLWGIQAAHEQFKKFNHGGKIINATSQAGVEGNPGLSLYCSTKFAVRG
FT                   LTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVATAEEAGKPEAWGWEQFTSQIALGR
FT                   VSQPEDVSNVVSFLAGKDSDYITGQTIIVDGGMRFR"
FT   misc_feature    117198..117956
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase, score 282.8, E-value 4.7e-82"
FT   misc_feature    117612..117698
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   CDS_pept        complement(118017..118166)
FT                   /transl_table=11
FT                   /locus_tag="SAS0101a"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS. No significant database hits"
FT                   /protein_id="CAG41869.1"
FT                   /translation="MFYNILGVLILVMLSTDALDSDIITHLRTSLINFLPIHSLLSALK
FT                   NPYC"
FT   CDS_pept        118313..119284
FT                   /transl_table=11
FT                   /locus_tag="SAS0102"
FT                   /product="NAD dependent epimerase/dehydratase family
FT                   protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0130"
FT                   /protein_id="CAG41870.1"
FT                   /translation="MERVLITGGAGFIGSHLVDDLQQDYDVYVLDNYRTGKRENIKSLA
FT                   DDHVFELDIREYDAVEQIMKTYQFDYVIHLAALVSVAESVEKPILSQEINVVATLRLLE
FT                   IIKKYNSHIKRFIFASSAAVYGDLPDLPKSDQSLILPLSPYAIDKYYGERTTLNYCSLY
FT                   NIPTAVVKFFNVFGPRQDPKSQYSGVISKMFDSFEHNKPFTFFGDGLQTRDFVYVYDVV
FT                   QSVRLIMEHKDAIGHGYNIGTGTFTNLLEVYRIIGELYGKSVEHEFKEARKGDIKHSYA
FT                   DISNLKALGFVPKYTVETGLKDYFNFEVDNIEEVTAKEVEMS"
FT   misc_feature    118322..119248
FT                   /note="Pfam match to entry PF01370 Epimerase, NAD dependent
FT                   epimerase/dehydratase family, score 280.1, E-value 2.9e-81"
FT   CDS_pept        119247..119939
FT                   /transl_table=11
FT                   /locus_tag="SAS0103"
FT                   /product="putative sugar transferase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0131"
FT                   /protein_id="CAG41871.1"
FT                   /translation="MKKLQLKKWKCRENDIEAVHNNKGYAYQRKLDKLEEVRKSYYPIK
FT                   RAIDLILSIVLLFLTLPIMVIFAIAIVIDSPGNPIYSQVRVGKMGKLIKIYKLRSMCKN
FT                   AEKNGAQWADKDDDRITNVGKFIRKTRIDELPQLINVVKGEMSFIGPRPERPEFVELFS
FT                   SEVIGFEQRCLVTPGLTGLAQIQGGYDLTPQQKLKYDMKYIHKGSLMMELYISIRTLMV
FT                   VITGEGSR"
FT   misc_feature    119379..119936
FT                   /note="Pfam match to entry PF02397 Bact_transf, Bacterial
FT                   sugar transferase, score 154.9, E-value 1.5e-43"
FT   misc_feature    119394..119462
FT                   /note="1 probable transmembrane helix predicted for SAS0103
FT                   by TMHMM2.0 at aa 50-72"
FT   CDS_pept        120149..121315
FT                   /transl_table=11
FT                   /locus_tag="SAS0104"
FT                   /product="galactosyl transferase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0132"
FT                   /protein_id="CAG41872.1"
FT                   /translation="MKIIYCITKADNGGAQTHLIQLANHFCVHHDVYVIVGNHGPMIEQ
FT                   LDARVNVIIIEHLVGPIDFKQDILAVKVLAQLFSKIKPDVIHLHSSKAGTVGRIAKFIS
FT                   KSKDTRIVFTAHGWAFTEGVKPAKKFLYLVIEKLMSLITDSIICVSDFDKQLALKYRFN
FT                   RLKLTTIHNGIADVPAVKQTLKSQSHNNIGKVVGMLPNKQDLQINAPTKHQFVMIARFA
FT                   YPKLPQNLIAAIEILKLHNSNHAHFTFIGDGPTLNDCQQQVAQAGLENDVTFLGNVINA
FT                   SHLLSQYDTFILISKHEGLPISIIEAMATGLPVIASHVGGISELVADNGICMMNNQPET
FT                   IAKVLEKYLIDSDYIKMSNQSRKRYLECFTEEKMIKEVEDVYNGKSTQ"
FT   misc_feature    120746..121240
FT                   /note="Pfam match to entry PF00534 Glycos_transf_1,
FT                   Glycosyl transferases group 1, score 108.3, E-value
FT                   1.6e-29"
FT   CDS_pept        121296..122534
FT                   /transl_table=11
FT                   /locus_tag="SAS0105"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0133"
FT                   /protein_id="CAG41873.1"
FT                   /translation="MENQHNSKLLTLLLIGLAVFIQQSSVIAGVNVSIADFITLLILVY
FT                   LLFFANHLLKANHFLQFFIILYTYRMIITLCLLFFDDLIFITVKEVLASTVKYAFVVIY
FT                   FYLGMIIFKLGNSKKVIVTSYIISSVTIGLFCIIAGLNKSPLLMKLLYFDEIRSKGLMN
FT                   DPNYFAMTQIITLVLAYKYIHNYIFKVLACGILLWSLTTTGSKTAFIILIVLAIYFFIK
FT                   KLFSRNAVSVVSMLVIMLILLCFTFYNINYYLFQLSDLDALPSLDRMASIFEEGFASLN
FT                   DSGSERSVVWINAISVIKYTLGFGVGLVDYVHIGSQINGILLVAHNTYLQIFVEWGILF
FT                   GALFIIFMLYLLFELFRFNISGKNVTAIVVMLTMLIYFLTVSFNNSRYVAFILGIIVFI
FT                   VQYEKMERDRNEE"
FT   misc_feature    121296..121379
FT                   /note="Signal peptide predicted for SAS0105 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.996) with cleavage site
FT                   probability 0.741 between residues 28 and 29"
FT   misc_feature    order(121320..121379,121389..121457,121470..121538,
FT                   121566..121634,121653..121721,121791..121859,
FT                   121878..121946,121989..122057,122160..122228,
FT                   122286..122354,122373..122432,122442..122495)
FT                   /note="12 probable transmembrane helices predicted for
FT                   SAS0105 by TMHMM2.0 at aa 9-28, 32-54, 59-81, 91-113,
FT                   120-142, 166-188, 195-217, 232-254, 289-311, 331-353,
FT                   360-379 and 383-400"
FT   misc_feature    122136..122324
FT                   /note="Pfam match to entry PF04932 Wzy_C, O-Antigen
FT                   Polymerase, score 54.2, E-value 2.9e-13"
FT   CDS_pept        122524..123954
FT                   /transl_table=11
FT                   /locus_tag="SAS0106"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0134"
FT                   /protein_id="CAG41874.1"
FT                   /translation="MKSDSLKENIIYQGLYQLIRTMTPLITIPIISRAFGPSGVGIVSF
FT                   SFNIVQYFLMIASVGVQLYFNRVIAKSVNDKRQLSQQFWDIFVSKLFLALTVFAMYMVV
FT                   ITIFIDDYYLIFLLQGIYIIGAALDISWFYAGTEKFKIPSLSNIVASGIVLSVVVIFVK
FT                   DQSDLSLYVFTIAIVTVLNQLPLFIYLKRYISFVSVNWIHVWQLFRSSLAYLLPNGQLN
FT                   LYTSISCVVLGLVGTYQQVGIFSNAFNILTVAIIMINTFDLVMIPRITKMSIQQSHSLT
FT                   KTLSNNMNIQLILTIPMVFGLIAIMPSFYLWFFGEEFASTVPLMTILAILVLIIPLNML
FT                   ISRQYLLIVNKIRLYNASITIGAVMNLVLCLVLIYFYGIYGAAIARLITEFILLIWRFV
FT                   DITKINVKLNIVSTIQCVIAAVMMFIVLGVVNHYLPPTMYATLLLIAIGIVVYLLLMMT
FT                   MKNQYVWQILRLLRHKTI"
FT   misc_feature    122539..123342
FT                   /note="Pfam match to entry PF01943 Polysacc_synt,
FT                   Polysaccharide biosynthesis protein, score 115.8, E-value
FT                   8.6e-32"
FT   misc_feature    order(122650..122718,122779..122847,122860..122928,
FT                   122947..123006,123034..123093,123184..123252,
FT                   123262..123321,123397..123465,123478..123546,
FT                   123583..123651,123661..123720,123745..123813,
FT                   123823..123891)
FT                   /note="13 probable transmembrane helices predicted for
FT                   SAS0106 by TMHMM2.0 at aa 43-65, 86-108, 113-135, 142-161,
FT                   171-190, 221-243, 247-266, 292-314, 319-341, 354-376,
FT                   380-399, 408-430 and 434-456"
FT   CDS_pept        124222..124821
FT                   /transl_table=11
FT                   /locus_tag="SAS0107"
FT                   /product="superoxide dismutase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0135"
FT                   /db_xref="GOA:Q6GCZ1"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCZ1"
FT                   /protein_id="CAG41875.1"
FT                   /translation="MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEG
FT                   TELEHQSLADMIANLDKVPEAMRMSVRNNGGGHFNHSLFWEILSPNSEEKGGVIDDIKA
FT                   QWGTLDEFKNEFANKATTLFGSGWTWLVVNDGKLEIVTTPNQDNPLTEGKTPILLFDVW
FT                   EHAYYLKYQNKRPDYMTAFWNIVNWKKVDELYQAAK"
FT   misc_feature    124225..124488
FT                   /note="Pfam match to entry PF00081 sodfe, Iron/manganese
FT                   superoxide dismutases, alpha-hairpin domain, score 172.7,
FT                   E-value 6.4e-49"
FT   misc_feature    124504..124818
FT                   /note="Pfam match to entry PF02777 sodfe_C, Iron/manganese
FT                   superoxide dismutases, C-terminal domain, score 209.6,
FT                   E-value 4.8e-60"
FT   misc_feature    124702..124725
FT                   /note="PS00088 Manganese and iron superoxide dismutases
FT                   signature."
FT   CDS_pept        125189..125914
FT                   /transl_table=11
FT                   /locus_tag="SAS0108"
FT                   /product="putative surface anchored protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0136"
FT                   /protein_id="CAG41876.1"
FT                   /translation="MKKLATVGSLIVTSTLVFSSMPFQNAHADTTSMNVSNKQSQNVQN
FT                   HRPYGGVVPQGMTQAQYTELEKALSQLSAGSNMQDYNMKLYDATQNIADKYNVIITTNV
FT                   GVFKPHAVRDMNGHALPLTKDGNFYQTNVDANGINHGGSEMVQNKTGHMSQQGHMNQNT
FT                   HMNQQPHMQQGHMQSSNHQMMSPKANMHSSNHQMNQSNKKVLPAAGESMTSSILTASIA
FT                   ALLLVSGLFLAFRRRSTNK"
FT   misc_feature    125189..125272
FT                   /note="Signal peptide predicted for SAS0108 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.993 between residues 28 and 29"
FT   misc_feature    125777..125899
FT                   /note="Pfam match to entry PF00746 Gram_pos_anchor, Gram
FT                   positive anchor, score 33.1, E-value 6.7e-07"
FT   misc_feature    125822..125890
FT                   /note="1 probable transmembrane helix predicted for SAS0108
FT                   by TMHMM2.0 at aa 212-234"
FT   CDS_pept        complement(126105..126845)
FT                   /transl_table=11
FT                   /locus_tag="SAS0109"
FT                   /product="GntR family regulatory protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0137"
FT                   /protein_id="CAG41877.1"
FT                   /translation="MTQTQPKFLTIYNTLYKEIQIGKYPSGHALPTEKELCARFDVSRM
FT                   TLRQAIKLLAEDGIVESTRGKGHFVIPQTNAQHASSMDQFKHPLDQILLARVSMSSINY
FT                   RVDLESEYTNHLFANHPSAVIAMERYYQKKDNHSKQADAFCFTFIPLNVIDTFKVNTQN
FT                   EDDMKTFVEQTIYSNAYQSDLKMSITKAPHFKNHSHVFDGDTHCWLIIETLYAQTPYPI
FT                   MINKWYIPQEISELTLTRIRQSDY"
FT   misc_feature    complement(126636..126827)
FT                   /note="Pfam match to entry PF00392 gntR, Bacterial
FT                   regulatory proteins, gntR family, score 67.7, E-value
FT                   2.6e-17"
FT   misc_feature    complement(126684..126758)
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT   misc_feature    complement(126690..126755)
FT                   /note="Predicted helix-turn-helix motif for SAS0109 with
FT                   score 1559.000, SD 4.50 at aa 31-52, sequence
FT                   PTEKELCARFDVSRMTLRQAIK"
FT   CDS_pept        127096..127803
FT                   /transl_table=11
FT                   /locus_tag="SAS0110"
FT                   /product="putative purine nucleoside phosphorylase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0138"
FT                   /protein_id="CAG41878.1"
FT                   /translation="MKSTPHIKPMNDVEIAETVLLPGDPLRAKFIAETYLDDVEQFNTV
FT                   RNMFGFTGTYKGKKVSVMGSGMGMPSIGIYSYELIHTFGCKKLIRVGSCGAMQENIDLY
FT                   DVIIAQGASTDSNYVQQYQLPGHFAPIASYQLLEKAVGTARDKGVRHHVGNVLSSDIFY
FT                   NADTTASERWMRMGILGVEMESAALYMNAIYAGVEALGVFTVSDHLIHETSTTPEERER
FT                   AFTDMIEIALSLV"
FT   misc_feature    127144..127800
FT                   /note="Pfam match to entry PF01048 PNP_UDP_1, Phosphorylase
FT                   family, score 293.2, E-value 3.3e-85"
FT   misc_feature    127285..127332
FT                   /note="PS01232 Purine and other phosphorylases family 1
FT                   signature."
FT   CDS_pept        127810..129162
FT                   /transl_table=11
FT                   /locus_tag="SAS0111"
FT                   /product="putative transport system protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0139"
FT                   /protein_id="CAG41879.1"
FT                   /translation="MNVEYSKIKKAVPILLFLFVFSLVIDNSFKLISVAIADDLNISVT
FT                   TVSWQATLAGLVIGIGAVVYASLSDAISIRTLFIYGVILIIIGSIIGYIFQHQFALLLV
FT                   GRIIQTAGLAAAETLYVIYVAKYLSKEDQKTYLGLSTSSYSLSLVIGTLSGGFISTYLH
FT                   WTNMFLIALIVVFTLPFLFKLLPKENNTNKAHLDFVGLILVATIATTVMLFITNFNWLY
FT                   MIGALIAIIVFALYIKNAQRPLVNKSFFQNKRYASFLFIVFVMYAIQLGYIFTFPFIME
FT                   QIYHLQLDTTSLLLVPGYIVAVIVGALSGKIGEYLNSKQAIITAIILIALSLILPAFAV
FT                   GNHISIFVISMIFFAGSFALMYAPLLNEAIKTIDLNMTGVAIGFYNLIINVAVSVGIAI
FT                   AAALIDFKALNFPGNDALSSHFGIILIILGLMSIVGLVLFVSLNRWTQSEK"
FT   misc_feature    127810..127920
FT                   /note="Signal peptide predicted for SAS0111 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.973) with cleavage site
FT                   probability 0.775 between residues 37 and 38"
FT   misc_feature    order(127843..127911,127948..128016,128035..128103,
FT                   128113..128181,128215..128283,128296..128364,
FT                   128401..128454,128467..128520,128581..128649,
FT                   128677..128736,128770..128829,128839..128907,
FT                   128944..129012,129070..129138)
FT                   /note="14 probable transmembrane helices predicted for
FT                   SAS0111 by TMHMM2.0 at aa 12-34, 47-69, 76-98, 102-124,
FT                   136-158, 163-185, 198-215, 220-237, 258-280, 290-309,
FT                   321-340, 344-366, 379-401 and 421-443"
FT   CDS_pept        129243..129905
FT                   /transl_table=11
FT                   /locus_tag="SAS0112"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0140"
FT                   /db_xref="GOA:Q6GCY6"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCY6"
FT                   /protein_id="CAG41880.1"
FT                   /translation="MKFEKYIDHTLLKPESTRTQIDQIIDEAKAYNFKSVCVNPTHVKY
FT                   AAERLADSEVLVCTVIGFPLGASTTATKAFETEDAIQNGADEIDMVINIGALKDGRFDD
FT                   VQQDIEAVVKVAKGHTVKVIIETVLLDHDEIVKASELTKAAGADFVKTSTGFAGGGATA
FT                   EDVKLMKDTVGADVEVKASGGVRNLEDFNKMVEAGATRIGASAGVQIMQGLEADSDY"
FT   misc_feature    129243..129878
FT                   /note="Pfam match to entry PF01791 DeoC,
FT                   Deoxyribose-phosphate aldolase, score 348.3, E-value
FT                   9e-102"
FT   CDS_pept        129933..131111
FT                   /transl_table=11
FT                   /locus_tag="SAS0113"
FT                   /product="putative phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0141"
FT                   /db_xref="GOA:Q6GCY5"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCY5"
FT                   /protein_id="CAG41881.1"
FT                   /translation="MTRPFNRVHLIVMDSVGIGEAPDAADFKDEGSHTLRHTLEGFDQT
FT                   LPNLEKLGLGNIDKLPVVNAVEQPEAYYTKLSEASVGKDTMTGHWEIMGLNIMQPFKVY
FT                   PNGFPEELIQQIEEMTGRKVVANKPASGTQIIDEWGEHQMKTGDLIVYTSADPVLQIAA
FT                   HEDIIPLEELYDICEKVRELTKDPKYLIGRIIARPYVGEPGNFTRTSNRHDYALKPFGK
FT                   TVLDHLKDGGYDVIAIGKINDIYDGEGVTEAVRTKSNMDGMDQLMKIVKKDFTGISFLN
FT                   LVDFDALYGHRRDKPGYAQAIKDFDDRLPELFSNLKEDDLVIITADHGNDPTAPGTDHT
FT                   REYIPVIMYSPKFKGGHALESDTTFSSIGATIADNFNVTLPEFGKSYLKELK"
FT   misc_feature    130578..130601
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    130698..131027
FT                   /note="Pfam match to entry PF01676 Metalloenzyme,
FT                   Metalloenzyme superfamily, score 129.4, E-value 6.9e-36"
FT   CDS_pept        complement(131242..132057)
FT                   /transl_table=11
FT                   /locus_tag="SAS0114"
FT                   /product="binding-protein-dependent transport systems
FT                   membrane component"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0142"
FT                   /protein_id="CAG41882.1"
FT                   /translation="MTQEIAKYNVHTKAHKRKLIKRWLIAIVVLAIIIWAFAGVPSLEL
FT                   KSKSLEILKSIFSGLFHPDISYIYIPDGEDLLRGLLETFAIAVVGTFIAAIICIPLAFL
FT                   GANNMVKLRPVSGVSKFILSVIRVFPEIVMALIFIKAVGPGSFSGVLALGIHSVGMLGK
FT                   LLAEDIEGLDFSAIESLKASGANKIKTLVFAVIPQIMPAFLSLILYRFELNLRSASILG
FT                   LIGAGGIGTPLIFAIQTRSWDRVGIILIGLVLMVAIVDLISGSIRKRIV"
FT   misc_feature    complement(131245..131820)
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport system inner membrane
FT                   component, score 38.3, E-value 1.9e-08"
FT   misc_feature    complement(order(131260..131319,131347..131415,
FT                   131434..131487,131641..131709,131743..131811,
FT                   131923..131991))
FT                   /note="6 probable transmembrane helices predicted for
FT                   SAS0114 by TMHMM2.0 at aa 23-45, 83-105, 117-139, 191-208,
FT                   215-237 and 247-266"
FT   misc_feature    complement(131923..132057)
FT                   /note="Signal peptide predicted for SAS0114 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.974) with cleavage site
FT                   probability 0.282 between residues 45 and 46"
FT   CDS_pept        complement(132054..132854)
FT                   /transl_table=11
FT                   /locus_tag="SAS0115"
FT                   /product="binding-protein-dependent transport system
FT                   membrane component"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0143"
FT                   /protein_id="CAG41883.1"
FT                   /translation="MPLETPTKYDSLLKKKVSLKTSFTFMLIIVLIIWSFIYTGFNFGD
FT                   LMIGIPQIGDLFKQMIPPDFEYLQQITTPMLDTIRMAIVSTVLGSIVSIPIALLCASNI
FT                   VHQKWISIPSRFILNIVRTIPDLLLAAIFVAVFGIGQIPGILALFILTICIIGKLLYES
FT                   LETIDPGPMEAMTAVGANKIKWIVFGVVPQAISSFMSYVLYAFEVNIRASAVLGLVGAG
FT                   GIGLFYDQTLGLFQYPKTATIILFTLVIVVVIDYISTKVRAHLA"
FT   misc_feature    complement(132066..132632)
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport system inner membrane
FT                   component, score 64.4, E-value 2.6e-16"
FT   misc_feature    complement(order(132093..132161,132234..132302,
FT                   132363..132422,132435..132503,132540..132608,
FT                   132726..132794))
FT                   /note="6 probable transmembrane helices predicted for
FT                   SAS0115 by TMHMM2.0 at aa 21-43, 83-105, 118-140, 145-164,
FT                   185-207 and 232-254"
FT   CDS_pept        complement(132856..133629)
FT                   /transl_table=11
FT                   /locus_tag="SAS0116"
FT                   /product="putative ABC transport ATP-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0144"
FT                   /db_xref="GOA:Q6GCY2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCY2"
FT                   /protein_id="CAG41884.1"
FT                   /translation="MSQIEFKNVSKVYPNGHVGLKNINLNIEKGEFAVIVGLSGAGKST
FT                   LLRSVNRLHDITSGEIFIQGKSITKAHGKALLEMRRNIGMIFQHFNLVKRSSVLRNVLS
FT                   GRVGYHPTWKMVLGLFPKEDKIKAMDALERVNILDKYNQRSDELSGGQQQRISIARALC
FT                   QESEIILADEPVASLDPLTTKQVMDDLRKINQELGITILINLHFVDLAKEYGTRIIGLR
FT                   DGEVVYDGPASEATDDVFSEIYGRTIKEDEKLGVN"
FT   misc_feature    complement(132958..133542)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 180.7, E-value 2.5e-51"
FT   misc_feature    complement(133144..133188)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(133498..133521)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(133843..134799)
FT                   /transl_table=11
FT                   /locus_tag="SAS0117"
FT                   /product="putative lipoprotein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0145"
FT                   /protein_id="CAG41885.1"
FT                   /translation="MKKFKCLFVLMLAVIVFAAACGNSSSLDNQKNASNDSDSKSGGYK
FT                   PKELTVQFVPSQNAGTLEAKAKPLEKLLSKELGIPVKVSVSTNYNTIVEAMKSKKVDVG
FT                   FLPPTAYTLAHDQKAADLLLQAQRFGVKEDGSASKELVDSYKSEILVKKDSKIKSLKDL
FT                   KGKKIALQDVTSTAGYTFPLAMLKNEAGINATKDMKIVNVKGHDQAVISLLNGDVDAAA
FT                   VFNDARNTVKKDQPNVFKDTRILKLTQAIPNDTISVRPDMDKDFQEKLKKAFIDIAKSK
FT                   EGHKIISEVYSHEGYTETKDSNFDIVREYEKLVKDMK"
FT   misc_feature    complement(134722..134781)
FT                   /note="1 probable transmembrane helix predicted for SAS0117
FT                   by TMHMM2.0 at aa 7-26"
FT   misc_feature    complement(134734..134799)
FT                   /note="Signal peptide predicted for SAS0117 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.259 between residues 22 and 23"
FT   misc_feature    complement(134737..134769)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        135028..136572
FT                   /transl_table=11
FT                   /locus_tag="SAS0118"
FT                   /product="putative exported protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0146"
FT                   /protein_id="CAG41886.1"
FT                   /translation="MKKIYKSLTVSAIVATVSLSALPQSLAITHESQPTKQQRTVLFDR
FT                   SHGQTAGAADWVSDGAFSDYADSIQKQGYDVKAIDGHSNITEASLKSSKIFVIPEANIP
FT                   FKESEQAAIVNYVKQGGNVVFISDHYNADRNLNRIDSSEAMNGYRRGAYEDMSKGMNAE
FT                   EKSSTAMQGVKSSDWLSTNFGVRFRYNALGDLNTSNIVSSKESFGITEGVKSVSMHAGS
FT                   TLAITNPEKAKGIVYTPEQLPAKSKWSHAVDQGIYNGGGKAEGPYVAISKVGKGKAAFI
FT                   GDSSLVEDSSPKYVREDNGEKKKTYDGFKEQDNGKLLNNITDWMSKDSDGKSLKASGLT
FT                   LDTKTKLLDFERPERSTEPEKEPWSQPPSGYKWYDPTTFKAGSYGSEKGADPQPNTPDD
FT                   HTPPNQNEKVTFDIPQNVSVNEPFEMTIHLKGFEANQTLENLRVGIYKEGGRQIGQFSS
FT                   KDNDYNPPGYSTLPTVKADENGNVTIKVNAKVLESMEGSKIRLKLGDKTLITTDFK"
FT   misc_feature    135028..135108
FT                   /note="Signal peptide predicted for SAS0118 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.634 between residues 27 and 28"
FT   CDS_pept        136623..138158
FT                   /transl_table=11
FT                   /locus_tag="SAS0119"
FT                   /product="putative nucleotidase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0147"
FT                   /protein_id="CAG41887.1"
FT                   /translation="MSNIAFYVVSDVHGYIFPTDFTSRNQYQPMGLLLANHVIEQDRRQ
FT                   YDQSFKIDNGDFLQGSPFCNYLIAHSGSSQPLVDFYNRMAFDFGTLGNHEFNYGLPYLK
FT                   DTLRRLNYPVLCANIYENDSTLTDNGVKYFQVGDQTVGVIGLTTQFIPHWEQPEHIQSL
FT                   TFHSAFEILQQYLPEMKRHADIIVVCYHGGFEKDLESGTPTEVLTGENEGYAMLEAFSK
FT                   DIDIFITGHQHRQIAERFKQTAVIQPGTRGTTVGRVVLSTDEYENLSVESCELLPVIDD
FT                   STFTIDEDDQHLRKQLEDWLDYEITTLPYDMTINHAFEARVAPHPFTNFMNYALLEKSD
FT                   ADVACTALFDSASGFKQVVTMRDVINNYPFPNTFKVLAVSGAKLKEAIERSAEYFDVKN
FT                   DEVSVSADFLGPKPQHFNYDIYGGVSYTIHVGRPKGQRVSNMMIQGHAVDLKQTYTICV
FT                   NNYRAVGGGQYDMFIDAPVVKDIQVEGAQLLIDFLSNNNLMRIPQVVDFKVEK"
FT   misc_feature    136632..137327
FT                   /note="Pfam match to entry PF00149 Metallophos,
FT                   Calcineurin-like phosphoesterase, score 56.2, E-value
FT                   7.4e-14"
FT   misc_feature    136878..136913
FT                   /note="PS00786 5'-nucleotidase signature 2."
FT   misc_feature    137559..138044
FT                   /note="Pfam match to entry PF02872 5_nucleotidaseC,
FT                   5'-nucleotidase, C-terminal domain, score 173.1, E-value
FT                   4.9e-49"
FT   CDS_pept        138209..138439
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SAS0120"
FT                   /product="hypothetical protein (fragment)"
FT                   /note="Possible gene remnant. Weakly similar to the
FT                   C-terminal regions of Streptococcus pneumoniae conserved
FT                   hypothetical protein spr1629 SWALL:Q8DNN0 (EMBL:AE008529)
FT                   (383 aa) fasta scores: E(): 2.4, 26.02% id in 73 aa, and
FT                   Streptococcus agalactiae hypothetical protein gbs1980
FT                   SWALL:Q8E2Y3 (EMBL:AL766855) (124 aa) fasta scores: E(): 9,
FT                   31.5% id in 73 aa"
FT   CDS_pept        join(138752..139225,139225..139572)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SAS0121"
FT                   /product="replication initiation protein (fragment)"
FT                   /note="Similar to the C-terminal regions of Staphylococcus
FT                   aureus replication initiation protein RepE SWALL:REPE_STAAU
FT                   (SWALL:P12053) (314 aa) fasta scores: E(): 4.9e-81, 73.68%
FT                   id in 266 aa, and to Staphylococcus aureus replication
FT                   initiation protein RepN SWALL:REPN_STAAU (SWALL:P19529)
FT                   (314 aa) fasta scores: E(): 2.3e-81, 74.43% id in 266 aa.
FT                   Contains a frameshift after codon 158"
FT                   /db_xref="PSEUDO:CAG41889.1"
FT   misc_feature    139052..139288
FT                   /note="Pfam match to entry PF02486 Rep_trans, Replication
FT                   initiation factor, score -15.7, E-value 0.0025"
FT   misc_feature    139324..139569
FT                   /note="Pfam match to entry PF02486 Rep_trans, Replication
FT                   initiation factor, score 19.8, E-value 2.6e-05"
FT   CDS_pept        join(140437..140484,140488..140697,140697..140921)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SAS0122"
FT                   /product="transposase (pseudogene)"
FT                   /note="Similar to Salmonella typhi transposase for
FT                   insertion sequence element IS200 SWALL:T200_SALTI
FT                   (SWALL:P59697) (152 aa) fasta scores: E(): 1e-34, 58.66% id
FT                   in 150 aa, and to Clostridium acetobutylicum
FT                   IS605/IS200-like transposase cac3531 SWALL:Q97DE6
FT                   (EMBL:AE007849) (157 aa) fasta scores: E(): 1.2e-48, 78.2%
FT                   id in 156 aa. CDS contains a nonsense mutation (ochre)
FT                   after codon 16 and a frameshift after codon 86"
FT                   /db_xref="PSEUDO:CAG41890.1"
FT   misc_feature    140700..140804
FT                   /note="Pfam match to entry PF01797 Transposase_17,
FT                   Transposase IS200 like, score 50.0, E-value 4.6e-14"
FT   CDS_pept        141371..143980
FT                   /transl_table=11
FT                   /locus_tag="SAS0123"
FT                   /product="putative aldehyde-alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0150"
FT                   /protein_id="CAG41891.1"
FT                   /translation="MLTIPEKENRGSKEQEVAIMIDALADKGKKALEALSKKSQEEIDH
FT                   IVHQMSLAAVDQHMVLAKLAHEETGRGIYEDKAIKNLYASEYIWNSIKDNKTVGIIGED
FT                   KEKGLTYVAEPIGVICGVTPTTNPTSTTIFKAMIAIKTGNPIIFAFHPSAQESSKRAAE
FT                   VVLEAAMKAGAPKDIIQWIEVPSIEATKQLMNHKGIALVLATGGSGMVKSAYSTGKPAL
FT                   GVGPGNVPSYIEKTAHIKRAVNDIIGSKTFDNGMICASEQVVVIDKEIYKDVTNEFKAH
FT                   QAYFVKKDELQRLENAIMNEQKTGIKPDIVGKSAVEIAELAGIPVPENTKLIIAEISGV
FT                   GSDYPLSREKLSPVLALVKAQSTKQAFQICEDTLHFGGLGHTAVIHTEDETLQKDFGLR
FT                   MKACRVLVNTPSAVGGIGDMYNELIPSLTLGCGSYGRNSISHNVSATDLLNIKTIAKRR
FT                   NNTQIFKVPAQIYFEENAIMSLTTMDKIEKVMIVCDPGMVEFGYTKTVENVLRQRTEQP
FT                   QIKIFSEVEPNPSTNTVYKGLEMMVDFQPDTIIALGGGSAMDAAKAMWMFFEHPETSFF
FT                   GAKQKFLDIGKRTYKIGMPENATFICIPTTSGTGSEVTPFAVITDSETNVKYPLADFAL
FT                   TPDVAIIDPQFVMSVPKSVTADTGMDVLTHAMESYVSVMASDYTRGLSLQAIKLTFEYL
FT                   KSSVEKGDKVSREKMHNASTLAGMAFANAFLGIAHSIAHKIGGEYGIPHGRANAILLPH
FT                   IIRYNAKDPQKHALFPKYEFFRADTDYADIAKFLGLKGNTTEALVESLAKAVYELGQSV
FT                   GIEMNLKSQGVSEEELNESIDRMAELAFEDQCTTANPKEALISEIKDIIQTSYDYKQ"
FT   misc_feature    141386..142744
FT                   /note="Pfam match to entry PF00171 aldedh, Aldehyde
FT                   dehydrogenase family, score -176.9, E-value 7.2e-07"
FT   misc_feature    142769..143941
FT                   /note="Pfam match to entry PF00465 Fe-ADH, Iron-containing
FT                   alcohol dehydrogenase, score 490.0, E-value 1.9e-144"
FT   misc_feature    143288..143374
FT                   /note="PS00913 Iron-containing alcohol dehydrogenases
FT                   signature 1."
FT   misc_feature    143546..143608
FT                   /note="PS00060 Iron-containing alcohol dehydrogenases
FT                   signature 2."
FT   CDS_pept        144318..144986
FT                   /transl_table=11
FT                   /locus_tag="SAS0124"
FT                   /product="capsular polysaccharide synthesis enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0151"
FT                   /protein_id="CAG41892.1"
FT                   /translation="MESTLELTKIKEVLQKNLKILIILPLLFLIISAIVTFFVLSPKYQ
FT                   ANTQILVNQTKGDNPQFMAQEVQSNIQLVNTYKEIVKSPRILDEVSKDLNDKYSPSKLS
FT                   SMLTITNQENTQLINIQVKSGHKQDSEKIANSFAKVTSKQIPKIMSVDNVSILSKADGT
FT                   AVKVAPKTVVNLIGAFFLGLVVALIYIFFKVIFDKRIKDEEDVEKELGLPVLGSIQKFN
FT                   "
FT   misc_feature    144324..144737
FT                   /note="Pfam match to entry PF02706 wzz, Chain length
FT                   determinant protein, score 157.5, E-value 2.4e-44"
FT   misc_feature    order(144375..144443,144831..144890)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SAS0124 by TMHMM2.0 at aa 20-42 and 172-191"
FT   CDS_pept        145002..145688
FT                   /transl_table=11
FT                   /locus_tag="SAS0125"
FT                   /product="capsular polysaccharide synthesis enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0152"
FT                   /protein_id="CAG41893.1"
FT                   /translation="MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLL
FT                   VTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDMRKPTQNYIFNEQNNNGLSSLIIGR
FT                   TTMSEAITSTEIENLDLLTAGPVPPNPSELIASERFKELVDLFNKRYDIIIVDTPPVNT
FT                   VTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYY
FT                   HYYGDE"
FT   CDS_pept        145691..146455
FT                   /transl_table=11
FT                   /locus_tag="SAS0126"
FT                   /product="capsular polysaccharide synthesis enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0153"
FT                   /protein_id="CAG41894.1"
FT                   /translation="MIDIHNHILPNIDDGPTNETEMLDLLKQATTQGVTEIIVTSHHLH
FT                   PRYTTPIEKVKSCLNHIESLEEVQALNLKFYYGQEIRITDQILNDIDRKVITGINDSRY
FT                   LLIEFPSNEVPHYTDQLFFELQSKGFVPIIAHPERNKAISQNLDILYDLINKGALSQVT
FT                   TASLAGISGRKIRKLAIQMIENNLTHFIGSDAHNTEIRPFLMKDLFNDKKLRDYYEDMN
FT                   GFISNAKLVVDDKKIPKRMPQQDYKQKRWFGL"
FT   misc_feature    146003..146302
FT                   /note="Pfam match to entry PF02811 PHP_C, PHP domain
FT                   C-terminal region, score 47.3, E-value 3.5e-11"
FT   CDS_pept        146475..148298
FT                   /transl_table=11
FT                   /locus_tag="SAS0127"
FT                   /product="capsular polysaccharide synthesis enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0154"
FT                   /protein_id="CAG41895.1"
FT                   /translation="MAHLSVKLRLLILALIDSLIVTFSVFVSYYILEPYFKTYSVKLLI
FT                   LAAISLFISHHISAFIFNMYHRAWEYASVSELILIVKAVTTSIVITMVVVTIVTGNRPF
FT                   FRLYLITWMMHLILIGGSRLFWRIYRKYLGGKSFNKKPTLVVGAGQAGSMLIRQMLKSD
FT                   EMKLEPVLAVDDDEHKRNITITEGVKVQGKIADIPELVRKYKIKKIIIAIPTIGQERLK
FT                   EINNICHMDGVELLKMPNIEDVMSGELEVNQLKKVEVEDLLGRDPVELDMDMISNELTN
FT                   KTILVTGAGGSIGSEICRQVCNFYPERIILLGHGENSIYLINRELRNRFGKNVDIVPII
FT                   ADVQNRARMFEIMETYKPYAVYHAAAHKHVPLMEENPEEAVRNNILGTKNTAEAAKNAE
FT                   VKKFVMISTDKAVNPPNVMGASKRIAEMIIQSLNDETHRTNFVAVRFGNVLGSRGSVIP
FT                   LFKSQIEEGGPVTVTHPEMTRYFMTIPEASRLVLQAGALAEGGEVFVLDMGEPVKIVDL
FT                   ARNLIKLSGKKEDDIRITYTGIRPGEKMFEELMNKDEVHPEQVFEKIYRGKVQHMKCNE
FT                   VEAIIQDIVNDFSKEKIINYANGKKGDNYVR"
FT   misc_feature    order(146502..146570,146604..146660,146703..146771,
FT                   146784..146852)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SAS0127 by TMHMM2.0 at aa 10-32, 44-62, 77-99 and 104-126"
FT   misc_feature    146715..148271
FT                   /note="Pfam match to entry PF02719 Polysacc_synt_2,
FT                   Polysaccharide biosynthesis protein, score 1244.4, E-value
FT                   0"
FT   CDS_pept        148288..149316
FT                   /transl_table=11
FT                   /locus_tag="SAS0128"
FT                   /product="capsular polysaccharide synthesis enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0155"
FT                   /protein_id="CAG41896.1"
FT                   /translation="MFDDKILLITGGTGSFGNAVMKRFLDSNIKEIRIFSRDEKKQDDI
FT                   RKKYNNSKLKFYIGDVRDSQSVETAMRDVDYVFHAAALKQVPSCEFFPVEAVKTNIIGT
FT                   ENVLQSAIHQNVKKVICLSTDKAAYPINAMGISKAMMEKVFVAKSRNIRSEQTLICGTR
FT                   YGNVMASRGSVIPLFIDKIKAGEPLTITDPDMTRFLMSLEDAVELVVHAFKHAETGDIM
FT                   VQKAPSSTVGDLATALLELFEADNAIEIIGTRHGEKKAETLLTREEYAQCEDMGDYFRV
FT                   PADSRDLNYSNYVETGNEKITQSYEYNSDNTHILTVEEIKEKLLTLEYVRNELNDYKAS
FT                   MR"
FT   misc_feature    148288..149184
FT                   /note="Pfam match to entry PF02719 Polysacc_synt_2,
FT                   Polysaccharide biosynthesis protein, score -255.6, E-value
FT                   2.2e-09"
FT   CDS_pept        149329..150438
FT                   /transl_table=11
FT                   /locus_tag="SAS0129"
FT                   /product="capsular polysaccharide synthesis enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0156"
FT                   /protein_id="CAG41897.1"
FT                   /translation="MNIVITGAKGFVGKNLKADLTSTTDHHIFEVHRQTKEEELESALL
FT                   KADFVVHLAGVNRPEHDKEFSLGNVSYLDHVLDILTRNTKKPAILLSSSIQATQDNPYG
FT                   ESKLQGEQLLREYAEEYGNTVYIYRWPNLFGKWCKPNYNSVIATFCYKIARNEEIQVND
FT                   RNVELTLNYVDDIVAEIKRAIEGTPTIENGVPTVPNVFKVTLGEIVDLLYKFKQSRLDR
FT                   TLPKLDNLFEKDLYSTYLSYLPSTDFSYPLLMNVDDRGSFTEFIKTPDRGQVSVNISKP
FT                   GITKGNHWHHTKNEKFLVVSGKGVIRFRHVNDDEIIEYYVSGDKLEVVDIPVGYTHNIE
FT                   NLGDTDMVTIMWVNEMFDPNQPDTYFLEV"
FT   CDS_pept        150442..151566
FT                   /transl_table=11
FT                   /locus_tag="SAS0130"
FT                   /product="capsular polysaccharide synthesis enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0157"
FT                   /protein_id="CAG41898.1"
FT                   /translation="MEKLKLMTIVGTRPEIIRLSSTIKACDQYFNQILVHTGQNYDYTL
FT                   NQIFFDDLELRQPDHYLEAVGSNLGETMGNIIAKTYDVLLREQPDALLILGDTNSCLAA
FT                   VSAKRLKIPVFHMEAGNRCFDQNVPEEINRKIVDHVSDVNLPYTEHSRRYLLDEGFNKA
FT                   NIFVTGSPMTEVIEAHRDKINHSDVLNKLGLEPQQYILVSAHREENIDNEKNFKSLMNA
FT                   INDIAKKYKMPVIYSTHPRSWKKIEESKFEFDPLVKKLKPFGFFDYNALQKDAFVVLSD
FT                   SGTLSEESSILKFPGVLIRTSTERPEVLDKGTVIVGGITYNNLIQSVELAREMQNNNEP
FT                   MIDAIDYKDTNVSTKVVKIIQSYKDIINRNTWRK"
FT   misc_feature    150511..151524
FT                   /note="Pfam match to entry PF02350 Epimerase_2,
FT                   UDP-N-acetylglucosamine 2-epimerase, score 577.0, E-value
FT                   1.2e-170"
FT   CDS_pept        151569..152648
FT                   /transl_table=11
FT                   /locus_tag="SAS0131"
FT                   /product="capsular polysaccharide synthesis enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0158"
FT                   /protein_id="CAG41899.1"
FT                   /translation="MRIAILGATNIKHMSLLSHYLNHIDLNINEVDIIYTDKYDIEEHI
FT                   QGINNYYKYKVDIKEDWTFIKKAIAYYRFRPYAMKILKENRYDFVIVWGSYTGHLFKSF
FT                   LEKHYKNKFILNIRDYFFENNKLIKYRMKKIVDASRVTTLSSEGFLKFLPKSEKYRIIY
FT                   SYNMSIIRESNVTDGFKKRWPINIGFIGNVRFNEINQKLIKELANDSRFHMQYFGTGSE
FT                   KLEVFARENFINNITFSGGFDLKETPKYLNEIDILNNLFGNQNIALDTALSIRMYYALF
FT                   LNKPIITTDDTFTATEANKFGLGFSINPENLKGIGDELMDWYNNLDVMDINHKREAYRN
FT                   DVIENNKQFYQEIGRIFNE"
FT   CDS_pept        152641..154035
FT                   /transl_table=11
FT                   /locus_tag="SAS0132"
FT                   /product="capsular polysaccharide synthesis enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0159"
FT                   /protein_id="CAG41900.1"
FT                   /translation="MNKIYNVTSYVIAILMFPCLMLGDKPLLFLAPISYGVGKLFISFS
FT                   NNPNFKFSKIVYDVLGFLRLVFIPAMIVFFQDSTIDNLPLGQAYFNQAVIYMSVEFIIG
FT                   SLFILILSKLFKHEVVSRNSFTLSGSSIYYIVFGLVICGIFVAFPEVRKNISFLIIKTD
FT                   AMGRGTEATSGLNVLFVMLFQLALALLFLIIAYASYKKYKENPKIIYVVLPLAIGILNI
FT                   SLIVGERRSYQLYTMVAVLTVVSILFSKHKRRINIIIISVGIFVLALMTLYKELYVFNY
FT                   SSYSEALNSTSVSNLKIVDTLQSYFYGPSNIAASIDYLNYYNGSFKQYLFDNTRAVFGF
FT                   NFFLDKKQLITSQLFNQLIYGSKQLTGHLISSAGYGIIYFGPLFFYLNLIANIFFAFLS
FT                   EYIIRKSHSLEVIFIGTYIYMRLITSIFSHPTPLITLISMILVVYVIAIIPGIIIKKFT
FT                   KKVGIE"
FT   misc_feature    order(152653..152706,152719..152772,152806..152865,
FT                   152908..152976,153013..153081,153160..153228,
FT                   153262..153321,153331..153384,153403..153459,
FT                   153766..153834,153871..153924,153934..154002)
FT                   /note="12 probable transmembrane helices predicted for
FT                   SAS0132 by TMHMM2.0 at aa 5-22, 27-44, 56-75, 90-112,
FT                   125-147, 174-196, 208-227, 231-248, 255-273, 376-398,
FT                   411-428 and 432-454"
FT   CDS_pept        154032..154589
FT                   /transl_table=11
FT                   /locus_tag="SAS0133"
FT                   /product="capsular polysaccharide synthesis enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0160"
FT                   /protein_id="CAG41901.1"
FT                   /translation="MIVKTFMKSKIFRLMNTPLLLFYKKEYLTGYYFENKVAGWLWAWK
FT                   AVPFKLLGINTSLPFPADITVRMHNPNNIVFDKNDIHIFQSPGTYFNNFSAVIYIGRGV
FT                   YIAPNVGIITANHNIKNLKSHAPGEDVKIGNYSWIGMNSVILPGVELGEHTIVGAGSVV
FT                   TKSFPEGNVVIGGNPAKIIKKI"
FT   misc_feature    154320..154373
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 8.3, E-value
FT                   9.6"
FT   misc_feature    154419..154472
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 11.3,
FT                   E-value 2.5"
FT   misc_feature    154473..154526
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 11.8,
FT                   E-value 1.7"
FT   CDS_pept        154598..155836
FT                   /transl_table=11
FT                   /locus_tag="SAS0134"
FT                   /product="capsular polysaccharide synthesis enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0161"
FT                   /protein_id="CAG41902.1"
FT                   /translation="MRLNKFIGDSFLMILSSGIAQVILIITTPIITRLYSPTEFGEFTI
FT                   FSNIAMILIPIINARYDLLIVNTKNDRSANILSQISFLISLLILLILIPIFAISACLYP
FT                   NFILDFIFIIIMLFLVSLTNIFTNYLNKERKYKVLSLINVFRAGSMALLQIIFGLLALG
FT                   SLGLIIGFSLSYIAGITLGYKTFKKHFNIVRDKEETKALFLENKNQLVYSTPSILLNSL
FT                   SFSVVVFFIGILYTNTEVGIYGMAIRVLGIPVTIISLGLSKIFMQQANDYYIEHGNFRN
FT                   LLLKFSSILVIVSIILYVPLYLFSEELVNILLGHSWVDAITVIKIVIPLFVIRLIVSTV
FT                   SLSVIVLQKQQLELILQALFLIGTTATFVISKMLNLTFLNFVSINTIVLIVSYMIFFIA
FT                   LYYFAKNKQFKNS"
FT   misc_feature    154613..155416
FT                   /note="Pfam match to entry PF01943 Polysacc_synt,
FT                   Polysaccharide biosynthesis protein, score 14.2, E-value
FT                   2.6e-05"
FT   misc_feature    order(154634..154702,154730..154798,154835..154903,
FT                   154913..154981,155018..155086,155096..155155,
FT                   155246..155305,155315..155383,155444..155512,
FT                   155555..155623,155657..155710,155738..155806)
FT                   /note="12 probable transmembrane helices predicted for
FT                   SAS0134 by TMHMM2.0 at aa 13-35, 45-67, 80-102, 106-128,
FT                   141-163, 167-186, 217-236, 240-262, 283-305, 320-342,
FT                   354-371 and 381-403"
FT   CDS_pept        155870..157075
FT                   /transl_table=11
FT                   /locus_tag="SAS0135"
FT                   /product="capsular polysaccharide synthesis enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0162"
FT                   /protein_id="CAG41903.1"
FT                   /translation="MSEKKILILCQYFYPEYVSSATLPTQLAEDLIANHINVDVMCGWP
FT                   YEYSNHKQVSKTEMHRGICIRRLKYSRFNNKSKVGRIINFFSLFSKFVINIPKMLKYDQ
FT                   ILVYSNPPILPLIPDVLHRLLKKKYSFVVYDIAPDNAIKTGATRPGSMIDKLMRYINRH
FT                   VYKNAENVIVLGTEMKNYLLNHQISKNADNIHVIPNWYDMRQLQDNRIYNDTFKAYREQ
FT                   YDKILLYSGNMGQLQDMETLISFLKLNKDQPQTLTILCGHGKKFADVKTAIEDHRIENV
FT                   KMFEFLTGTDYADVLKIADVCIASLIKEGVGLGVPSKNYGYLAAKKALVLIMDKQSDIV
FT                   QHVEQYDAGIQIDNGDAHAIYNFINTHSSKELHEMGERAHQLFKDKYTREINTMKYYNL
FT                   LK"
FT   misc_feature    156503..157015
FT                   /note="Pfam match to entry PF00534 Glycos_transf_1,
FT                   Glycosyl transferases group 1, score 11.6, E-value 1.2e-05"
FT   CDS_pept        157086..157643
FT                   /transl_table=11
FT                   /locus_tag="SAS0136"
FT                   /product="capsular polysaccharide synthesis enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0163"
FT                   /protein_id="CAG41904.1"
FT                   /translation="MKRLFDVVSSIYGLVVLSPILLITALLIKMESPGPAIFKQKRPTI
FT                   NNELFNIYKFRSMKIDTPNVATDLMDSTSYITKTGKVIRKTSIDELPQLLNVLKGEMSI
FT                   VGPRPALYNQYELIEKRTKVNVHTIRPGVTGLAQVMGRDDITDDQKVAYDHYYLTHQSM
FT                   MLDMYIIYKTIKNIVTSEGVHH"
FT   misc_feature    157089..157637
FT                   /note="Pfam match to entry PF02397 Bact_transf, Bacterial
FT                   sugar transferase, score 143.7, E-value 3.4e-40"
FT   misc_feature    157104..157169
FT                   /note="1 probable transmembrane helix predicted for SAS0136
FT                   by TMHMM2.0 at aa 7-28"
FT   CDS_pept        157643..158530
FT                   /transl_table=11
FT                   /locus_tag="SAS0137"
FT                   /product="capsular polysaccharide synthesis enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0164"
FT                   /protein_id="CAG41905.1"
FT                   /translation="MRKNILITGVHGYIGNALKDKLIEQGHQVDQINVRNQLWKSTSFK
FT                   DYDVLIHTAALVHNNSPQARLSDYMQVNMLLTKQLAQKAKSEDVKQFIFMSTMAVYGKE
FT                   GQVGKSDQIDTQTPMNPTTNYGISKKFAEQALQELISDSFKVAIVRPPMIYGAHCPGNF
FT                   QRLMQLSKRLPIIPNINNQRSALYIKHLTAFIDQLISLEVTGVYHPQDSFYFDTSSVMY
FT                   EIRRQSHRKTVLINMPSVLNKYFNKLSVFRKLFGNLIYSNTLYENNNALEVIPGKMSLV
FT                   IADIMDETTTKDKA"
FT   CDS_pept        158584..159846
FT                   /transl_table=11
FT                   /locus_tag="SAS0138"
FT                   /product="capsular polysaccharide synthesis enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0165"
FT                   /protein_id="CAG41906.1"
FT                   /translation="MKLTVVGLGYIGLPTSIMFAKHGVDVLGVDINQQTIDKLQSGQIS
FT                   IEEPGLQEIYEEVLSSGKLKVSTTPEASDVFIIAVPTPNNDDQYRSCDISLVMRALDSI
FT                   LPFLKKGNTIIVESTIAPKTMDDFVKPVIENLGFTIGEDIYLVHCPERVLPGKILEELV
FT                   HNNRIIGGVTKACIEAGKRVYRTFVQGEMIETDARTAEMSKLMENTYRDVNIALANELT
FT                   KICNNLNINVLDVIEMANKHPRVNIHQPGPGVGGHCLAVDPYFIIAKDPENAKLIQTGR
FT                   EINNSMPAYVVDTTKQIIKALSGNKVTVFGLTYKGDVDDIRESPAFDIYELLNQEPDIE
FT                   VCAYDPHVELDFVEHDMSHAVKDASLVLILSDHSEFKNLSDSHFDKMKHKVIFDTKNVV
FT                   KSSFEDVSYYNYGNIFNFIDK"
FT   misc_feature    158584..159150
FT                   /note="Pfam match to entry PF03721 UDPG_MGDP_dh_N,
FT                   UDP-glucose/GDP-mannose dehydrogenase family, NAD binding
FT                   domain, score 308.0, E-value 1.2e-89"
FT   misc_feature    158641..158673
FT                   /note="PS00639 Eukaryotic thiol (cysteine) proteases
FT                   histidine active site."
FT   misc_feature    159172..159450
FT                   /note="Pfam match to entry PF00984 UDPG_MGDP_dh,
FT                   UDP-glucose/GDP-mannose dehydrogenase family, central
FT                   domain, score 167.8, E-value 1.9e-47"
FT   misc_feature    159505..159786
FT                   /note="Pfam match to entry PF03720 UDPG_MGDP_dh_C,
FT                   UDP-glucose/GDP-mannose dehydrogenase family, UDP binding
FT                   domain, score 123.6, E-value 3.9e-34"
FT   CDS_pept        159893..161068
FT                   /transl_table=11
FT                   /locus_tag="SAS0139"
FT                   /product="capsular polysaccharide synthesis enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0166"
FT                   /protein_id="CAG41907.1"
FT                   /translation="MCLNFREDNVMKKIMVIFGTRPEAIKMAPLVKEIDHNGNFEANIV
FT                   ITAQHRDMLDSVLSIFDIQADHDLNIMQDQQTLADLTANALAKLDSIINEEQPDMILVH
FT                   GDTTTTFVGSLAAFYHQIPVGHVEAGLRTHQKYSPFPEELNRVMVSNIAELNFAPTVIA
FT                   AKNLLFENKDKERIFITGNTVIDALSTTVQNDFVSTIINKHKGKKVILLTAHRRENIGE
FT                   PMHQIFKAVRDLADEYKDVVFIYPMHRNPKVRAIAEKYLSGRNRIELIEPLDAIEFHNF
FT                   TNQSYLVLTDSGGIQEEAPTFGKPVLVLRNHTERPEGVEAGTSRVIGTDYDNIVRNVKQ
FT                   LIEDDEAYQRMSQANNPYGDGQASRRICEAIEYYFGLRTDKPDEFVPLRHK"
FT   misc_feature    159986..161008
FT                   /note="Pfam match to entry PF02350 Epimerase_2,
FT                   UDP-N-acetylglucosamine 2-epimerase, score 654.7, E-value
FT                   5.1e-194"
FT   CDS_pept        complement(161133..161459)
FT                   /transl_table=11
FT                   /locus_tag="SAS0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0167"
FT                   /db_xref="GOA:Q6GCW1"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR023953"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCW1"
FT                   /protein_id="CAG41908.1"
FT                   /translation="MFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNT
FT                   EDTDEVKILTIWESEDSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGY
FT                   HYQK"
FT   misc_feature    complement(161238..161432)
FT                   /note="Pfam match to entry PF03992 ABM, Antibiotic
FT                   biosynthesis monooxygenase, score 49.5, E-value 7.7e-12"
FT   CDS_pept        complement(161466..161849)
FT                   /transl_table=11
FT                   /locus_tag="SAS0141"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0168"
FT                   /protein_id="CAG41909.1"
FT                   /translation="MRLILIVIGLIFTALGIAGAVLPLLPTTPFLLVAVFCFARSSDRF
FT                   YNWLINQKIYKEYVENFYLHRGYTLQQKIKILISLYIVIGFSIYMVDVLAVRIGLIIMV
FT                   IIQTAVLFTFVKTLPKSNHKIEE"
FT   misc_feature    complement(161496..161726)
FT                   /note="Pfam match to entry PF04304 DUF454, Protein of
FT                   unknown function (DUF454), score 133.5, E-value 4.1e-37"
FT   misc_feature    complement(order(161505..161558,161571..161624,
FT                   161736..161840))
FT                   /note="3 probable transmembrane helices predicted for
FT                   SAS0141 by TMHMM2.0 at aa 4-38, 76-93 and 98-115"
FT   misc_feature    complement(161754..161849)
FT                   /note="Signal peptide predicted for SAS0141 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.977) with cleavage site
FT                   probability 0.348 between residues 32 and 33"
FT   CDS_pept        162276..163763
FT                   /transl_table=11
FT                   /locus_tag="SAS0142"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0169"
FT                   /db_xref="GOA:Q6GCV9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCV9"
FT                   /protein_id="CAG41910.1"
FT                   /translation="MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHIT
FT                   RAKDKDVDHAVKVAQDAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIETLNNGKPI
FT                   RETTAIDIPFAARHFHYFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPML
FT                   LAAWKIAPAIAAGNTIVIQPSSSTPLSLLEVAKIFQEVLPKGVVNILTGKGSESGNAIF
FT                   NHDGVDKLSFTGSTDVGYQVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLG
FT                   ILFNQGEVCSAGSRLLVHEKIYDQLVPRLQEAFSNIKVGDPQDEATQMGSQTGKDQLDK
FT                   IQSYIDAAKESDAQILAGGHRLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTV
FT                   IKVKDDQEAIDIANDSEYGLAGGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFG
FT                   GYKKSGIGRETYKGALSNYQQVKNIYIDTSNALKGLY"
FT   misc_feature    162333..163736
FT                   /note="Pfam match to entry PF00171 aldedh, Aldehyde
FT                   dehydrogenase family, score 703.2, E-value 1.2e-208"
FT   misc_feature    163038..163061
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT   misc_feature    163122..163157
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT   CDS_pept        164409..165368
FT                   /transl_table=11
FT                   /locus_tag="SAS0143"
FT                   /product="putative cation efflux system protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0170"
FT                   /protein_id="CAG41911.1"
FT                   /translation="MNGKKANTINRYKYFHHVNHQKIQQSSKKTLWASLIITLLFTVIE
FT                   FVGGLVSNSLALLSDSFHMLSDVLALGLSMLAIYFASKKPTARYTFGYLRFEILAAFLN
FT                   GLALIVISIWILYEAIVRIIYPQPIESGIMFMIASIGLLVNIILTIILVRSLKQEDNIN
FT                   IQSALWHFMGDLLNSIGVIVAVVLIYFTGWRIIDPIISIVISLIILRGGYKITRNAWLI
FT                   LMESVPQHLDTDQIMADIKNIDGILDVHEFHLWSITTEHYSLSAHVVLDKKYEGDDYQA
FT                   IDQVSSLLKEKYGIAHSTLQIENLQLNPLDEPYFDKLT"
FT   misc_feature    164409..164576
FT                   /note="Signal peptide predicted for SAS0143 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.768) with cleavage site
FT                   probability 0.292 between residues 56 and 57"
FT   misc_feature    order(164496..164564,164592..164651,164688..164756,
FT                   164799..164867,164904..164972,164982..165035)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SAS0143 by TMHMM2.0 at aa 30-52, 62-81, 94-116, 131-153,
FT                   166-188 and 192-209"
FT   misc_feature    164499..165335
FT                   /note="Pfam match to entry PF01545 Cation_efflux, Cation
FT                   efflux family, score 387.7, E-value 1.2e-113"
FT   CDS_pept        165436..165702
FT                   /transl_table=11
FT                   /locus_tag="SAS0144"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /protein_id="CAG41912.1"
FT                   /translation="MTERKCACNKLFSILVRGPNTENFEKKFYRQCKLGCGPQHREFRK
FT                   EILQAMQVGVGQRNKFCENIISVPLPRLFWIMLHHLNDFRQFL"
FT   misc_feature    165436..165492
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT   CDS_pept        complement(165662..165865)
FT                   /transl_table=11
FT                   /locus_tag="SAS0145"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0171"
FT                   /protein_id="CAG41913.1"
FT                   /translation="MDKESVVASLARNKKIAVETMAGQRYIIERILHTNDEKHIHILKP
FT                   KDVVLDVDSIKEIDENHLNDAT"
FT   CDS_pept        166043..166555
FT                   /transl_table=11
FT                   /locus_tag="SAS0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0172"
FT                   /protein_id="CAG41914.1"
FT                   /translation="MTLFLLEANNLDFASTKEELEAKAASLSTKTIPTLIEVQATENLT
FT                   HGYFIVEANDEAEAKQFLTEADISIQLVKEVRLVGKDLDEVKNGDAHVDYLVTWNIPEG
FT                   ITMDQYLARKKKNSVHYEEVPEVEFKRTYVCEDMSKCICLYNAPDEEAVRRARKAVDTP
FT                   IDGIEKL"
FT   CDS_pept        166897..167637
FT                   /transl_table=11
FT                   /locus_tag="SAS0147"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0173"
FT                   /protein_id="CAG41915.1"
FT                   /translation="MIKIQQLQHHFGSHKVIHNFNLDISKGEIVTFIGKSGCGKSTLLN
FT                   IIGGFIHPSSGRVIIDNEIKQQPSPDCLMLFQHHNLLPWKTINDNIRIGFRQKISDEEI
FT                   NAQLKLVDLEGRGKHFPEQLSGGMKQRVALCRAHVHKPNVILMDEPLGALDAFTRYKLQ
FT                   DQLVQLKHKTQSTIILVTHDIDEAIYLSDRIVLLGEGCNIISQYEITASHPRSRNDSHL
FT                   LKVRNEIMETFALNHHQVEPEYYL"
FT   misc_feature    166975..167496
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 187.9, E-value 1.6e-53"
FT   misc_feature    166996..167019
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        167651..168625
FT                   /transl_table=11
FT                   /locus_tag="SAS0148"
FT                   /product="putative lipoprotein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0174"
FT                   /protein_id="CAG41916.1"
FT                   /translation="MKRLSIIVIIGIFIITGCDWQRTSKEPSKNAQNQQVIKIGYLPIT
FT                   HSANLMMTKKLLSQYNHPKYKLELVKFNNWPDLMDALNSGRIDGASTLIELAMKSKQKG
FT                   SNIKAVALGHHEGNVIMGQKGMHLNEFNNNGDDYHFGIPHRYSTHYLLLEELRKQLKIK
FT                   PGHFSYHEMSPAEMPAALSEHRITGYSVAEPFGALGEKLGKGKTLKHGDDVIPDAYCCV
FT                   LVLRGELLDQHKDVAQAFVQDYKKSGFKMNDRKQSVDIMTHHFKQSRDVLTQSAAWTSY
FT                   GDLTIKPSGYQEITTLVKQHHLFNPPAYDDFVEPSLYKEASRS"
FT   misc_feature    167672..167704
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        168622..169383
FT                   /transl_table=11
FT                   /locus_tag="SAS0149"
FT                   /product="putative transport system permease"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0175"
FT                   /protein_id="CAG41917.1"
FT                   /translation="MTRPTNNKFILPIITFIIFLGIWEMVIIIGHYQPVLLPGPALVGK
FT                   SIWTFIVTGEIFQHLAISLWRFVAGFVVALLVAIPLGFLLGRNRWLYNAIEPLFQLIRP
FT                   ISPIAWAPFVVLWFGIGSLPAIAIIFIAAFFPIVFNTIKGVRDIEPQYLKIAANLNLTG
FT                   WSLYRNILFPGAFKQIMAGIHMAVGTSWIFLVSGEMIGAQSGLGFLIVDARNMLNLEDV
FT                   LAAIFFIGLFGFIIDRFISYIEQFILRRFGE"
FT   misc_feature    order(168646..168714,168724..168792,168811..168879,
FT                   168967..169035,169159..169227,169285..169344)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SAS0149 by TMHMM2.0 at aa 9-31, 35-57, 64-86, 116-138,
FT                   180-202 and 222-241"
FT   misc_feature    168736..168759
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    168787..169368
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport system inner membrane
FT                   component, score 93.4, E-value 4.8e-25"
FT   CDS_pept        169396..170427
FT                   /transl_table=11
FT                   /locus_tag="SAS0150"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0176"
FT                   /protein_id="CAG41918.1"
FT                   /translation="MTLETLIKEQLDPHLVEVDEGTYYPRTFIQQLFVDGYFGEAALRK
FT                   NAEVIEAVSQSCLTTGFCLWCQLAFSTYLENATQPHLNNDLQQQLLSGEILGATGLSNP
FT                   MKSFNDLEKLNLEHTYVDGQLVVSGRMPAVSNIQEDHYFGAISKHESSDEFVMFILRAN
FT                   QDGITLVEKTNFLGVNGSATYQITLNQVVVPQSQIITHDAKQFAATIRPQFIAYQIPIG
FT                   LGSIKSSLELIDAFSNAQNGINQYLEYDVEAFKKRYRQLREEYYAILDDGNLTSHLNEL
FT                   ISLKKDIGYLLLDVNQASVVNGGSRAYTPYSPQVRKLKEGFFFAALTPTLRHLGKLEAE
FT                   LKG"
FT   CDS_pept        170644..171003
FT                   /transl_table=11
FT                   /locus_tag="SAS0151"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0177"
FT                   /protein_id="CAG41919.1"
FT                   /translation="MNTIDTHTKEQQFSNLVRSYRKEYVGKGPNSIRVSFKDNWAIAHM
FT                   TGVLSKVESFYLNDKRNESMLHYTRTEKIKQMYKEIDVNEMESLVGAKFVKLFTDIDLN
FT                   DDEVISIFVFDKSIE"
FT   CDS_pept        171078..172202
FT                   /transl_table=11
FT                   /locus_tag="SAS0152"
FT                   /product="putative D-isomer specific 2-hydroxyacid
FT                   dehydrogenase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0178"
FT                   /protein_id="CAG41920.1"
FT                   /translation="MSNGAVFFVIFLKQATCNTYFKEVKIYHLGEMDMKIVALFPEAVE
FT                   GQENQLLNTKKALGLKTFLEERGHEFIILADNGEDLDKHLPDMDVIISAPFYPAYMTRE
FT                   RIEKAPNLKLAITAGVGSDHVDLAAASEHNIGVVEVTGSNTVSVAEHAVMDLLILLRNY
FT                   EEGHRQSVEGEWNLSQVGNHAHELQHKTIGIFGFGRIGQLVAERLAPFNVTLQHYDPIN
FT                   QQDHKLSKFVSFDELVSTSDAITIHAPLTPETDNLFDKDVLSRMKKHSYLVNTARGKIV
FT                   NRDALVEALASEHLQGYAGDVWYPQPAPADHPWRTMPRNAMTVHYSGMTLEAQKRIEDG
FT                   VKDILERFFNHEPFQDKDIIVASGRIASKSYTAK"
FT   misc_feature    171219..171503
FT                   /note="Pfam match to entry PF00389 2-Hacid_DH, D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, catalytic domain,
FT                   score 96.5, E-value 5.6e-26"
FT   misc_feature    171519..172052
FT                   /note="Pfam match to entry PF02826 2-Hacid_DH_C, D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD binding domain,
FT                   score 245.4, E-value 8.3e-71"
FT   misc_feature    171651..171734
FT                   /note="PS00065 D-isomer specific 2-hydroxyacid
FT                   dehydrogenases NAD-binding signature."
FT   misc_feature    171786..171854
FT                   /note="PS00670 D-isomer specific 2-hydroxyacid
FT                   dehydrogenases signature 2."
FT   CDS_pept        172588..173838
FT                   /transl_table=11
FT                   /locus_tag="SAS0153"
FT                   /product="putative transporter protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0179"
FT                   /protein_id="CAG41921.1"
FT                   /translation="MKRLSTTLKVRLISNFLQLIITTAFIPFIALYLTDMLSQSIVGIY
FT                   LVGLVVLKFPLSIISGYLIEIFPKKLLVLIYQATMVIMLVFMGVFGSHQLWQIIGFCVA
FT                   YAIFTIVWGLQFPVMDTLIMDAITEDVEHYIYKISYWMTNLSVAIGALLGGLMYGYSML
FT                   LLFLIAACIFLIVLFILYIWLPQDRNQVKQSDDKRHASRYQKLQIMNIFRSYKLVLKDR
FT                   NYMLLISGFSIIMMGEFSISSYIAIRLKDQFETISIGSYDITGAKMLAILLMINTVVVI
FT                   LLTYSISKVVLKIDFKKALITGLLIYIVGYSGLTYLNQFGLLVVFMIIATVGEIIYSPI
FT                   VSEQRFKIIPKAKRGTYSAVNALGIHFSETLARLGIVLGVFLTSLQMGLYMFIVLTIGA
FT                   SMLVAGVFGGQKQVNTN"
FT   misc_feature    order(172624..172683,172711..172779,172798..172857,
FT                   172870..172929,172990..173058,173071..173139,
FT                   173260..173328,173395..173463,173482..173535,
FT                   173545..173613,173650..173718,173746..173814)
FT                   /note="12 probable transmembrane helices predicted for
FT                   SAS0153 by TMHMM2.0 at aa 13-32, 42-64, 71-90, 95-114,
FT                   135-157, 162-184, 225-247, 270-292, 299-316, 320-342,
FT                   355-377 and 387-409"
FT   CDS_pept        174285..181460
FT                   /transl_table=11
FT                   /locus_tag="SAS0154"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0180"
FT                   /protein_id="CAG41922.1"
FT                   /translation="MIMGNLRFQQEYFRIYKNNTESTTHRNAYWVKLAKNVEATKMMYA
FT                   LSTIVQQHASIRHFFDVTTDDNLTMILHEFLPFIEIKQVPSSSANYDLEAFFKQELSTY
FT                   HFNDSPLFKVKLFQFADAAYILLDFHVSIFDDSQIDIFLDDLCNAYRGNTVINNTRQHA
FT                   HINRNDDKDNQDASHIALDSNYFRLENNSDIHIDSYFPIKHPFEQALYQTYLIDDMTSI
FT                   DMASLAVSVYLANHIMSQQHDVTLGIHVPSHLPNDLHGNIVPLTLTIDAKDVCQRFTTD
FT                   FNKCVLQNMSQLQCAKSSLSLETIFHCYHHMMSCCNDVIEDVHQIHDAHTSLADIEIFP
FT                   HQHGFKIIYNSAAYDLLSIETLSDLVRNIYLQITEENGNKRTTVDELNLMTERDIQLYD
FT                   DINLSLPEIDDAQTVVTLFEQQVEATPNHVAVQFDGVFITYQTLNARANDLAHRLRNQY
FT                   GVEPNDRVAVIAEKSIEMIIAMIGVLKAGGAYVPIDLNYPSDRQEYILKDVTPKVVITY
FT                   QALYENGKQNINHIDLNKIAWKNIDNLSKCNTLEDHAYVIYTSGTTGNPKGTLIPHRGI
FT                   VRLVHQNHYVPLNEETTILLSGTIAFDAATFEIYGALLNGGKLIVAKKEQLLNPIAVEQ
FT                   LINENDVNTMWLTSSLFNQIASERIEVLVPLKYLLIGGEVLNAKWVDLLNQKPKHPQII
FT                   NGYGPTENTTFTTTYNIPNKVPNRIPIGKPILGTHVYIMQGERRCGVGIPGELCTSGFG
FT                   LAAGYLNQPELTADKFIKDSNINQLMYRSGDIVRLLPDGNIDYLYRKDKQVKIRGFRIE
FT                   LSEVEHALERIQGINKAVVIVQNHDQDQYIVAYYEAMHTLSHNKIKSQLRMTLPEYMIP
FT                   VNFMHIEQIPITINGKLDKKALPIMDYVDTDAYVAPSTDTEHLLCQIFADILHVNQVGI
FT                   HDNFFELGGHSLKATLVVNRIEASTGKRLQIGDLLQKPTVFELAQAIAKVQEQNYEVIP
FT                   ETIVKDDYVLSSAQKRMYLLWKSNHKDTVYNVPFLWRLSSELNVAQLRQAVQRLIARHE
FT                   ILRTQYIVVDDEVRQRIVADVAVDFEEVNTHFTDEQEIMRQFVAPFNLEKPSQIRVRYI
FT                   RSPLHAYLFIDTHHIINDGMSNIQLMNDLNALYQHKLLLPLKLQYKDYSEWMSHRDMTK
FT                   HRQYWLSQFKDEVPILSLPTDYVRPNIKTTNGAMMSFTMNQQMRQLLQKYVEKHQITDF
FT                   MFFMSVVMTLLSRYARKDDVVVGSVMSARMHKGTEQMLGMFANTLVYRGQPSPDKMWTQ
FT                   FLQEVKEMSLEAYEHQEYPFECLVNDLDQSHDASRNPLFDVMLVLQNNETNHAHFGHSK
FT                   LTHIQPKSVTAKFDLSFIIEEDRDDYTINIEYNTDLYHSETVRHMGNQCMIMIDYILKH
FT                   QDTLQICDIPNGTEELLNWVNTHVNDRMLNVPGNKSIISYFNEVVSRQGNHVALVMNDL
FT                   TMTYETLRNYVDAIAHMLLSNGVGNGQRVALFTERSFEMIAAMLATVKVGASYIPIDID
FT                   FPNKRQGAILEDAKVTAVMSYGVEIETTLPVIQLENAKGFVESKENEQYDDLHGNQLEN
FT                   TAMLDNEMYAIYTSGTTGMPKGVAIRQRNLLNLVHAWSTELQLGDNEVFLQHANIVFDA
FT                   SVMEIYCCLLNGHTLVIPDREERVNPEQLQQLINKHRVTVASIPLQMCSVMEDFYIEKL
FT                   ITGGATSTASFVKYIEKHCGTYFNAYGPSESTVITSYWSHQCGDLIPETIPIGKPLSNI
FT                   QVYIMSDGLLCGIGMPGELCIAGDSLAIGYINRPELMADKWQNNPFGKGKLYHSGDLAR
FT                   YTSDGQIEFLGRIDKQVKVNGYRIELDEIENAILAIRGISDCVVTVSHFDTHDILNAYY
FT                   VGEQQMEQDLKQYLNDHLPKYMIPKTITHIDYMPLTTNDKVDTTRLPNPSTIQQSNKVY
FT                   SEPSNEIEQTFVDVFGEVLKQNDVGVDDDFFELGGNSLEAMLVVSHLKRFGHHISMQTL
FT                   YQYKTVRQIVNYMHQNQQSLVALPDNLSELQKIVMSRYNLGVLEDSLSHRPIGNTLLTG
FT                   ATGFLGAYLIEALQGYSHRIYCFIRADNEEIARYKLMTNLNDYFSEETVEMMLSNIEVI
FT                   VGDFECMDDVVLPENMDTIIHAGARTDHFGDDDEFEKVNVQGTVDVIRLAQQHHARLIY
FT                   VSTISVGTYFDIDTEDVTFSEADVYKGQLLTSPYTRSKFYSELKVLEAVNNGLDGRIVR
FT                   VGNLTSPYNGRWHMRNIKTNRFSMVMNDLLQLDCIGVSMAEMPVDFSFVDTTARQIVAL
FT                   AQVNTPQIIYHVLSPNKMPVKSLLECVKRKEIELVSDESFNEILQKQDMYETIGLTSVD
FT                   REQQLAMIDTTLTLKIMNHISEKWPTITNNWLYHWAQYIKTIFNK"
FT   misc_feature    175599..176777
FT                   /note="Pfam match to entry PF00501 AMP-binding, AMP-binding
FT                   enzyme, score 453.1, E-value 2.5e-133"
FT   misc_feature    175950..175985
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT   misc_feature    177021..177215
FT                   /note="Pfam match to entry PF00550 pp-binding,
FT                   Phosphopantetheine attachment site, score 72.7, E-value
FT                   7.8e-19"
FT   misc_feature    177090..177137
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT   misc_feature    177261..178115
FT                   /note="Pfam match to entry PF00668 Condensation,
FT                   Condensation domain, score 231.0, E-value 1.7e-66"
FT   misc_feature    178674..179861
FT                   /note="Pfam match to entry PF00501 AMP-binding, AMP-binding
FT                   enzyme, score 390.4, E-value 1.8e-114"
FT   misc_feature    179775..179801
FT                   /note="PS00697 ATP-dependent DNA ligase AMP-binding site."
FT   misc_feature    180108..180299
FT                   /note="Pfam match to entry PF00550 pp-binding,
FT                   Phosphopantetheine attachment site, score 52.6, E-value
FT                   9.3e-13"
FT   misc_feature    180177..180224
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT   CDS_pept        181473..182117
FT                   /transl_table=11
FT                   /locus_tag="SAS0155"
FT                   /product="4'-phosphopantetheinyl transferase superfamily
FT                   protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0181"
FT                   /protein_id="CAG41923.1"
FT                   /translation="MTVFVMQLQSNLKSIEELISQSRWSYKKPRTVNYRYNQDKLMHRL
FT                   GDILVQYGIQHDTGLLPHEWHYHISPRGKADIVQHNRDGQPIYVSLSYSYPYIVCVVDK
FT                   EPVGIDIEKISQRLDWRTLVTCFSTNEAHQICSLNDFYQIWTQKESFTKLIGEGLIKGL
FT                   DIYDMTQSHFYQSREVKFKQFIFDQFMVQVCFLGQAPWGYKKVSVFQLLSS"
FT   misc_feature    181791..181964
FT                   /note="Pfam match to entry PF01648 ACPS,
FT                   4'-phosphopantetheinyl transferase superfamily, score 15.7,
FT                   E-value 0.00024"
FT   CDS_pept        complement(182445..182939)
FT                   /transl_table=11
FT                   /locus_tag="SAS0156"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0182"
FT                   /protein_id="CAG41924.1"
FT                   /translation="MTKRQMGIFIYAGIIGGLLSGIVKLGWEVMFPPRTPERNATNPPQ
FT                   ELLQQLGFSSEFTHQTYTFSNMELPWVSFIVHFSFSIVIAIIYCILVKKYAYLAMGQGA
FT                   VFGIAIWVLFHLIIMPIMHTVPAVWDQPFQEHLSEFFGHIVWMMTIELVRQHFVYRYKL
FT                   N"
FT   misc_feature    complement(order(182466..182522,182565..182633,
FT                   182667..182735,182853..182921))
FT                   /note="4 probable transmembrane helices predicted for
FT                   SAS0156 by TMHMM2.0 at aa 7-29, 69-91, 103-125 and 140-158"
FT   CDS_pept        complement(183194..183958)
FT                   /transl_table=11
FT                   /locus_tag="SAS0157"
FT                   /product="putative amino acid kinase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0183"
FT                   /db_xref="GOA:Q6GCU4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCU4"
FT                   /protein_id="CAG41925.1"
FT                   /translation="MKFIVIKIGGSTLSDMHPSIINNIKHLRSNNIYPIIVHGGGPFIN
FT                   EALSNQQIEPHFVNGLRVTDKATMTITKHTLIADVNTALVAQFNQHQCSAIGLCGLDAQ
FT                   LFEITSFDQQYGYVGVPTALNKDALQYLCTKFVPIINSIGFNNHDGEFYNINADTLAYF
FT                   IASSLKAPIYVLSNIAGVLINDVVIPQLPLVDIHQYIEHGDIYGGMIPKVLDAKNAIEN
FT                   GCPKVIIASGNKPNIIESIYNNDFVGTTILNS"
FT   misc_feature    complement(183266..183955)
FT                   /note="Pfam match to entry PF00696 aakinase, Amino acid
FT                   kinase family, score 114.4, E-value 2.2e-31"
FT   CDS_pept        complement(183974..185215)
FT                   /transl_table=11
FT                   /locus_tag="SAS0158"
FT                   /product="putative arginine biosynthesis bifunctional
FT                   protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0184"
FT                   /db_xref="GOA:Q6GCU3"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCU3"
FT                   /protein_id="CAG41926.1"
FT                   /translation="MKHQETTSQQYNFSIIKHGDISTPQGFTAGGMHIGLRANKKDFGW
FT                   IYSSSLASAAAVYTLNQFKAAPLIVTEDTLQKSKGKLQALVVNSANANSCTGQQGIDDA
FT                   RQTQTWVAQQLQIPSEHVAVASTGVIGEYLPMDKIKTGTEHIKDANFATPGAFNEAILT
FT                   TDTCTKHIAVSLKIDGKTVTIGGSTKGSGMIHPNMATMLAFITTDASIESNTLHQLLKS
FT                   STDHTFNMITVDGDTSTNDMVLVMANHQVEHQILSQDHPQWETFVDAFNFVCTFLAKAI
FT                   ARDGEGATKLISVNVSGAKSISDARKIGKTIVSSNLVKSAIFGEDANFGRIITAIGYSG
FT                   CEIDPNCTYVQLNQIPVVDKGMAVLFDEQAMSNTLTHENVTIDVQLGLGNAAATAYGCD
FT                   LSYDYVRINASYRT"
FT   misc_feature    complement(183977..185137)
FT                   /note="Pfam match to entry PF01960 ArgJ, ArgJ family, score
FT                   656.7, E-value 1.3e-194"
FT   CDS_pept        complement(185227..186261)
FT                   /transl_table=11
FT                   /locus_tag="SAS0159"
FT                   /product="putative N-acetyl-gamma-glutamyl-phosphate
FT                   reductase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0185"
FT                   /db_xref="GOA:Q6GCU2"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCU2"
FT                   /protein_id="CAG41927.1"
FT                   /translation="MMIKVGIVGGSGYGAIELIRLLQTHPHVTIAHIYSHSKVDEPLKL
FT                   TFPHLQHIMQHFEALTVDNNDCDVIFFATPAPVSKTCIPPLVEKGIHVIDLSGAFRIKN
FT                   REIYEAYYKETAAAQDDLNHAIYSISEWQSFDNNGTKLISNPGCFPTATLLALHPLISE
FT                   KIVDLSSIIIDAKTGVSGAGRSLSQRVHFSEMNENLSAYAIGNHKHKPEIEQYLSIIAG
FT                   QDVSVIFTPHLVPMTRGILSTIYVKLSSEYTTESLHKLMTSYYANQPFVRIRDIGTFPT
FT                   TKEVLGSNYCDIGIYVDETTQTAILVSVIDNLVKGASGQAIQNLNILYDFEVTTGLNQS
FT                   PVYP"
FT   misc_feature    complement(185317..185793)
FT                   /note="Pfam match to entry PF02774 Semialdhyde_dhC,
FT                   Semialdehyde dehydrogenase, dimerisation domain, score
FT                   161.8, E-value 1.2e-45"
FT   misc_feature    complement(185785..185835)
FT                   /note="PS01224 N-acetyl-gamma-glutamyl-phosphate reductase
FT                   active site."
FT   misc_feature    complement(185830..186258)
FT                   /note="Pfam match to entry PF01118 Semialdhyde_dh,
FT                   Semialdehyde dehydrogenase, NAD binding domain, score 94.2,
FT                   E-value 2.8e-25"
FT   CDS_pept        complement(186297..187481)
FT                   /transl_table=11
FT                   /locus_tag="SAS0160"
FT                   /product="putative ornithine aminotransferase precursor"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0186"
FT                   /db_xref="GOA:Q6GCU1"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR034757"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCU1"
FT                   /protein_id="CAG41928.1"
FT                   /translation="MNSIIELTDYYSSNNYAPLKLVISKGKGVKVWDTDGKQYIDCISG
FT                   FSVANQGHCHPTIVKAMTEQASKLSIISRVLYSDNLGKWEEKICHLAKKDKVLPLNSGT
FT                   EAVEAAIKIARKWGSEVKGITDGQVEIIAMNNNFHGRTLGSLSLSNHDAYKAGFHPLLQ
FT                   GTTTVDFGDIEQLTQAISPNTAAIILEPIQGEGGVNIPPKGYIQAVRQLCDKHQILLIA
FT                   DEIQVGLGRTGKWFAMEWEQVVPDIYILGKALGGGLYPVSAVLANNDVMRVLTPGTHGS
FT                   TFGGNPLAIAISTAALDVLKDEQLVERSERLGSFLLKALLQLKHPSIKEIRGRGLFIGI
FT                   ELNTDAAPFVDQLIQRGILCKDTHRTIIRLSPPLVIDKEEIHQIVAAFQDVFKN"
FT   misc_feature    complement(186303..187454)
FT                   /note="Pfam match to entry PF00202 aminotran_3,
FT                   Aminotransferase class-III, score 579.5, E-value 2.2e-171"
FT   misc_feature    complement(186711..186824)
FT                   /note="PS00600 Aminotransferases class-III
FT                   pyridoxal-phosphate attachment site."
FT   CDS_pept        complement(187734..189089)
FT                   /transl_table=11
FT                   /locus_tag="SAS0161"
FT                   /product="putative branched-chain amino acid transport
FT                   system carrier protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0187"
FT                   /protein_id="CAG41929.1"
FT                   /translation="MKKKLTFKENMFIGSMLFGLFFGAGNLIFPIHLGQAAGSNVFIAN
FT                   LGFLITAIGLPFLGIIAIGISKTSGLFEIASRVNKTYAYIFTIALYLVIGPFFALPRLA
FT                   TTSFEIAFSPFLSPKQITLYLFIFSFVFFVIAWFFARKPSRILEYIGKFLNPVFLVLLA
FT                   IILLFAFIHPLGGISDAPISKQYQSNALFNGFLDGYNTLDALASLAFGIIIVATIKKLG
FT                   IENPTDIAKETIKSGTISIIMMGIIYTLLAIMGTLSIGHFKLSENGGIALAQITQYYLG
FT                   NYGIVLLSLIVMVACLKTAIGLITAFSETFEHLFPKMNYLAIATVVSFISFLFANVGLT
FT                   KIIMYSVPVLMFLYPLAIALIVLTLFSSKFHHSKLIYQCTIFFTMIAALVDGLKASPEF
FT                   ISSTSFSQTLINFSQKYLPLSDIGMGWVVLSLIGFIIGFIIYKIKHRKIPQA"
FT   misc_feature    complement(187758..189074)
FT                   /note="Pfam match to entry PF05525 Branch_AA_trans,
FT                   Branched-chain amino acid transport protein, score 802.0,
FT                   E-value 2.3e-238"
FT   misc_feature    complement(order(187767..187826,187920..187973,
FT                   187992..188060,188070..188138,188199..188267,
FT                   188310..188378,188439..188507,188565..188633,
FT                   188670..188729,188772..188840,188901..188969,
FT                   188997..189056))
FT                   /note="12 probable transmembrane helices predicted for
FT                   SAS0161 by TMHMM2.0 at aa 12-31, 41-63, 84-106, 121-140,
FT                   153-175, 195-217, 238-260, 275-297, 318-340, 344-366,
FT                   373-390 and 422-441"
FT   misc_feature    complement(188982..189089)
FT                   /note="Signal peptide predicted for SAS0161 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.721 between residues 36 and 37"
FT   CDS_pept        complement(189365..189922)
FT                   /transl_table=11
FT                   /locus_tag="SAS0162"
FT                   /product="putative isochorismatase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0188"
FT                   /protein_id="CAG41930.1"
FT                   /translation="MINFNKTALVLIDLQEGILKMDYAPYTAENVVQNANKLIDVFRKN
FT                   NGFIAFVRVNFYDGKDVLQPNAMISLPPKEGDDYSRFHHLLDKRDDDFVIDKRHFSAFV
FT                   GTDLDLQLRRRGIDTIVLGGVATHIGVDTTARDAYQLNYNQFFVTDMMSAQNETLHQFP
FT                   IDNVFPLMGQTITTNDFLNILN"
FT   misc_feature    complement(189377..189919)
FT                   /note="Pfam match to entry PF00857 Isochorismatase,
FT                   Isochorismatase family, score 155.9, E-value 7.3e-44"
FT   CDS_pept        complement(189989..191629)
FT                   /transl_table=11
FT                   /locus_tag="SAS0163"
FT                   /product="putative thiamine pyrophosphate enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0189"
FT                   /protein_id="CAG41931.1"
FT                   /translation="MKQRIGAYLIDAIHRAGVDKIFGVPGDFNLAFLDDIISNPNVDWV
FT                   GNTNELNASYAADGYARLNGLAALVTTFGVGELSAVNGIAGSYAERIPVIAITGAPTRA
FT                   VEHAGKYVHHSLGEGTFDDYRKMFAHITVAQGYITPENATTEIPRLINTAIAERRPVHL
FT                   HLPIDVAISEIEIPTPFEVTAAKDTDASTYIELLTSKLHQSKQPIIITGHEINSFHLHQ
FT                   ELEDFVNQTQIPVAQLSLGKGAFNEENPYYMGIYDGKIAEDKIRDYVDNSDLILNIGAK
FT                   LTDSATAGFSYQFNIDDVVMLNHHNIKIDDVTNDEISLPSLLKQLSNISYTNNATFPAY
FT                   HRPTSPDYTVGTEPLTQQTYFKMMQNFLKPNDVIIADQGTSFFGAYDLALYKNNTFIGQ
FT                   PLWGSIGYTLPATLGSQLADKDRRNLLLIGDGSLQLTVQAISTMIRQHIKPVLFVINND
FT                   GYTVERLIHGMYEPYNEIHMWDYKALPAVFGGKNVEIHDVESSKDLQDTFNAINGHPDV
FT                   MHFVEVKMSVEDAPKKLIDIAKAFSQQNK"
FT   misc_feature    complement(190061..190570)
FT                   /note="Pfam match to entry PF02775 TPP_enzymes_C, Thiamine
FT                   pyrophosphate enzyme, C-terminal TPP binding domain, score
FT                   155.3, E-value 1.1e-43"
FT   misc_feature    complement(190625..191053)
FT                   /note="Pfam match to entry PF00205 TPP_enzymes, Thiamine
FT                   pyrophosphate enzyme, central domain, score 17.2, E-value
FT                   2.2e-06"
FT   misc_feature    complement(191096..191629)
FT                   /note="Pfam match to entry PF02776 TPP_enzymes_N, Thiamine
FT                   pyrophosphate enzyme, N-terminal TPP binding domain, score
FT                   183.0, E-value 5e-52"
FT   CDS_pept        complement(191902..193947)
FT                   /transl_table=11
FT                   /locus_tag="SAS0164"
FT                   /product="glucose-specific PTS transporter protein, IIABC
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0190"
FT                   /db_xref="GOA:Q6GCT7"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011299"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCT7"
FT                   /protein_id="CAG41932.1"
FT                   /translation="MRKKLFGQLQRIGKALMLPVAILPAAGLLLAIGTAMQGESLQHYL
FT                   PFIQNGGVQTVAKLMTGAGGIIFDNLPMIFALGVAIGLAGGDGVAAIAAFVGYIIMNKT
FT                   MGDFLQVTPKNIGDPASGYASILGIPTLQTGVFGGIIIGALAAWCYNKFYNINLPSYLG
FT                   FFAGKRFVPIMMATTSFILAFPMALIWPTIQSGLNAFSTGLLDSNTGVAVFLFGFIKRL
FT                   LIPFGLHHIFHAPFWFEFGSWKNAAGEIIHGDQRIFIEQIREGAHLTAGKFMQGEFPVM
FT                   MFGLPAAALAIYHTAKPENKKVVAGLMGSAALTSFLTGITEPLEFSFLFVAPLLFFIHA
FT                   VLDGLSFLTLYLLDLHLGYTFSGGFIDYFLLGILPNKTQWWLVIPVGLVYAVIYYFVFR
FT                   FLIVKLKYKTPGREDKQSQAATASATELPYAVLEAMGGKANIKHLDACITRLRVEVNDK
FT                   SKVDVPGLKDLGASGVLEVGNNMQAIFGPKSDQIKHEMQQIMNGQVVENPTTMEDDKDE
FT                   TVVVAEDKSATSELSHIVHAPLTGEVTPLSEVPDQVFSEKMMGDGIAIKPSQGEVRAPF
FT                   NGKVQMIFPTKHAIGLVSDSGLELLIHIGLDTVKLNGEGFTLHVEEGQEVKQGDLLINF
FT                   DLDYIRNHAKSDITPIIVTQGNITNLDFKQGEHGNISFGDQLFEAK"
FT   misc_feature    complement(191983..192297)
FT                   /note="Pfam match to entry PF00358 PTS_EIIA_1,
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 1, score 241.4, E-value 1.3e-69"
FT   misc_feature    complement(192121..192159)
FT                   /note="PS00371 PTS EIIA domains phosphorylation site
FT                   signature 1."
FT   misc_feature    complement(192562..192666)
FT                   /note="Pfam match to entry PF00367 PTS_EIIB,
FT                   phosphotransferase system, EIIB, score 67.8, E-value
FT                   2.4e-17"
FT   misc_feature    complement(192577..192630)
FT                   /note="PS01035 PTS EIIB domains cysteine phosphorylation
FT                   site signature."
FT   misc_feature    complement(order(192742..192810,192826..192885,
FT                   192904..192972,192985..193041,193060..193116,
FT                   193291..193359,193372..193440,193504..193572,
FT                   193660..193728,193846..193914))
FT                   /note="10 probable transmembrane helices predicted for
FT                   SAS0164 by TMHMM2.0 at aa 12-34, 74-96, 126-148, 170-192,
FT                   197-219, 278-296, 303-321, 326-348, 355-374 and 380-402"
FT   misc_feature    complement(192916..193911)
FT                   /note="Pfam match to entry PF02378 PTS_EIIC,
FT                   Phosphotransferase system, EIIC, score 400.9, E-value
FT                   1.3e-117"
FT   misc_feature    complement(193837..193947)
FT                   /note="Signal peptide predicted for SAS0164 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.406 between residues 37 and 38"
FT   CDS_pept        194532..195587
FT                   /transl_table=11
FT                   /locus_tag="SAS0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0191"
FT                   /protein_id="CAG41933.1"
FT                   /translation="MTGFSVYLGQPLDEAYIKRMIKQGYQMIFTSVQIPEEDDETKYHY
FT                   FTKLLNLLKHEQVTYLIDANPSILTPSFYEHLRQYDAQFMIRIDHSTSIEAIEAIMAQG
FT                   LKCCLNASIISRELLTSLHQQLNDFTLLSFCHNYYPRPDTGLSVDLVNKKNELIYQFNP
FT                   KAQIYGFIVGSDLRGPLHKGLPTIEATRHSHPVVAAKLLQETGVSEVLVGDSLIEMRQA
FT                   KQLIDFCKHRHFTLCIEEVFDTTVTYLFDMCHKVRPDNPENVIRSETSRQICPHSIQPQ
FT                   FTTQRRIGSVTVDNLNNGRYQGEMQIVRQTLSAHDNVNVVAQIIKEDLPLLSCIEPNDT
FT                   FDFQKTRECKK"
FT   misc_feature    194532..195569
FT                   /note="Pfam match to entry PF05913 DUF871, Bacterial
FT                   protein of unknown function (DUF871), score 647.6, E-value
FT                   6.8e-192"
FT   CDS_pept        195584..196483
FT                   /transl_table=11
FT                   /locus_tag="SAS0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0192"
FT                   /db_xref="GOA:Q6GCT5"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCT5"
FT                   /protein_id="CAG41934.1"
FT                   /translation="MMENSTTEARNEATMHLDEMTVEEALITMNKEDQQVPLAVRKAIP
FT                   QLTKVIKKTIAQYKKGGRLIYIGAGTSGRLGVLDAAECVPTFNTDPHEIIGIIAGGQHA
FT                   MTMAVEGAEDHKKLAEEDLKNIDLTSKDVVIGIAASGKTPYVIGGLTFANTIGATTVSI
FT                   SCNEHAVISEIAQYPVEVKVGPEVLTGSTRLKSGTAQKLILNMISTITMVGVGKVYDNL
FT                   MIDVKATNQKLIDRSVRIIQEICAITYDEAMALYQVSEHDVKVATVMGMCGISKEEATR
FT                   RLLNNGDIVKRAIRDRQP"
FT   misc_feature    195989..196012
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    196133..196186
FT                   /note="PS01272 Glucokinase regulatory protein family
FT                   signature."
FT   CDS_pept        196495..197949
FT                   /transl_table=11
FT                   /locus_tag="SAS0167"
FT                   /product="sucrose-specific PTS tranporter protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0193"
FT                   /db_xref="GOA:Q6GCT4"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCT4"
FT                   /protein_id="CAG41935.1"
FT                   /translation="MTKEQQLAERIIAAVGGMDNIDSVMNCMTRVRIKVLDENKVDDQE
FT                   LRHIDGVMGVIHDERIQVVVGPGTVNKVANHMAELSGVKLGDPIPHHHNDSEKMDYKSY
FT                   AADKAKANKEAHKAKQKNGKLNKVLKSIANIFIPLIPAFIGAGLIGGIAAVLSNLMVAG
FT                   YISGAWITQLITVFNVIKDGMLAYLAIFTGINAAKEFGATPGLGGVIGGTTLLTGIAGK
FT                   NILMNVFTGEPLQPGQGGIIGVIFAVWILSIVEKRLHKIVPNAIDIIVTPTIALLIVGL
FT                   LTIFIFMPLAGFVSDSLVSVVNGIISIGGVFSGFIIGASFLPLVMLGLHHIFTPIHIEM
FT                   INQSGATYLLPIAAMAGAGQVGAALALWVRCKRNTTLRNTLKGALPVGFLGIGEPLIYG
FT                   VTLPLGRPFLTACIGGGIGGAVIGGIGHIGAKAIGPSGVSLLPLISDNMYLGYIAGLLA
FT                   AYAGGFVCTYLFGTTKAMRQTDLLGD"
FT   misc_feature    196516..196620
FT                   /note="Pfam match to entry PF00367 PTS_EIIB,
FT                   phosphotransferase system, EIIB, score 59.6, E-value
FT                   7.2e-15"
FT   misc_feature    196552..196605
FT                   /note="PS01035 PTS EIIB domains cysteine phosphorylation
FT                   site signature."
FT   misc_feature    order(196888..196956,196999..197067,197104..197172,
FT                   197200..197259,197296..197364,197407..197475,
FT                   197533..197601,197644..197697,197716..197784,
FT                   197842..197910)
FT                   /note="10 probable transmembrane helices predicted for
FT                   SAS0167 by TMHMM2.0 at aa 132-154, 169-191, 204-226,
FT                   236-255, 268-290, 305-327, 347-369, 384-401, 408-430 and
FT                   450-472"
FT   misc_feature    196891..197739
FT                   /note="Pfam match to entry PF02378 PTS_EIIC,
FT                   Phosphotransferase system, EIIC, score 134.0, E-value
FT                   2.8e-37"
FT   CDS_pept        197949..198827
FT                   /transl_table=11
FT                   /locus_tag="SAS0168"
FT                   /product="RpiR family transcriptional regulator"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0194"
FT                   /protein_id="CAG41936.1"
FT                   /translation="MMTNILYRIDKQLSDFTKTEKIIADYILKNPHKIIDMTVNDLADV
FT                   TNVSTASIVRFSRKMTHQGFQELKIAISRYLPEDIATNPHLELIENESVETLKNKMIAR
FT                   ATNTMRFVATNIMDAQIDAICDVLKNARTIFLFGFGASSLTIGDLFQKLSRIGLNVRLL
FT                   HETHLLVSTFATHDDRDCMIFVTNQGSHSELQSIAQVATHYSIPIITISSTANNPVAQI
FT                   ADYALIYGRTDENEMRMAATTSLFAQLFTVDILYYRFVALNYHAILDCITQSKMALDNY
FT                   RKHLATIDFKH"
FT   misc_feature    197955..198275
FT                   /note="Pfam match to entry PF01418 HTH_6, Helix-turn-helix
FT                   domain, rpiR family, score 100.8, E-value 2.7e-27"
FT   misc_feature    198321..198731
FT                   /note="Pfam match to entry PF01380 SIS, SIS domain, score
FT                   19.5, E-value 0.0016"
FT   CDS_pept        complement(199021..199302)
FT                   /transl_table=11
FT                   /locus_tag="SAS0169"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0195"
FT                   /protein_id="CAG41937.1"
FT                   /translation="MVLITYQIILFFIISLSYYLTLNHYMAVTVGNFTSIFGMFAAILF
FT                   MYYYLLYKSPEYNQRKRFKHFIHITNLIIIAFSTFVLVHLALKLFFSI"
FT   misc_feature    complement(order(199042..199110,199147..199215,
FT                   199243..199299))
FT                   /note="3 probable transmembrane helices predicted for
FT                   SAS0169 by TMHMM2.0 at aa 2-20, 30-52 and 65-87"
FT   CDS_pept        199515..202304
FT                   /transl_table=11
FT                   /locus_tag="SAS0170"
FT                   /product="putative type I restriction enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0196"
FT                   /db_xref="GOA:Q6GCT1"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCT1"
FT                   /protein_id="CAG41938.1"
FT                   /translation="MAYQSEYALENEMMNQLEQLGYERVTIRDNKQLLDNFRTILNERH
FT                   ADKLEGNPLTDKEFQRLLTMIDGKSIFESARILRDKLPLRRDDESEVYLSFLDTKSWCK
FT                   NKFQVTNQVSVEDTYKARYDVTILINGLPLVQVELKRRGIDINEAFNQVKRYRKQNYTG
FT                   LFRYIQMFIISNGVETRYFSNNDSELLKSHMFYWSDKQNNRINTLQSFAESFMRPCQLA
FT                   KMISRYMIINETDRILMAMRPYQVYAVEALIQQATETGNNGYVWHTTGSGKTLTSFKAS
FT                   QILSQQDDIKKVIFLVDRKDLDSQTEEEFNKFAKGAVDKTFNTSQLVRQLNDKSLPLIV
FT                   TTIQKMAKAIQGNAHLLEQYKTNKVVFIIDECHRSQFGDMHRLVKQHFKNAQYFGFTGT
FT                   PRFPENSSQDGRTTADIFGRCLHTYLIRDAIHDGNVLGFSVDYINTFKNKALKAEDNSM
FT                   VEAIDTEEVWLADKRVELVTRHIINNHDKYTRNRQYSSIFTVQSIHALIKYYETFKRLN
FT                   KKLEQPLTIAGIFTFKPNEDDRDGEVPYHSREKLEIMISDYNKKFETNFSTDTTNEYFN
FT                   HISKNVKKGVKDSKIDILIVVNMFLTGFDSKVLNTLYVDKNLMYHDLIQAYSRTNRVEK
FT                   ESKPFGKIVNYRDLKKETDDALRVFSQTNDTDTILMRSYEEYKKEFMDAYRELKMIVPT
FT                   PHMVDDIQDEEELKRFVEAYRLLAKIILRLKAFDEFEFTIDEIGMDEQENEDYKSKYLA
FT                   VYDQVKRATAEKNKVSILNDIDFEIEMMRNDTINVNYIMNILRQIDLEDKAEQRRNQEQ
FT                   IRRILDHADDPTLRLKRDLIREFIDNVVPSLNKDDDIDQEYVNFESIKKEAEFKGFAGE
FT                   RSIDEQALKTISNDYQYSGVVNPHHLKKMIGDLPLKEKRKARKAIESFVAETTEKYGV"
FT   misc_feature    199521..200084
FT                   /note="Pfam match to entry PF04313 HSDR_N, Type I
FT                   restriction enzyme R protein N terminus (HSDR_N), score
FT                   168.9, E-value 9e-48"
FT   CDS_pept        complement(202451..203050)
FT                   /transl_table=11
FT                   /locus_tag="SAS0171"
FT                   /product="putative membrane protein"
FT                   /note="Weakly similar to Cortinarius talus ATPase subunit 6
FT                   ATP6 SWALL:Q8M3Z0 (EMBL:AF388804) (214 aa) fasta scores:
FT                   E(): 0.31, 25.61% id in 203 aa, and to Bacillus cereus ABC
FT                   transporter permease protein bc4219 SWALL:Q818N0
FT                   (EMBL:AE017011) (210 aa) fasta scores: E(): 7.8, 20.31% id
FT                   in 192 aa"
FT                   /protein_id="CAG41939.1"
FT                   /translation="MSLSKLPLLNHFANIRIQPKLIIKLFLTLIIIVTYTFVSGLSVDY
FT                   KKLLSEAGLSETSLAQIKIFSQISIFFSRVFSVLFTFLIILVISRIMRSDANTKSIFSA
FT                   TLSYILFTNAISLIILTIQISAGLSLIDYSITSLNIFAKGNRILGTFDLQFFVQAYILT
FT                   VMLIGTSKLSIRASTIWGIIYLILIITFSLISISIQ"
FT   misc_feature    complement(order(202457..202525,202544..202612,
FT                   202670..202738,202775..202843,202922..202990))
FT                   /note="5 probable transmembrane helices predicted for
FT                   SAS0171 by TMHMM2.0 at aa 21-43, 70-92, 105-127, 147-169
FT                   and 176-198"
FT   CDS_pept        203176..203931
FT                   /transl_table=11
FT                   /locus_tag="SAS0172"
FT                   /product="putative membrane protein"
FT                   /note="Weakly similar to Oceanobacillus iheyensis
FT                   hypothetical conserved protein ob2941 SWALL:Q8EMB6
FT                   (EMBL:AP004603) (287 aa) fasta scores: E(): 0.5, 22.37% id
FT                   in 286 aa, and to the C-terminal region of Enterococcus
FT                   faecalis hypothetical protein ef0417 SWALL:Q838M6
FT                   (EMBL:AE016948) (392 aa) fasta scores: E(): 0.0033, 24.56%
FT                   id in 232 aa"
FT                   /protein_id="CAG41940.1"
FT                   /translation="MRRKRKWLIVICVLLVLITISQILKHFNYGTESKEAYNTYTVEKE
FT                   RQLDLQGKAYPREVKTYYKNNQVGTYLGVQVADGQTVKKGDKVNLSITSTGKTGAGIIK
FT                   QISELPISYEENLSLHENDALHLPESNNDGELANSKSISASPIFKSNNNSELSKYGVII
FT                   DDLSLPIRAGYSLEIKVPLNAIKIPKSVLTKGNNVFIVNKNSIVEKRNIRIKRINGDII
FT                   VEKGLKPGDKLIKQPKSTMNDGDKVEISS"
FT   misc_feature    203176..203277
FT                   /note="Signal peptide predicted for SAS0172 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.343 between residues 34 and 35"
FT   misc_feature    203194..203247
FT                   /note="1 probable transmembrane helix predicted for SAS0172
FT                   by TMHMM2.0 at aa 7-24"
FT   CDS_pept        203928..204608
FT                   /transl_table=11
FT                   /locus_tag="SAS0173"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Similar to Enterococcus faecalis ABC transporter,
FT                   ATP-binding protein ef2986 SWALL:Q82ZR2 (EMBL:AE016956)
FT                   (224 aa) fasta scores: E(): 7.8e-39, 54.66% id in 225 aa,
FT                   and to Bacillus halodurans ABC transporter bh3673
FT                   SWALL:Q9K6Q5 (EMBL:AP001519) (227 aa) fasta scores: E():
FT                   6e-38, 49.32% id in 223 aa"
FT                   /protein_id="CAG41941.1"
FT                   /translation="MIELKNVYRTFKNGDKNIRVLKDINIHINAGEFIAIMGPSGSGKS
FT                   TLINILGFIDREYHGEYLFEGSNYQTQSDNQLANIRNKTVGFVFQNFKLIHNNTILENI
FT                   SMPLVYTNMNTIERKNKVMTVLSAVGLDGKGDFTPSKLSGGQQQRVAIARAIINNPKFI
FT                   IADEPTGALDSDTSKIIMDIFTSLNRDNHTTIILVTHDRKVAEKADRIIHILGGRIQHE
FT                   EVIK"
FT   misc_feature    204018..204578
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 191.2, E-value 1.7e-54"
FT   misc_feature    204039..204062
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    204351..204395
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        204605..205783
FT                   /transl_table=11
FT                   /locus_tag="SAS0174"
FT                   /product="putative permease protein"
FT                   /note="Similar to Clostridium perfringens probable ABC
FT                   transporter cpe1540 SWALL:Q8XK63 (EMBL:AP003190) (394 aa)
FT                   fasta scores: E(): 1.1e-34, 34.42% id in 398 aa, and to the
FT                   C-terminal region of Escherichia coli macrolide-specific
FT                   ABC-type efflux carrier MacB or b0879 SWALL:MACB_ECOLI
FT                   (SWALL:P75831) (648 aa) fasta scores: E(): 4.8e-24, 26.88%
FT                   id in 398 aa"
FT                   /protein_id="CAG41942.1"
FT                   /translation="MRKVLNIFTIAFKSILKNKGRNIFTMIGIIIGISSVITIMSLGNG
FT                   FKKTAADQFSDAGAGKQEALISFTFKVDEKIKKYPFNQRDIELVNQVDGVLDAKLKENK
FT                   EEGIEATITNVQKKSDIFIIKKQNLHSFKVGRGFDKEDNELRKKIVVINDQVAKTVFNN
FT                   NAIGKSLYIEGQGFEVIGITDKLYSDSSTVIMPENTFNYYMGHLHQGLPTLQIIIEDGY
FT                   NKKTVVKKVESLLNKKGSGSVLGEYTYTDTEEIIKSIDKIFDSITYFVAAVAGISLFIA
FT                   GIGVMNVMYISVAERTEEIAIRRAFGAKSRDIELQFLIESILICVTSGFIGLILGVVFA
FT                   TIIDVLTPDYIKSVVSLSSVIIAVSVSILIGLLFGWIPARAASKKELIDIIK"
FT   misc_feature    204605..204745
FT                   /note="Signal peptide predicted for SAS0174 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.986) with cleavage site
FT                   probability 0.627 between residues 47 and 48"
FT   misc_feature    order(204662..204730,205400..205468,205553..205621,
FT                   205664..205732)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SAS0174 by TMHMM2.0 at aa 20-42, 266-288, 317-339 and
FT                   354-376"
FT   misc_feature    205391..205765
FT                   /note="Pfam match to entry PF02687 FtsX, Predicted
FT                   permease, score 143.8, E-value 3.3e-40"
FT   CDS_pept        205990..206211
FT                   /transl_table=11
FT                   /locus_tag="SAS0175"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAG41943.1"
FT                   /translation="MLKLHKKIAWTGIKGSAITTFITALYNGSSVWNALAVAGIAFGGG
FT                   AGTAVAALGRATVMRFIKRWGVRKTAAW"
FT   misc_feature    205990..206142
FT                   /note="Signal peptide predicted for SAS0175 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.809) with cleavage site
FT                   probability 0.503 between residues 51 and 52"
FT   misc_feature    206080..206148
FT                   /note="1 probable transmembrane helix predicted for SAS0175
FT                   by TMHMM2.0 at aa 31-53"
FT   CDS_pept        206249..207967
FT                   /transl_table=11
FT                   /locus_tag="SAS0176"
FT                   /product="putative membrane protein"
FT                   /note="Weakly similar to Clostridium beijerinckii CirB
FT                   protein SWALL:CAD97581 (EMBL:AJ566621) (581 aa) fasta
FT                   scores: E(): 1.2e-10, 24.04% id in 599 aa, and Clostridium
FT                   perfringens hypothetical protein cpe0306 SWALL:Q8XNM7
FT                   (EMBL:AP003186) (532 aa) fasta scores: E(): 0.013, 20.43%
FT                   id in 558 aa"
FT                   /protein_id="CAG41944.1"
FT                   /translation="MGKPLFKKGDSMNNSIFYTYLKFNLRYFIRRKFEIVKRSRLNVTT
FT                   KILFLIKLIFSSLLLFISTIMLADYFSDYIDFIEYYFYASMFIYIVFIPLIPRTKLLIN
FT                   PMDKQLLYRSSLREVDIFNLIYASDVLKKFVGYFNLLIVGMAISLYHISPFIFNLKVFC
FT                   ALIYFSTISYVIQIIFINIKVISTKKLFSYHYCVFNFMMGSIVSVIGFVVSFLLVNLLI
FT                   KPFLVFSTYVIKSKKTFEWYSYFQDIKNEVIIINEKVMQLLDYISPHTIFMRLNFVNIS
FT                   FVIITIALFIALYYFNKIGFWYRKEDIYLSSTNINFSLPISIKAITTIQLKHWISNKEE
FT                   VNLHKPFFYISYSIWFFLGCLIYFSQMAYNQLANAVIFILILNTITRDSFSAGTDFFTK
FT                   SLRFDSDRKSIGLYRMSNTDFKQIYDSKLSLIRFIGFKETILAIILLAIFLNQDIYLYI
FT                   IGFEIIIINTVIIPNLSLLPSYLSPHFNHQHYSELESFEEQIFLEDTVFDKVKNFLSSS
FT                   YFLILFVGYLSQRNYIDIMIFIIIFNILALILVSLFIRFSKQKITKSWRKRDLYL"
FT   misc_feature    order(206390..206449,206477..206536,206651..206719,
FT                   206729..206797,206834..206902,207071..207139,
FT                   207173..207241,207284..207343,207362..207421,
FT                   207530..207598,207611..207679,207842..207910)
FT                   /note="12 probable transmembrane helices predicted for
FT                   SAS0176 by TMHMM2.0 at aa 48-67, 77-96, 135-157, 161-183,
FT                   196-218, 275-297, 309-331, 346-365, 372-391, 428-450,
FT                   455-477 and 532-554"
FT   CDS_pept        208026..208469
FT                   /transl_table=11
FT                   /locus_tag="SAS0177"
FT                   /product="putative membrane protein"
FT                   /note="Similar to the C-terminal regions of Bacillus
FT                   thuringiensis integral membrane protein pbt138 SWALL:Q8KIV7
FT                   (EMBL:AL731825) (177 aa) fasta scores: E(): 1.7e-06, 26.56%
FT                   id in 128 aa, and to Methanococcus jannaschii hypothetical
FT                   protein mj0793 SWALL:Y793_METJA (SWALL:Q58203) (178 aa)
FT                   fasta scores: E(): 1.2e-05, 30.65% id in 137 aa"
FT                   /protein_id="CAG41945.1"
FT                   /translation="MGCLVYYLLNIDLGKMIVAQDLNLQEIFFHNLIYFFSAIFGFLTL
FT                   GLLNIGMLLINSGMLGFFIAHGIYSNQLKSILLVLAPHAIFEILALLIASTFSLGFLSY
FT                   LYQRMVKKNKIKNKMFHNFVTTIITVIVLTIIASLLEVYVTIN"
FT   misc_feature    order(208122..208190,208275..208343,208380..208448)
FT                   /note="3 probable transmembrane helices predicted for
FT                   SAS0177 by TMHMM2.0 at aa 33-55, 84-106 and 119-141"
FT   CDS_pept        208481..209203
FT                   /transl_table=11
FT                   /locus_tag="SAS0178"
FT                   /product="ATP-binding transport protein"
FT                   /note="Weakly similar to Bacillus subtilis ATP-binding
FT                   transport protein nata nata or bsu02750 SWALL:NATA_BACSU
FT                   (SWALL:P46903) (246 aa) fasta scores: E(): 1e-12, 29.43% id
FT                   in 214 aa, and to Clostridium tetani ABC transporter
FT                   ATP-binding protein ctp37 SWALL:Q899X7 (EMBL:AF528097) (213
FT                   aa) fasta scores: E(): 8.8e-16, 35.92% id in 206 aa"
FT                   /protein_id="CAG41946.1"
FT                   /translation="MLVLNNLQKKFTNSKMVLNNVNAKFRSGSINCIVGVNGAGKTTLL
FT                   NIISSILMPTKGDVYLNSESIFENSTLKKEIFYTPVNPFFYENLSAKDNLYLICSLYNR
FT                   KIDQITIEKTIKDVGLNIEDLNIPVYNFSSGMKQKLNFASMLLVDSNVLLLDEPFNALD
FT                   HVAQKNFTRILKGLVSKEKIIIFTSHLPNTILELSENIYLLKDGCFTDKRKAQSFNQTT
FT                   LETWLLESQKEVIPYEEK"
FT   misc_feature    208562..209101
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 150.8, E-value 2.5e-42"
FT   misc_feature    208583..208606
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    208874..208918
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        209190..209366
FT                   /transl_table=11
FT                   /locus_tag="SAS0179"
FT                   /product="putative membrane protein"
FT                   /note="Poor database matches. Similar to internal region of
FT                   Salmonella typhimurium melibiose carrier protein stm4299
FT                   SWALL:MELB_SALTY (SWALL:P30878) (476 aa) fasta scores: E():
FT                   8.7, 40.35% id in 57 aa"
FT                   /protein_id="CAG41947.1"
FT                   /translation="MKKNDLLVMSVVYILTSVIMFYINGLSKQFFTYVVGFPIIYFGYI
FT                   CLVNLIKKRSRNN"
FT   misc_feature    order(209208..209261,209274..209342)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SAS0179 by TMHMM2.0 at aa 7-24 and 29-51"
FT   CDS_pept        complement(209413..209601)
FT                   /transl_table=11
FT                   /locus_tag="SAS0180"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /protein_id="CAG41948.1"
FT                   /translation="MSTFRLSFNKLFYCGFSPNISSKFLFNTEQIFLHSDREGLCTPFS
FT                   IRDIVCLVTPTLFASSF"
FT   CDS_pept        complement(210076..211668)
FT                   /transl_table=11
FT                   /locus_tag="SAS0181"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0198"
FT                   /protein_id="CAG41949.1"
FT                   /translation="MSNLLEVNSLNVQFNYDETTVQAVKNVSFELRKKHILGIVGESGS
FT                   GKSITAKSILGLLPDYPDHTLTGEIIFNGQSLNNLSTSALQQIRGKDISMIFQDPLSSL
FT                   NPRLTIGKQITEVLFQHKRVSKSEAKSMTIDILEKVGIKHATRQFDAYPHELSGGMRQR
FT                   VMIAMALILKPQILIADEPTTALDASTQNQLLQLMKSLYEYTETSIIFITHDLGAVYQF
FT                   CDDVIVMKDGSVVESGTVESIFKSPQHTYTKRLIDAIPDIHQTRPPRPLNNDILLKFDR
FT                   VSVDYTSPSGSLYRAVNDINLGIRKGETLGIVGESGSGKSTLAKTVVGLKEVSEGFIWY
FT                   NELPLSLFKDDELKSLRQEIQMIFQDPFASINPRFKVIDVIKRPLIIHGKVKDNDDIIK
FT                   TVVSLLEKVGLDQSFLYRYPHELSGGQRQRVSIARALAVEPKVIVCDEAVSALDVSIQK
FT                   DIIELLKQLQLDFGITYLFITHDMGVINEICDRVAVMKNGEIVELNNTEDIIKHPQSDY
FT                   AKQLISEVAVIAK"
FT   misc_feature    complement(210175..210750)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 220.6, E-value 2.4e-63"
FT   misc_feature    complement(210361..210405)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(210706..210729)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(210973..211569)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 211.0, E-value 1.9e-60"
FT   misc_feature    complement(211159..211203)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(211525..211548)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        211796..213103
FT                   /transl_table=11
FT                   /locus_tag="SAS0182"
FT                   /product="putative transport system permease"
FT                   /note="Possible alternative translational start sites.
FT                   C-terminal region is similar to Bacillus subtilis dipeptide
FT                   transport system permease protein DppB or BSU12930
FT                   SWALL:DPPB_BACSU (SWALL:P26903) (308 aa) fasta scores: E():
FT                   8.3e-32, 32.24% id in 307 aa, and to Fusobacterium
FT                   nucleatum subsp. vincentii ATCC 49256 dipeptide transport
FT                   system permease protein FNV2131 SWALL:Q7P899
FT                   (EMBL:AABF01000003) (308 aa) fasta scores: E(): 2.2e-45,
FT                   42.67% id in 307 aa"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0199"
FT                   /protein_id="CAG41950.1"
FT                   /translation="MYHKAFYKFVLSVLSLPIFLYAVIKFFFSAKRKNFYANNSEISEI
FT                   ERALHQKYKYLSQQKSSTQIHKEALKIFKAQSSNTSSKNIEQAHFSTYFENLLFHKFIM
FT                   IKVILALPMFILLTIYLQPLVRYIFERIVMAVIVIIGVIVSVFTILYFSPLDAAYSILG
FT                   QNATKAQIHQFNVLHHLNEPYFIQLWDTIKGVFTFDLGTTYKGNEVVTKAVGERIPITI
FT                   IVAVLALIVALIIAIPIGIISAMKRNSWLDITLMIIALIGLSIPSFWQGLLFILAFSLK
FT                   LDILPPSYMPEHPISLILPVLVIGTSIAASITRMTRSSVLEVMRSDYVLTAYAKGLSTT
FT                   QVVIKHILKNAIIPIVTLVGLLVAELLGGSAVTEQVFNINGIGRYIVQKQLIPDIPAVM
FT                   GGVVYISIVISLANLIIDIFYALIDPKLRSEINERK"
FT   misc_feature    order(211814..211882,212102..212170,212198..212251,
FT                   212456..212524,212561..212629,212672..212740,
FT                   212846..212914,212996..213064)
FT                   /note="8 probable transmembrane helices predicted for
FT                   SAS0182 by TMHMM2.0 at aa 7-29, 103-125, 132-154, 221-243,
FT                   256-278, 293-315, 351-373 and 401-423"
FT   misc_feature    212447..213082
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport system inner membrane
FT                   component, score 178.5, E-value 1.1e-50"
FT   CDS_pept        213109..214272
FT                   /transl_table=11
FT                   /locus_tag="SAS0183"
FT                   /product="putative transport system permease"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0200"
FT                   /protein_id="CAG41951.1"
FT                   /translation="MVKLTTKIASLKLFASYAIATYILVILTSALNLFKGYVADTFYIA
FT                   ETLLIVLTIILIIILTTEQTWKHHDLWRRIVEVLLLLMTLTGNVFTLLMFVSIRRYQRT
FT                   SQIHSYNGWESFIRKTTRHRIAIIGLLILVYMLTLSIVSQFTFDTTLATKNQFNALLHG
FT                   PSLAYPFGTDDFGRDLFTRVVVGTKLTFSISIISVVIAVIFGVLLGTIAGYFNHIDNLI
FT                   MRILDVVFAIPSLLLAVAIIASFGASIPNLIIALSIGNIPSFARTMRASVLEIKRMEYV
FT                   DAARITGENTWNIIWRYILPNAIAPMIVRFSLNIGVVVLTTSSLSFLGLGVAPDVAEWG
FT                   NILRTGSNYLETHSNLAIVPGVCIMFVVLAFNFIGDAVRDALDPRIH"
FT   misc_feature    order(213151..213210,213229..213288,213331..213399,
FT                   213481..213549,213685..213753,213790..213849,
FT                   213859..213927,214039..214107,214165..214233)
FT                   /note="9 probable transmembrane helices predicted for
FT                   SAS0183 by TMHMM2.0 at aa 15-34, 41-60, 75-97, 125-147,
FT                   193-215, 228-247, 251-273, 311-333 and 353-375"
FT   misc_feature    213667..214269
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport system inner membrane
FT                   component, score 150.7, E-value 2.7e-42"
FT   CDS_pept        214289..216064
FT                   /transl_table=11
FT                   /locus_tag="SAS0184"
FT                   /product="RGD-containing lipoprotein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0201"
FT                   /protein_id="CAG41952.1"
FT                   /translation="MKKIISIAIIVLALVLSGCGVPTKSEVAQKSSKVEVKGERPTIHF
FT                   LGQASYENDMNIVKDQLENAGFNVKMNIQPDYGSYRTQRQAGNYDIQIDDWMTVFGDPN
FT                   YAMTALFSSTGSNSLLKDKHVDQLLNKASTQNEADVKQTYKQIEDEVVFDKGYMAPLYG
FT                   SKKNLVYDNKVLDKNSVGLPNSRALIWQQFDYNNSRERDTRPLVMTQQDGEIPTLDPIR
FT                   SIAPSVYSINMNMYTRLLLLDENDHLTTKGSLSHDYAVNKDNKAFYFLLRDDDYFAKVV
FT                   NGQARNTGERVSAEDVKFSLDRARDKKSVPNNNTYNMHKHINDIKILKDEDIDQLRKEK
FT                   DKDDKSIYDKLIKAYNVKSLTTDGQKVNNKDGIYQIVKITTDQSMPREVNYLTHSSAGI
FT                   LSKKFVNQVNQEYPKGYGDSSTIPANSDGKNALYASGAYIMTQKNAYQATFQRNPGFNE
FT                   TEKGSYGPAKIKNITLKFNGDPNNALSELRNHSIDMLADVNQKHFDLIKSDKNLSIIRK
FT                   NGRKSVFLMLNIKKGIFKTHPNLRQAVVNAIDQDQFIKFYRGDKFKIASPITPLVDTGN
FT                   EQRQDLEKVEKAINQ"
FT   misc_feature    214289..214369
FT                   /note="Signal peptide predicted for SAS0184 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.666 between residues 27 and 28"
FT   misc_feature    214313..214345
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        216102..218108
FT                   /transl_table=11
FT                   /locus_tag="SAS0185"
FT                   /product="putative gamma-glutamyltranspeptidase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0202"
FT                   /protein_id="CAG41953.1"
FT                   /translation="MVINLNDKQTKTSKEGLISVSHPLAAKIGKDVLDQGGNAMDAVIA
FT                   IQLALNVVEPFASGIGGGGYLLYYEQSTGSITAFDARETAPAHVDKQFYLDDSGEYKSF
FT                   FDMTTHGKTVAVPAIPKLFDYIHKRYAKLSLEDLINPAIELAIEGHAANWATEKYSRQQ
FT                   HARLTKYYETAQVFTHENQYWREGDWIVQPELGKTFQILREQGFNAFYKGDIAKQLVNV
FT                   VKACGGTITLEDLAKYDIQIKAPISATFKDYDIYSMGPSSSGGITVIQILKLLEHVDLP
FT                   SMGPRSVDYLHHLIQAMHLAYSDRAQYLADDNFHEVPVQSLIDDNYLKARSTLIDSNKA
FT                   NIDIEHGVVSDCISHTDVEENHTETTHFCVIDKEGNIASFTTSIGMIYGSGITIPGYGV
FT                   LLNTTMDGFDVVDGGINEIAPYKRPLSNMAPTIVMYHGKPILTVGAPGAISIIASVAQT
FT                   LINVLVFGMDIQQAIDEPRVYSSHPNRIEWEPQFSQSTILALIARGHAMEHKPDAYIGD
FT                   VHGLHVDLNTRDASGGADDTREGTVMGGEVLSIRKQPLLSPEIYDNDTHRVYFNDVQLP
FT                   LLADQVRWMHDKYWVDESVVRIIFSEVSAHIEDLRSYENAGENYIDIAWLARKKGYQVA
FT                   LKDDGLYLTDDTYTSVKRNTNAYYRYDRDSITR"
FT   misc_feature    216189..217721
FT                   /note="Pfam match to entry PF01019 G_glu_transpept,
FT                   Gamma-glutamyltranspeptidase, score 754.6, E-value
FT                   4.3e-224"
FT   CDS_pept        complement(218421..219194)
FT                   /transl_table=11
FT                   /locus_tag="SAS0186"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="GOA:Q6GCR5"
FT                   /db_xref="InterPro:IPR007595"
FT                   /db_xref="InterPro:IPR038641"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCR5"
FT                   /protein_id="CAG41954.1"
FT                   /translation="MKAHKIFWLNLAAIIIISIVVSGGMFLAMKWEQIHLKDGLKKVLS
FT                   TYPIKNLETLYEIDGHDNPHYENNDQDTWYIESSYSVVGSDELLKEDRMLLKVDKNTHK
FT                   ITGEYDTTTNDRKNATDSTYKSYPVKVVNNKIVFTKDVKDPALKQKIENNQFLIQSGDL
FT                   TSILNSNDLKVTHDPTTDYYNLSGKLSNDNPNVKQLKRRYNIPRNASTKVELKGMSDLK
FT                   GNNHQDQKLYFYFSSPGKDQIIYKESLTYNKLSEH"
FT   misc_feature    complement(218430..219194)
FT                   /note="Pfam match to entry PF04507 DUF576, Protein of
FT                   unknown function, DUF576, score 483.8, E-value 1.4e-142"
FT   misc_feature    complement(219108..219176)
FT                   /note="1 probable transmembrane helix predicted for SAS0186
FT                   by TMHMM2.0 at aa 7-29"
FT   CDS_pept        complement(219384..220010)
FT                   /transl_table=11
FT                   /locus_tag="SAS0187"
FT                   /product="putative phosphodiesterase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0203"
FT                   /db_xref="GOA:Q6GCR4"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCR4"
FT                   /protein_id="CAG41955.1"
FT                   /translation="MAKVLYITAHPFNELVSNSMAAGKAFIETYQQQHPDDEVKHIDLF
FT                   ETYIPVIDKDVLTGWGKMSNGETLTDDEQMKVSRLSDILEEFLSADKYVFVTPMWNLSF
FT                   PPVVKAYIDAISIAGKTFKYSAEGPQGLLTDKKVLHIQSRGGYYTEGPAADFEMGDRYL
FT                   RTIMTFLGVPSYETIIIEGHNAEPHKTEEIKATSINNAEKLATIF"
FT   misc_feature    complement(219393..220007)
FT                   /note="Pfam match to entry PF02525 Flavodoxin_2,
FT                   Flavodoxin-like fold, score 176.7, E-value 3.9e-50"
FT   misc_feature    complement(219648..219671)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        220219..220797
FT                   /transl_table=11
FT                   /locus_tag="SAS0188"
FT                   /product="putative peptidase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0204"
FT                   /protein_id="CAG41956.1"
FT                   /translation="MTKRPKRILATIIIFLSLLFTIIYIDDIQKWFNQYTDKLTQNHKG
FT                   QGHSKWEDFFRGSRITETFGKYQHSPFDGKHYGIDFALPKGTPIKAPTNGKVTRIFNNE
FT                   LGGKVLQIAEDNGEYHQWYLHLDKYNVKVGDRVKAGDIIAYSGNTGKQTTGAHLHFQRM
FT                   KGGVGNAYAEDPKPFIDQLPDGERSLYDL"
FT   misc_feature    220219..220290
FT                   /note="Signal peptide predicted for SAS0188 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.938) with cleavage site
FT                   probability 0.645 between residues 24 and 25"
FT   misc_feature    220237..220293
FT                   /note="1 probable transmembrane helix predicted for SAS0188
FT                   by TMHMM2.0 at aa 7-25"
FT   misc_feature    220486..220752
FT                   /note="Pfam match to entry PF01551 Peptidase_M37, Peptidase
FT                   family M23/M37, score 96.1, E-value 7.4e-26"
FT   CDS_pept        221180..222277
FT                   /transl_table=11
FT                   /locus_tag="SAS0189"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0205"
FT                   /protein_id="CAG41957.1"
FT                   /translation="MAELKLEHIKKTYDNNNTVVKDFNLHITDKEFIVFVGPSGCGKST
FT                   TLRMVAGLESITSGDFYIDGERMNDVEPKNRDIAMVFQNYALYPHMTVFENMAFGLKLR
FT                   KVNKKEIEQKVNEAAEILGLTEYLGRKPKALSGGQRQRVALGRAIVRDAKVFLMDEPLS
FT                   NLDAKLRVQMRTEILKLHKRLNTTTIYVTHDQTEALTMASRIVVLKDGDIMQVGTPREI
FT                   YDAPNCIFVAQFIGSPAMNMLNATVEMDGLKVGTHHFKLHNKKFEKLKAAGYLDKEIIL
FT                   GIRAEDIHEEPIFIQTSPETQFESEVVVSELLGSEIMVHSTFQGMELISKLDSRTQVMA
FT                   NDKITLAFDMNKCHFFDEKTGNRIV"
FT   misc_feature    221267..221812
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 222.2, E-value 8.1e-64"
FT   misc_feature    221288..221311
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    221582..221626
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    222068..222244
FT                   /note="Pfam match to entry PF03459 TOBE, TOBE domain, score
FT                   44.1, E-value 3.2e-10"
FT   CDS_pept        222290..223561
FT                   /transl_table=11
FT                   /locus_tag="SAS0190"
FT                   /product="putative extracellular sugar-binding lipoprotein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0206"
FT                   /protein_id="CAG41958.1"
FT                   /translation="MSKILKCITLAVVMLLIVTACGPNRSKEDIDKALNKDNSKDKPNQ
FT                   LTMWVDGDKQMAFYKKITDQYTKKTGIKVKLVNIGQNDQLENISLDAPAGKGPDIFFLA
FT                   HDNTGSAYLQGLAAEIKLSKDELKGFNKQALKAMNYDNKQLALPAIVETTALFYNKKLV
FT                   KNAPQTLEEVEANAAKLTDSKKKQYGMLFDAKNFYFNYPFLFGNDDYIFKKNGSEYDIH
FT                   QLGLNSKHVVKNAERLQKWYDKGYLPKAATHDVMIGLFKEGKVGQFVTGPWNINEYQET
FT                   FGKDLGVTTLPTDGGKPMKPFLGVRGWYLSEYSKHKYWAKDLMLYITSKDTLQKYTDEM
FT                   SEITGRVDVKSSNPNLKVFEKQARHAEPMPNIPEMRQVWEPMGNASIFISNGKNPKQAL
FT                   DEATNDITQNIKILHPSQNDKKGD"
FT   misc_feature    222290..222373
FT                   /note="Signal peptide predicted for SAS0190 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.954 between residues 28 and 29"
FT   misc_feature    222308..223291
FT                   /note="Pfam match to entry PF01547 SBP_bac_1, Bacterial
FT                   extracellular solute-binding protein, score 83.9, E-value
FT                   3.5e-22"
FT   misc_feature    222320..222352
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        223564..224832
FT                   /transl_table=11
FT                   /locus_tag="SAS0191"
FT                   /product="putative sugar transport system permease"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0207"
FT                   /protein_id="CAG41959.1"
FT                   /translation="MTKRNPKLAALLSVIPGLGQFYNKRPIKGTIFFIFFISFISVFYS
FT                   FLNIGFWGLFTLGTVPKLDDSRVLLAQGIISILLVAFAIMLYIINILDAYRNAERFNRN
FT                   EEIKDPKARMVATWDKTFPYLLISPGTFLLIFVVVFPLIFMFGVAFTNYNLYNAPPRHT
FT                   LEWVGLDNFKTLFTIGVWRKTFFSVITWTLVWTLVATTLQIALGLFLAIIVNHPVVKGK
FT                   KFIRTVLILPWAVPSFVTILIFVALFNDEFGAINNDILQPLLGVAPAWLSDPFWAKVAL
FT                   IGIQVWLGFPFVFALFTGVLQSISSDWYEAADMDGASSWQKFRNITFPHVIYATAPLLI
FT                   MQYAGNFNNFNLIYLFNKGGPPVSGQNAGSTDILISWVYNLTFEFNNFNMGAVVSLIIG
FT                   FIVAIVAFIQFRRTSTFKDEGGL"
FT   misc_feature    223564..223713
FT                   /note="Pfam match to entry PF05154 TM2, TM2 domain, score
FT                   64.1, E-value 3.1e-16"
FT   misc_feature    order(223654..223722,223765..223833,223927..223995,
FT                   224137..224205,224242..224310,224398..224466,
FT                   224539..224598,224725..224793)
FT                   /note="8 probable transmembrane helices predicted for
FT                   SAS0191 by TMHMM2.0 at aa 31-53, 68-90, 122-144, 192-214,
FT                   227-249, 279-301, 326-345 and 388-410"
FT   misc_feature    224116..224808
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport system inner membrane
FT                   component, score 73.8, E-value 3.7e-19"
FT   misc_feature    224464..224550
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        224834..225673
FT                   /transl_table=11
FT                   /locus_tag="SAS0192"
FT                   /product="putative sugar transport system permease"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0208"
FT                   /protein_id="CAG41960.1"
FT                   /translation="MTKKKNILKAIGIYSFIAMMFVIILYPLLWTFGISLNPGTNLYGA
FT                   KMIPDNATFKNYAFLLFDDSSQYLTWYKNTLIVASANALFSVIFVTLTAYAFSRYRFVG
FT                   RKYGLITFLILQMFPVLMAMVAIYILLNTIGLLDSLFGLTLVYIGGSIPMNAFLVKGYF
FT                   DTIPKELDESAKIDGAGHMRIFLQIMLPLAKPILAVVALFNFMGPFMDFILPKILLRSP
FT                   EKFTLAVGLFNFINDKYANNFTVFAAGAIMIAVPIAIVFLFLQRYLVSGLTTGATKG"
FT   misc_feature    224834..224965
FT                   /note="Signal peptide predicted for SAS0192 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.806) with cleavage site
FT                   probability 0.559 between residues 44 and 45"
FT   misc_feature    order(224867..224935,225056..225124,225158..225226,
FT                   225254..225322,225383..225451,225557..225625)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SAS0192 by TMHMM2.0 at aa 12-34, 75-97, 109-131, 141-163,
FT                   184-206 and 242-264"
FT   misc_feature    225035..225655
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport system inner membrane
FT                   component, score 72.0, E-value 1.3e-18"
FT   misc_feature    225320..225406
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        225744..226823
FT                   /transl_table=11
FT                   /locus_tag="SAS0193"
FT                   /product="putative oxidoreductase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0209"
FT                   /protein_id="CAG41961.1"
FT                   /translation="MMTIKVGIIGCGGIANGKHMPSLQKVENVEMIAFCDVDISKAASA
FT                   AEAYGTDNAKVYDDYKALLKDDTIDVIHVCTPNDSHCEITVAGLHAGKHVMCEKPMAKT
FT                   TAEAQKMIDTAKSTGKKLTIGYQNRFRADSQFLHQAAQRGDLGDIYFGKAHAIRRRAVP
FT                   TWGVFLDEEAQGGGPLIDIGTHALDLTLWMMDNYEPESVMGSTFHKLNKQHHAANAWGS
FT                   WNPDEFTVEDSAFGFIKMKNGATIMLESAWAINSLEVDEAKCSLSGTKAGADMKDGLRI
FT                   HGEDMGTLYTKHVELENKGVDFYEGNEVDEAEEEAKAWIDAVVNDTEPVVKPEQAMVVT
FT                   KILEAIYQSAKSGKAIYFE"
FT   misc_feature    225753..226121
FT                   /note="Pfam match to entry PF01408 GFO_IDH_MocA,
FT                   Oxidoreductase family, NAD-binding Rossmann fold, score
FT                   150.9, E-value 2.3e-42"
FT   misc_feature    226152..226490
FT                   /note="Pfam match to entry PF02894 GFO_IDH_MocA_C,
FT                   Oxidoreductase family, C-terminal alpha/beta domain, score
FT                   9.9, E-value 0.035"
FT   CDS_pept        226848..227888
FT                   /transl_table=11
FT                   /locus_tag="SAS0194"
FT                   /product="putative oxidoreductase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0210"
FT                   /protein_id="CAG41962.1"
FT                   /translation="MTKLKVGVIGVGGIAQDRHIPALLKLKDTVSLVAVQDINTVQMID
FT                   VAKRFNIPHAVETPSELFKLVDAVVICTPNKFHADLSIEALNHGVHVLCEKPMAMTTEE
FT                   CDRMIEAANKNHKLLTVAYHYRHTDVAITAKKAIESGVVGKPLVARVQAMRRRKVPGWG
FT                   VFTNKALQGGGSLIDYGCHLLDLSLWLLGKDMVPHEVLGKTYNQLSKQPNQINDWGTFD
FT                   HTKFDVDDHVTSYMTFANRASMQFECSWSANIKEDKVHVSLSGEDGGINLFPFEIYEPR
FT                   FGTIFESKANVEHNEDIAGERQARNFVNACLGIEEIVVKPEEARNVNALIEAIYRSDLD
FT                   NKSIQL"
FT   misc_feature    226857..227216
FT                   /note="Pfam match to entry PF01408 GFO_IDH_MocA,
FT                   Oxidoreductase family, NAD-binding Rossmann fold, score
FT                   144.0, E-value 2.7e-40"
FT   misc_feature    227250..227630
FT                   /note="Pfam match to entry PF02894 GFO_IDH_MocA_C,
FT                   Oxidoreductase family, C-terminal alpha/beta domain, score
FT                   30.0, E-value 5.6e-06"
FT   CDS_pept        227943..228911
FT                   /transl_table=11
FT                   /locus_tag="SAS0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0211"
FT                   /protein_id="CAG41963.1"
FT                   /translation="MKIGVFSVLFYDKNFEDMLDYVSESGLDMIEVGTGGNPGDKFCKL
FT                   DELLENEDKRQAFMKSITDRGLQISGFSCHNNPISPDPIEAKEADETLRKTIRLANLLD
FT                   VPVVNTFSGIAGSDDTAKKPNWPVTPWPTAYSEIYDYQWNEKLIPYWQDLAEFAKEQDV
FT                   KIAIELHAGFLVHTPYTMLKLREATNEYIGANLDPSHLWWQGIDPIAAIRILGQANAIH
FT                   HFHAKDTYINQENVNMYGLTDMQPYGNVATRAWTFRTVGYGHSPYVWADIISQLIINGY
FT                   DYVLSIEHEDPIMSVEEGFQKACQTLKSVNIYDKPADMWWA"
FT   CDS_pept        complement(229272..229766)
FT                   /transl_table=11
FT                   /locus_tag="SAS0196"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0212"
FT                   /protein_id="CAG41964.1"
FT                   /translation="MILSILLIFFCIRLVSLKISINHSKQLKADGAVEYGVKNSKFLAI
FT                   THVLIYVLAGVEAFINKDTFSFANGIGLVILIFAYIMLFMVIKTLGGIWTLKLFILPNH
FT                   PIIKSGLYKITKHPNYFLNIIPELIGVLLLTHATYTTILLVPYAYFLYVRIKQEEKLMN
FT                   I"
FT   misc_feature    complement(229275..229550)
FT                   /note="Pfam match to entry PF04140 ICMT, Isoprenylcysteine
FT                   carboxyl methyltransferase (ICMT) family, score 167.5,
FT                   E-value 2.4e-47"
FT   misc_feature    complement(order(229308..229376,229506..229574,
FT                   229587..229640))
FT                   /note="3 probable transmembrane helices predicted for
FT                   SAS0196 by TMHMM2.0 at aa 43-60, 65-87 and 131-153"
FT   CDS_pept        229999..231378
FT                   /transl_table=11
FT                   /locus_tag="SAS0197"
FT                   /product="putative sugar phosphate transport protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0213"
FT                   /protein_id="CAG41965.1"
FT                   /translation="MNFFDIHKIPNKGIPLSVQRKLWLRNFMQAFFVVFFVYMAMYLIR
FT                   NNFKAAQPFLKEEIGLSTLELGYIGLAFSITYGLGKTLLGYFVDGRNTKRIISFLLILS
FT                   AITVLIMGFVLSYFGSVMGLLIVLWGLNGVFQSVGGPASYSTISRWAPRTKRGRYLGFW
FT                   NTSHNIGGAIAGGVALWGANVFFHGNVIGMFIFPSVIALLIGIATLFIGKDDPEELGWN
FT                   RAEEIWEEPVDKENIDSQGMTKWEIFKKYILGNPVIWILCVSNVFVYIVRIGIDNWAPL
FT                   YVSEHLHFSKGDAVNTIFYFEIGALVASLLWGYVSDLLKGRRAIVAIGCMFMITFVVLF
FT                   YTNATSVMMVNISLFALGALIFGPQLLIGVSLTGFVPKNAISVANGMTGSFAYLFGDSM
FT                   AKVGLAAIADPTRNGLNIFGYTLSGWTDVFIVFYVALFLGMILLGIVAFYEEKKIRSLK
FT                   I"
FT   misc_feature    order(230062..230130,230188..230256,230293..230361,
FT                   230371..230439,230476..230538,230566..230634,
FT                   230752..230820,230878..230946,230971..231030,
FT                   231058..231126,231163..231222,231280..231348)
FT                   /note="12 probable transmembrane helices predicted for
FT                   SAS0197 by TMHMM2.0 at aa 22-44, 64-86, 99-121, 125-147,
FT                   160-180, 190-212, 252-274, 294-316, 325-344, 354-376,
FT                   389-408 and 428-450"
FT   misc_feature    230461..230511
FT                   /note="PS00942 glpT family of transporters signature."
FT   CDS_pept        complement(231737..232495)
FT                   /transl_table=11
FT                   /locus_tag="SAS0198"
FT                   /product="putative response regulator"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0214"
FT                   /db_xref="GOA:Q6GCQ3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCQ3"
FT                   /protein_id="CAG41966.1"
FT                   /translation="MFKVVICDDERIIREGLKQIIPWGDYHFNTIYTAKDGVEALSLIQ
FT                   QHQPELVITDIRMPRKNGVDLLNDIAHLDCNVIILSSYDDFEYMKAGIQHHVLDYLLKP
FT                   VDHAQLEVILGRLVRTLLEQQSQNGRSLASCHDAFQPLLKVEYDDYYVNQIVDQIKQSY
FT                   QTKVTVSDLIQHIDVSESYAMRTFKDHVGITIVDYLNRYRILQSLQLLDRHYKHYEIAD
FT                   KVGFSEYKMFSYHFKKYLQMSPSDYCKQAK"
FT   misc_feature    complement(231749..231880)
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   20.3, E-value 0.0049"
FT   misc_feature    complement(231896..232036)
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   29.8, E-value 6.7e-06"
FT   misc_feature    complement(232130..232492)
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 80.1, E-value 4.8e-21"
FT   CDS_pept        complement(232488..234044)
FT                   /transl_table=11
FT                   /locus_tag="SAS0199"
FT                   /product="putative sensor kinase protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0215"
FT                   /db_xref="GOA:Q6GCQ2"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCQ2"
FT                   /protein_id="CAG41967.1"
FT                   /translation="MTAYKPYRHQLRRSLFASTIFPVFLVIIIGLVSFYAIYIWIEHRT
FT                   IHQHVDESQSSLHHTEKQIQTFITQHNNSFQELDLTNHHDVTATKRGLLKLIHQQPATL
FT                   YYELSGPNQFITNNYEHLNTKNMYLFSTHQLKFKNSTYMLKIYMANTPRLSEIKKDSRQ
FT                   FALIVDQYDNILYANDDRFTIGEKYRPQQFGFMNESVKLNHADHRLIIYKDIHENIEDG
FT                   ITLLIVMAVVLVLLVIFGFISADNMAKRQTKDIETIIQKIYYAKNRHLGTYTPLKNNSE
FT                   LEEINNYIYDLFESNEQLIHSIEHTERRLRDIQLKEIERQFQPHFLFNTMQTIQYLITL
FT                   SPKLAQTVVQQLSQMLRYSLRTNSHTVELNEELNYIEQYVAIQNIRFDDMIKLHIESSE
FT                   EARHQTIGKMMLQPLIENAIKHGRDTESLDITIRLTLARQNLHVLVCDNGIGMSSSRLQ
FT                   YVRQSLNNDVFDTKHLGLNHLHNKAMIQYGSHARLHIFSKRNQGTLICYKIPLSRGNVD
FT                   V"
FT   misc_feature    complement(232509..232841)
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase, score 11.2,
FT                   E-value 0.0056"
FT   misc_feature    complement(order(233313..233381,233934..234002))
FT                   /note="2 probable transmembrane helices predicted for
FT                   SAS0199 by TMHMM2.0 at aa 15-37 and 222-244"
FT   misc_feature    complement(233940..234044)
FT                   /note="Signal peptide predicted for SAS0199 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.978) with cleavage site
FT                   probability 0.496 between residues 35 and 36"
FT   CDS_pept        complement(234041..235009)
FT                   /transl_table=11
FT                   /locus_tag="SAS0200"
FT                   /product="putative lipoprotein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0216"
FT                   /protein_id="CAG41968.1"
FT                   /translation="MKSKIYILLLFLIFLSACANTRHSESDKNVLTVYSPYQSNLIRPI
FT                   LNEFEKQEHVKIEIKHGSTQVLLSNLHNEDFSERGDVFMGGVLSETIDHPEDFVPYQDT
FT                   SVTQQLEDYRSNNKYVTSFLLMPTVIVVNSDLQGDIKIRGYQDLLQPILKGKIAYSNPN
FT                   TTTTGYQHMRAIYSMHHRVSDVHQFQNHAMQLSKTSKVIEDVAKGKYYAGLSYEQDART
FT                   WKNKGYPVSIVYPIEGTMLNVDGIALVKNAHPHPKRKKLVQYLTSRSVQQRLVAEFDAK
FT                   SIRKDVSEQSDQSIENLKNIPLIPKSKLPDIPHHKFLEMIQ"
FT   misc_feature    complement(234938..235009)
FT                   /note="Signal peptide predicted for SAS0200 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.739 between residues 24 and 25"
FT   misc_feature    complement(234956..234988)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        235597..237846
FT                   /transl_table=11
FT                   /locus_tag="SAS0201"
FT                   /product="formate acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0217"
FT                   /db_xref="GOA:Q6GCQ0"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCQ0"
FT                   /protein_id="CAG41969.1"
FT                   /translation="MLETNKNHATAWQGFKNGRWNRHVDVREFIQLNYTLYEGNDSFLA
FT                   GPTEATSKLWEQVMQLSKEERERGGMWDMDTKVASTITSHDAGYLDKDLETIVGVQTEK
FT                   PFKRSMQPFGGIRMAKAACEAYGYELDEETEKIFTDYRKTHNQGVFDAYSREMLNCRKA
FT                   GVITGLPDAYGRGRIIGDYRRVALYGVDFLMEEKMHDFNTMSTEMSEDVIRLREELSEQ
FT                   YRALKELKELGQKYGFDLSRPAENFKEAVQWLYLAYLAAIKEQNGAAMSLGRTSTFLDI
FT                   YAERDLKAGVITESEVQEIIDHFIMKLRIVKFARTPDYNELFSGDPTWVTESIGGVGID
FT                   GRPLVTKNSFRFLHSLDNLGPAPEPNLTVLWSVRLPDNFKTYCAKMSIKTSSIQYENDD
FT                   IMRESYGDDYGIACCVSAMTIGKQMQFFGARANLAKTLLYAINGGKDEKSGAQVGPNFE
FT                   GINSEVLEYDEVFKKFDQMMDWLAGVYINSLNVIHYMHDKYSYERIEMALHDTEIVRTM
FT                   ATGIAGLSVAADSLSAIKYAQVKPIRNEEGLVVDFEIEGDFPKYGNNDDRVDDIAVDLV
FT                   ERFMTKLRSHKTYRDSEHTMSVLTITSNVVYGKKTGNTPDGRKAGEPFAPGANPMHGRD
FT                   QKGALSSLSSVAKIPYDCCKDGISNTFSIVPKSLGKEPEDQNRNLTSMLDGYAMQCGHH
FT                   LNINVFNRETLIDAMEHPEEYPQLTIRVSGYAVNFIKLTREQQLDVISRTFHESM"
FT   misc_feature    235627..237420
FT                   /note="Pfam match to entry PF02901 PFL, Pyruvate formate
FT                   lyase, score 1146.0, E-value 0"
FT   misc_feature    237466..237789
FT                   /note="Pfam match to entry PF01228 Gly_radical, Glycine
FT                   radical, score 169.5, E-value 6e-48"
FT   misc_feature    237751..237777
FT                   /note="PS00850 Glycine radical signature."
FT   CDS_pept        237869..238624
FT                   /transl_table=11
FT                   /locus_tag="SAS0202"
FT                   /product="putative pyruvate formate-lyase activating
FT                   enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0218"
FT                   /db_xref="GOA:Q6GCP9"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR034465"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCP9"
FT                   /protein_id="CAG41970.1"
FT                   /translation="MLKGHLHSVESLGTVDGPGLRYILFTQGCLLRCLYCHNPDTWKIS
FT                   EPSREVTVDEMVNEILPYKPYFDASGGGVTVSGGEPLLQMPFLEKLFAELKENGVHTCL
FT                   DTSAGCANDTKAFQRHFEELQKHTDLILLDIKHIDNDKHIRLTGKPNTHILNFARKLSD
FT                   MKQPVWIRHVLVPGYSDDKDDLIKLGEFINSLDNVEKFEILPYHQLGVHKWKTLGIAYE
FT                   LEDVEAPDDEAVKAAYRYVNFKGKIPVEL"
FT   misc_feature    237917..237982
FT                   /note="PS01087 Radical activating enzymes signature."
FT   misc_feature    237935..238435
FT                   /note="Pfam match to entry PF04055 Radical_SAM, Radical SAM
FT                   superfamily, score 99.4, E-value 7.5e-27"
FT   misc_feature    237965..237982
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   CDS_pept        238614..238922
FT                   /transl_table=11
FT                   /locus_tag="SAS0203"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAG41971.1"
FT                   /translation="MNYKYNSDRKESICNFKSEGAYASFSIEYRVLARRSKYMRQLLQW
FT                   LKEDVFVSSYADKECDVLLKVGFQYHHLADVEWVIICYLHMNMSLFKFLLTLSNEKY"
FT   CDS_pept        238960..240723
FT                   /transl_table=11
FT                   /locus_tag="SAS0204"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0220"
FT                   /protein_id="CAG41972.1"
FT                   /translation="MKRISKDIWAVFKLLYQNKGRFSINALLLQLIMIFISSTYLILLF
FT                   NMMLKVAGQSQLTINNWTEIVSHPASVILLIIFILSVAFLIYVEFSLLVYMVYAGFDRQ
FT                   IITFKSIFKNAFVNVRKLIGVPVIFFVIYLMLMIPIANLGLSSVLTKNIYIPKFLTEEL
FT                   MKTTKGIIIYGTFMIAVFILNFKLIFTLPLTILNRQSLFKNMRLSWQITKRNKFRLVIE
FT                   IVILELIIGAILTLIISGATYLAICVDEEGDKFLVSSILFVVLKSALFFYYLFTKLSLI
FT                   SVLVLHLKQENVLDQPGLEFKYPKPKRKSRFFIISMVLAVTCFIGYNMYLLYNNTINTN
FT                   ISIIGHRGFEDKGVENSIPSLKAAAKANVEYVELDTIMTKDKQFVVSHDNNLKRLTGVN
FT                   KNISESNFKDVVGLKMRQNGHEAKLVSLDEFIETAKQSNVKLLVELKPHGKEPADYTQR
FT                   VIDILKKHGVEHQYRVMSLDYDVMTKLKKEAPYLKCGYIIPLQFGHFKETSLDFFVIED
FT                   FSYSPRLVNQAHLENKEVYTWTINGEEDLTKYLQTNVDGIITDDPALADQIKEEKKDET
FT                   YFDRSIRILFE"
FT   misc_feature    order(239020..239088,239167..239262,239323..239391,
FT                   239479..239547,239626..239694,239722..239781,
FT                   239893..239961)
FT                   /note="7 probable transmembrane helices predicted for
FT                   SAS0204 by TMHMM2.0 at aa 21-43, 70-101, 122-144, 174-196,
FT                   223-245, 255-274 and 312-334"
FT   misc_feature    239995..240657
FT                   /note="Pfam match to entry PF03009 GDPD, Glycerophosphoryl
FT                   diester phosphodiesterase family, score 93.8, E-value
FT                   3.7e-25"
FT   CDS_pept        complement(240887..241231)
FT                   /transl_table=11
FT                   /locus_tag="SAS0205"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0221"
FT                   /protein_id="CAG41973.1"
FT                   /translation="MTTQMKIKTYLVAGIKAALLDTTGIKLASKSETTSHTYQHQALVD
FT                   QLHELIANTDLNKLSYLNLDAFQKRDILAAHYIAKSAIRTKNLDQMTKAKHRLESIYDS
FT                   ISNPLHSQNN"
FT   CDS_pept        241421..243322
FT                   /transl_table=11
FT                   /locus_tag="SAS0206"
FT                   /product="staphylocoagulase precursor"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0222"
FT                   /protein_id="CAG41974.1"
FT                   /translation="MKKQIISLGALAVASSLFTWDNKADAIVTKDYSGKSQVNAGSKNG
FT                   KQIADGYYWGIIENLENQFYNIFHLLDQHKYAEKEYKDAVDKLKTRVLEEDQYLLERKK
FT                   EKYEIYKELYKKYKKENPNTQVKMKAFDKYDLGDLTMEEYNDLSKLLTKALDNFKLEVK
FT                   KIESENPDLKPYSESEERTAYGKIDSLVDQAYSVYFAYVTDAQHKTEALNLRAKIDLIL
FT                   GDEKDPIRVTNQRTEKEMIKDLESIIDDFFIETKLNRPKHITRYDGTKHDYHKHKDGFD
FT                   ALVKETREAVAKADESWKNKTVKKYEETVTKSPVVKEEKKVEEPQSPKFDNQQEVKITV
FT                   DKAEETTQPVAQPLVKIPQGTITGEIVKGPEYPTMENKTLQGEIVQGPDFPTMEQNRPS
FT                   LSDNYTQPTTPNPILEGLEGSSSKLEIKPQGTESTLKGTQGESSDIEVKPQASETTEAS
FT                   HYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTNQDGTV
FT                   TYGARPTQNKPSKTNAYNVTTHANRQVSYGARPTQNKPSKTNAYNVTTHANGQVSYGAR
FT                   PTQNKPSKTNAYNVTTHANGQVSYGARPTYKKPSKTNAYNVTTHADGTATYGPRVTK"
FT   misc_feature    241421..241498
FT                   /note="Signal peptide predicted for SAS0206 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.978 between residues 26 and 27"
FT   misc_feature    242900..242980
FT                   /note="PS00429 Staphylocoagulase repeat signature."
FT   misc_feature    242903..242983
FT                   /note="Pfam match to entry PF04022 Staphylcoagulse,
FT                   Staphylocoagulase repeat, score 57.3, E-value 3.4e-14"
FT   misc_feature    242984..243064
FT                   /note="Pfam match to entry PF04022 Staphylcoagulse,
FT                   Staphylocoagulase repeat, score 54.4, E-value 2.6e-13"
FT   misc_feature    243062..243142
FT                   /note="PS00429 Staphylocoagulase repeat signature."
FT   misc_feature    243065..243145
FT                   /note="Pfam match to entry PF04022 Staphylcoagulse,
FT                   Staphylocoagulase repeat, score 59.3, E-value 8.8e-15"
FT   misc_feature    243143..243223
FT                   /note="PS00429 Staphylocoagulase repeat signature."
FT   misc_feature    243146..243226
FT                   /note="Pfam match to entry PF04022 Staphylcoagulse,
FT                   Staphylocoagulase repeat, score 59.3, E-value 8.8e-15"
FT   misc_feature    243224..243304
FT                   /note="PS00429 Staphylocoagulase repeat signature."
FT   misc_feature    243227..243307
FT                   /note="Pfam match to entry PF04022 Staphylcoagulse,
FT                   Staphylocoagulase repeat, score 55.2, E-value 1.5e-13"
FT   CDS_pept        complement(243925..245109)
FT                   /transl_table=11
FT                   /locus_tag="SAS0207"
FT                   /product="putative thiolase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0223"
FT                   /protein_id="CAG41975.1"
FT                   /translation="MQEAYIVAYGRSAAAKAKQGALFHERPDDVAAKVLQGVLKRIDGK
FT                   FNKNMIEDVIVGTAFPEGLQGQNIARTIALLTGLSDTVPGQTVNRYCSSGLQTIAIAAN
FT                   QIMAGQGDILVAGGVELMSAVPMGGNEPTNNPTLQYDDIGASYPMGLTAENVASQFDVS
FT                   REDQDAYAVRSHQRAYEAQRDGRFNDEIIPIQVNSVEYTNAGPKVHTNIFDQDEFIRPD
FT                   TTMEALAKLRTVFKADGTVTAGTSAPLSDGAGFVVLMSGDKVKELGVTPIARFVGYKAV
FT                   GVDPKIMGIGPAYAIPEVLSLSNLSVEDIDLIELNEAFASQTIASIKEVGLDISRTNVN
FT                   GGAIALGHPLGATGAMLTARLLNEMGRRPDSRYGMVTMCIGVGMGAAAIFEYVR"
FT   misc_feature    complement(243931..243999)
FT                   /note="1 probable transmembrane helix predicted for SAS0207
FT                   by TMHMM2.0 at aa 371-393"
FT   misc_feature    complement(243934..244311)
FT                   /note="Pfam match to entry PF02803 thiolase_C, Thiolase,
FT                   C-terminal domain, score 223.3, E-value 3.8e-64"
FT   misc_feature    complement(243949..243990)
FT                   /note="PS00099 Thiolases active site."
FT   misc_feature    complement(244048..244098)
FT                   /note="PS00737 Thiolases signature 2."
FT   misc_feature    complement(244324..245109)
FT                   /note="Pfam match to entry PF00108 thiolase, Thiolase,
FT                   N-terminal domain, score 325.0, E-value 9.3e-95"
FT   misc_feature    complement(244792..244848)
FT                   /note="PS00098 Thiolases acyl-enzyme intermediate
FT                   signature."
FT   CDS_pept        complement(245139..247400)
FT                   /transl_table=11
FT                   /locus_tag="SAS0208"
FT                   /product="putative fatty oxidation complex protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0224"
FT                   /protein_id="CAG41976.1"
FT                   /translation="MTINKVTVLGAGTMGAQLAALFVNAGLKVKLLDIVVDKNDPNLIA
FT                   KKSYDKITDKKRPLLFDLNLASHLTYGNFDDDLVNDDADLYIEAVKEDIEIKHAVWQQV
FT                   LQHAKEDALFATNTSGIPINAIAQTFNEKDQERFFGLHFFNPPRIMKLVELIPTSHTKE
FT                   SIILDVKNFAQNVLGKGVIVVNDVPGFVANRVGTQTMNDIMYRAEQHKLSIVDVDALTG
FT                   QAIGRPKTGTYALSDLVGLDIAVSVIKGMQQVPEETPYFHDVKIVNTLFDNGALGRKTK
FT                   QGFYKKDKETKARLVYDVEKQDYVPVSQPQLPILNEFNKDLVHNLDVIFNAQDEAGLFL
FT                   WETLRNNFYYSAINVPKATDDFRDIDRALVWGFNWKLGPFQLWDAMGYERVKTRMEDEI
FT                   GDLPQWISDLDGGFYKQDETIEYATPVSHFVKDELWDKGDAKLSVTHDDQLLLKLQSKN
FT                   NVITDEFNDALVDAIDLLENDHYTSMVIYADGNNFSVGANLFLMKKAHEDGLVDDVVAQ
FT                   SIDKLHYSFNRLKYSLKPVVTAVQGRALGGGCELVLYSPIVVAASETYIGLVEAGVGLL
FT                   PSGGGLAEMADRILRTSHKFDDKQASMTKVLTNIAFAKVSTNAFEARRYGYLRDTDTII
FT                   FNTAQRVEVALKRAKYEAETNYIPNPRHQYIALGEDFKALIQGQLDAQRRGHFISDHDY
FT                   HIALNIATILAGGDLPRNTFINQRYIQSLEKIGFIDLLKSKKSYERIAHMLKTGKPLRN
FT                   "
FT   misc_feature    complement(245502..246053)
FT                   /note="Pfam match to entry PF00378 ECH, Enoyl-CoA
FT                   hydratase/isomerase family, score 28.0, E-value 1.7e-10"
FT   misc_feature    complement(245730..245792)
FT                   /note="PS00166 Enoyl-CoA hydratase/isomerase signature."
FT   misc_feature    complement(246540..246836)
FT                   /note="Pfam match to entry PF00725 3HCDH, 3-hydroxyacyl-CoA
FT                   dehydrogenase, C-terminal domain, score 103.9, E-value
FT                   3.3e-28"
FT   misc_feature    complement(246840..247400)
FT                   /note="Pfam match to entry PF02737 3HCDH_N,
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD binding domain, score
FT                   114.7, E-value 1.8e-31"
FT   CDS_pept        complement(247587..248798)
FT                   /transl_table=11
FT                   /locus_tag="SAS0209"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0225"
FT                   /protein_id="CAG41977.1"
FT                   /translation="MTFEKETVLKTLFPEDVLSIAKGLTDGEVEFLQQVDSLLESKYRE
FT                   NINQHWIDATVPEDYFKDLGELNYFNNPLLYKDRPNAKMPSQLFQFFMSYLLARFDISL
FT                   ATLLGVHQGLGHNTFYFGGSKEQIAKYVPKLQSHELRTCFALTEPEHGSDVAGGLETVA
FT                   ERQGDTWVINGEKKWIGGAHVSDVIPVFAVNKETGKPHCFVVRPEQDGVDIEVIDNKIA
FT                   LRIVPNALIKLTNVKVDEADRLQNITSFKDIAKILYSTRAGVAYMATGGMAGALRATLD
FT                   YVTERKQFGKPISKYQLIQEKLAMMQGNLAQAMATCAQLANMQAHGEYDEVATSTAKMM
FT                   NALRLRETVAMGRGITGGNGILADDYDIARFFSDAEAIYTYEGTHEINALVIGRALTGD
FT                   SAFV"
FT   misc_feature    complement(247608..248051)
FT                   /note="Pfam match to entry PF00441 Acyl-CoA_dh, Acyl-CoA
FT                   dehydrogenase, C-terminal domain, score 117.0, E-value
FT                   3.8e-32"
FT   misc_feature    complement(248067..248366)
FT                   /note="Pfam match to entry PF02770 Acyl-CoA_dh_M, Acyl-CoA
FT                   dehydrogenase, middle domain, score 30.5, E-value 6.2e-09"
FT   misc_feature    complement(248370..248510)
FT                   /note="Pfam match to entry PF02771 Acyl-CoA_dh_N, Acyl-CoA
FT                   dehydrogenase, N-terminal domain, score 18.7, E-value
FT                   1.8e-05"
FT   CDS_pept        complement(248910..250415)
FT                   /transl_table=11
FT                   /locus_tag="SAS0210"
FT                   /product="putative acyl-CoA synthetase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0226"
FT                   /protein_id="CAG41978.1"
FT                   /translation="MNFDWIKTRSDFDDDKPAVIDHAKQTSWTYQQLNARADNMAHYLT
FT                   SQGVKKGDVIGIFAPNDIAILDLLFACFKTGAVFLPLNWRLNPKEIAAIVEDAQLKLLF
FT                   YAEKHLSSLTDIDQNLLHMDIDVAQYDEIVNPDYHQPFQATPVEPQDLAALIYTSGTTG
FT                   SPKGVMFSYESFVHNGANLELTYKFNSNYITIVSTPMFHVLGFNDTVLPVLMSGGTLIL
FT                   QRYFNGEELNDMIAQYHPTFIIMIPTMYYSTLRASNFNPENFKAMDYIIQGGSQPLPSI
FT                   QAAFKQYGINIINGYGLTEAPLVLVNTPENSKRKPMSIGKAVMFVDARILDDNGEEVPT
FT                   GEIGELAIKAKNVTPGYWNKPAETAKAFHGRYLLTGDLAKMDDDGDIFIIERKKELIIT
FT                   GGENVLPSEVENALAEHPLVDRCVVVGYDHPKYGESIAAAIILREDEPHYAEILDQHMR
FT                   SRLAGYKVPRMYVPVTHMPLNSTQKPDKLAIRQMMNDKVSQTL"
FT   misc_feature    complement(249144..250331)
FT                   /note="Pfam match to entry PF00501 AMP-binding, AMP-binding
FT                   enzyme, score 400.3, E-value 2e-117"
FT   misc_feature    complement(249918..249953)
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT   CDS_pept        complement(250441..252003)
FT                   /transl_table=11
FT                   /locus_tag="SAS0211"
FT                   /product="putative acetyl-CoA transferase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0227"
FT                   /protein_id="CAG41979.1"
FT                   /translation="MKQITWHDLQHIIKDGDVIGLPALAVANLPAEVLRAVLAQHDTYH
FT                   TPKDLTFILANDIHSLGAAPDLDDFIERRMIKRVIMSILTASSKTAQAMKNNDIEAYFL
FT                   PQGIIATHYRQSNQLLPGVITKIGLNTAVDPRYGGGKVNTRTTDDLVSLVTINDETYLH
FT                   YTFPSVDVALLRGTYADQQGNIYLTQEAYLSECYHVALNAKANHGKVIVQVKALVDGYQ
FT                   LKPNEVVIPGNLVDYVYVTEDEKNHRQVIQSHYLPALSGEERIDGIPEPALPFNSRKLI
FT                   LRRAAQFLTYGDTISIGYGINNELSNLLHEECVEHDVQPILDVGIFGGFVGSREHFGMN
FT                   YNADVRMPHDRAWDFIYNNGVSVAYLSFAEVDQYGNVNVSYFNDRLNGCGGFIDITQSV
FT                   NKIIFSGTFVAGSHVSCHNQRLNIETEGQNQKFVSDVSHIDFNAQYSQSLEQEVYFVTE
FT                   RAVFELTNQGLKLIEIAPGLDLHKDILNQMAFKPIIADHLKLIDTSIYKEKWGQLKQSI
FT                   HKV"
FT   misc_feature    complement(251281..251997)
FT                   /note="Pfam match to entry PF01144 CoA_trans, Coenzyme A
FT                   transferase, score 61.5, E-value 1.9e-15"
FT   CDS_pept        252459..253601
FT                   /transl_table=11
FT                   /locus_tag="SAS0212"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0229"
FT                   /protein_id="CAG41980.1"
FT                   /translation="MSSASTQSTKTSDIHNESINKQMEAKAHETAQNADLKTEARSLFD
FT                   NATKSIGRLAGNDESLNLNLKDMFSEVFKPHTKNEADEIFIAGTAKTTPAICDISEEWG
FT                   KPWLFSRVFIAFTVTFIGLWVMAAIFNNTNAIPGLIFIGALTVPLSGLFFFYESNAFKN
FT                   ISIFEVIIMFFIGGVFSLLSTMLLYRFVVFSDQFERFGSLTFFDAFLVGLVEETGKALI
FT                   IVYFVNKLKTNKILNGLLIGAAIGAGFAVFESAGYILNFALGENVPLLDIVFTRAWTAI
FT                   GGHLVWSAIVGAAIVIAKEQHGFEFKDIFDKRFLIFFLSAVGLHGIWDTSLTVLGSDTL
FT                   KIFILIVIVWILVFILMGAGLKQVNLLQKEFKEQQKKVDE"
FT   misc_feature    order(252777..252845,252858..252926,252963..253031,
FT                   253074..253142,253161..253229,253272..253340,
FT                   253398..253454,253482..253541)
FT                   /note="8 probable transmembrane helices predicted for
FT                   SAS0212 by TMHMM2.0 at aa 107-129, 134-156, 169-191,
FT                   206-228, 235-257, 272-294, 314-332 and 342-361"
FT   CDS_pept        complement(253915..255390)
FT                   /transl_table=11
FT                   /locus_tag="SAS0213"
FT                   /product="putative extracellular solute-binding
FT                   lipoprotein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0230"
FT                   /protein_id="CAG41981.1"
FT                   /translation="MKFKRLATIFSAVLVLSGCGSMHSSGKDLNISLPLKTKSIAPYET
FT                   DVPVKIGAAESLFKTNDQGKIEKALVKSYHQPNDTTLDIELKDNIKFQNGQKLTAEKVK
FT                   SSLENSMKKSDLVKYSLPISSITAKGQKLTIKTNSAYPELVSELANPFMAIYDTDAKSD
FT                   VNQTPVGTGPYQIKDYKQSRKISLSNFKDYWQGKPKLDHITVTYQEDGNNRVRNLESQK
FT                   DDLITDVPVNKVQDIENNQNLKVSKESGFRTSLLMYNHTNKKMTKSVREALDHIIDRQG
FT                   IADHIYQGYAKPATSPFNDKIPYIKEPKLTKQNIEQAKTLLAKDGYTKEHPLKIKLITY
FT                   DGRPELSKIAQVLQSDAKKANIEIDIKSVDDIEGYLKDRSAWDATMYSFGTIPRGDTGY
FT                   FFNQAYKKDGAINKGDYNNSNVDDLINQLNHTVDVKERHNISNDIIKLSSRDVPNSYIA
FT                   YNDQIVAANAKVKNYKVTPEGIYLIDYRTTIER"
FT   misc_feature    complement(253930..255369)
FT                   /note="Pfam match to entry PF00496 SBP_bac_5, Bacterial
FT                   extracellular solute-binding proteins, family 5, score
FT                   59.7, E-value 6.7e-15"
FT   misc_feature    complement(255313..255390)
FT                   /note="Signal peptide predicted for SAS0213 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.826 between residues 26 and 27"
FT   misc_feature    complement(255334..255366)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(255588..255944)
FT                   /transl_table=11
FT                   /locus_tag="SAS0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0231"
FT                   /protein_id="CAG41982.1"
FT                   /translation="MTVDIGRIYDNKDNTDAIRILVDRVWPRGISKRTANLDYWLKDIA
FT                   PSTELRQWFQHDPKLFGAFKEKYEKELRDQDAQKDAFEKLKDIVNQHNHVLLLYAAKDT
FT                   KHNQAVVLQQLLNT"
FT   misc_feature    complement(255594..255941)
FT                   /note="Pfam match to entry PF04343 DUF488, Protein of
FT                   unknown function, DUF488, score 155.7, E-value 8.6e-44"
FT   CDS_pept        complement(256101..256274)
FT                   /transl_table=11
FT                   /locus_tag="SAS0215"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0232"
FT                   /protein_id="CAG41983.1"
FT                   /translation="MKLNQRYVKVFALYFVSIVTANIIVKNNNLIKTLIQTIAGYTVFA
FT                   VGLKYLTKRKNK"
FT   misc_feature    complement(order(256122..256175,256203..256256))
FT                   /note="2 probable transmembrane helices predicted for
FT                   SAS0215 by TMHMM2.0 at aa 7-24 and 34-51"
FT   CDS_pept        complement(256300..257445)
FT                   /transl_table=11
FT                   /locus_tag="SAS0216"
FT                   /product="flavohemoprotein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0233"
FT                   /protein_id="CAG41984.1"
FT                   /translation="MLTEQEKDIIKQTVPLLKEKGTEITSIFYPKMFKAHPELLNMFNQ
FT                   TNQKRGMQSSALAQAVMAAAVNIDNLSVIKPVIMPVAYKHCALQVYAEHYPIVGENLLK
FT                   AIQDVTGLEENDPVIQAWAKAYGVIADVFIQIEKEIYDQMMWIGFKPFKITNIKQESED
FT                   IKSFTVETEEYDFSEFTPGQYITVDVSSEKLPYRAKRHYSIVSGEKNHLTFGVKRDVTT
FT                   EHEGEVSTILHDEIKEGDMINLAAPVGGFVLENTTEPQLFLGSGIGVTPLVAMYEAASA
FT                   KGLDTQMVQVAENEQHLPFKDNFNSIASHHDNAKLYTHLKDKQGYIGAEELQAFLANKP
FT                   EIYICGGTKFLQSMIEALKSLNYDMDRVHYETFIPRLSVAV"
FT   misc_feature    complement(256687..256995)
FT                   /note="Pfam match to entry PF00970 FAD_binding_6,
FT                   Oxidoreductase FAD-binding domain, score 34.6, E-value
FT                   7.6e-08"
FT   misc_feature    complement(257032..257445)
FT                   /note="Pfam match to entry PF00042 globin, Globin, score
FT                   56.1, E-value 8e-14"
FT   CDS_pept        258018..258971
FT                   /transl_table=11
FT                   /locus_tag="SAS0217"
FT                   /product="L-lactate dehydrogenase 1"
FT                   /EC_number="1.1.1.27"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0234"
FT                   /db_xref="GOA:Q6GCN4"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCN4"
FT                   /protein_id="CAG41985.1"
FT                   /translation="MNKFKGNKVVLIGNGAVGSSYAFSLVNQSIVDELVIIDLDTEKVR
FT                   GDVMDLKHATPYSPTTVRVKAGEYSDCHDADLVVICAGAAQKPGETRLDLVSKNLKIFK
FT                   SIVGEVMASKFDGIFLVATNPVDILAYATWKFSGLPKERVIGSGTILDSARFRLLLSEA
FT                   FDVAPRSVDAQIIGEHGDTELPVWSHANIAGQPLKTLLEQRPEGKAQIEQIFVQTRDAA
FT                   YDIIQAKGATYYGVAMGLARITEAIFRNEDAVLTVSALLEGEYDEEDVYIGVPAVINRN
FT                   GIRNVVEIPLNDEEQSKFAHSAKTLKDIMAEAEELK"
FT   misc_feature    258036..258458
FT                   /note="Pfam match to entry PF00056 ldh, lactate/malate
FT                   dehydrogenase, NAD binding domain, score 261.2, E-value
FT                   1.5e-75"
FT   misc_feature    258462..258968
FT                   /note="Pfam match to entry PF02866 ldh_C, lactate/malate
FT                   dehydrogenase, alpha/beta C-terminal domain, score 287.9,
FT                   E-value 1.3e-83"
FT   misc_feature    258543..258563
FT                   /note="PS00064 L-lactate dehydrogenase active site."
FT   CDS_pept        complement(259291..260820)
FT                   /transl_table=11
FT                   /locus_tag="SAS0218"
FT                   /product="putative PTS transport system, IIBC component"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0235"
FT                   /protein_id="CAG41986.1"
FT                   /translation="MKSLFEKAQQFGKSFMLPIAILPAAGLLLGIGGALSNPNTVKAYP
FT                   ILDITLLQNIFTLMSAAGSIVFQNLPVIFAIGVAIGLSRSDKGTAGLAALLGFLIMNAT
FT                   MNGLLTITGTLAKDQLAQNGQGMVLGIQTVETGVFGGIITGIMTAILHNKYHKVVLPPY
FT                   LGFFGGSRFVPIVTAFAAIFLGVLMFFIWPSIQAGIYHVGGFVTKTGAIGTFVYGFILR
FT                   LLGPLGLHHIFYLPFWQTALGGTLEVKGHLVQGTQNIFFAQLGDPDVTKYYSGVSRFMS
FT                   GRFITMMFGLCGAALAIYHTAKPEHKKVVGGLMLSAALTSFLTGITEPLEFSFLFVAPI
FT                   LYVIHAFFDGLAFMMADIFNITIGQTFSGGFIDFLLFGVLQGNSKTNYLYVIPIGIVWF
FT                   CLYYIVFRFLITKFNFKTPGREDKAAAQQVEATERAQTIVAGLGGKDNIEIVDCCATRL
FT                   RVTLHQNDKVDKVLLESTGAKGVIQQGTGVQVIYGPHVTVIKNEIEELLGD"
FT   misc_feature    complement(259414..259518)
FT                   /note="Pfam match to entry PF00367 PTS_EIIB,
FT                   phosphotransferase system, EIIB, score 54.4, E-value
FT                   2.5e-13"
FT   misc_feature    complement(259429..259482)
FT                   /note="PS01035 PTS EIIB domains cysteine phosphorylation
FT                   site signature."
FT   misc_feature    complement(order(259591..259659,259672..259740,
FT                   259759..259827,259840..259896,259915..259983,
FT                   260158..260226,260245..260313,260371..260439,
FT                   260476..260544,260581..260649,260710..260778))
FT                   /note="11 probable transmembrane helices predicted for
FT                   SAS0218 by TMHMM2.0 at aa 15-37, 58-80, 93-115, 128-150,
FT                   170-192, 199-221, 280-302, 309-327, 332-354, 361-383 and
FT                   388-410"
FT   misc_feature    complement(259771..260787)
FT                   /note="Pfam match to entry PF02378 PTS_EIIC,
FT                   Phosphotransferase system, EIIC, score 382.5, E-value
FT                   4.3e-112"
FT   misc_feature    complement(260692..260820)
FT                   /note="Signal peptide predicted for SAS0218 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.705 between residues 43 and 44"
FT   CDS_pept        261182..262117
FT                   /transl_table=11
FT                   /locus_tag="SAS0219"
FT                   /product="putative inosine-uridine preferring nucleoside
FT                   hydrolase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0236"
FT                   /protein_id="CAG41987.1"
FT                   /translation="MKRKIIMDCDPGHDDAIALILAGAIDSPLEILAVTTVAGNQSVDK
FT                   NTTNALNVLDIMGRQDIAVAKGADRPLIKPAAFASEIHGESGLDGPKLPSTPSRQAVAM
FT                   PASDVIINKVMTSDTPVTIVATGPLTNVATALIREPRIAEHIESITLMGGGTFGNWTPT
FT                   AEFNIWVDAEAAKRVFESGITINVFGLDVTHQVLADDHVIERFESINNPVAQFVVELLQ
FT                   FFKKTYKTHFNMDGGPIHDACTILYLLQPELFTMVPVNIDIEHQSPLTYGTMAVDLNHV
FT                   TGKPANAYFATAVDVEEVWNLIDHKLRTYE"
FT   misc_feature    261185..262114
FT                   /note="Pfam match to entry PF01156 IU_nuc_hydro,
FT                   Inosine-uridine preferring nucleoside hydrolase, score
FT                   375.7, E-value 4.9e-110"
FT   misc_feature    261203..261235
FT                   /note="PS01247 Inosine-uridine preferring nucleoside
FT                   hydrolase family signature."
FT   misc_feature    261311..261349
FT                   /note="PS00018 EF-hand calcium-binding domain."
FT   CDS_pept        262153..262323
FT                   /transl_table=11
FT                   /locus_tag="SAS0219a"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0237"
FT                   /note="No significant database hits"
FT                   /protein_id="CAG41988.1"
FT                   /translation="MPDISVLRVFVLDYNGHDNLIMIEICMLKMLQKTQNTKIYSKFQL
FT                   LYFKRLKSQKI"
FT   CDS_pept        262433..264550
FT                   /transl_table=11
FT                   /locus_tag="SAS0220"
FT                   /product="putative PTS multi-domain regulator"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0238"
FT                   /protein_id="CAG41989.1"
FT                   /translation="MLKGGSNMNGDNQQILREIVLNPTIHGKELESIFGLSRRQLGYRI
FT                   QKINLWLEQEGYPKLERTSQGNFIVSSEIMTLFKRDVSEQQMLNGNNVIFSIETRRYYL
FT                   MLMLFSKENAMSLNHFSIDLQVSKNTVIHDINHVKEQLENHGLSLKYSRKHGYEIVGDE
FT                   FEVRRFFIKLIDQRLNHDITKSEVLKALNLTFEDIAYQKDKIKQVEQFLKSRFIDKSLS
FT                   SLPYVLCVIRRRIQSGHVMNPLNINYQYLRDTKEYQATEIMTQLEPDLPEAEKLYLTLH
FT                   LLSTSVQWTDLQESDNISNLTMAIAQMIHHFEQITFINIEDKEKLSQQLLLHLTPAFYR
FT                   IKYNLTDRDELINPLQGNYQSLFHMVKQSCQSLTEYFGKSLPDNEIAYLTMLFGGSLRR
FT                   QDENFDGKIKAIIVCTQGTSVSQMMLYELRNLFPEIIFLDAISLRTFENYTLDYDIVFS
FT                   PMFVLTHKKLFITKVALSENEQRKLRKEVMKYINKESADIDKEINKLMALIERTTTVND
FT                   ITELRDGLEDFIANYNSISTINGSIVTQNKTLDLADLIPARHVKRIHHVENIDEAIAKA
FT                   SDVLVANHFIDIKYIHEMQQVFDDSYMVIMQNIAIPHAYSEKHVHKTAMSMLILQEPIY
FT                   MSDGTAIHIIVPIAAVDKVTHLRALLQLRDVAQDNDAIKRIIQSRKNSDVNEILKNYSN
FT                   KEARENGWDSN"
FT   misc_feature    262505..262570
FT                   /note="Predicted helix-turn-helix motif for SAS0220 with
FT                   score 1056.000, SD 2.78 at aa 25-46, sequence
FT                   IHGKELESIFGLSRRQLGYRIQ"
FT   misc_feature    263333..263620
FT                   /note="Pfam match to entry PF00874 PRD, PRD domain, score
FT                   97.5, E-value 2.7e-26"
FT   misc_feature    264092..264508
FT                   /note="Pfam match to entry PF00359 PTS_EIIA_2,
FT                   Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2, score 3.9, E-value 4.2e-06"
FT   CDS_pept        264535..265002
FT                   /transl_table=11
FT                   /locus_tag="SAS0221"
FT                   /product="putative PTS transport system, IIA component"
FT                   /EC_number="2.7.1.69"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0240"
FT                   /protein_id="CAG41990.1"
FT                   /translation="MGQQLVHKENIMLNLSATDKESVLSQMSDVLFQNGFVKSTFKDAV
FT                   IDREKEFATGLPTHLCSVAIPHTDVEHINHRTIGVAVLEKEVPFIEMGTLDQQTEVKIV
FT                   FMLAMDKVDDQLKLLQQLMQIFQSEEKLEQILRTKDETILATLINDYLEYN"
FT   misc_feature    264544..264987
FT                   /note="Pfam match to entry PF00359 PTS_EIIA_2,
FT                   Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2, score 47.8, E-value 2.6e-11"
FT   CDS_pept        265025..265303
FT                   /transl_table=11
FT                   /locus_tag="SAS0222"
FT                   /product="putative PTS transport system, IIB component"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0241"
FT                   /protein_id="CAG41991.1"
FT                   /translation="MKQVLVACGAGIATSTVVNNAIEEMAKEHNIKVDIKQIKITEVGP
FT                   YEDTADLLVTTAMTKKEYKFPVINARNFLTGIGIEETKQQILTELQK"
FT   misc_feature    265025..265102
FT                   /note="Signal peptide predicted for SAS0222 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.859) with cleavage site
FT                   probability 0.422 between residues 26 and 27"
FT   misc_feature    265031..265300
FT                   /note="Pfam match to entry PF02302 PTS_IIB, PTS system,
FT                   Lactose/Cellobiose specific IIB subunit, score 95.1,
FT                   E-value 1.4e-25"
FT   CDS_pept        265530..266789
FT                   /transl_table=11
FT                   /locus_tag="SAS0223"
FT                   /product="putative PTS transport system, IIC component"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0242"
FT                   /protein_id="CAG41992.1"
FT                   /translation="MSYFTDFVRGFLDLGATVILPVVIFLLGLFFRQKIGAAFRSGLTI
FT                   GVAFVGIFLVIDLLVKNLGPAAQAMVKNLGVSLNVIDVGWPATSSIAWASSVAAFIIPL
FT                   GIIVNVVLLVTKVTKTMNVDIWNFWHYTFTAAMVYAVSGSIWQALLAAVIFQVICLKVA
FT                   DWTAPMMSEFFDLPGVSIATGSTISYAPGIYLVKLLQKVPGLNKLDADPETIQKRFGAF
FT                   GESIFVGLILGLGIGVLAGYKPGDIINLGMSMAAVMVLMPRMVKILMEGLMPVSESART
FT                   WLNKRFGEREIYIGLDAAVALGHPAVISTALILVPITVLLAVILPGNQVLPFGDLATIP
FT                   FVVAFIVGAARGNIIHSVIVGTIMIAISLYIATDVAPIFTDMAKGTNVQMPKGSSEISS
FT                   IDQGGNIVNYLIFKLFSLFN"
FT   misc_feature    order(265557..265622,265641..265709,265803..265871,
FT                   265932..266000,266058..266126,266187..266255,
FT                   266436..266504,266517..266585,266598..266666)
FT                   /note="9 probable transmembrane helices predicted for
FT                   SAS0223 by TMHMM2.0 at aa 10-31, 38-60, 92-114, 135-157,
FT                   177-199, 220-242, 303-325, 330-352 and 357-379"
FT   misc_feature    265857..266774
FT                   /note="Pfam match to entry PF03611 EIIC-GAT, PTS system
FT                   Galactitol-specific IIC component, score 717.9, E-value
FT                   4.8e-213"
FT   CDS_pept        266807..267862
FT                   /transl_table=11
FT                   /locus_tag="SAS0224"
FT                   /product="putative zinc-binding dehydrogenase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0243"
FT                   /protein_id="CAG41993.1"
FT                   /translation="MKALVKTREGHGNLELLDKEVATPLDDKVKIKVHYAGICGTDIHT
FT                   YEGHYKVNFPVTLGHEFSGEIVEVGADVKDFKVGDRVTSETTFYVCNECEYCKSKDYNL
FT                   CNHRKGIGTQVDGAFTNYVIAREESLHHIPDEVSYQSAAMTEPLACAHHGVSKIQVNSG
FT                   DVAVVMGPGPIGLLVAQVLKSKGATVVVTGLDNDKVRLDKAEALHMDYVVNLQQTDLKT
FT                   YINGITDGYGADVVVECSGAVPAARQGLDILRKKGFYSQIGIFKDAEIPFDMEKVIQKE
FT                   ITVVGSRSQKPADWEPSLQLMADGLVNAEALVTKIYDISKWDEAYQHLKSGEGIKALLK
FT                   PLDLDENEGEN"
FT   misc_feature    266831..267829
FT                   /note="Pfam match to entry PF00107 ADH_zinc_N, Zinc-binding
FT                   dehydrogenase, score 334.1, E-value 1.6e-97"
FT   misc_feature    266981..267025
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT   CDS_pept        267864..268010
FT                   /transl_table=11
FT                   /locus_tag="SAS0225"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0244"
FT                   /protein_id="CAG41994.1"
FT                   /translation="MVESMLTFMLGPLRQITDFYMEHLLVSNSIVIAGYFATGIFKKKK
FT                   VVN"
FT   misc_feature    267918..267986
FT                   /note="1 probable transmembrane helix predicted for SAS0225
FT                   by TMHMM2.0 at aa 19-41"
FT   CDS_pept        268034..269077
FT                   /transl_table=11
FT                   /locus_tag="SAS0226"
FT                   /product="putative zinc-binding dehydrogenase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0245"
FT                   /protein_id="CAG41995.1"
FT                   /translation="MKALKLYGVEDLRYEDNEKPVIESANDVIVKVRATGICGSDTSRY
FT                   KKMGPYIKGMPFGHEFSGVVDAIGSDVTHVNVGDKVTGCPAIPCYQCEYCLKGEYARCE
FT                   KLFVIGSYEPGSFAEYVKLPAQNVLKVPDNVDYIEAAMVEPSAVVAHGFYKSNIQPGMT
FT                   VAVMGCGSIGLLAIQWARIFGAAHIIAIDIDAHKLDIATSLGAHQTINSKEENLEKFIE
FT                   NHYANQIDLAIESSGAKVTIGQILTLPKKGGEVVLLGIPYDDIEIDRVHFEKILRNELT
FT                   VCGSWNCLSSNFPGKEWTATLHYMKTKDINVKPIISHFLPLEKGPETFDKLVNKKERFD
FT                   KVMFTIY"
FT   misc_feature    268052..269068
FT                   /note="Pfam match to entry PF00107 ADH_zinc_N, Zinc-binding
FT                   dehydrogenase, score 297.0, E-value 2.4e-86"
FT   misc_feature    268205..268249
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT   CDS_pept        269605..270321
FT                   /transl_table=11
FT                   /locus_tag="SAS0227"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0246"
FT                   /db_xref="GOA:Q6GCM3"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="InterPro:IPR034709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCM3"
FT                   /protein_id="CAG41996.1"
FT                   /translation="MIYAGILAGGIGSRMGNVPLPKQFLDIDNKPILIHTIEKFILVSE
FT                   FNEIIIATPAQWISHTQDILKKYNITDQRVKVVAGGTDRNETIMNIIDYIRNVNGINND
FT                   DVIVTHDAVRPFLTQRIIKENIEVAEKYGAVDTVIEAIDTIVMSKDKQNIHSIPVRNEM
FT                   YQGQTPQSFNIKLLQDSYRALSSAQKEILSDACKIIVESGHPVKLVRGELYNIKVTTPY
FT                   DLKVANAIIQGDIADD"
FT   misc_feature    269608..270303
FT                   /note="Pfam match to entry PF01128 IspD, Uncharacterized
FT                   protein family UPF0007, score 98.8, E-value 1.1e-26"
FT   CDS_pept        270314..271339
FT                   /transl_table=11
FT                   /locus_tag="SAS0228"
FT                   /product="putative zinc-binding dehydrogenase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0247"
FT                   /protein_id="CAG41997.1"
FT                   /translation="MINQVYQLVAPRQFDVTYNNVDIYGNHVIVRPLYLSICAADQRYY
FT                   TGRRDENVLRKKLPMSLVHEAVGEVVFDSKGVFEKGTKVVMVPNTPTEKHDVIAENYLP
FT                   SSYFRSSGYDGFMQDYVVMAHDRIVPLPNAIDLSTISYTELVSVSYHAIQRFERKSIPL
FT                   KTSFGIWGDGNLGYITAILLRKLYPEAKIYVFGKTDYKLSHFSFVDDIFTVNQIPDDLK
FT                   INHAFECVGGKGSQVALQQIVEHISPEGSIALLGVSELPVEVNTRLVLEKGLTLIGSSR
FT                   SGSKDFEQVVDLYRKYPDIVEKLALLKGHEINVCTMQDIVQAFEMDLSTSWGKTVLKWT
FT                   I"
FT   misc_feature    270344..271330
FT                   /note="Pfam match to entry PF00107 ADH_zinc_N, Zinc-binding
FT                   dehydrogenase, score 39.3, E-value 5e-10"
FT   CDS_pept        271361..273055
FT                   /transl_table=11
FT                   /locus_tag="SAS0229"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0248"
FT                   /protein_id="CAG41998.1"
FT                   /translation="MTKTKQAIHIDNIYWERVQLYIEGHSEGVDLTSGQFVLRNLTETK
FT                   TLEANEMKIDGNTFICRFNVAILDDGYYLPMDKYLFVYHDQLEYIGQLNPNIIDQAYAA
FT                   LNEEQIEEYNELTTQNGKVNYLLAYDAKVFRKGGVSQHTVYTITPEIASDVNEFVFDIE
FT                   ITLPQEKSGVIATSAHWIHKQGHKASFESRSFLFKAIFNITKLLHIKRSKTILFTSDSR
FT                   PNLSGNFKYVYDELLRQKVDFDYDIKTVFKANITDRRKWRDKFRLPYLLGKADYIFVDD
FT                   FHPLIYTVRFRPSQEIIQVWHAVGAFKTVGFSRTGKKGGPFIDSLNHRSYTKAYVSSET
FT                   DIPFYAEAFGIREENVVPTGVPRTDVLFDEAYATQIKQEMEDELPIIKGKKVILFAPTF
FT                   RGNGHGTAHYPFFKIDFERLARYCEKHNAVVLFKMHPFVKNRLNISREHRQYFIDVSDH
FT                   REVNDILFVTDLLISDYSSLIYEYAVFKKPMIFYAFDLEDYITTRDFYEPYESFVPGKI
FT                   VQSFDALMDALDNEDYEVEKVVPFLDKHFKYQDGRSSERLVKDLFRR"
FT   misc_feature    272498..273049
FT                   /note="Pfam match to entry PF04464 glyphos_transf,
FT                   CDP-Glycerol:Poly(glycerophosphate)
FT                   glycerophosphotransferase, score 279.1, E-value 5.9e-81"
FT   CDS_pept        complement(273367..273501)
FT                   /transl_table=11
FT                   /locus_tag="SAS0230"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches. Doubtful CDS"
FT                   /protein_id="CAG41999.1"
FT                   /translation="MLIRSINGKTPEGAVPVEDRGPNTEADEKSAYNNVQVGVAETAP"
FT   CDS_pept        273703..273828
FT                   /transl_table=11
FT                   /locus_tag="SAS0230a"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0250"
FT                   /note="No significant database matches. Doubtful CDS"
FT                   /protein_id="CAG42000.1"
FT                   /translation="MLGPLTRIEKSLLQAHFRSVNYCQYNFVEHRTLIYVPACSN"
FT   CDS_pept        274081..275250
FT                   /transl_table=11
FT                   /locus_tag="SAS0231"
FT                   /product="putative teichoic acid biosynthesis protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0251"
FT                   /protein_id="CAG42001.1"
FT                   /translation="MIKNTIKKLIEHSIYTTFKLLSKLPNKNLIYFESFHGKQYSDNPK
FT                   ALYEYLTEHSDAQLIWGVKKGYEHIFQQHNVPYVTKFSMKWFLAMPRAKAWMINTRTPD
FT                   WLYKSPRTTYLQTWHGTPLKKIGLDISNVKMLGTNTQNYQDGFKKESQRWDYLVSPNPY
FT                   STSIFQHAFHVSRDRILETGYPRNDKLSHKRNDTEYINGIKTRLNIPLDKKVIMYAPTW
FT                   RDDEAIREGSYQFNVNFDIEALRQALDDDYVILLRMHYLVVTRIDEHDDFVKDVSDYED
FT                   ISDLYLISDALVTDYSSVMFDFGVLKRPQIFYAYDLDKYGDELRGFYMDYKKELPGPIV
FT                   ENQTALIDALKQIDETANEYIEARTVFYQKFCSLEDGHASQRICQTIFK"
FT   misc_feature    274687..275247
FT                   /note="Pfam match to entry PF04464 glyphos_transf,
FT                   CDP-Glycerol:Poly(glycerophosphate)
FT                   glycerophosphotransferase, score 329.6, E-value 3.8e-96"
FT   CDS_pept        275526..276242
FT                   /transl_table=11
FT                   /locus_tag="SAS0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0252"
FT                   /db_xref="GOA:Q6GCL7"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="InterPro:IPR034709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCL7"
FT                   /protein_id="CAG42002.1"
FT                   /translation="MKYAGILAGGIGSRMGNVPLPKQFLDLDNKPILIHTLEKFILIND
FT                   FEKIIIATPQQWMTHTKDTLRKFKISDERIEVIQGGSDRNDTIMNIVKHIESTNGINDD
FT                   DVIVTHDAVRPFLTHRIIKENIQAALEYGAVDTVIDAIDTIVTSKDNQTIDAIPVRNEM
FT                   YQGQTPQSFNINLLKESYAQLSDEQKSILSDACKIIVETNKPVRLVKGELYNIKVTTPY
FT                   DLKVANAIIRGGIADD"
FT   misc_feature    275529..276224
FT                   /note="Pfam match to entry PF01128 IspD, Uncharacterized
FT                   protein family UPF0007, score 89.6, E-value 6.4e-24"
FT   CDS_pept        276235..277260
FT                   /transl_table=11
FT                   /locus_tag="SAS0233"
FT                   /product="putative zinc-binding dehydrogenase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0253"
FT                   /protein_id="CAG42003.1"
FT                   /translation="MINQVYQLVAPRQFEVTYNNVDIYSDYVIVRPLYMSICAADQRYY
FT                   TGSRDENVLSQKLPMSLIHEGVGEVVFDSKGVFNKGTKVVMVPNTPTEKDDVIAENYLK
FT                   SSYFRSSGHDGFMQDFVLLNHDRAVPLPDDIDLSIISYTELVTVSLHAIRRFEKKSISN
FT                   KNTFGIWGDGNLGYITAILLRKLYPESKIYVFGKTDYKLSHFSFVDDVFFINKIPEGLT
FT                   FDHAFECVGGRGSQSAINQMIDYISPEGSIALLGVSEFPVEVNTRLVLEKGLTLIGSSR
FT                   SGSKDFQDVVDLYIQYPDIVDKLALLKGQEFEIATINDLTEAFEADLSTSWGKTVLKWI
FT                   M"
FT   misc_feature    276265..277251
FT                   /note="Pfam match to entry PF00107 ADH_zinc_N, Zinc-binding
FT                   dehydrogenase, score 30.1, E-value 1.7e-09"
FT   CDS_pept        277282..278970
FT                   /transl_table=11
FT                   /locus_tag="SAS0234"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0254"
FT                   /protein_id="CAG42004.1"
FT                   /translation="MVKSKIYIDKIYWERVQLFVEGHSENLDLEDSNFVLRNLTETRTM
FT                   KANDVKIDGNQFVCRFNVAILDNGYYLPEDKYLLVNEQELDYIAQLNPDVINDAYQNLK
FT                   PEQEEEYNELETQNGKINFLLQTYLKEFRKGGISKKTVYTVTPEISSDVNEFVLDVVVT
FT                   TPEVKSIYIVRKYKELRKYFRKQSFNTRQFIFKAIFNTTKFFHLKKGNTVLFTSDSRPT
FT                   MSGNFEYIYNEMLRQNLDKKYDIHTVFKANITDRRGIIDKFRLPYLLGKADYIFVDDFH
FT                   PLIYTVRFRRSQEVIQVWHAVGAFKTVGFSRTGKKGGPFIDSLNHRSYTKAYVSSETDI
FT                   PFYAEAFGIKEKNVVPTGVPRTDVLFDEAYATQIKQEMEDELPIIKGKKVILFAPTFRG
FT                   SGHGTAHYPFFKIDFERLARYCEKNNAVVLFKMHPFVKNRLNIADKHKQYFVDVSDFRE
FT                   VNDILFITDLLISDYSSLIYEYAVFKKPMIFYAFDLEDYITTRDFYEPYESFVPGKIVQ
FT                   SFDALMDALDNEDYEGEKVIPFLDKHFKYQDGRSSERLVRNLFGS"
FT   misc_feature    278413..278964
FT                   /note="Pfam match to entry PF04464 glyphos_transf,
FT                   CDP-Glycerol:Poly(glycerophosphate)
FT                   glycerophosphotransferase, score 282.4, E-value 6e-82"
FT   CDS_pept        279003..280724
FT                   /transl_table=11
FT                   /locus_tag="SAS0235"
FT                   /product="putative glycosyl transferase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0255"
FT                   /protein_id="CAG42005.1"
FT                   /translation="MMKFSVIVPTYNSEKYITELLNSLAKQDFPKTEFEVVVVDDCSTD
FT                   QTLQIVEKYRNKLNLKVSQLETNSGGPGKPRNVALKQAEGEFVLFVDSDDYINKETLKD
FT                   AAAFIDEHHSDVLLIKMKGVNGRGVPQSMFKETAPEVTLLNSRIIYTLSPTKIYRTTLL
FT                   KDNDIYFPEELKSAEDQLFTMKAYLNANRISVLSDKAYYYATKREGEHMSSAYVSPEDF
FT                   YEVMRLIAVEILNADLEEAHKDQILAEFLNRHFSFSRTNGFSLKVKLEDQPQWINALGD
FT                   FIQAVPERVDALVMSKLRPLLHYARAKDIDNYRTVEESYRQGQYYRFDIVDGKLNIQFN
FT                   EGEPYFEGIDIAKPKVKMTAFKFDNHKIVTELTLNEFMIGEGHYDVRLKLHSRNKKHTM
FT                   YVPLSVNANKQYRFNIMLEDIKAYLPKEKIWDVFLEVQIGTEVFEVRVGNQRNKYAYTA
FT                   ETSALIHLNNDFYRLTPYFTKDFNNISLYFTAITLTDSISLKLKGKNKIILTGLDRGYV
FT                   FEEGMASVVLKDDMIMGMLSQTSENEVEILLSKDIKKRDFKNIVKLNTAHMTYSLK"
FT   misc_feature    279015..279503
FT                   /note="Pfam match to entry PF00535 Glycos_transf_2,
FT                   Glycosyl transferase, score 137.6, E-value 2.3e-38"
FT   CDS_pept        280868..281542
FT                   /transl_table=11
FT                   /locus_tag="SAS0236"
FT                   /product="cell wall metabolism protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0256"
FT                   /db_xref="GOA:Q6GCL3"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="InterPro:IPR023551"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCL3"
FT                   /protein_id="CAG42006.1"
FT                   /translation="MINKNDIVADVVTDYPKAADIFRSVGIDFCCGGQVSIEAASLEKK
FT                   NVDLNELLQRLNDVEQTNTPGSLNPKFLNVSSLIQYIQAAYHEPLREEFKNLTPYVTKL
FT                   SKVHGPNHPYLVELKETYDTFKNGMLEHMQKEDDVDFPKLIKYEQGEVVDDINTVIDDL
FT                   VSDHIATGQLLVKMSDLTSSYEPPIEACGTWRLVYQRLKALEVLTHEHVHLENHVLFKK
FT                   VS"
FT   misc_feature    280877..281077
FT                   /note="Pfam match to entry PF04405 ScdA_N, Domain of
FT                   Unknown function (DUF542), score 140.3, E-value 3.7e-39"
FT   misc_feature    281099..281314
FT                   /note="Pfam match to entry PF03794 HHE, Domain of Unknown
FT                   function, score 53.2, E-value 5.9e-13"
FT   misc_feature    281339..281539
FT                   /note="Pfam match to entry PF03794 HHE, Domain of Unknown
FT                   function, score 52.6, E-value 8.9e-13"
FT   CDS_pept        281786..283540
FT                   /transl_table=11
FT                   /locus_tag="SAS0237"
FT                   /product="autolysin sensor kinase protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0257"
FT                   /db_xref="GOA:Q6GCL2"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCL2"
FT                   /protein_id="CAG42007.1"
FT                   /translation="MLSLTMLLLERVGLIIILAYVLMNIPYFKNLMNRRRTWKARWQLC
FT                   IIFSLFALMSNLTGIVIDHQHSLSGSVYFRLDDDVSLANTRVLTIGVAGLVGGPFVGLF
FT                   VGVISGIFRVYMGGADAQVYLISSIFIGIIAGYFGLQAQRRKRYPSIAKSAMIGIVMEM
FT                   IQMLSILTFSHDKAYAVDLISLIALPMIIVNSVGTAIFMSIIISTLKQEEQMKAVQTHD
FT                   VLQLMNQTLPYFKEGLNRESAQQIAMIIKNLMKVSAVAITSKNEILSHVGAGSDHHIPT
FT                   NEILTSLSKDVLKSGKLKEVHTKEEIGCSHPNCPLRAAIVIPLEMHGSIVGTLKMYFTN
FT                   PNDLTFVERQLAEGLANIFSSQIELGEAETQSKLLKDAEIKSLQAQVSPHFFFNSINTI
FT                   SALVRINSEKARELLLELSYFFRANLQGSKQHTITLDKELSQVRAYLSLEQARYPGRFN
FT                   ININVEDKYRDVLVPPFLIQILVENAIKHAFTNRKQGNDIDVSVIKETATHVRIIVQDN
FT                   GQGISKDKMHLLGETSVESESGTGSALENLNLRLKGLFGKSAALQFESTSSGTTFWCVL
FT                   PYERQEEE"
FT   misc_feature    order(281801..281869,281903..281971,282047..282115,
FT                   282152..282205,282248..282301,282335..282403)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SAS0237 by TMHMM2.0 at aa 6-28, 40-62, 88-110, 123-140,
FT                   155-172 and 184-206"
FT   misc_feature    282239..282286
FT                   /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature."
FT   misc_feature    283196..283522
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase, score 56.7,
FT                   E-value 5.2e-14"
FT   CDS_pept        283543..284283
FT                   /transl_table=11
FT                   /locus_tag="SAS0238"
FT                   /product="autolysin response regulator protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0258"
FT                   /db_xref="GOA:Q6GCL1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCL1"
FT                   /protein_id="CAG42008.1"
FT                   /translation="MKALIIDDEPLARNELTYLLNEIGGFEEINEAENVKETLEALLIN
FT                   QYDIIFLDVNLMDENGIELGAKIQKMKEPPAIIFATAHDQYAVQAFELNATDYILKPFG
FT                   QKRIEQAVNKVRATKAKDDNSASAIANDMSANFDQSLPVEIDDKIHMLKQQNIIGIGTH
FT                   NGITTIHTTNHKYETTEPLNRYEKRLNPAYFIRIHRSYIINTKHIKEVQQWFNYTYMVI
FT                   LTNGVKMQVGRSFMKDFKASIGLL"
FT   misc_feature    283543..283902
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 112.0, E-value 1.2e-30"
FT   misc_feature    283960..284274
FT                   /note="Pfam match to entry PF04397 LytTR, LytTr DNA-binding
FT                   domain, score 115.5, E-value 1.1e-31"
FT   CDS_pept        284396..284839
FT                   /transl_table=11
FT                   /locus_tag="SAS0239"
FT                   /product="holin-like protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0259"
FT                   /db_xref="GOA:Q6GCL0"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="InterPro:IPR023736"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCL0"
FT                   /protein_id="CAG42009.1"
FT                   /translation="MVVKQQKDASKPAHFFHQVIVIALVLFVSKIIESFMPIPMPGSVI
FT                   GLVLLFVLLCTGAVKLGEVEKVGTTLTNNIGLLFVPAGISVVNSLGVISQAPFLIIGLI
FT                   IVSTILLLICTGYVTQIIMKVTSRSKGDKVTKKIKIEEAQAHD"
FT   misc_feature    order(284432..284491,284519..284587,284606..284674,
FT                   284684..284752)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SAS0239 by TMHMM2.0 at aa 13-32, 42-64, 71-93 and 97-119"
FT   misc_feature    284438..284767
FT                   /note="Pfam match to entry PF03788 LrgA, LrgA family, score
FT                   103.2, E-value 5.5e-28"
FT   CDS_pept        284832..285533
FT                   /transl_table=11
FT                   /locus_tag="SAS0240"
FT                   /product="holin-like protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0260"
FT                   /db_xref="GOA:Q6GCK9"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="InterPro:IPR024891"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCK9"
FT                   /protein_id="CAG42010.1"
FT                   /translation="MINHLALNTPYFGILLSVIPFFLATILFEKTNRFFLFAPLFVSMV
FT                   FGVAFLYLTGIPYKTYKIGGDIIYFFLEPATICFAIPLYKKREVLVKHWHRIIGGIGIG
FT                   TVVALLIILTFAKLAQFANDVILSMLPQAATTAIALPVSAGIGGIKELTSLAVILNGVI
FT                   IYALGNKFLKLFRITNPIARGLALGTSGHTLGVAPAKELGPVEESMASIALVLVGVVVV
FT                   AVVPVFVAIFF"
FT   misc_feature    order(284844..284912,284931..284999,285030..285083,
FT                   285120..285179,285207..285275,285294..285362,
FT                   285459..285527)
FT                   /note="7 probable transmembrane helices predicted for
FT                   SAS0240 by TMHMM2.0 at aa 5-27, 34-56, 67-84, 97-116,
FT                   126-148, 155-177 and 210-232"
FT   misc_feature    284850..285530
FT                   /note="Pfam match to entry PF04172 LrgB, LrgB-like family,
FT                   score 384.9, E-value 8.6e-113"
FT   CDS_pept        complement(285641..286345)
FT                   /transl_table=11
FT                   /locus_tag="SAS0241"
FT                   /product="GntR family regulatory protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0262"
FT                   /protein_id="CAG42011.1"
FT                   /translation="MLKYEHIAKQLNAFIHQSKFKPGDKLPSVTQLKERYQVSKSTIIK
FT                   ALGLLEQDGLIYQAQGSGIYVRNIADANRINVFKTNGFSKSLGEHRMTSKVLVFKEMAT
FT                   PPKSVQDELQLNADDTVYYLERLRFVDDDVLCIEYSYYHKEIVKYLNDDIAKGSIFDYL
FT                   ESNMKLRIGFSDIFFNVDKLTSSEASLLQLSTGEPCLRYHQTFYTMTGKPFDSSDIVFH
FT                   YRHAQFYIPSKK"
FT   misc_feature    complement(286148..286339)
FT                   /note="Pfam match to entry PF00392 gntR, Bacterial
FT                   regulatory proteins, gntR family, score 57.5, E-value
FT                   3e-14"
FT   CDS_pept        286494..287285
FT                   /transl_table=11
FT                   /locus_tag="SAS0242"
FT                   /product="putative PTS transport system protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0263"
FT                   /protein_id="CAG42012.1"
FT                   /translation="MSNKYKEQAQDILTAVGGVENIVDATYDTKCITIHMQHTIPSTAN
FT                   EVKQIVDVTSVAENDAQLVIKLNGNVDEVYQQLQRLIKNANVEESENTDNINSQDTSYI
FT                   PQVKVTTPILVKAPIAGRRILLKEVRDSIFREKMVGEGLAIKAHEESKVIAPFNGLISM
FT                   IVPTKHAVRIQSEDGVDIVIHIGVNTVDLEGKGFKCFVKQNDRVEAGQTLLQFDQQYIQ
FT                   QQGYNADVIVVISNSADLGKVELTMNEIITTEDVIFKIFKN"
FT   misc_feature    286884..287201
FT                   /note="Pfam match to entry PF00358 PTS_EIIA_1,
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 1, score 124.6, E-value 2e-34"
FT   misc_feature    287025..287063
FT                   /note="PS00371 PTS EIIA domains phosphorylation site
FT                   signature 1."
FT   CDS_pept        287301..288737
FT                   /transl_table=11
FT                   /locus_tag="SAS0243"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number="3.2.1.86"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0264"
FT                   /protein_id="CAG42013.1"
FT                   /translation="MTKLPRNFMWGGALAANQFEGGYDKGGKGLSVIDVMTSGAHGKAR
FT                   QITKSIDQNHYYPNHEGIDFYHRYKEDIALFNEMGLKCLRTSIAWTRIFPNGDEDVPNE
FT                   EGLAFYDRIFDELIAQDIEPVVTLSHFEMPLHLAKHYGGFRNREVVDYFVHFARVVFER
FT                   YKDKVTYWMTFNEINNQMDTSNPIFLWTNSGVALTENDNPEEVLYQVAHHELLASALAV
FT                   RLGKEINPKFKIGTMISHVPIYPYSCHPKDMMEAQIANRLRFFFPDVQVRGYYPSYAKK
FT                   MLARKGYDVGWQEGDDSILQQGTVDYIGFSYYMSTAVKHDVDTTVENNIVNGGLNHSVE
FT                   NPHIATSDWGWAIDPDGLRYTLNVLYDRYQLPLFIVENGFGAVDEVVDGHIHDDYRIEY
FT                   LKAHITAAIEAVDQDGVDLIGYTPWGIIDIVSFTTGEMKKRYGLIYVDRDNDGHGTMER
FT                   LKKDSFYWYQQVIASNGDKL"
FT   misc_feature    287301..288734
FT                   /note="Pfam match to entry PF00232 Glyco_hydro_1, Glycosyl
FT                   hydrolase family 1, score 490.2, E-value 1.6e-144"
FT   misc_feature    287322..287366
FT                   /note="PS00653 Glycosyl hydrolases family 1 N-terminal
FT                   signature."
FT   misc_feature    288417..288443
FT                   /note="PS00572 Glycosyl hydrolases family 1 active site."
FT   CDS_pept        complement(289230..289991)
FT                   /transl_table=11
FT                   /locus_tag="SAS0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0265"
FT                   /protein_id="CAG42014.1"
FT                   /translation="MSKEAGHTFLAKLGKTRLRPGGKEATDWLIQQGAFSQDKQVLEVA
FT                   CNMCTTSIYLAHTYGCHIQGVDINKKALEKAQENISAAGLESYIQVQQANAVKLPFDDN
FT                   QFDIVLNEAMLTMLPITIKEKALREYYRVLKPGGILLTHDIVIVNESHATHVVKSLSAA
FT                   INVNVSPQTKLGWLDLYNQAGFNHVHYHTGPMSLMTPKGLIYDEGIVGTIKIINNALKK
FT                   ENRPMFCKMFKTMTKLRKDMNYITFVAKKED"
FT   misc_feature    complement(289569..289625)
FT                   /note="Pfam match to entry PF01209 Ubie_methyltran,
FT                   ubiE/COQ5 methyltransferase family, score 20.4, E-value
FT                   5.2e-06"
FT   CDS_pept        complement(290242..291156)
FT                   /transl_table=11
FT                   /locus_tag="SAS0245"
FT                   /product="putative ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0266"
FT                   /protein_id="CAG42015.1"
FT                   /translation="MTNKVVILGSTNVDQFLTVERYAQPGETLHVEEAQKAFGGGKGAN
FT                   QAIATARMQADTTFITKIGTDGVADFILEDFKAAHIDTSYIIKSTEAKTGQAFITVNAE
FT                   GQNTIYVYGGANMTMTPEDVINAKDAIINADFVVAQLEVPIPAIISAFEIAKAHGVTTV
FT                   LNPAPAKALPNELLSLIDIIVPNETEAELLSGIKVTNEQSMKDNANYFLSLGIKTVLIT
FT                   LGKQGTYFATKNQSQHIEAYKVNAIDTTAAGDTFIGAFVSRLNKSQDNLADAIDFGNKA
FT                   SSLTVQKHGAQASIPLLEEVNQV"
FT   misc_feature    complement(290263..291147)
FT                   /note="Pfam match to entry PF00294 pfkB, pfkB family
FT                   carbohydrate kinase, score 265.0, E-value 1.1e-76"
FT   misc_feature    complement(290374..290415)
FT                   /note="PS00584 pfkB family of carbohydrate kinases
FT                   signature 2."
FT   CDS_pept        complement(291184..291588)
FT                   /transl_table=11
FT                   /locus_tag="SAS0246"
FT                   /product="putative ribose transport protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0267"
FT                   /db_xref="GOA:Q6GCK3"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCK3"
FT                   /protein_id="CAG42016.1"
FT                   /translation="MKKSAVLNEHISKAIATIGHFDLLTINDAGMPIPNDHRRIDLAVT
FT                   KNLPRFIDVLATVLEEMEIQKIYLAEEIKEHNPTQLQQIKQLISSEIEIIFIPHEEMKS
FT                   NLAHPLNKGNIRTGETTPYSNIALESNVTF"
FT   misc_feature    complement(291187..291588)
FT                   /note="Pfam match to entry PF05025 RbsD_FucU, RbsD / FucU
FT                   transport protein family, score 269.9, E-value 3.5e-78"
FT   CDS_pept        complement(291603..292484)
FT                   /transl_table=11
FT                   /locus_tag="SAS0247"
FT                   /product="putative sugar transport protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0268"
FT                   /db_xref="GOA:Q6GCK2"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCK2"
FT                   /protein_id="CAG42017.1"
FT                   /translation="MSIVALLIGLGPLIGWGFFPTVASKFGGKPVHQIIGATVGTLIFA
FT                   IILAVVTSSGFPTGTNLLFALLSGAGWGFGQIITFKAFELVGSSRAMPVTTAFQLLGAS
FT                   LWGVFALGNWPGIGHKIIGFTALVVILIGARMTVWSERKEASNAKNLRRAVVLLLIGEF
FT                   GYWLYSAAPQATSIDGLTAFLPQAMGMVIVAVIYGFMNMKAENPFRNKITWLQIISGFF
FT                   FAFGALTYLISAQPNMNGLATGFILSQTSVVLATLTGIYFLKQHKTSKEMVITIIGLVL
FT                   ILVAASVTVFIK"
FT   misc_feature    complement(order(291609..291668,291696..291764,
FT                   291783..291851,291879..291947,291972..292025,
FT                   292068..292121,292134..292202,292245..292298,
FT                   292317..292385,292413..292481))
FT                   /note="10 probable transmembrane helices predicted for
FT                   SAS0247 by TMHMM2.0 at aa 2-24, 34-56, 63-80, 95-117,
FT                   122-139, 154-171, 180-202, 212-234, 241-263 and 273-292"
FT   misc_feature    complement(292410..292484)
FT                   /note="Signal peptide predicted for SAS0247 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.929) with cleavage site
FT                   probability 0.463 between residues 25 and 26"
FT   CDS_pept        complement(292716..293714)
FT                   /transl_table=11
FT                   /locus_tag="SAS0248"
FT                   /product="LacI family regulatory protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0269"
FT                   /protein_id="CAG42018.1"
FT                   /translation="MKKVSIKDVAREAGVSVTTVSHILNHNDSRFSATTIKNVHAVSER
FT                   LGYAPNKHAKQLRGSKIQTIGVILPSLTNPFFSALMQSIHDHKPSDVDLCFLTSTATDL
FT                   YDNIKHLIDRGIDGLIIAQYISSPDALNNYLKKHHVPYVVLDQNDHQGYTDFVRTNEYQ
FT                   GGQLAAQHLIELGHNNMMIVAPYDMMANMSTRVAGFVDTLRANQLPEPQIVHTELSKRG
FT                   GLTIVDDIMVQSATAIFAINDELAIGILRGLIEHGISIPKDISLIGYDDIDYAAYVSPP
FT                   LTTVAQPITDIGKTSLTLLLQRLQHLDKSIDMIELPTTLKIRATTGYHLSN"
FT   misc_feature    complement(292743..293531)
FT                   /note="Pfam match to entry PF00532 Peripla_BP_like,
FT                   Periplasmic binding proteins and sugar binding domain of
FT                   the LacI family, score 43.8, E-value 4.2e-10"
FT   misc_feature    complement(293628..293705)
FT                   /note="Pfam match to entry PF00356 lacI, Bacterial
FT                   regulatory proteins, lacI family, score 48.0, E-value
FT                   2.3e-11"
FT   misc_feature    complement(293640..293705)
FT                   /note="Predicted helix-turn-helix motif for SAS0248 with
FT                   score 2168.000, SD 6.57 at aa 4-25, sequence
FT                   VSIKDVAREAGVSVTTVSHILN"
FT   misc_feature    complement(293643..293699)
FT                   /note="PS00356 Bacterial regulatory proteins, lacI family
FT                   signature."
FT   CDS_pept        293932..294045
FT                   /transl_table=11
FT                   /locus_tag="SAS0248a"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0269a"
FT                   /note="No significant database matches. Doubtful CDS"
FT                   /protein_id="CAG42019.1"
FT                   /translation="MFIVMKNTKVIILNNKIFVFEKSIKKHNEMMYIELCD"
FT   CDS_pept        294095..294487
FT                   /transl_table=11
FT                   /locus_tag="SAS0249"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0270"
FT                   /protein_id="CAG42020.1"
FT                   /translation="MQFKLKEEEIISFLELKYPEKEFEYGRLLVGQHKRDDLDVYYFGD
FT                   TFLMCTIISFKTFEIKETVELSYDAVNRIVLKDGWLFRKMRIETMQKVLKYGTSKLMLT
FT                   DFQKENYNKYIQGQKQRVIFENGHFV"
FT   CDS_pept        complement(294615..295991)
FT                   /transl_table=11
FT                   /locus_tag="SAS0250"
FT                   /product="putative transport protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0271"
FT                   /protein_id="CAG42021.1"
FT                   /translation="MNNTQSSPRSNIIIAIMLSALTYWLFAQSFINIGPLVGQTYQTSP
FT                   AVLNLSISLTSFATGIFMVAAGDIADKIGQLRMTYMGLIISMFASLLLIISDITALLII
FT                   GRILQGLSAAILLPSTVGVLNNQFKGEHLRRAISYLMISTVGGIGLAGVIGGLIATNFG
FT                   WQTNFIISIVIAFIAILLLKGTPEKVSQHSHRHPFDYKGMSIFAVMIGSFTLLLTQGFE
FT                   QGWFSTFSFICLSIFIITTLIFIIIERRHEVPFIDFSVLRNRPFIGAFLNNFVLNSGLG
FT                   VTVVFFIYAQTHLGLSAAQSGLVTLPYAIVAVAMIRLGEKATLRFGGKLMLIIGPLFPV
FT                   IGITIISMTQLSASQYVIAVIIGFVICAIGNGLVATPGLTIAIFSMPNEKVGLATGLYK
FT                   MSGTLGGAFGIALSTTVFSMLQLNYAPSVAATVTFIVSIVLMILGSLSAYMIIPKTVKS
FT                   "
FT   misc_feature    complement(order(294642..294710,294738..294806,
FT                   294867..294935,294948..295016,295035..295094,
FT                   295122..295190,295251..295319,295329..295388,
FT                   295446..295505,295515..295583,295620..295688,
FT                   295698..295757,295794..295862,295890..295958))
FT                   /note="14 probable transmembrane helices predicted for
FT                   SAS0250 by TMHMM2.0 at aa 12-34, 44-66, 79-98, 102-124,
FT                   137-159, 163-182, 202-221, 225-247, 268-290, 300-319,
FT                   326-348, 353-375, 396-418 and 428-450"
FT   misc_feature    complement(295107..295142)
FT                   /note="PS00962 Ribosomal protein S2 signature 1."
FT   misc_feature    complement(295818..295991)
FT                   /note="Signal peptide predicted for SAS0250 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.938) with cleavage site
FT                   probability 0.705 between residues 58 and 59"
FT   CDS_pept        296225..297217
FT                   /transl_table=11
FT                   /locus_tag="SAS0251"
FT                   /product="putative choloylglycine hydrolase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0272"
FT                   /protein_id="CAG42022.1"
FT                   /translation="MCTGFTIQTLNNQVLLGRTMDYDYPLDGSPAVTPRNYRWTSRTGT
FT                   TGQTQYGFIGTGTDMEGFIYGDGVNEHGVAISTQYFRGYSSYGSTHKAGAMNITQNEIV
FT                   TWILGYTTSIEDMKQQASQIHVVAVYLNDIGEVPPLHYHVSDATGHSVEVSFKEGEVVI
FT                   KDNPIGVLTNHPDLDWHYSNLRQYINISPYPATAKLLEGVTIEPLGNEAGTFGLPGGFT
FT                   STERFVRMAFMKANIAQNNDKEMDLMNAFYLLDAVNIPIGIVRPHDADNHYTMYQTVIN
FT                   LTTRTLYIKYYGSNELVALKLTDDLINRKDMTIFKPEKHITIRKLNDNQ"
FT   misc_feature    296228..297169
FT                   /note="Pfam match to entry PF02275 CBAH, Linear amide C-N
FT                   hydrolases, choloylglycine hydrolase family, score 225.4,
FT                   E-value 8.8e-65"
FT   CDS_pept        297543..298493
FT                   /transl_table=11
FT                   /locus_tag="SAS0252"
FT                   /product="peptidoglycan hydrolase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0273"
FT                   /db_xref="GOA:Q6GCJ6"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCJ6"
FT                   /protein_id="CAG42023.1"
FT                   /translation="MKKLTAAAIATMGFATFTMAHQADAAETTNTQQAHTQMSTQSQDV
FT                   SYGTYYTIDSNGDYHHTPDGNWNQAMFDNKEYSYTFVDAQGHTHYFYNCYPKNANANGS
FT                   GQTYVNPAIAGDNNDYTASQSQQHINQYGYQSNVGPDASYYSHSNNNQAYNSHDGNGKV
FT                   NYPNGTSNQNGGLASKATASGHAKDASWLTSRKQLQPYGQYHGGGAHYGVDYAMPENSP
FT                   VYSLTDGTVVQAGWSNYGGGNQVTIKEANSNNYQWYMHNNRLTVSAGDKVKAGDQIAYS
FT                   GSTGNSTAPHVHFQRMSGGIGNQYAVDPTSYLQSR"
FT   misc_feature    297543..297617
FT                   /note="Signal peptide predicted for SAS0252 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.766 between residues 25 and 26"
FT   misc_feature    298212..298478
FT                   /note="Pfam match to entry PF01551 Peptidase_M37, Peptidase
FT                   family M23/M37, score 141.6, E-value 1.4e-39"
FT   CDS_pept        complement(298545..299204)
FT                   /transl_table=11
FT                   /locus_tag="SAS0253"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0274"
FT                   /protein_id="CAG42024.1"
FT                   /translation="MIEINNLSKRYRNKQIFNHLTMSFDSNRLTVLLGDNGAGKSTLLR
FT                   MIAGIEKANDGTINYFGEKWNQRQIQNHIGYVPQDIALFEHMTVAENINFFKSLCKNPI
FT                   NDTTINEYLQQLNFDDTSAKVSTLSGGNKRKINILVGLLGQPRILILDEPTVGIDLKSR
FT                   HDIHQLLNIMKSKCLIILTTHHLDEVEALADDIKLIGQDPFYQHVLEDKQWAYTYY"
FT   misc_feature    complement(298605..299126)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 158.7, E-value 1e-44"
FT   misc_feature    complement(298779..298823)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(299082..299105)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(299218..300138)
FT                   /transl_table=11
FT                   /locus_tag="SAS0254"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0275"
FT                   /protein_id="CAG42025.1"
FT                   /translation="MKPYIQLVVFKQWLQYILLVTTIVIALVLIGIGYRVAHDNFKIPI
FT                   TIQDLDQTTASKSFVNKIKQSDYVTIKKVDEDESYIEDDVTKKEAILSMQIPKGFSQKL
FT                   KENRLKETIQLYGRDDFIGGIAVEIVSSSLYEQQIPNIIYEHLEDMKQHQSIDAINKSY
FT                   HKHTPESKIKFVSLTKQAQQSISISLIFAVILFVSAVQVVLHYRLNQQAALQRLSQYHL
FT                   TRFKLYSTYVMTHTILLLLVLLAVSLYLSQPLSLIFYLKSLLLILIYEIGIVFILFHIQ
FT                   TISHRLFMTFIYALAMGIVYLIIFM"
FT   misc_feature    complement(order(299224..299292,299305..299373,
FT                   299392..299460,299518..299586,300028..300096))
FT                   /note="5 probable transmembrane helices predicted for
FT                   SAS0254 by TMHMM2.0 at aa 15-37, 185-207, 227-249, 256-278
FT                   and 283-305"
FT   CDS_pept        complement(300135..301301)
FT                   /transl_table=11
FT                   /locus_tag="SAS0255"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0276"
FT                   /protein_id="CAG42026.1"
FT                   /translation="MKTIHLFRIYHSFLLKKWYLIIYLLFILAALVITLTTIQHVTEDD
FT                   NHFNIGVVDKDQSSETKLILNSIGKGSNLGKNVSIKAYDDKQAHTLLKKHKLQGYFVFD
FT                   KGMTKAFYKQGELPISVYTYDQQSMKSVVLSQLTDSVYQRLMRSMGGILAFQDLAPKAS
FT                   HSDSINVMTDLLITGLNRSGAFNLEPIHLYDTGSYYAITGFLTTVFIFALSLFTVLKMN
FT                   QDTVLKARLKMFHFSKERLLIIRVLITWFYTMLWSIVGVVWIVFSIPNTFELYNWPTLA
FT                   IHLSYYVTFLILWLLLIELLTTGLLNSISKVILAIVILVLSGLTIPTIFLQHIANGVFN
FT                   IQPFAVVTNQLLEIILNNYILELHPSFYLSFIALLIINLAVLVWRYRQ"
FT   misc_feature    complement(order(300150..300203,300297..300365,
FT                   300399..300467,300510..300578,300639..300707,
FT                   301176..301244))
FT                   /note="6 probable transmembrane helices predicted for
FT                   SAS0255 by TMHMM2.0 at aa 20-42, 199-221, 242-264, 279-301,
FT                   313-335 and 367-384"
FT   misc_feature    complement(301173..301301)
FT                   /note="Signal peptide predicted for SAS0255 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.980) with cleavage site
FT                   probability 0.974 between residues 43 and 44"
FT   CDS_pept        complement(301369..302892)
FT                   /transl_table=11
FT                   /locus_tag="SAS0256"
FT                   /product="putative exported protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0277"
FT                   /protein_id="CAG42027.1"
FT                   /translation="MSKKLKIIIPIIVVLLLIGGIAWGVYAFFANTPKNTYLKSEQQTA
FT                   KMYKDYFNDRFENEVKFQEKMKDNSFLSSLELSADASDEIVKGLGIPKSVVNASKIKMS
FT                   YGHDPKKEKSMINLEPTIADSALGKFQLAADKDKHYFESPLFKGKYSVNNSDLLSTYSK
FT                   LTGEDEETAKENGITNQQLNLNTLFSNAQAQQSDYSKIAEKYSELIVDKLDDDNFDKGK
FT                   KEEIKVNGEKYKVRPVTLTLSRADTKKITLAVLEEAKKDKDLKKLMEEQGATKDFEKDI
FT                   KKAIDDVKETKKDEFAKIQSKIYTEKHTIVKREITITDKENNKTKIKGTNTLEDDKLKL
FT                   DYALDFDQDKYTYAEAKYTIKGVSSKEKDNKYSDKYEFGKKTEYDESKIKLDNQEKVDG
FT                   TKRQDKGKITVALDKYSDENEFTFENNIDSDVKNNTQKSTLNIGIKYAEEPINFILKSS
FT                   TKLKADIDFDDSGAKDFNSLSSKDREKLEKEIEKNGGKMFESILKKASK"
FT   misc_feature    complement(302803..302892)
FT                   /note="Signal peptide predicted for SAS0256 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.803 between residues 30 and 31"
FT   misc_feature    complement(302806..302874)
FT                   /note="1 probable transmembrane helix predicted for SAS0256
FT                   by TMHMM2.0 at aa 7-29"
FT   CDS_pept        complement(303223..304125)
FT                   /transl_table=11
FT                   /locus_tag="SAS0257"
FT                   /product="putative exported protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0278"
FT                   /protein_id="CAG42028.1"
FT                   /translation="MVIMKKTILLTMTTLTLFSMSPNSAQAYTNDSKTLEEAKKAHPNA
FT                   QFKVNKDTGAYTYTYDKNNTPNNNHQNQSRTNDNHQHANQRDLNNNQYHSSLSGQYTHI
FT                   NDAIDSHTPPQTSPSNPLTPAIPNVEDNDDELNNAFSKDNKGLITGIDLDELYDELQIA
FT                   EFNDKAKTADGKPLALGNGKIIDQPLITSKNNLYTAGQCTWYVFDKRAKDGHTISTFWG
FT                   DAKNWAGQASSNGFKVDRHPTRGSILQTVNGPFGHVAYVEKVNIDGSILISEMNWIGEY
FT                   IVSSRTISASEVSSYNYIH"
FT   misc_feature    complement(303226..303582)
FT                   /note="Pfam match to entry PF05257 CHAP, CHAP domain, score
FT                   164.5, E-value 1.8e-46"
FT   misc_feature    complement(304045..304125)
FT                   /note="Signal peptide predicted for SAS0257 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.787 between residues 27 and 28"
FT   CDS_pept        304364..304657
FT                   /transl_table=11
FT                   /locus_tag="SAS0258"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0279"
FT                   /db_xref="GOA:Q6GCJ0"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCJ0"
FT                   /protein_id="CAG42029.1"
FT                   /translation="MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEG
FT                   QAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ"
FT   misc_feature    304364..304630
FT                   /note="Pfam match to entry PF06013 DUF909, Bacterial
FT                   protein of unknown function (DUF909), score 155.6, E-value
FT                   8.7e-44"
FT   CDS_pept        304740..307769
FT                   /transl_table=11
FT                   /locus_tag="SAS0259"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0280"
FT                   /db_xref="GOA:Q6GCI9"
FT                   /db_xref="InterPro:IPR023838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCI9"
FT                   /protein_id="CAG42030.1"
FT                   /translation="MKKKNWIYALIVTLIIIIAIVSMIFFVQTKYGDQSEKGSRSVSNK
FT                   NNKIHIAIVNEDQPTTYNGKKVELGQAFIKRLANEKNYKFETVTRNVAESGLKNGGYQV
FT                   MIVIPENFSKLAMQLDAKTPSKISLQYKTAVGQKEEVAKNTEKVVSNVLNDFNKNLVEI
FT                   YLTSIIDNLHNAQKNVGAIMTREHGVNSKFSNYLLNPINDFPELFTDTLVNSISANKDI
FT                   TKWFQTYNKSLLSANSDTFRVNTDYNVSTLIEKQNSLFDEHNTAMDKMLQDYKSQKDSV
FT                   ELDNYINALKQMDSQIDQQSSMQDTGKEEYKQTVKENLDKLREIIQSQESPFSKGMIED
FT                   YRKQLTESLQDELANNKDLQDALNSIKMNNAQFAENLEKQLHDDIVKEPDTDTTFIYNM
FT                   SKQDFIAAGLNEDEANKYEAIVKEAKRYKNEYNLKKPLAEHINLTDYDNQVAQDTSSLI
FT                   NDGVKVQRTETIKSNDINQLTVATDPHFNFEGDIKINGKKYDIKDQSVQLDTSNKEYKV
FT                   EVNGVAKLKKDAEKDFLKDKTMHLQLLFGQANRQDEPNDKKTTSVVDVTLNHNLDGRLS
FT                   KDALSQQLSALSRFDAHYKMYTDTKGREDKPFDNKRLIDMMVDQVINDMESFKDDKVAV
FT                   LHQIDSMEENSDKLIDDILNNKKNTTKNKEDISKLIDQLENVKKTFAEEPQEPKIDKGK
FT                   NDEFNTMSSNLDKEISRISEKSTQLLSDTQESKTIADSVSGQLNQLDNNVNKLHATGRA
FT                   LGVRANDLNRQMAKNDKDNELFAKEFKKVLQNSKDGDRQNQALKAFMSNPVQKKNLENV
FT                   LANNGNTDVISPTLFVLLMYLLSMITAYIFYSYERAKGQMNFIKDDYSSKNHLWNNVIT
FT                   SGVIGTTGLVEGLIVGLIAMNKFHVLAGYRAKFILMVILTMMVFVLINTYLLRQVKSIG
FT                   MFLMIAALGLYFVAMNNLKAAGQGVTNKISPLSYIDNMFFNYLNAEHPIGLALVILTVL
FT                   VIIGFVLNMFIKHFKKERLI"
FT   misc_feature    304740..304820
FT                   /note="Signal peptide predicted for SAS0259 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.983) with cleavage site
FT                   probability 0.605 between residues 27 and 28"
FT   misc_feature    order(304752..304820,307200..307268,307329..307397,
FT                   307440..307508,307521..307574,307671..307739)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SAS0259 by TMHMM2.0 at aa 5-27, 821-843, 864-886, 901-923,
FT                   928-945 and 978-1000"
FT   CDS_pept        307769..308227
FT                   /transl_table=11
FT                   /locus_tag="SAS0260"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0281"
FT                   /db_xref="GOA:Q6GCI8"
FT                   /db_xref="InterPro:IPR018920"
FT                   /db_xref="InterPro:IPR034026"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCI8"
FT                   /protein_id="CAG42031.1"
FT                   /translation="MLMNSVIALTFLTASSNNGGLNIDVQQEEEKRINNDLNQYDTTLF
FT                   NKDSKAVNDAIAKQKKERQQQIKNDMFQNQASHSTRLNETKKVLFSKSNLEKTSESDKS
FT                   PYIQNKQEKKIFPYILMSVGAFLTLGFVIFSIHKGRRTKNESARKSNI"
FT   misc_feature    308111..308179
FT                   /note="1 probable transmembrane helix predicted for SAS0260
FT                   by TMHMM2.0 at aa 115-137"
FT   CDS_pept        308199..308441
FT                   /transl_table=11
FT                   /locus_tag="SAS0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0282"
FT                   /db_xref="GOA:Q6GCI7"
FT                   /db_xref="InterPro:IPR014921"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCI7"
FT                   /protein_id="CAG42032.1"
FT                   /translation="MNQHVKVTFDFTNYNYGTYDLAVPAYLPIKNLIALVLDSLDISIF
FT                   DVNTQIKVMTKGQLLVENDRLIDYQIADGDILKLL"
FT   CDS_pept        308454..309788
FT                   /transl_table=11
FT                   /locus_tag="SAS0262"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0283"
FT                   /db_xref="GOA:Q6GCI6"
FT                   /db_xref="InterPro:IPR018778"
FT                   /db_xref="InterPro:IPR042565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCI6"
FT                   /protein_id="CAG42033.1"
FT                   /translation="MVKNHNPKNEMQDMLTPLDAEEAAKTKLRLDMREIPKSSIKPEHF
FT                   HLMYLLEQHSPYFIDAELTELRDSFQIHYDINDNHTPFDNIKSFTKNEKLRYLLNIKNL
FT                   EEVNRTRYTFVLAPDELFFTRDGLPIAKTRGLQNVVDPLPVSEAEFLTRYKALVICAFN
FT                   EKQSFDALVEGNLELHKGTPFETKVIEAATLDLLTAFLDEQYQKQEQDYSQNYAYVRKV
FT                   GHTVFKWVAIGMTTLSVLLIAFLAFLYFSVMKHNERIEKGYQAFVKDDYTQVLNTYDDL
FT                   DGKKLDKEALYIYAKSYIQTNKQGLEKDKKENLLNNVTPNSNKDYLLYWMELGQGHLDE
FT                   AINIATYLDDNDITKLALINKLNEIKNNGDLSNDKRSEETKKYNDKLQDILDKEKQVKD
FT                   EKAKSEEEKAKAKDEKLKQQEENEKKQKEQAQKDKEKRQEAERKK"
FT   misc_feature    309138..309206
FT                   /note="1 probable transmembrane helix predicted for SAS0262
FT                   by TMHMM2.0 at aa 229-251"
FT   CDS_pept        309810..314249
FT                   /transl_table=11
FT                   /locus_tag="SAS0263"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0284"
FT                   /db_xref="GOA:Q6GCI5"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022206"
FT                   /db_xref="InterPro:IPR023839"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCI5"
FT                   /protein_id="CAG42034.1"
FT                   /translation="MHKLIIKYNKQLKMLNLRDGKTYTISEDERADITLKSLGEVIHLE
FT                   QNNQGTWQANHTSINKVLVRKGDLDDITLQLYTEADYASFAYPSIQDTMTIGPNAYDDM
FT                   VIQSLMNAIIIKDFQSIQESQYVRIVHDKNTDVYINYELQEQLTNKAYIGDHIYVEGIW
FT                   LEVQADGLNVLSQNTVASSLIRLTQEMPHAQADDYNTYHRSPRIIHREPTDDIKIERPP
FT                   QPIQKNNTVIWRSIIPPLVMIALTVVIFLVRPIGIYILMMIGMSSVTIVFGITTYFSEK
FT                   KKYNKDVEKREKDYKDYLDNKSKEINKAIKAQRFSLNYHYPTVAEIKDIVETKAPRIYE
FT                   KTSHHHDFLHYKLGIANVEKSFKLDYQEEEFNQRRDELFDDAKELYEFYTDVEQAPLIN
FT                   DLNHGPIAYIGARHLILEELEKMLIQLSIFHSYHDLEFLFVTREDEVETLKWARWLPHM
FT                   TLRGQNIRGFVYNQRTRDQILTSIYSMIKERIQAVRERSKSNEQIIFTPQLVFVITDMS
FT                   LIIDHVILEYVNQDLSEYGISLIFVEDVIESLPEHVDTIIDIKSRTEGELITKEKELVQ
FT                   LKFTPENIDNVDKEYIARRLANLIHVEHLKNAIPDSITFLEMYNVKEVDQLDVVNRWRQ
FT                   NETYKTMAVPLGVRGKDDILSLNLHEKAHGPHGLVAGTTGSGKSEIIQSYILSLAINFH
FT                   PHEVAFLLIDYKGGGMANLFKDLVHLVGTITNLDGDEAMRALTSIKAELRKRQRLFGEH
FT                   DVNHINQYHKLFKEGIATEPMPHLFIISDEFAELKSEQPDFMKELVSTARIGRSLGIHL
FT                   ILATQKPSGVVDDQIWSNSKFKLALKVQDRQDSNEILKTPDAADITLPGRAYLQVGNNE
FT                   IYELFQSAWSGATYDIEGDKLEVEDKTIYMINDYGQLQAINKDLSGLEDEETKENQTEL
FT                   EAVIDHIESITTRLEIEEVKRPWLPPLPENVYQEDLVETDFRKLWSDDAKEVELTLGLK
FT                   DVPEEQYQGPMVLQLKKAGHIALIGSPGYGRTTFLHNIIFDVARHHRPDQAHMYLFDFG
FT                   TNGLMPVTDIPHVADYFTVDQEDKIAKAIRIFNDEIDRRKKILSQYRVTSISEYRKLTG
FT                   ETIPHVFILIDNFDAVKDSPFQEVFENMMIKMTREGLALDMQVTLTASRANAMKTPMYI
FT                   NMKTRIAMFLYDKSEVSNVVGQQKFAVKDVVGRALLSSDDNVSFHIGQPFKHDETKSYN
FT                   DQINDEVSAMTEFYKGETPSDIPMMPDEIKYEDYRESLSLPDIVANGALPIGLDYEGVT
FT                   LQKIKLTEPAMISSENPREIAHIAEIMMKEIDILNEKYAICIADSSGEFKAYRHQVANF
FT                   AEEREDIKAIHQLMIEDLKQREMDGPFEKDSLYIINDFKTFIDCTYIPEDDVKKLITKG
FT                   PELGLNILFVGIHKELIDAYDKQIDVARKMINQFSIGIRISDQQFFKFRFIQREPVIKE
FT                   NEAYMVANQAYQKIRWFK"
FT   misc_feature    order(310497..310565,310578..310646)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SAS0263 by TMHMM2.0 at aa 230-252 and 257-279"
FT   misc_feature    311691..312272
FT                   /note="Pfam match to entry PF01580 FtsK_SpoIIIE,
FT                   FtsK/SpoIIIE family, score 145.0, E-value 1.4e-40"
FT   misc_feature    311823..311846
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    312717..313286
FT                   /note="Pfam match to entry PF01580 FtsK_SpoIIIE,
FT                   FtsK/SpoIIIE family, score 110.5, E-value 3.5e-30"
FT   CDS_pept        314279..314671
FT                   /transl_table=11
FT                   /locus_tag="SAS0264"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="GOA:Q6GCI4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCI4"
FT                   /protein_id="CAG42035.1"
FT                   /translation="MNFNDIETMVKSKFKDIKKHAEEIAHEIEVRSGYLRKAEQYKRLE
FT                   FNLSFALDDIESTAKDVQTAKTSANKDSVTVKGKAPNTLYIEKRNLMKQKLEMLGEDID
FT                   KNKESLQKAKEIAGEKASEYFNKAMN"
FT   misc_feature    314279..314515
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT   CDS_pept        314687..315001
FT                   /transl_table=11
FT                   /locus_tag="SAS0265"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Listeria monocytogenes hypothetical
FT                   protein lmo0063 SWALL:Q8YAQ4 (EMBL:AL591973) (99 aa) fasta
FT                   scores: E(): 0.01, 22.91% id in 96 aa, and to Listeria
FT                   innocua hypothetical protein lin0056 SWALL:Q92FP7
FT                   (EMBL:AL596163) (99 aa) fasta scores: E(): 0.014, 22.91% id
FT                   in 96 aa"
FT                   /db_xref="GOA:Q6GCI3"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCI3"
FT                   /protein_id="CAG42036.1"
FT                   /translation="MGGYKGIKADGGKVDQAKQLAAKTAKDIEACQKQTQQLAEYIEGS
FT                   DWEGQFANKVKDVLLIMAKFQEELVQPIADHQKAIDNLSQNLAKYDTLSIKQGLDRVNP
FT                   "
FT   CDS_pept        314998..315675
FT                   /transl_table=11
FT                   /locus_tag="SAS0266"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Listeria monocytogenes hypothetical
FT                   protein lmo0064 SWALL:Q8YAQ3 (EMBL:AL591973) (233 aa) fasta
FT                   scores: E(): 0.066, 22.89% id in 214 aa, and to Listeria
FT                   innocua hypothetical protein lin0057 SWALL:Q92FP6
FT                   (EMBL:AL596163) (233 aa) fasta scores: E(): 0.39, 21.69% id
FT                   in 212 aa"
FT                   /protein_id="CAG42037.1"
FT                   /translation="MMKDVKRIDYFSYEELTILGGSKLPLVNFELFDPSNFEEAKAALI
FT                   EKELVTENDKLTDAGFKVATLVREYISAIVNIRINDMYFAPFSYEKDEYILLSRFKNNG
FT                   FQIRIINKDIAWWSIVQSYPLLMRQEKSNDWDFKQIDDETLENLNNESIDTIGRVLEIE
FT                   IYNHQGDPQQSLYNIYEQNDLLLIRYPLKDKVLNVHIGVINTFIRELFGFNTDENHINK
FT                   AEE"
FT   CDS_pept        315675..315992
FT                   /transl_table=11
FT                   /locus_tag="SAS0267"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAG42038.1"
FT                   /translation="MTLSGKISVKAETIAHVVKELESISQKYDEIAQNFGKIAQLNYYS
FT                   SEKASHSMENGYSSAATVISGLKGPLSTLGGGVMNSAQKFFEADEHWGTEFAKLYYNIE
FT                   G"
FT   CDS_pept        316002..317846
FT                   /transl_table=11
FT                   /locus_tag="SAS0268"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to Listeria monocytogenes
FT                   hypothetical protein lmo0066 SWALL:Q8YAQ1 (EMBL:AL591973)
FT                   (604 aa) fasta scores: E(): 2.1e-11, 22.54% id in 630 aa"
FT                   /protein_id="CAG42039.1"
FT                   /translation="MTKDIEYLTADYDNEKSSIQSVIDAIEGQDFLDVDTTMDDAVSDV
FT                   SSLDEDGAISLTSSVVGPQGSKLMGYYQNELYDYASQLDSKMKEIIDTPFIEDIDKAFK
FT                   GITNVKLENILIKNGGGHGRDTYGASGKIAKGDAKKSDSDVYSIDEILKSDQEFVKVID
FT                   QHYKEMKKEDKKLSKSDFEKMMTQGASCDYMTVAEAEELEEQKKKEEAIEIAALAGMVV
FT                   LSCINPVAGAVAIGAYSAYSAANAATGKNIVTGRKLSKEERIMEGLSLIPLPGMGFLKG
FT                   AGKSLMKLGFKGGEKFAVKTGLQKTMQQAVSRISPKMGMMKNSVLNQSRNFAQNTHVGQ
FT                   MLSNMRGQATHTVQQSRNWIGQQAQNVKRIVNNGLDKEIAHPFKQQLAPAGMGGIKFAE
FT                   TTTLRNMGQNMKRAVTPQNHVTHGPKDSMVRSEGKHSVSSHEINSSKYVESPNYTKVEF
FT                   GEHYARLRPKKLKANIEYTTPTGHIYRTDHKGRIKEVYVDNLSLKDGGRNNHAQRTVGG
FT                   EDRLPDDDGGHLIARMFGGSKDIDNLVAQSKFINRSFKENGQWYKLEKLWEKAIKSGKS
FT                   IENVKVEVKYKGNSQRPTEFSVRYNINGEQFLKNIINK"
FT   CDS_pept        317857..318351
FT                   /transl_table=11
FT                   /locus_tag="SAS0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0293"
FT                   /protein_id="CAG42040.1"
FT                   /translation="MTFEEKLSQMYNEIANKISSMIPVEWEKVYAMAYIDDEGGEVFYY
FT                   YTEPGSNELYYYTSVLNKYDISESEFMDSAYELYKQFQKLRNIFKKEGHEPWTSCEFDF
FT                   TNEGKLKVSFDYIDWINTEFDQLGRQNYYMYKKFGVIPEMEYEMEEVKQIEQYIKEQEE
FT                   E"
FT   misc_feature    317863..318315
FT                   /note="Pfam match to entry PF04634 DUF600, Protein of
FT                   unknown function, DUF600, score 356.6, E-value 2.8e-104"
FT   CDS_pept        318562..319245
FT                   /transl_table=11
FT                   /locus_tag="SAS0270"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAG42041.1"
FT                   /translation="MTTKENIDTLRKPGAQALSLISLFLILFSCLTFFFGLDYERFPNY
FT                   LKITTIIELIIIVISLLQWIRFIDFEKESTQKYKKIYARFLVIINVLTTITVVFALCNL
FT                   YYFAAVQNHYDLFNYWLMGTISIIISYLLLVIGGMFTLLKLPKVTKRWGGKTKTHFGLL
FT                   LTALSSFIYIEKIIEYILIPNVVESKFIIIVSMMVIAGAQFVAFQFIMQYSRFYIFELN
FT                   TEDDD"
FT   misc_feature    order(318604..318672,318691..318756,318814..318882,
FT                   318916..318984,319042..319110,319129..319197)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SAS0270 by TMHMM2.0 at aa 15-37, 44-65, 85-107, 119-141,
FT                   161-183 and 190-212"
FT   CDS_pept        319392..320003
FT                   /transl_table=11
FT                   /locus_tag="SAS0271"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAG42042.1"
FT                   /translation="MEFLLLIVVAGLYYIIYLTAVMYSEKIVVLPIIIYAIVFVVIGIT
FT                   YIFIGDSYDQLTNFNVILYMGSLFYAWMAFRNLWNRPLLLKYKNITDSSSGIVNKSEYN
FT                   SVESLRINIEIAKYKGIISLIVAIVLTVLMTLKSTPQITAETRDLSISFFILSLFIIII
FT                   FAVWDLIIRVRKGAFAFVVIRPILFSCWLFILNMILSRLV"
FT   misc_feature    order(319401..319454,319473..319541,319569..319628,
FT                   319749..319808,319836..319904,319923..319991)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SAS0271 by TMHMM2.0 at aa 4-21, 28-50, 60-79, 120-139,
FT                   149-171 and 178-200"
FT   misc_feature    319404..319454
FT                   /note="PS00251 TNF family signature."
FT   CDS_pept        320202..320702
FT                   /transl_table=11
FT                   /locus_tag="SAS0272"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="Similar to Bacillus cereus hypothetical cytosolic
FT                   protein bc3263 SWALL:Q813D5 (EMBL:AE017008) (173 aa) fasta
FT                   scores: E(): 8.5e-11, 31.41% id in 156 aa, and to the
FT                   C-terminal region of Bacillus subtilis hypothetical
FT                   cytosolic protein YeeE SWALL:O30580 (EMBL:AF012532) (369
FT                   aa) fasta scores: E(): 1.4e-11, 28.76% id in 146 aa"
FT                   /protein_id="CAG42043.1"
FT                   /translation="MTFEEKLNEMYNEIANKISSMIPVEWAKVYAMAYIDEESGEVFFN
FT                   YTEPRSDELFYYTSVIKKYNISRSGFMNSVYELHDQFEKLRELFIEEGHEPWTSCEFDF
FT                   TKEGKLKVSFDYIDWLNTEFDQLGRENYYMYKKFGVIPEMEYEMEEIKEIEQYIKEQDE
FT                   AEQ"
FT   misc_feature    320208..320660
FT                   /note="Pfam match to entry PF04634 DUF600, Protein of
FT                   unknown function, DUF600, score 339.7, E-value 3.5e-99"
FT   CDS_pept        320713..321213
FT                   /transl_table=11
FT                   /locus_tag="SAS0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacillus halodurans hypothetical protein
FT                   bh3703 SWALL:Q9K6M5 (EMBL:AP001519) (169 aa) fasta scores:
FT                   E(): 2e-07, 30.06% id in 163 aa, and to the C-terminal
FT                   region of Bacillus subtilis hypothetical protein YeeE
FT                   SWALL:O30580 (EMBL:AF012532) (369 aa) fasta scores: E():
FT                   5.8e-11, 30.13% id in 146 aa"
FT                   /protein_id="CAG42044.1"
FT                   /translation="MTFEEKQSEMYNKIANEISGMIPVEWEKVYTIAYVDNQGGEVIFN
FT                   YTKPGSEELNYYSDIPKDCNVSNDIFMDLWMKVYRMFDELRETFKKEGHEPWTSCEFDF
FT                   TRDGKLKVSFDYIDWLNTEFDQLSLENYYMYKKFEVIPEMEYKMEEIKEIEQYIKEQEE
FT                   AEI"
FT   misc_feature    320719..321171
FT                   /note="Pfam match to entry PF04634 DUF600, Protein of
FT                   unknown function, DUF600, score 306.8, E-value 2.8e-89"
FT   CDS_pept        321224..321724
FT                   /transl_table=11
FT                   /locus_tag="SAS0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0294"
FT                   /note="Similar to Bacillus cereus hypothetical cytosolic
FT                   protein bc3263 SWALL:Q813D5 (EMBL:AE017008) (173 aa) fasta
FT                   scores: E(): 2.8e-13, 36.02% id in 161 aa, and to the
FT                   C-terminal region of Bacillus subtilis hypothetical protein
FT                   YeeE SWALL:O30580 (EMBL:AF012532) (369 aa) fasta scores:
FT                   E(): 3.5e-13, 32.85% id in 140 aa"
FT                   /protein_id="CAG42045.1"
FT                   /translation="MTFEEKLNEMYNEISNKISSMIPVEWEKVYTMAYIDDGGGEVFFN
FT                   YTKPNSDELNYYTDIPKEYNISVQVFDDLWMDLYDLFEELRNLFKEEGLEPWTSCEFDF
FT                   TREGTLNVSFDYIDWVNTEFDQLGRENYYMYKKFGVIPEMEYEMKEIKEIEQYIKEQDE
FT                   AEI"
FT   misc_feature    321230..321682
FT                   /note="Pfam match to entry PF04634 DUF600, Protein of
FT                   unknown function, DUF600, score 354.6, E-value 1.1e-103"
FT   CDS_pept        321735..322235
FT                   /transl_table=11
FT                   /locus_tag="SAS0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacillus cereus hypothetical cytosolic
FT                   protein bc3263 SWALL:Q813D5 (EMBL:AE017008) (173 aa) fasta
FT                   scores: E(): 4e-10, 30.51% id in 154 aa, and to the
FT                   C-terminal region Bacillus subtilis hypothetical protein
FT                   YeeE SWALL:O30580 (EMBL:AF012532) (369 aa) fasta scores:
FT                   E(): 3.5e-09, 27.33% id in 150 aa"
FT                   /protein_id="CAG42046.1"
FT                   /translation="MAFEEKLNEMYNEIANKISSMIPVEWETVYAMAYVNERSGEVFYN
FT                   YTEPSSDELFYYTSVLNKYNIPRSEFMDSVYELYKQFDNLRELFIEEGLEPWTSCEFDF
FT                   TRDGKLNVSFDYIDWVNSEFGPMGREHYYMYKKFGIWPEKEYAINWVKKIKDYVKEQDE
FT                   AEL"
FT   misc_feature    321741..322193
FT                   /note="Pfam match to entry PF04634 DUF600, Protein of
FT                   unknown function, DUF600, score 343.8, E-value 2e-100"
FT   CDS_pept        322246..322746
FT                   /transl_table=11
FT                   /locus_tag="SAS0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacillus cereus hypothetical cytosolic
FT                   protein bc3263 SWALL:Q813D5 (EMBL:AE017008) (173 aa) fasta
FT                   scores: E(): 1e-10, 33.11% id in 154 aa, and to the
FT                   C-terminal region of Bacillus subtilis hypothetical protein
FT                   YeeE SWALL:O30580 (EMBL:AF012532) (369 aa) fasta scores:
FT                   E(): 9.4e-11, 30.71% id in 140 aa"
FT                   /protein_id="CAG42047.1"
FT                   /translation="MTFEEKLSQMYNEIANKISSMIPVEWEKVYTIAYVDDQGGEVIFN
FT                   YTKPESEDLNYYTDISRDYNISEEIFDDLWMNLYYLFMNLRDLFKKEGLEPWTSCEFDF
FT                   TREGNLKVSFDYIDWIKLGFGPSGKENYYMYKKFGVIPETEYEINKVKEIEQFIKEQDE
FT                   AEL"
FT   misc_feature    322252..322704
FT                   /note="Pfam match to entry PF04634 DUF600, Protein of
FT                   unknown function, DUF600, score 334.5, E-value 1.2e-97"
FT   CDS_pept        322757..323257
FT                   /transl_table=11
FT                   /locus_tag="SAS0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacillus cereus hypothetical cytosolic
FT                   protein bc3263 SWALL:Q813D5 (EMBL:AE017008) (173 aa) fasta
FT                   scores: E(): 2.8e-14, 37.01% id in 154 aa, and to the
FT                   C-terminal region of Bacillus subtilis hypothetical protein
FT                   YeeE SWALL:O30580 (EMBL:AF012532) (369 aa) fasta scores:
FT                   E(): 3.3e-12, 32.14% id in 140 aa"
FT                   /protein_id="CAG42048.1"
FT                   /translation="MTFEEKLSQMYNEIANKISSMIPVEWEKVYTIAYVDDQGGEVVFN
FT                   YTKPGSEDLNYYTYIPREYNVSEKVFYDLWTDLYRLFKKLRNAFKEEDLEPWTSCEFDF
FT                   TRDGKLNVVFDYVDWMNSEFGPSGKENYYMYKKFGVLPETEYEINKVKEIEQYIKEQDE
FT                   AEL"
FT   misc_feature    322763..323215
FT                   /note="Pfam match to entry PF04634 DUF600, Protein of
FT                   unknown function, DUF600, score 346.5, E-value 3e-101"
FT   CDS_pept        323268..323768
FT                   /transl_table=11
FT                   /locus_tag="SAS0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacillus cereus hypothetical cytosolic
FT                   protein bc3263 SWALL:Q813D5 (EMBL:AE017008) (173 aa) fasta
FT                   scores: E(): 1.3e-10, 33.11% id in 154 aa, and to the
FT                   C-terminal region of Bacillus subtilis YeeE SWALL:O30580
FT                   (EMBL:AF012532) (369 aa) fasta scores: E(): 3.1e-11, 31.42%
FT                   id in 140 aa"
FT                   /protein_id="CAG42049.1"
FT                   /translation="MTFEEKLSQMYNEIADEISGMIPVEWENIYTIAYVTDQGGEVIFN
FT                   YTKPGSDELNYYTDISRDYNISEEIFDDLWMNLYYLFMNLRDLFKKEGLEPWTSCEFDF
FT                   TSEGKLKVSFDYIDWINTEFDQLGRENYYMYKKFGVLPEMEYEINKVKEIEQYIKEQDE
FT                   AEL"
FT   misc_feature    323274..323726
FT                   /note="Pfam match to entry PF04634 DUF600, Protein of
FT                   unknown function, DUF600, score 329.3, E-value 4.6e-96"
FT   CDS_pept        323779..324267
FT                   /transl_table=11
FT                   /locus_tag="SAS0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0297"
FT                   /note="Similar to Bacillus cereus hypothetical cytosolic
FT                   protein bc3263 SWALL:Q813D5 (EMBL:AE017008) (173 aa) fasta
FT                   scores: E(): 1.8e-12, 33.33% id in 156 aa, and to the
FT                   C-terminal region of Bacillus subtilis YeeE SWALL:O30580
FT                   (EMBL:AF012532) (369 aa) fasta scores: E(): 1.4e-11, 29.45%
FT                   id in 146 aa"
FT                   /protein_id="CAG42050.1"
FT                   /translation="MTFEEKLSQMYNEIANEISGMIPVEWEKVYTIAYVDDEGGEVVFN
FT                   YTKPGSDELNYYTYIPREYNVSEKVFYDLWTDLYRLFKKLRNAFKEEDLEPWTSCEFDF
FT                   TREGNLKVSFDYIDWIKLGFGPSGKENYYMYKKFGVLPETEYEMEEIREVEKYVKDQE"
FT   misc_feature    323785..324237
FT                   /note="Pfam match to entry PF04634 DUF600, Protein of
FT                   unknown function, DUF600, score 353.9, E-value 1.8e-103"
FT   CDS_pept        324892..325266
FT                   /transl_table=11
FT                   /locus_tag="SAS0280"
FT                   /product="putative lipoprotein"
FT                   /note="Poor database matches. Weakly similar to Clostridium
FT                   tetani hypothetical protein ctc00500 SWALL:Q898F5
FT                   (EMBL:AE015937) (145 aa) fasta scores: E(): 0.27, 26.98% id
FT                   in 126 aa"
FT                   /protein_id="CAG42051.1"
FT                   /translation="MKRILVVFLMLAIILAGCSNKGEKYQKDIDKVYKEQNQMNKIASK
FT                   VQNTIKTDIKQEDSNTHVYKDGKVIVIGIQLYKDREKMYYFAYEIKDGKAEINREIDPI
FT                   KYMKDHKADYEDENVEVEKD"
FT   misc_feature    324892..324966
FT                   /note="Signal peptide predicted for SAS0280 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.991) with cleavage site
FT                   probability 0.440 between residues 25 and 26"
FT   misc_feature    324913..324945
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        325416..325814
FT                   /transl_table=11
FT                   /locus_tag="SAS0281"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0301"
FT                   /protein_id="CAG42052.1"
FT                   /translation="MEKSIKIMTIIGIVIQGLATVFSLLLMVLAASGVMTTDVSTTVNG
FT                   EVDPVDAETAAAIFTVLFLFLFIFGIISIILGAIGMFKASKNKKMSGILLIIGAVISGN
FT                   IITFALWLVSGIKLLTNNKPKDEISDLS"
FT   misc_feature    325416..325505
FT                   /note="Signal peptide predicted for SAS0281 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.456 between residues 30 and 31"
FT   misc_feature    order(325434..325502,325584..325652,325686..325754)
FT                   /note="3 probable transmembrane helices predicted for
FT                   SAS0281 by TMHMM2.0 at aa 7-29, 57-79 and 91-113"
FT   CDS_pept        complement(326064..326888)
FT                   /transl_table=11
FT                   /locus_tag="SAS0282"
FT                   /product="putative formate/nitrite transporter"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0302"
FT                   /protein_id="CAG42053.1"
FT                   /translation="MKEKHIKWDKIFYGDDWVNNVVETIRTKDILQSVYLKRYLLRAMM
FT                   AGFIIGIITVFVLSVKATHEPDLPPGIVNMASAITFSFALVLILFTNSELLTSNFMYFT
FT                   VGLYYKVIKPTRVLKIFLLCFAGNILGAAILFSFMRFSNVMTPDMLNQLSAVIEHKTLS
FT                   TGFVSILMKAIFANFFINISLVIAMQIDDVLAKMFVMMFGVTIFAFMGYEHVVYNSCLF
FT                   MGGLIYQVDTLHFIPAISNIAAAFIGNYIGGGLIIGLFYAYLNDHHQFYKNN"
FT   misc_feature    complement(326085..326831)
FT                   /note="Pfam match to entry PF01226 Form_Nir_trans,
FT                   Formate/nitrite transporter, score 57.4, E-value 3.2e-14"
FT   misc_feature    complement(order(326097..326165,326241..326309,
FT                   326328..326396,326472..326540,326598..326666,
FT                   326709..326777))
FT                   /note="6 probable transmembrane helices predicted for
FT                   SAS0282 by TMHMM2.0 at aa 38-60, 75-97, 117-139, 165-187,
FT                   194-216 and 242-264"
FT   CDS_pept        complement(327127..328434)
FT                   /transl_table=11
FT                   /locus_tag="SAS0283"
FT                   /product="putative amino acid transport system"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0303"
FT                   /protein_id="CAG42054.1"
FT                   /translation="MKKQVIISGLMLFSLFFGAGNLIFPPMLGHTAGQNMWIGMLGFAL
FT                   TGILLPFITVIVVAFYDEGVESVGNRIHPWFGFIFAVVIYMSIGAFYGIPRAANVAYEI
FT                   GTRHILPVHNQWTLIIFAAIFFAIVYWISLNPSKIVDNLGKLLTPLLLLMVSLLSIAVI
FT                   FNPESALSAPKDKYITHPFISGSLEGYFTMDLVAALAFSVVIVNGYKFKGLTDRMKILK
FT                   YVCFSGLIAAILLGMIYFALAYVGASTAPGNFKDGTDILTYNSLRVFGSFGNLVFGMTV
FT                   ILACLTTCIGLVNACATFTKKHVPKFSYKIFALIFSIIGFLFTTLGLEMILKIAVPLLT
FT                   LIYPVSIALVLISFANMFSTFRFSWAYRLATVITLIISILQILNSFNLLHGVILKSFMM
FT                   LPLADIDLAWLVPFMLFAIIGFIIDVFIRRPKQATT"
FT   misc_feature    complement(order(327154..327213,327256..327324,
FT                   327361..327429,327439..327507,327544..327612,
FT                   327700..327768,327802..327870,327940..328008,
FT                   328042..328110,328153..328221,328258..328326,
FT                   328354..328422))
FT                   /note="12 probable transmembrane helices predicted for
FT                   SAS0283 by TMHMM2.0 at aa 5-27, 37-59, 72-94, 109-131,
FT                   143-165, 189-211, 223-245, 275-297, 310-332, 336-358,
FT                   371-393 and 408-427"
FT   misc_feature    complement(327154..328434)
FT                   /note="Pfam match to entry PF05525 Branch_AA_trans,
FT                   Branched-chain amino acid transport protein, score 785.4,
FT                   E-value 2.3e-233"
FT   misc_feature    complement(328342..328434)
FT                   /note="Signal peptide predicted for SAS0283 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.991) with cleavage site
FT                   probability 0.391 between residues 31 and 32"
FT   CDS_pept        329018..329908
FT                   /transl_table=11
FT                   /locus_tag="SAS0284"
FT                   /product="putative exported protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0304"
FT                   /protein_id="CAG42055.1"
FT                   /translation="MNKISKYIAIASLSVAVTVSAPQTTNSTAFAKSSAEVQQTQQASI
FT                   PASQKVNLGNQNIMAVAWYQNSAEAKALYLQGYNSAKVQLDKEIKKNKGKHKLAIALDL
FT                   DETVLDNSPYQGYASIHNKPFPEGWHEWVQAAKAKPVYGAKEFLKYADKKDVDIYYISD
FT                   RDKEKDLKATQKNLKQQGIPQAKKSHILLKGKDDKSKESRRQMVQKDHKLVMLFGDNLL
FT                   DFTDPKEATAESREALIEKHKDDFGKKYIIFPNPMYGSWEATIYNNNYKASDKAKDKLR
FT                   KNAIKQFDPKTGEVK"
FT   misc_feature    329018..329110
FT                   /note="Signal peptide predicted for SAS0284 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.972 between residues 31 and 32"
FT   misc_feature    329105..329800
FT                   /note="Pfam match to entry PF03767 acid_phosphat_B, HAD
FT                   superfamily, subfamily IIIB (Acid phosphatase), score
FT                   292.9, E-value 4.1e-85"
FT   CDS_pept        330158..331207
FT                   /transl_table=11
FT                   /locus_tag="SAS0285"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0305"
FT                   /protein_id="CAG42056.1"
FT                   /translation="MFLAWNEIRRNKLKFGLIIGVLTMISYLLFLLSGLANGLINMNKE
FT                   GIDKWQAEAIVLNKDANQTVQQSVFNKKDIENKYKKQATLKQTGEIVSNGHQKDNVLVF
FT                   GVEKSSFLVPSLIEGHKATKDNEVLADETLKNKGFKIGDTLSLSQSDEKLHIVGFTESA
FT                   KYNASPVIFTNDATIAKINPRLTGDKINAVVVRDTNWKDKKLNQELEAVSINDFIENLP
FT                   GYKPQNLTLNFMISFLFVISATVIGIFLYVMTLQKTSLFGILKAQGFTNGYLANVVISQ
FT                   TLILALFGTAFGLLLTGVTGAFLPDAVPVKFDVLTLLVFAIVLMIVSVLGSLFSILTIR
FT                   KIDPLKAIG"
FT   misc_feature    330158..330265
FT                   /note="Signal peptide predicted for SAS0285 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.775) with cleavage site
FT                   probability 0.505 between residues 36 and 37"
FT   misc_feature    order(330194..330262,330845..330913,330974..331042,
FT                   331100..331168)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SAS0285 by TMHMM2.0 at aa 13-35, 230-252, 273-295 and
FT                   315-337"
FT   misc_feature    330827..331198
FT                   /note="Pfam match to entry PF02687 FtsX, Predicted
FT                   permease, score 71.4, E-value 2.1e-18"
FT   CDS_pept        331220..331897
FT                   /transl_table=11
FT                   /locus_tag="SAS0286"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0306"
FT                   /protein_id="CAG42057.1"
FT                   /translation="MLKFENVTKSFKDGNRNIEAVKDTNFEINKGDIIALVGPSGSGKS
FT                   TFLTMAGALQTPTSGHILINNQDITTMKQKALAKVRMSEIGFILQATNLVPFLTVKQQF
FT                   TLLKKKNKNVMSNEDYQQLMSQLGLTSLLNKLPSEISGGQKQRVAIAKALYTNPSIILA
FT                   DEPTAALDTENAIEVIKILRDQAKQRKKACIIVTHDERLKAYCDRSYHMKDGVLNLENE
FT                   TVE"
FT   misc_feature    331310..331864
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 181.2, E-value 1.8e-51"
FT   misc_feature    331331..331354
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    331637..331681
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        332105..333136
FT                   /transl_table=11
FT                   /locus_tag="SAS0287"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0307"
FT                   /protein_id="CAG42058.1"
FT                   /translation="MDLLIGTLFLFLVLVIFTLFTYKAPNGMRAMGALANAAIATFLVE
FT                   AFNKYVGGEVFGIKFLEELGDAAGGLGGVAAAGLTALAIGVSPVYALVIAAACGGMDLL
FT                   PGFFAGYMIGYVMKYTEKYVPDGVDLIGSIVILAPLARLIAVLLTPVVNSTLIRIGDII
FT                   QSSTNTNPIIMGIILGGIITVVGTAPLSSMALTALLGLTGVPMAIGAMAAFSSAFMNGT
FT                   LFHRLKLGDRKSTIAVSIEPLSQADIVSANPIPIYITNFFGGAIAGLIIAMSGLINDAT
FT                   GTATPIAGFLVMFGFNHPTTIVIYGVVMAIVGALAGYLGSIVFKKYPIVTKQDMINRGA
FT                   VDA"
FT   misc_feature    332105..332215
FT                   /note="Signal peptide predicted for SAS0287 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.912) with cleavage site
FT                   probability 0.427 between residues 37 and 38"
FT   misc_feature    order(332114..332173,332192..332245,332303..332362,
FT                   332381..332449,332492..332560,332618..332677,
FT                   332690..332758,332864..332932,333008..333076)
FT                   /note="9 probable transmembrane helices predicted for
FT                   SAS0287 by TMHMM2.0 at aa 4-23, 30-47, 67-86, 93-115,
FT                   130-152, 172-191, 196-218, 254-276 and 302-324"
FT   CDS_pept        333479..334597
FT                   /transl_table=11
FT                   /locus_tag="SAS0288"
FT                   /product="PfkB family carbohydrate kinase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0308"
FT                   /protein_id="CAG42059.1"
FT                   /translation="MSDSEKEILKRIKDNPFISQRELAEAIGLSRPSVANIISGLIQKE
FT                   YVMGKAYVLNEDYPIVCIGAANVDRKFYVHKNLVAETSNPVTSTRSIGGVARNIAENLG
FT                   RLGETVAFLSASGQDSEWEMIKRLSTPFMNLDHVQQFENASTGSYTALISKEGDMTYGL
FT                   ADMEVFDYITPEFLIKRSHLLKKAKCIIVDLNLGKEALNFLCAYTTKHQIKLVITTVSS
FT                   PKMKNMPDSLHAIDWIITNKDETETYLNLKIESTDDLKIAAKRWNDLGVKNVIVTNGVK
FT                   ELIYRSGEEEIIKSVMPSNSVKDVTGAGDSFCAAVVYSWLNGMSTEDILIAGMVNAKKT
FT                   IETKYTVRQNLDQQQLYHDMEDYKNGKFTKVY"
FT   misc_feature    333530..333595
FT                   /note="Predicted helix-turn-helix motif for SAS0288 with
FT                   score 1997.000, SD 5.99 at aa 18-39, sequence
FT                   ISQRELAEAIGLSRPSVANIIS"
FT   misc_feature    333653..334537
FT                   /note="Pfam match to entry PF00294 pfkB, pfkB family
FT                   carbohydrate kinase, score 110.0, E-value 4.8e-30"
FT   misc_feature    333755..333829
FT                   /note="PS00583 pfkB family of carbohydrate kinases
FT                   signature 1."
FT   misc_feature    334388..334429
FT                   /note="PS00584 pfkB family of carbohydrate kinases
FT                   signature 2."
FT   CDS_pept        334572..335495
FT                   /transl_table=11
FT                   /locus_tag="SAS0289"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0309"
FT                   /protein_id="CAG42060.1"
FT                   /translation="MANLQKYIEYSREVQQALENNQPIVALESTIISHGMPYPQNVEMA
FT                   TTVEQIIRNNGAIPATIAIIDGKIKIGLESEDLEILATSKDVAKVSRRDLAEVVAMKCV
FT                   GATTVATTMICAAMAGIQFFVTGGIGGVHKGAEHTMDISADLEELSKTNVTVICAGAKS
FT                   ILDLPKTMEYLETKGVPVIGYQTNELPAFFTRESGVKLTSSVETPERLADIHLTKQQLN
FT                   LEGGIVVANPIPYEHALSKAYIEAIINEAVVEAENQGIKGKDATPFLLGKIVEKTNGKS
FT                   LAANIKLVENNAALGAKIAVAVNKLL"
FT   misc_feature    334605..335480
FT                   /note="Pfam match to entry PF04227 Indigoidine_A,
FT                   Indigoidine synthase A like protein, score 755.0, E-value
FT                   3.4e-224"
FT   misc_feature    334878..334946
FT                   /note="1 probable transmembrane helix predicted for SAS0289
FT                   by TMHMM2.0 at aa 103-125"
FT   CDS_pept        335506..336726
FT                   /transl_table=11
FT                   /locus_tag="SAS0290"
FT                   /product="putative nucleoside permease"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0310"
FT                   /protein_id="CAG42061.1"
FT                   /translation="MNILFAITGIAFALFVAFLFSFDRKNIDFKKTLIMIFIQVLIVLF
FT                   MMNTTIGLTILTALGSFFEGLINVSKAGINFVFGDIQNKNGFTFFLNVLLPLVFISVLI
FT                   GIFNYIKVLPFIIKYVGIAINKITRMGRLESYFAISTAMFGQPEVYLTIKDIIPRLSRA
FT                   KLYTIATSGMSAVSMAMLGSYMQMIEPKFVVTAVMLNIFSALIIASVINPYKSDDSDVE
FT                   IDNLTKSTETKSVNGKTGKPKKVAFFQMIGDSAMDGFKIAVVVAVMLLAFISLMEAINI
FT                   MFGSVGLNFKQLIGYVFAPIAFLMGIPWSEAVPAGSLMATKLITNEFVAMLDFKNVLGD
FT                   VSARTQGIISVYLVSFANFGTVGIIVGSIKGISDKQGEKVASFAMRLLLGSTLASIISG
FT                   SIIGLVL"
FT   misc_feature    335506..335568
FT                   /note="Signal peptide predicted for SAS0290 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.611) with cleavage site
FT                   probability 0.269 between residues 21 and 22"
FT   misc_feature    335506..336723
FT                   /note="Pfam match to entry PF01773 Nucleoside_tra2, Na+
FT                   dependent nucleoside transporter, score 427.9, E-value
FT                   9.7e-126"
FT   misc_feature    order(335515..335571,335605..335673,335767..335835,
FT                   336079..336138,336295..336363,336382..336450,
FT                   336544..336612,336649..336717)
FT                   /note="8 probable transmembrane helices predicted for
FT                   SAS0290 by TMHMM2.0 at aa 4-22, 34-56, 88-110, 192-211,
FT                   264-286, 293-315, 347-369 and 382-404"
FT   CDS_pept        complement(336832..338364)
FT                   /transl_table=11
FT                   /locus_tag="SAS0291"
FT                   /product="sodium:solute symporter family protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0311"
FT                   /protein_id="CAG42062.1"
FT                   /translation="MKEIGFGTLNWVAVIIYLLAMLFIGVYFTKRASQSTNSFFTASGR
FT                   LPSWVVGFSIYATTLSAITFMSTPEKAFLTDWSYIAGNIAIVAIIPLLIYFYVPFFKKL
FT                   KVTSAYEYLEARFGPSIRVIGSLLFVVYHLGRVAIVIYLPTLAITSVSDMNPYIVASLV
FT                   GLLCILYTFLGGFEGVVWSDFIQGVILLGGALVIIILGVMNIKGGFGTVFADAIEHKKL
FT                   ISADNWKLNTAAAAIPIIFLGNIFNNLYQYTASQDVVQRYQASDSLKETNKSLWTNGIL
FT                   ALISAPLFYGMGTMLYSFYTHEAVLPKGFNTSSVVPYFILTEMPPFVAGLLIAAIFAAA
FT                   QSTISSSLNSISACISIDIKQRFFGKGSERHEVNFARFIIIIAGIFGFGMSLYLIASNS
FT                   NDLWDLFLFVTGLFGVPLAGVFAVGIFTKRTNTFGVICGLILGIIFAYVYNGVGKGNSP
FT                   FYVSTISFTVAFVFAYILSFIVPSKHKKDITGLTIFEKDKPSTYISKMATKK"
FT   misc_feature    complement(order(336922..336990,337018..337071,
FT                   337084..337152,337180..337248,337348..337416,
FT                   337474..337542,337603..337671,337750..337806,
FT                   337825..337893,337936..338004,338065..338133,
FT                   338161..338229,338287..338355))
FT                   /note="13 probable transmembrane helices predicted for
FT                   SAS0291 by TMHMM2.0 at aa 4-26, 46-68, 78-100, 121-143,
FT                   158-180, 187-205, 232-254, 275-297, 317-339, 373-395,
FT                   405-427, 432-449 and 459-481"
FT   misc_feature    complement(337039..338250)
FT                   /note="Pfam match to entry PF00474 SSF, Sodium:solute
FT                   symporter family, score 39.1, E-value 1.9e-10"
FT   CDS_pept        complement(338404..339285)
FT                   /transl_table=11
FT                   /locus_tag="SAS0292"
FT                   /product="putative N-acetylneuraminate lyase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0312"
FT                   /db_xref="GOA:Q6GCF6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005264"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCF6"
FT                   /protein_id="CAG42063.1"
FT                   /translation="MNKDLKGLYAALLVPFDENGQVNEQGLKQIAQNAIETEELDGLYV
FT                   NGSSGENFLLNTEQKKQVFKVAKEAVGDKVKLIAQVGSLDLNEAIELGKYATELGYDAL
FT                   SAVTPFYYPFTFEEIRDYYFDIIEATQNNMIIYAIPDLTGVNISIEQFSELFNHEKIVG
FT                   VKYTAPNFFLLERIRKAFPDKLILSGFDEMLVQATISGVDGAIGSTYNVNGRRARKIFD
FT                   LARQGQIQEAYQLQHDSNDIIETVLSMGIYPTLKEILRHRGIDAGLPKRPFKPFNEAHR
FT                   QTLDQLIAKYDL"
FT   misc_feature    complement(338410..339276)
FT                   /note="Pfam match to entry PF00701 DHDPS,
FT                   Dihydrodipicolinate synthetase family, score 306.4, E-value
FT                   3.5e-89"
FT   CDS_pept        339443..340303
FT                   /transl_table=11
FT                   /locus_tag="SAS0293"
FT                   /product="putative ROK family protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0313"
FT                   /protein_id="CAG42064.1"
FT                   /translation="MYYIAIDIGGTQIKSAVIDKQLNMFDYQQISTPDNKSELITDKVY
FT                   EIVTGYMKQYQLIQPVIGISSAGVVDEQKGEIVYAGPTIPNYKGTNFKRLLKSLSPYVK
FT                   VKNDVNAALLGELKLHQYQAERIFCMTLGTGIGGAYKNNQGHIDNGELHKANEVGYLLY
FT                   RPTENTTFEQRAATSALKKRMIAGGFTRSTHVPVLFEAAEEGDDIAKQILNEWAEDVAE
FT                   GIAQIQVMYDPGLILIGGGISEQGDNLIKYIEPKVAHYLPKDYVYAPIQTTKSKNDAAL
FT                   YGCLQ"
FT   misc_feature    339455..339982
FT                   /note="Pfam match to entry PF00480 ROK, ROK family, score
FT                   32.8, E-value 3.7e-09"
FT   CDS_pept        complement(340580..341380)
FT                   /transl_table=11
FT                   /locus_tag="SAS0294"
FT                   /product="putative transcription regulator"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0314"
FT                   /protein_id="CAG42065.1"
FT                   /translation="MKFENRVQRYQHLFTKTDKRIVNYIRQNGYSDAFSTINSLTHAIG
FT                   TSPATMTRFSHKLDYENFQDLKFNIQQEMTETVIENSPIIQRIHKYHQQIIQQTGEFID
FT                   NDIIQTFIDKLQSSRHILFAGLGSSGLSATEFYYRMIRMGLKGNVTTDSHLMKISASLL
FT                   SHSDMFIAMSNSGNTSELISAAEVAKSHGAYVVAITNFEGSKLTDCADLVLLTTDQSRN
FT                   TDHQFINTQIATLFLIDIVSYHLLENTNLSQTYQHTKSIILDNK"
FT   misc_feature    complement(340640..341047)
FT                   /note="Pfam match to entry PF01380 SIS, SIS domain, score
FT                   67.2, E-value 3.8e-17"
FT   misc_feature    complement(341180..341380)
FT                   /note="Pfam match to entry PF01418 HTH_6, Helix-turn-helix
FT                   domain, rpiR family, score 24.4, E-value 4.7e-07"
FT   CDS_pept        341521..342189
FT                   /transl_table=11
FT                   /locus_tag="SAS0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0315"
FT                   /db_xref="GOA:Q6GCF3"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCF3"
FT                   /protein_id="CAG42066.1"
FT                   /translation="MLPHGLIVSCQALPDEPLHSSFIMSKMALAAYEGGAVGIRANTKE
FT                   DILAIKETVDLPVIGIVKRDYNHSDVFITATSKEVDELIESQCEVIALDATLQQRPKET
FT                   LDELVSYIRTHAPNVEIMADIATVEEAKNAARLGFDYIGTTLHGYTSYTQGQLLYQNDF
FT                   QFLKDVLQSVDAKVIAEGNVITPDMYKRVMDLGVHCSVVGGAITRPKEITKRFVQVMED
FT                   "
FT   misc_feature    341590..342186
FT                   /note="Pfam match to entry PF04131 nanE, Putative
FT                   N-acetylmannosamine-6-phosphate epimerase, score 284.9,
FT                   E-value 1.1e-82"
FT   CDS_pept        complement(342320..343633)
FT                   /transl_table=11
FT                   /locus_tag="SAS0296"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0316"
FT                   /protein_id="CAG42067.1"
FT                   /translation="MNQYHSNAQQPSAWRFFVYSLVGILCFFIPFTINGNNTIFVDHVH
FT                   LAIRSIIGPLMPYVALIMILIGTALPIVRRTFMTSITNLVITLFKVAGAMIGIMYVFKI
FT                   GPSILFKANYGPFLFEKLMMPLSILIPVGAIALSLLVGYGLLEFVGVYMEPIMRPIFKT
FT                   PGKSAVDAVASFVGSYSLGLLITNRVYKQGMYNKREATIIATGFPTVSATFMIIVAKTL
FT                   GLMPHWNLYFWITLVITFVVTAITAWLPPITNESTEYYNGQEGEQEVAIEGSRLKTAYA
FT                   EAMKQNALTPSLVKNVWDNLKDGLEMTVGILPSILSIGFLGLIVANYTPFIDWLGYIFY
FT                   PFIYIFPIADQALLAKASAISIVEMFLPSLLVTKAAMSTKFVVGVVSVSAIIFFSALVP
FT                   CILATEIKIPVWKLIIIWFLRVALSLLITIPVALLIFG"
FT   misc_feature    complement(order(342329..342397,342425..342493,
FT                   342512..342580,342590..342643,342656..342724,
FT                   342878..342946,342965..343033,343076..343135,
FT                   343196..343264,343328..343396,343415..343483,
FT                   343541..343600))
FT                   /note="12 probable transmembrane helices predicted for
FT                   SAS0296 by TMHMM2.0 at aa 12-31, 51-73, 80-102, 124-146,
FT                   167-186, 201-223, 230-252, 304-326, 331-348, 352-374,
FT                   381-403 and 413-435"
FT   CDS_pept        344051..346123
FT                   /transl_table=11
FT                   /locus_tag="SAS0297"
FT                   /product="lipase precursor"
FT                   /EC_number="3.1.1.3"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0317"
FT                   /db_xref="GOA:Q6GCF1"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCF1"
FT                   /protein_id="CAG42068.1"
FT                   /translation="MLRGQEERKYSIRKYSIGVVSVLAATMFVVSSHEAQASEKTPTNA
FT                   AVQKETLNQPGEQGNAITSHQMQSGKQLDDMHKENGKSGTVTEGKDTLQLSKYQSTQNS
FT                   KTIRTQNDNQVKQDSERQGSKQSHQNNATNNTERQNDQVQNTHHAERNGSQSTTSQSND
FT                   VDKSQPSIPAQKVLPNHDKAAPTSTTPPSNDKTAPKSTKAQDATTDKHPNQQDTHQPAH
FT                   QIIDAKQDDTVRQSEQKPQVGDLSKHIDGQNSPEKPTDKNTDNKQLIKDALQAPKTRST
FT                   TNAAADAKKVRPLKANQVQPLNKYPVVFVHGFLGLVGDNAPALYPNYWGGNKFKVIEEL
FT                   RKQGYNVHQASVSAFGSNYDRAVELYYYIKGGRVDYGAAHAAKYGHERYGKTYKGIMPN
FT                   WEPGKKVHLVGHSMGGQTIRLMEEFLRNGNKEEIAYHKAHGGEISPLFTGGHNNMVASI
FT                   TTLATPHNGSQAADKFGNTEAVRKIMFALNRFMGNKYSNIDLGLTQWGFKQLPNESYID
FT                   YIKRVSKSKIWTSDDNAAYDLTLDGSAKLNNMTSMNPNITYTTYTGVSSHTGPLGYENP
FT                   DLGTFFLMDTTSRIIGHDAREEWRKNDGVVPVISSLHPSNQPFVNVTNDEPATRRGIWQ
FT                   VKPIIQGWDHVDFIGVDFLDFKRKGAELANFYTGIINDLLRVEATESKGTQLKAS"
FT   misc_feature    344051..344161
FT                   /note="Signal peptide predicted for SAS0297 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.935 between residues 37 and 38"
FT   misc_feature    344060..344140
FT                   /note="Pfam match to entry PF04650 YSIRK_signal, YSIRK type
FT                   signal peptide, score 47.5, E-value 3.2e-11"
FT   misc_feature    345203..345226
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    345266..345295
FT                   /note="PS00120 Lipases, serine active site."
FT   CDS_pept        complement(346365..347192)
FT                   /transl_table=11
FT                   /locus_tag="SAS0298"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0318"
FT                   /protein_id="CAG42069.1"
FT                   /translation="MTEIKDKVITKDAFALPYTIIKAKNQPTKGAIVYIHGGGLMFGKA
FT                   NDLSPQYIDILTEHYDLIQLSYRLLPEVSLDCIIEDVYASFDAIQSQYSNCPIFTFGRS
FT                   SGAYLSLLIARDRDIDGVIDFYGYSRINTEPFKTTNSYYAKIAQSVNETMIAQLTSPTP
FT                   VVQDQIAQRFLIYVYARGTGKWINMINIADYTDSKYNIAPDELKTLPPVFIAHCNGDYD
FT                   VPVEESEHIMNHVPHSTFERVNKNEHDFDRRPNDEAITIYRKVVDFLNAITMM"
FT   CDS_pept        complement(347265..348464)
FT                   /transl_table=11
FT                   /locus_tag="SAS0299"
FT                   /product="NADH:flavin oxidoreductase / NADH oxidase family
FT                   protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0319"
FT                   /protein_id="CAG42070.1"
FT                   /translation="MYRYKPLLQSIHLPNGIKISNRFVLSPMTVNTSTKEGYITKEDLA
FT                   YAARRSNSAGMQVTGAAYIEPYGQLFEYGFNIDHDACIPGLTNMASTMKQHGSLAIIQL
FT                   AHAGRFSNQAILNFGKVYGPSPMTLHSPIEHDVIAMSHEKINSIIQQYRDATLRAIKAG
FT                   FDGVEISIAQRLLIQTFFSTFSNKRTDHYGADSLKNRARLCLEVMRAVQEVIDKEAPDN
FT                   FILGFRATPEETRGSDLGYTIDEFNQLIDWVMDVSNIQYLAIASWGRHIYQNTSRTPGD
FT                   HFGRPVNQIVYEHLAGRIPLIASGGINSPESALDALQHADMVGMSSPFVTEPDFVHKLA
FT                   EQRPHDINLEFSMADLEDLAIPHAAFKDIVKMMDYGEGLKKHTRDALRQLEQNYHDSSS
FT                   "
FT   misc_feature    complement(347427..348449)
FT                   /note="Pfam match to entry PF00724 oxidored_FMN,
FT                   NADH:flavin oxidoreductase / NADH oxidase family, score
FT                   175.0, E-value 1.3e-49"
FT   CDS_pept        348766..349767
FT                   /transl_table=11
FT                   /locus_tag="SAS0300"
FT                   /product="putative bacterial luciferase family protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0320"
FT                   /protein_id="CAG42071.1"
FT                   /translation="MVKLSVLDYALIDEGKDAQKALQDSVTLAKLADRLGFKRIWFTEH
FT                   HNVPAFACSSPELLMMHTLAQTNHIRVGSGGVMLPHYRPYKIAEHFRMMAALYPNRIDL
FT                   GIGNNPGTTMVKQALDGINPTYDSYDESISLLRDYLTIKDKPSAHTLGVQPHIDHFPEM
FT                   WLLSSSATSAKIAAELGIGLSVGTFLLPDINAIHAAKDNIDIYKKHFQASTIKMDAKVM
FT                   ASVFVIVADNEAEVAALQHALDVWLLGKLQFAEFEDFPSVDTAQKYKLNDRDKEMIQAH
FT                   QARIIAGTQEKVKAQLDDFIATFEVDEVLVAPLIPGIEQRCKTLKLLAEIYL"
FT   misc_feature    348769..349695
FT                   /note="Pfam match to entry PF00296 bac_luciferase,
FT                   Luciferase-like monooxygenase, score 57.0, E-value 4.4e-14"
FT   CDS_pept        349801..350133
FT                   /transl_table=11
FT                   /locus_tag="SAS0301"
FT                   /product="putative glycine cleavage H-protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0321"
FT                   /protein_id="CAG42072.1"
FT                   /translation="MKKLANYLWVEKVGDLYVFSMTPELQDDIGTVGYVEFVSPDEVKV
FT                   DDEIVSIEASKTVIDVQTPLSGTIIERNTKAEEEPTILNSEKPEENWLFKLDDVDKEAF
FT                   LALPEA"
FT   misc_feature    349801..350130
FT                   /note="Pfam match to entry PF01597 GCV_H, Glycine cleavage
FT                   H-protein, score -12.4, E-value 2.8e-07"
FT   CDS_pept        350134..350934
FT                   /transl_table=11
FT                   /locus_tag="SAS0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0322"
FT                   /db_xref="GOA:Q6GCE6"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="InterPro:IPR035801"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCE6"
FT                   /protein_id="CAG42073.1"
FT                   /translation="METLKSNKARLEYLINDMHRERNDNDVLVMPSSFEDLWELYRGLA
FT                   NVRPALPVSDEYLAVQDAMLSDLNRQHVTDLKDLKPIKGDNIFVWQGDITTLKIDAIVN
FT                   AANSRFLGCMQANHDCIDNIIHTKAGVQVRLDCAEIIRQQGRNEGVGKAKITRGYNLPA
FT                   KYIIHTVGPQIRRLPVSKMNQDLLAKCYLSCLKLADQHSLNHVAFCCISTGVFAFPQDE
FT                   AAEIAVRTVESYLKETNSTLKVVFNVFTDKDLQLYKEAFNRDAE"
FT   misc_feature    350440..350817
FT                   /note="Pfam match to entry PF01661 A1pp, Appr-1 -p
FT                   processing enzyme family, score 112.3, E-value 9.5e-31"
FT   CDS_pept        350921..351868
FT                   /transl_table=11
FT                   /locus_tag="SAS0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0323"
FT                   /protein_id="CAG42074.1"
FT                   /translation="MMQSSKWNAMSLLMDDKTKQAEVLRTAIDEADAIVIGIGAGMSAS
FT                   DGFTYVGERFTENFPDFIEKYRFFDMLQASLHPYGSWQEYWAFESRFITLNYLDQPVGQ
FT                   SYLALKSLVEGKQYHIITTNADNAFDVADYDMTHVFHIQGEYILQQCSQHCHAQTYRND
FT                   DLIRKMVVAQQDMLIPWEMIPRCPKCDAPMEVNKRKAEVGMVEDAEFHAQLHRYNAFLE
FT                   QHQDDKVLYLEIGIGYTTPQFVKHPFQRMTRKNENALYMTMNKKAYRIPNSIQERTIHL
FT                   TEDISTLITTALRNDSTTQNNNIGETKDVLNRTD"
FT   CDS_pept        351846..352868
FT                   /transl_table=11
FT                   /locus_tag="SAS0304"
FT                   /product="putative lipoate-protein ligase A"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0324"
FT                   /protein_id="CAG42075.1"
FT                   /translation="MYLIEPIRNGEYITDGAIALAMQVYVNQHIFLDEDILFPYYCDPK
FT                   VEIGRFQNTAIEVNQDYIDKHSIQVVRRDTGGGAVYVDKGAVNMCCILEQDTSIYGDFQ
FT                   RFYQPAIKALHTLGATDVIQSGRNDLTLNGKKVSGAAMTLMNNRIYGGYSLLLDVNYEA
FT                   MDKVLKPNRKKIASKGIKSVRARVGHLREALDEKYRGITIEEFKNLMVTQILGIDDIKE
FT                   AKRYELTDADWEAIDELVDKKYKNWDWNYGKSPKYEYNRSERLSSGTVDITISVEQNRI
FT                   ADCRIFGDFFGQGDIKDVEEALQGTKMTREDLTHQLKQLDIVYYFGNVTVGSLVEMILS
FT                   "
FT   misc_feature    351975..352334
FT                   /note="Pfam match to entry PF03099 BPL_LipA_LipB,
FT                   Biotin/lipoate A/B protein ligase family, score 77.4,
FT                   E-value 3.1e-20"
FT   CDS_pept        353181..354209
FT                   /transl_table=11
FT                   /locus_tag="SAS0305"
FT                   /product="putative reductase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0325"
FT                   /protein_id="CAG42076.1"
FT                   /translation="MMNNKVLVTGGTGFVGMRIISRLLEQGYEVQTTIRDLSKADKVIK
FT                   TMQDNGISTERLMFVEADLSQDEHWDEAMKDCKYVLSVASPVFFGKTDDAEVMAKPAIE
FT                   GIQRILRAAEHAGVKRVVMTANFGAVGFSNKDKNSITNESHWTNEDEPGLSVYEKSKLL
FT                   AEKAAWDFVENENTTVEFATINPVAIFGPSLDAHVSGSFHLLENLLNGSMKRVPQIPLN
FT                   VVDVRDVAELHILAMTNEQANGKRFIATADGQINLLEIAKLIKEKRPEIAQKVSTKKLP
FT                   DFVLSLGAKFNHQAKEGKLLLDMNRNVSNERAKILLGWEPIATQKEAILAAVDSMAKYH
FT                   LI"
FT   misc_feature    353754..353783
FT                   /note="PS00152 ATP synthase alpha and beta subunits
FT                   signature."
FT   CDS_pept        complement(354302..355648)
FT                   /transl_table=11
FT                   /locus_tag="SAS0306"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0326"
FT                   /protein_id="CAG42077.1"
FT                   /translation="MQAILNFIVDILSQPAILVALIAFIGLIVQKKPAATITSGTIKTI
FT                   LGFLILSAGADVVVRSLEPFGKIFQHAFGVQGIVPNNEAIVSLALKDFGTTAALIMVCG
FT                   MIVNILIARFTNLKYIFLTGHHTFYMAAFLAIILTVSHIKGWLTIVIGALVLGLIMAVL
FT                   PALLQPTMRKITGNDQVALGHFGSISYFAAGAVGQLFKGKSKSTEEIKFPKGLSFLRES
FT                   TISISITMALLYFIACLFAGVSYVHESISNGQNFIVFSLIQGVTFAAGVFIILTGVRLI
FT                   LAEIVPAFKGISEKLVPNSKPALDCPIVFPYAQNAVLIGFFVSFITGVIGMFILFLFGG
FT                   VVILPGVVAHFFLGATAAVFGNARGGIKGAVAGAALNGILITFLPLLFLPFLGELGGAA
FT                   TTFSDTDFLTVGIVFGNAVKYMGLFGAILFIIIVGATAILLKGRQKPQQ"
FT   misc_feature    complement(order(354329..354430,354473..354541,
FT                   354560..354628,354638..354706,354800..354868,
FT                   354911..354979,355148..355216,355226..355294,
FT                   355313..355372,355562..355630))
FT                   /note="10 probable transmembrane helices predicted for
FT                   SAS0306 by TMHMM2.0 at aa 7-29, 93-112, 119-141, 145-167,
FT                   224-246, 261-283, 315-337, 341-363, 370-392 and 407-440"
FT   misc_feature    complement(354419..355648)
FT                   /note="Pfam match to entry PF04215 SgaT_UlaA, Putative
FT                   sugar-specific permease, SgaT/UlaA, score 397.1, E-value
FT                   1.8e-116"
FT   misc_feature    complement(355037..355060)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(355663..355947)
FT                   /transl_table=11
FT                   /locus_tag="SAS0307"
FT                   /product="putative PTS transport system protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0327"
FT                   /protein_id="CAG42078.1"
FT                   /translation="MKILVVCGHGLGSSFMVEMNAQEALRQLNAPSDIEVEHSDIMTAS
FT                   PEMADLFICGRDLAENAERLGDVLVLDNILDKAELQQKLSEKLQQLNMI"
FT   misc_feature    complement(355681..355944)
FT                   /note="Pfam match to entry PF02302 PTS_IIB, PTS system,
FT                   Lactose/Cellobiose specific IIB subunit, score 102.7,
FT                   E-value 7.4e-28"
FT   CDS_pept        complement(355949..356392)
FT                   /transl_table=11
FT                   /locus_tag="SAS0308"
FT                   /product="putative PTS transport system IIA component"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0328"
FT                   /protein_id="CAG42079.1"
FT                   /translation="MSLDILSTTRIIVKEQVNDWTEAITIASQPLLQEQIIEQGYVQAM
FT                   IDSVNELGPYIVIAPEIAIAHARPNNDVHQVGLSLLKLNQHVAFCDEDHYASLIFVLSA
FT                   IDNHSHLSVLQNLATVLGDNQTVQQLLTATNAQDIKNILKEHD"
FT   misc_feature    complement(355955..356383)
FT                   /note="Pfam match to entry PF00359 PTS_EIIA_2,
FT                   Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2, score 99.1, E-value 8.9e-27"
FT   CDS_pept        complement(356397..358352)
FT                   /transl_table=11
FT                   /locus_tag="SAS0309"
FT                   /product="putative PTS multidomain regulator"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0329"
FT                   /protein_id="CAG42080.1"
FT                   /translation="MLSYRQIEILYLLIHEQTFIPINTIANQLGVSPRTIQYDIAYIEQ
FT                   YAETYHYQVSRNKAAGIKVTTAHATLLNELEHNLTNQIHFSKDERLTHIALKLFETTDP
FT                   VSTKQLAQDVNVSRRTIADDIKMIQAQLDQYHLKLNYVHNKGFNIIGEEDHYRKAYAHF
FT                   IHQYMKQAAPFIEADIFNSESIALVRRAIIKTLNSENYHLVQSAIDGLIYHILIAIQRL
FT                   NENFSFDIPINEIDKWRHTNQYAIASKMIENLERSCNVTFPESEIIFITLHLLGSKMTE
FT                   HTASSITFEYHDLSQNIHELITCVSQELGIDMSKDNKLHTSLITHIKPAIHRIKYDMLQ
FT                   PNPLRQEVMRRYPQIIEAVSKHISPIEQDAAIRFNEDELTYITIHFASSIERVATHKQS
FT                   MIKVVLLCGSGIGTSQLLKSKLNHLYPEFHIWDAYSIYQLEESRLLQDNIDYVISTVPC
FT                   EISAVPVIHVDPFINQQSRQKLNQIINDSREQRVMKMATDGKSLADLLPEHRIIINKQP
FT                   LSIESAIAVAVQPLINDGIVYSNYTAAILKQFEQFGSYMVISPHIALIHAGTDYVQNGV
FT                   GFALTYFTEGIIFGSKANDPVHLVITLATDHPNAHLKALGQLSECLSNDLYRQDFLDGN
FT                   IFKIKQHIALTMTKEA"
FT   misc_feature    complement(356415..356840)
FT                   /note="Pfam match to entry PF00359 PTS_EIIA_2,
FT                   Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2, score 17.5, E-value 3.7e-07"
FT   misc_feature    complement(357087..357149)
FT                   /note="Pfam match to entry PF02302 PTS_IIB, PTS system,
FT                   Lactose/Cellobiose specific IIB subunit, score 20.8,
FT                   E-value 3e-05"
FT   misc_feature    complement(357186..357473)
FT                   /note="Pfam match to entry PF00874 PRD, PRD domain, score
FT                   108.1, E-value 1.7e-29"
FT   misc_feature    complement(357522..357809)
FT                   /note="Pfam match to entry PF00874 PRD, PRD domain, score
FT                   85.4, E-value 1.2e-22"
FT   misc_feature    complement(357975..358040)
FT                   /note="Predicted helix-turn-helix motif for SAS0309 with
FT                   score 1440.000, SD 4.09 at aa 105-126, sequence
FT                   VSTKQLAQDVNVSRRTIADDIK"
FT   misc_feature    complement(358230..358295)
FT                   /note="Predicted helix-turn-helix motif for SAS0309 with
FT                   score 1474.000, SD 4.21 at aa 20-41, sequence
FT                   IPINTIANQLGVSPRTIQYDIA"
FT   CDS_pept        358564..358983
FT                   /transl_table=11
FT                   /locus_tag="SAS0310"
FT                   /product="MarR family regulatory protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0330"
FT                   /protein_id="CAG42081.1"
FT                   /translation="MEFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQ
FT                   DGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAF
FT                   TSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ"
FT   misc_feature    358648..358965
FT                   /note="Pfam match to entry PF01047 MarR, MarR family, score
FT                   58.5, E-value 1.6e-14"
FT   misc_feature    358705..358770
FT                   /note="Predicted helix-turn-helix motif for SAS0310 with
FT                   score 1531.000, SD 4.40 at aa 48-69, sequence
FT                   LTQNDIAKALQRTGPTVSNLLR"
FT   CDS_pept        359090..360445
FT                   /transl_table=11
FT                   /locus_tag="SAS0311"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0331"
FT                   /db_xref="GOA:Q6GCD7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCD7"
FT                   /protein_id="CAG42082.1"
FT                   /translation="MKDEQLYYFEKSPVFKAMMHFSLPMMIGTLLSVIYGILNIYFIGF
FT                   LEDSHMISAISLTLPVFAILMGLGNLFGVGAGTYISRLLGAKDYSKSKFVSSFSIYGGI
FT                   ALGLIVILVTLPFSDQIAAILGARGETLALTSNYLKVMFLSAPFVILFFILEQFARAIG
FT                   APMISMIGMLASVGLNIILDPILIFGFDLNVVGAALGTAISNVAAALFFIVYFMKNSDV
FT                   VSVNIKLAKPNKEMLSEIFKIGIPAFLMSILMGFTGLVLNLFLAHYGNFAIASYGISFR
FT                   LVQFPELIIMGLCEGVVPLIAYNFMANKGRMKDVIKAVIMSIGVIFVVCMIAVFTIGHH
FT                   MVGLFTTDQDIVEMATFILKVTMTSLLLNGIGFLFTGMLQATGQGRGATIMAILQGAII
FT                   IPVLFIMNALFGLTGVIWSLLIAESLCALAAMLIVYLLRDRLTVDTSELIEG"
FT   misc_feature    order(359147..359215,359243..359311,359372..359440,
FT                   359483..359551,359588..359656,359669..359737,
FT                   359816..359884,359942..360010,360044..360103,
FT                   360146..360214,360251..360319,360332..360400)
FT                   /note="12 probable transmembrane helices predicted for
FT                   SAS0311 by TMHMM2.0 at aa 20-42, 52-74, 95-117, 132-154,
FT                   167-189, 194-216, 243-265, 285-307, 319-338, 353-375,
FT                   388-410 and 415-437"
FT   misc_feature    359159..359644
FT                   /note="Pfam match to entry PF01554 MatE, MatE, score 95.3,
FT                   E-value 1.3e-25"
FT   misc_feature    359468..359515
FT                   /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature."
FT   CDS_pept        360552..360992
FT                   /transl_table=11
FT                   /locus_tag="SAS0312"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0332"
FT                   /protein_id="CAG42083.1"
FT                   /translation="MYKSKILLKYIFSEEPEVKDLTEEKYNQDYEALTFSFKEETYQSR
FT                   LAKKTPTKAGYFVTCWTKDENNCNQPYSKEAFADYLMIIVIDEELSGYFLFPRELLVEK
FT                   GILTTFEHKGKMAFRVYPKWCNQLNKTAGQTQKWQCKYFFEY"
FT   CDS_pept        complement(361075..362433)
FT                   /transl_table=11
FT                   /locus_tag="SAS0313"
FT                   /product="putative glycerol-3-phosphate transporter"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0333"
FT                   /protein_id="CAG42084.1"
FT                   /translation="MNFLKPAKHIKPLPENQIDDTYKRLRLQVFLGIFIGYAGYYLLRK
FT                   NFSLAMPALQEQGFTKAELGFALSAVSIAYGFSKFFMGTVSDRSNARIFLVLGLALTAI
FT                   VNLLMGFVPFFTSGIGIMFVLLFLNGWFQGMGWPPSGRVLVHWFSVSERGSKTALWNVA
FT                   HNVGGGIMAPIAAWGITTTAFINFGYLKGFEGVFIYPALLALIIAAISYVLIRDTPQSQ
FT                   GLPPIEIYKNDFATSDKKTLETELTTKEILFKYVLNNKWVWAIAFANIFVYFVRYGVLD
FT                   WAPVYLSEEKHFDLKASGWAYFLYEWAGIPGTLLCGYISDKLFKGRRGPAGFFFMLGVT
FT                   VFVLIYWLNPPGNAWLDNVSLIAIGFLIYGPVMLIGLQALDYVPKKAAGTAAGLTGLFG
FT                   YLFGAVMANIVLGAVVDKFGWDVGFILLTAISVFAMLSFILTWNKVGQETVHH"
FT   misc_feature    complement(order(361108..361176,361189..361257,
FT                   361294..361362,361390..361443,361477..361536,
FT                   361594..361653,361789..361848,361891..361959,
FT                   362020..362079,362089..362157,362176..362244,
FT                   362302..362355))
FT                   /note="12 probable transmembrane helices predicted for
FT                   SAS0313 by TMHMM2.0 at aa 27-44, 64-86, 93-115, 119-138,
FT                   159-181, 196-215, 261-280, 300-319, 331-348, 358-380,
FT                   393-415 and 420-442"
FT   misc_feature    complement(361930..361980)
FT                   /note="PS00942 glpT family of transporters signature."
FT   CDS_pept        362745..363671
FT                   /transl_table=11
FT                   /locus_tag="SAS0314"
FT                   /product="putative dioxygenase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0334"
FT                   /protein_id="CAG42085.1"
FT                   /translation="MNIVGHHHISMYTKDAKRNKDFYTNVLGLRLVEKSVNQDNPSMYH
FT                   LFYGDEVGTAGTILSFFEIPNAGHKQPGTETIYRFSLLVPNQAALHYFEKRLDNNGITS
FT                   ERLYYLGQEGVVFKDEDDLEIILLVNDSFEVPHQWQHNVYSEIPQAYQILGIGPVELRV
FT                   RNAARTVEFLENVLGYRKRDNKSFDVLTLAPQGLYSDFVVIEQQGQRERPGRGYIHHIA
FT                   INTPQMSDLDAIYKKLQQQTQSNSGIIDRYFFKSLYYRHNSIMYEFATEAPGFTIDTPL
FT                   EQLGSQLNLPDFLEAEREQIESKLHEI"
FT   misc_feature    362757..363125
FT                   /note="Pfam match to entry PF00903 Glyoxalase,
FT                   Glyoxalase/Bleomycin resistance protein/Dioxygenase
FT                   superfamily, score 52.3, E-value 1.1e-12"
FT   misc_feature    363207..363521
FT                   /note="Pfam match to entry PF00903 Glyoxalase,
FT                   Glyoxalase/Bleomycin resistance protein/Dioxygenase
FT                   superfamily, score 17.6, E-value 6.6e-05"
FT   CDS_pept        363685..364746
FT                   /transl_table=11
FT                   /locus_tag="SAS0315"
FT                   /product="putative luciferase-like monooxygenase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0335"
FT                   /protein_id="CAG42086.1"
FT                   /translation="MAKLEMNKNTPLEFGLYSLGDHLLNPLKGEKVSYEQRINEIIEAS
FT                   KLADEAGIDVFAVGESHQEHFTTQAPTVVLGAIAQATKHIKVSSSSTIISATDPVRVFE
FT                   DFATLDLISHGRAEIVAGRASRTGIFDLFGYDLKDYDELFEEKLGLLLELNKTERITWS
FT                   GKYRPELRNMKIFPRPIDNTLPIWRAVGGPPASAIKAGKQGVPMMITTLGGPAMNFKGS
FT                   IDAYRQAATEAGFDASPKSLPVSIASLFYTAETTQDAMREFYPHLNTGMSFIRGVGYPK
FT                   QQFANSPDYREALMVGSPQQIIEKILYQHELYGHQRFMAQLDFGGVPFENVMKNIELIG
FT                   NDIIPAIKKHLSK"
FT   misc_feature    363718..364725
FT                   /note="Pfam match to entry PF00296 bac_luciferase,
FT                   Luciferase-like monooxygenase, score 76.0, E-value 8e-20"
FT   CDS_pept        364760..365326
FT                   /transl_table=11
FT                   /locus_tag="SAS0316"
FT                   /product="NADH-dependent FMN reductase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0336"
FT                   /protein_id="CAG42087.1"
FT                   /translation="MNIVLLSGSTVGSKTRIAMDDLKNELEVINEGHQIELMDLRELEL
FT                   EFSVGKNYLDTTGDVYKLTTSLMQADVIFIGFPIFQASIPGALKNVFDLLPVNAFRDKV
FT                   IGLVATAGSSKHYLIPEMHLKPILSYMKAHTMQTYVFIEEKDFSNQQIVNDDVVFRLKA
FT                   LAQSTMRTAKVQQQVFEEENNQYDF"
FT   misc_feature    364760..365278
FT                   /note="Pfam match to entry PF03358 FMN_red, NADPH-dependent
FT                   FMN reductase, score 28.9, E-value 9.3e-09"
FT   CDS_pept        complement(365386..366381)
FT                   /transl_table=11
FT                   /locus_tag="SAS0317"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0338"
FT                   /db_xref="GOA:Q6GCD1"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCD1"
FT                   /protein_id="CAG42088.1"
FT                   /translation="MASLKNKHFMIGLTLTFIVALFSFLAAKLPILDKVGALTIAILIA
FT                   ILYRHFRGYPEQYSSGITFSSKYLLRFAIILYGLKLNIFDIIGQGSRLLAIDVGVVIFS
FT                   IVMMLFVNKLLHGDKNIALLLGVGTGVCGAAAIAAVAPIFKSREKDTAISIGIIALIGT
FT                   IFSLIYTAIYAIFSMTTNVYGAWSGVSLHEIAHVVLAGGFGGSDALKIALLGKLGRVFL
FT                   LIPLTIVLILIMRFRSSESSSNGRISIPYFLIGFVIMALVNTYVTIPSALLNILNTVST
FT                   ICLLMAMVALGLNVAFKDLKNRALKPLMTIIITSICLSSLAFIVVHWLYS"
FT   misc_feature    complement(order(365392..365460,365497..365565,
FT                   365575..365643,365680..365733,365776..365835,
FT                   365854..365922,365950..366018,366037..366105,
FT                   366118..366177,366238..366291,366304..366357))
FT                   /note="11 probable transmembrane helices predicted for
FT                   SAS0317 by TMHMM2.0 at aa 9-26, 31-48, 69-88, 93-115,
FT                   122-144, 154-176, 183-202, 217-234, 247-269, 273-295 and
FT                   308-330"
FT   misc_feature    complement(365449..366351)
FT                   /note="Pfam match to entry PF03601 Cons_hypoth698,
FT                   Conserved hypothetical protein 698, score 487.6, E-value
FT                   1e-143"
FT   misc_feature    complement(365788..365817)
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT   misc_feature    complement(366271..366381)
FT                   /note="Signal peptide predicted for SAS0317 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.527 between residues 37 and 38"
FT   CDS_pept        366686..367231
FT                   /transl_table=11
FT                   /locus_tag="SAS0318"
FT                   /product="putative acetyltransferase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0339"
FT                   /protein_id="CAG42089.1"
FT                   /translation="MFGMKVNEQIILKILEAHDTEALFNLVNRSRNSLREWLPWVDATE
FT                   QPSDTRAFIKRGLLQFSDGNGFQCGIWYEGTLVGVIGLHEINRMHRKTSLGYYLDKQFE
FT                   GHGIMTQAVEALIKYCFEELDLNRIEISAAVNNEKSRAIPERLGFTREGMLRDNELLNG
FT                   IYSSSYIYSLLKSEYDQK"
FT   misc_feature    366890..367135
FT                   /note="Pfam match to entry PF00583 Acetyltransf,
FT                   Acetyltransferase (GNAT) family, score 55.6, E-value
FT                   1.1e-13"
FT   CDS_pept        367498..368352
FT                   /transl_table=11
FT                   /locus_tag="SAS0319"
FT                   /product="putative lipoprotein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0340"
FT                   /db_xref="GOA:Q6GCC9"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR034981"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCC9"
FT                   /protein_id="CAG42090.1"
FT                   /translation="MKKLTTLLLASTLLIAACGNDDSKKDDSKTSKKDDGVKAELKQAT
FT                   KAYDKYTDEQLNEFLKGTEKFVKAIENNDMAQAKALYPKVRMYYERSEPVAEAFGDLDP
FT                   KIDARLADMKEEKKEKEWSGYHKIEKALYEDKKIDDVTKKDAQQLLKDAKELHAKADTL
FT                   DITPKLMLQGSVDLLNEVATSKITGEEEIYSHTDLYDFKANIEGAQKIYDLFKPILEKK
FT                   DKKLSDDIQMNFDKVNQLLDKYKDNNGGYESFEKVSKKDRKAFADAVNALGEPLSKMAV
FT                   ITE"
FT   misc_feature    367498..367572
FT                   /note="Signal peptide predicted for SAS0319 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.666 between residues 25 and 26"
FT   misc_feature    367519..367551
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    367579..368349
FT                   /note="Pfam match to entry PF04302 DUF451, Protein of
FT                   unknown function (DUF451), score 603.1, E-value 1.8e-178"
FT   CDS_pept        368349..369578
FT                   /transl_table=11
FT                   /locus_tag="SAS0320"
FT                   /product="putative Sec-independent exported protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0341"
FT                   /protein_id="CAG42091.1"
FT                   /translation="MTNYEQVNDSTQFSRRTFLKMLGIGGAGVAIGASGVGSMWSFKSM
FT                   FNTPEDPEKDAYEFYGKVQPGITTPTQKTCNFVALDLKSKDRDAIKAMFKKWTVMADRM
FT                   MDGDKVGKPSNNPLMPPVDTGESIGLGASKLTITFGISKSLMKKIGLSSKIPDAFKDLP
FT                   HFPNDQLIDDYSDGDIMIQACSNDSQVSFHAVHNLVRPFRDIVKVRWAQSGFISAKGKE
FT                   TSRNLMAFKDGTINPRKSNQLKDYVFIDDGWAKHGTYCVVRRIQIHIETWDRTALEEQE
FT                   ATFGRKRHSGAPLTGGKEFDEIDLKAKDSHGEYIIDKDAHTRLAKEANTSILRRAFNYV
FT                   DGTDDRTGNFETGLLFIAFQKATKQFIDIQNNLGSNDKLNEYITHRGSASFLVLPGVSK
FT                   GGYLGETLFD"
FT   misc_feature    368409..368468
FT                   /note="1 probable transmembrane helix predicted for SAS0320
FT                   by TMHMM2.0 at aa 21-40"
FT   misc_feature    368538..369545
FT                   /note="Pfam match to entry PF04261 Dyp_perox, Dyp-type
FT                   peroxidase family, score 610.8, E-value 8.5e-181"
FT   CDS_pept        369556..371271
FT                   /transl_table=11
FT                   /locus_tag="SAS0321"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0342"
FT                   /protein_id="CAG42092.1"
FT                   /translation="MVKHYLIKFVAMLITAAMVCSFGLLKSQAAKQQSISDVYSVITDA
FT                   KSALSNNSISNDNKQKAIEQVVSAVKKLSLEDNSEGNAVKSDVRKLEDAKANDNQKDTL
FT                   SQLTKSLIAYEEKLASKDAGSKIKLLQQQVDAKDAVMTKAIKDKNKAELESLNNSLNQI
FT                   WTSNETVIRNYDANQYGQIEVALLQLRIAIHKSPLDTAKVSHAWTTFKSNIDHVDKKSD
FT                   TSAKDQYHVSQLNDELEKAIKAIDDNQLSDADAALTHFIEIWPYVEGQIQTKDGALYTK
FT                   IEDKIPYYQSVLDEHNKAHVKDGLVDLNNQIKEVVGHSYSFVDVMIIFLREGLEVLLIV
FT                   MTLTTMTRNVKDKKGTASVIGGAIAGLVLSIILAITFVETLGNSGILRESMEAGLGIVA
FT                   VILMFIVGVWMHKRSNAKRWNDMIKNMYANAISNGNLVLLATIGLISVLREGVEVIIFY
FT                   MGMIGELATKDFIIGIALAIVILIIFALLFRFIVRLIPIFYIFRVLSIFIFIMGFKMLG
FT                   VSIQKLQLLGAMPRHVIEGFPTINWLGFYPTYEPLIAQAAYIMVVAILIFKFKK"
FT   misc_feature    369556..369642
FT                   /note="Signal peptide predicted for SAS0321 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.689 between residues 29 and 30"
FT   misc_feature    order(369568..369630,370621..370689,370732..370785,
FT                   370846..370905,370963..371031,371050..371118,
FT                   371209..371262)
FT                   /note="7 probable transmembrane helices predicted for
FT                   SAS0321 by TMHMM2.0 at aa 5-25, 356-378, 393-410, 431-450,
FT                   470-492, 499-521 and 552-569"
FT   CDS_pept        complement(371363..372064)
FT                   /transl_table=11
FT                   /locus_tag="SAS0322"
FT                   /product="putative Sec-independent protein translocase
FT                   protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0343"
FT                   /protein_id="CAG42093.1"
FT                   /translation="MVHFSELRHRLVKILLSFVITVIVVYVSSFWWMTPFITYITRAHV
FT                   SLHAFSFTEMIQIYVMIIFFIAFCLISPVMFYQLWAFVAPGLHNNERQFIYKYSFFSVL
FT                   LFIFGVAFAFYVGFPMIIQFALKLSLTLNISPVIGFKAYLIELIRWLFTFGILFQLPIL
FT                   FIGLAKFGLIDTTSLKHYRKYIYFACFVLASIIAPPDLTLNILLTLPLILLFEFSTFIV
FT                   KFTYRGKPPTH"
FT   misc_feature    complement(order(371399..371452,371462..371515,
FT                   371549..371617,371699..371767,371825..371893,
FT                   371963..372031))
FT                   /note="6 probable transmembrane helices predicted for
FT                   SAS0322 by TMHMM2.0 at aa 12-34, 58-80, 100-122, 150-172,
FT                   184-201 and 205-222"
FT   misc_feature    complement(371435..372040)
FT                   /note="Pfam match to entry PF00902 TatC, Sec-independent
FT                   protein translocase protein (TatC), score 236.5, E-value
FT                   4e-68"
FT   CDS_pept        complement(372081..372296)
FT                   /transl_table=11
FT                   /locus_tag="SAS0323"
FT                   /product="putative Sec-independent protein translocase
FT                   protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0344"
FT                   /protein_id="CAG42094.1"
FT                   /translation="MITNTFILGITGPTSLVVISIIALIIFGPKKLPQFGRAIGSTLKE
FT                   FKSATEDLDKESHDTPSKESKQQREQ"
FT   misc_feature    complement(372105..372266)
FT                   /note="Pfam match to entry PF02416 MttA_Hcf106, mttA/Hcf106
FT                   family, score 71.8, E-value 1.5e-18"
FT   misc_feature    complement(372216..372284)
FT                   /note="1 probable transmembrane helix predicted for SAS0323
FT                   by TMHMM2.0 at aa 5-27"
FT   CDS_pept        complement(372404..372793)
FT                   /transl_table=11
FT                   /locus_tag="SAS0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0345"
FT                   /protein_id="CAG42095.1"
FT                   /translation="MAFTLSAIQQAHQQFTGVDFPKLFKAFKDMGMTYNIVNIQDGTAT
FT                   YVHQSEDDIVTSSVKSTIPVAQKSNQSIVQDVLTRHQQGQTDFETFCDEMAEAGIYKWH
FT                   IDIQAGTCTYIDLQDQAVISELIPQ"
FT   CDS_pept        373033..373236
FT                   /transl_table=11
FT                   /locus_tag="SAS0325"
FT                   /product="putative DNA-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0346"
FT                   /protein_id="CAG42096.1"
FT                   /translation="MRNRLKELRARDGLNQTQLAKLAGVSRQTISLIERNNFMPSVLTA
FT                   IKIARIFNETVETVFIIEEDEV"
FT   misc_feature    373045..373209
FT                   /note="Pfam match to entry PF01381 HTH_3, Helix-turn-helix,
FT                   score 56.3, E-value 6.8e-14"
FT   misc_feature    373072..373137
FT                   /note="Predicted helix-turn-helix motif for SAS0325 with
FT                   score 2277.000, SD 6.94 at aa 14-35, sequence
FT                   LNQTQLAKLAGVSRQTISLIER"
FT   misc_feature    373159..373224
FT                   /note="Predicted helix-turn-helix motif for SAS0325 with
FT                   score 1224.000, SD 3.36 at aa 43-64, sequence
FT                   LTAIKIARIFNETVETVFIIEE"
FT   CDS_pept        373233..373946
FT                   /transl_table=11
FT                   /locus_tag="SAS0326"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0347"
FT                   /protein_id="CAG42097.1"
FT                   /translation="MKILRYIGYLLLGGLVGGIIGGILGNFDGLGIENLTFATYTNVVV
FT                   ISIVATIIIILVEAIVLMNQRRALKYKRLVDEEVDIDATDQYELLANRYVLNGSILSVI
FT                   QTIIAFVVLLIFVVGQAEANAMLFFLIPFFASAIFNTQFTLFNRKFDDRMPKIADKNYT
FT                   EKRLEILDEGERHIELIALFKTYAINLSILILAIIFIGSYSIATGINQSFSLLLIIAIF
FT                   IYNAFSYLLKRRRFY"
FT   misc_feature    order(373251..373307,373350..373418,373515..373583,
FT                   373611..373670,373785..373853,373866..373925)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SAS0326 by TMHMM2.0 at aa 7-25, 40-62, 95-117, 127-146,
FT                   185-207 and 212-231"
FT   CDS_pept        373971..374813
FT                   /transl_table=11
FT                   /locus_tag="SAS0327"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0348"
FT                   /protein_id="CAG42098.1"
FT                   /translation="MTTLLNVDRVNKQYKDSDFKLQDASLTISTNETVGLIGKNGSGKS
FT                   TLINILVGNRHKDNGSIAFFGEEHAADDVEYKEHIGVVFDDLRVPNKLTIKDIDKVFQS
FT                   IYTTWNSQKFFDLIKYFELPRQTKIKTFSRGMRMKIALTIALSHDVKLLILDEATAGMD
FT                   VSGREEVMELLEDFVAQGGGILISSHISEDIEQLADKLVFMKDGRMILTEQKDILLAQY
FT                   GIVTTGDKDVEITKHLIIASRLSKGKYQILVKDYAEIENAEPLKHIDDATKIIMRGEV"
FT   misc_feature    374061..374591
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 140.7, E-value 2.7e-39"
FT   misc_feature    374082..374105
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        374813..375442
FT                   /transl_table=11
FT                   /locus_tag="SAS0328"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0349"
FT                   /protein_id="CAG42099.1"
FT                   /translation="MKGMFLSSFYATRKQTYIYFIVAIIAAGYFAVFNPLMSSAMAGVM
FT                   LITPITDNIKHEKDSRWMYYVSTLPVKRSDYIKSYFAFYLILFGASLMIGLVVTTIVTQ
FT                   SVMIGIMSGLMSFGIIGAYSIIFPLTFKFGAENSNVIMIVASILLLFSFVVFFFIYGMV
FT                   SGASALEFEKISTEGWLVVIVYAVIGIVITSVSYILSIKIFNKQEL"
FT   misc_feature    374813..374932
FT                   /note="Signal peptide predicted for SAS0328 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.813) with cleavage site
FT                   probability 0.764 between residues 40 and 41"
FT   misc_feature    order(374855..374923,375050..375118,375131..375199,
FT                   375233..375301,375344..375412)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SAS0328 by TMHMM2.0 at aa 15-37, 80-102, 107-129, 141-163
FT                   and 178-200"
FT   misc_feature    375428..375436
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="PS00014 Endoplasmic reticulum targeting sequence."
FT   CDS_pept        complement(375832..376965)
FT                   /transl_table=11
FT                   /locus_tag="SAS0329"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0350"
FT                   /protein_id="CAG42100.1"
FT                   /translation="MVNALTPKHLAEKRAGFHELFFDLIFVYAIQKIAHVILTTQNGSI
FT                   SADLFFKYIVMSLFLWLMWSHQTFFTNRFGQVTFKDVSFMMFNMFIMVFLSNSLYPDFE
FT                   KTFFPFFLCVAIMYLSIGLQYLLHIRTGLDYGDKRTCQAFASVAFVISFLSFLSLVLPQ
FT                   SIHYIPGFLGVFIAATGLIPFQKYLVLSPVNMMHLVERFSLLTIIIFGEVLVGLASSSF
FT                   SIDHFSYIYIFQFMILISLFGVYWIITENYINHKLSSIGFRLSYTHLLINIALGVINAA
FT                   IVFSNNNKLNDLFEINMMYISVLIFYIGLWLITPYFHNELTNAKYISSSLGILVVSYII
FT                   SLIFKGHDQVMIISVSVATFCIMLIYFKNQRLRNKHE"
FT   misc_feature    complement(order(375865..375918,376021..376089,
FT                   376108..376176,376219..376287,376300..376353,
FT                   376396..376464,376483..376536,376579..376647,
FT                   376666..376719,376762..376821,376855..376923))
FT                   /note="11 probable transmembrane helices predicted for
FT                   SAS0329 by TMHMM2.0 at aa 15-37, 49-68, 83-100, 107-129,
FT                   144-161, 168-190, 205-222, 227-249, 264-286, 293-315 and
FT                   350-367"
FT   CDS_pept        377504..378685
FT                   /transl_table=11
FT                   /locus_tag="SAS0330"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0351"
FT                   /db_xref="GOA:Q6GCB8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCB8"
FT                   /protein_id="CAG42101.1"
FT                   /translation="MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNP
FT                   SEIDEVIIGNVLQAGQGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVT
FT                   GENDIVLAGGMENMSQSPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAEN
FT                   LVEQYGISREEQDTFAVNSQQKAVRAQQNGEFDSEIVPVSIPQRKGEPILVTKDEGVRE
FT                   NVSVEKLSRLRPAFKKDGTVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGS
FT                   HGVDPSIMGIAPVGAVEKALKRSKKELSDIDVFELNEAFAAQSLAVDRELKLPPEKVNV
FT                   KGGAIALGHPIGASGARVLVTLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK"
FT   misc_feature    377504..378292
FT                   /note="Pfam match to entry PF00108 thiolase, Thiolase,
FT                   N-terminal domain, score 542.1, E-value 4.2e-160"
FT   misc_feature    377753..377809
FT                   /note="PS00098 Thiolases acyl-enzyme intermediate
FT                   signature."
FT   misc_feature    378305..378676
FT                   /note="Pfam match to entry PF02803 thiolase_C, Thiolase,
FT                   C-terminal domain, score 225.0, E-value 1.1e-64"
FT   misc_feature    378518..378568
FT                   /note="PS00737 Thiolases signature 2."
FT   misc_feature    378620..378661
FT                   /note="PS00099 Thiolases active site."
FT   CDS_pept        complement(378768..379520)
FT                   /transl_table=11
FT                   /locus_tag="SAS0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0352"
FT                   /protein_id="CAG42102.1"
FT                   /translation="MTQYPLWQQLNTLKQATWVDLTHTFDPEIPRFSEFEKGEVSTLFT
FT                   VKDHGFYVQRWNIVTQYGTHIDAPIHFVENKRYLEDIDLKELVLPLIVLDFSTEVANNN
FT                   DFIVTRAHIEAWEKEHGTIEPGTFVALRTDWSKRWPNIEKFENKDANGQQHAPGWGLDA
FT                   LKYLIEERRVEAVGHETFDTDASVDVVKNGDLVGERYILGQDKYQVELLTNLDQLPTRG
FT                   AIIYAISPKPKDAPGFPVRAFAIKPSND"
FT   misc_feature    complement(378825..379469)
FT                   /note="Pfam match to entry PF04199 Cyclase, Putative
FT                   cyclase, score 294.1, E-value 1.8e-85"
FT   CDS_pept        complement(379563..381791)
FT                   /transl_table=11
FT                   /locus_tag="SAS0332"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocyst
FT                   eine methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0353"
FT                   /db_xref="GOA:Q6GCB6"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCB6"
FT                   /protein_id="CAG42103.1"
FT                   /translation="MTTIKTSNLGFPRLGRKREWKKAIESYWAKKISKEELDQTLTDLH
FT                   KENLLLQKYYHLDSIPVGDFSLYDHILDTSLLFNIIPERFQGRTIDDDLLFDIARGNKD
FT                   HVASALIKWFNTNYHYIVPEWDNVEPKVSRNVLLDRFKYAQSLNVNAHPVIVGPITFVK
FT                   LSKGGHQTFEEKVKTLLPLYKEVFESLIDAGAEYIQVDEPILVTDDSESYENITREAYD
FT                   YFEKAGVAKKLVIQTYFERAHLKFLSSLPVGGLGLDFVHDNGYNLKQIEAGDFDKSKTL
FT                   YAGIIDGRNVWASDIEAKKVLIDKLLAHTNELVIQPSSSLLHVPVSLDDETLDTSVGEG
FT                   LSFATEKLDELDALRRLFNQNDSVKYDKLKARYERFQNQSFKNLDYDFESVRTSRQSPF
FT                   AQRIEQQQKRLNLPDLPTTTIGSFPQSREVRKYRADWKNKRITDEAYETFLKNEIARWI
FT                   KIQEDIGLDVLVHGEFERNDMVEFFGEKLQGFLVTKFGWVQSYGSRAVKPPIIYGDVKW
FT                   TAPLTVDETVYAQSLTDKPVKGMLTGPVTILNWSFERVDLPRKVVQDQIALAINEEVLA
FT                   LEAAGIKVIQVDEPALREGLPLRSEYHEQYLKDAVLSFKLATSSVRDETQIHTHMCYSQ
FT                   FGQIIHAIHDLDADVISIETSRSHGDLIKDFEDINYDLGIGLGVYDIHSPRIPTKEEIT
FT                   TAINRSLQQIDRSLFWVNPDCGLKTRKEEEVKDALTVLVNAVKAKRQE"
FT   misc_feature    complement(379578..380549)
FT                   /note="Pfam match to entry PF01717 Methionine_synt,
FT                   Methionine synthase, vitamin-B12 independent, score 603.7,
FT                   E-value 1.2e-178"
FT   CDS_pept        complement(381788..383629)
FT                   /transl_table=11
FT                   /locus_tag="SAS0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0354"
FT                   /protein_id="CAG42104.1"
FT                   /translation="MSQFLTQLKDNVLVADGAIGTILYSEGLDTCPEAYNLSHPDKVER
FT                   IHRSYIEAGADVIQTNTYGANFEKLKRFGLEDKVKAIHQAAVRIAKKAANKDTYILGTV
FT                   GGFRGIKQEDISLQTILYHTEIQIDTLIEEGVDALLFETYYDLEELTNVISRTRKKYDI
FT                   PIIAQLTASNTNYLVNGQAINEGLKQLVQCGANIVGLNCHHGPHHMQESFTHIELPEHA
FT                   YLSCYPNASLLDIENSEFKYSDNAQYFGQVAQNLIHEGVRLIGGCCGTTPEHIKFIKES
FT                   IQTLKPVNDKKVIPIPTKALFNPSQNKVRQSLTSKVQERPTVIIELDTPKHLDTDRFFE
FT                   NIAKLDKANVDAVTLADNSLATVRISNIAAASLIKQYYNIEPLVHITCRDRNLIGLQSH
FT                   LLGLSLIGVNEILAITGDPSKVGHLPGATNVYDVNSKGLTELALRFNQGINTDGDALKK
FT                   RTHFNIAGAFNPNVRKLDGAVKRLEKKIESGMSYFITQPVYSKEKIIEIYHATKHLNKP
FT                   FFIGIMPIASYKNALFLHNEVPGIKMSDEILQQFEAVKDDNAKTRELSLKLSKDLIDTV
FT                   HEYFNGLYIITPFQNVEDSLELAAYSKSITAHKEAIL"
FT   misc_feature    complement(381821..382708)
FT                   /note="Pfam match to entry PF02219 MTHFR,
FT                   Methylenetetrahydrofolate reductase, score -46.5, E-value
FT                   9.1e-11"
FT   misc_feature    complement(382778..383596)
FT                   /note="Pfam match to entry PF02574 S-methyl_trans,
FT                   Homocysteine S-methyltransferase, score 200.4, E-value
FT                   2.9e-57"
FT   CDS_pept        complement(383598..384758)
FT                   /transl_table=11
FT                   /locus_tag="SAS0334"
FT                   /product="Cys/Met metabolism PLP-dependent enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0355"
FT                   /protein_id="CAG42105.1"
FT                   /translation="MTLSKETEVIFDWRRGVEYHSANPPLYDSSTFHQTSLGGDVKYDY
FT                   ARSGNPNRELLEEKLARLEQGKFAFAFASGIAAISAVLLTFKSGDHVILPDDVYGGTFR
FT                   LTEQILNRFNIEFTTVDTTKLEQIEGAIQSNTKLIYIETPSNPCFKITDIKAVSKIAEK
FT                   HELLVAVDNTFMTPLGQSPLLLGADIVIHSATKFLSGHSDLIAGAVITNNEAISEALYL
FT                   IQNGTGNMLSAQDSWTLAKHLKTFPIRFKQSVENAQKIVSFLIKQDEISEVYYPGLTTA
FT                   HLEQAKNGGAVIGFRLADESKAQQFVDALTLPLVSVSLGGVETILSHPATMSHAALPEE
FT                   VRQERGITFGLFRLSVGLEDPDELIADIKYALKEAFNESIPHTIER"
FT   misc_feature    complement(383640..384743)
FT                   /note="Pfam match to entry PF01053 Cys_Met_Meta_PP, Cys/Met
FT                   metabolism PLP-dependent enzyme, score 545.8, E-value
FT                   3e-161"
FT   misc_feature    complement(384153..384197)
FT                   /note="PS00868 Cys/Met metabolism enzymes
FT                   pyridoxal-phosphate attachment site."
FT   CDS_pept        complement(384755..385858)
FT                   /transl_table=11
FT                   /locus_tag="SAS0335"
FT                   /product="Cys/Met metabolism PLP-dependent enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0356"
FT                   /protein_id="CAG42106.1"
FT                   /translation="MKDTQLAQITLTDDSTGAIANPIHLSTAYKHPKLGQSTGFDYTRT
FT                   KNPTRSTFETCFAKLEHGIASFATSSGMSAIQLICNLFKPHDEILVSFDLYGGTFRLFE
FT                   FYEQQYNIKFKYVDFTDYEQVEKEITDKTVALFIEPISNPQMIAIDVKPYYQLCKAKGL
FT                   LSIIDNTFLTPYLSTPLAEGADIVLHSATKYIGGHNDVLAGVVTVKDESLAQQLFDFHN
FT                   MTGATLSPIDSYLLLRGLKTLHLRIERAQSNARKLAKKCQSLQAIDEVLYSGQTGMLSL
FT                   RLNKAYSVAKLLENLDICIFAESLGGTETLVTFPYTQTHVDMPDAEKDKRGIDEYLIRL
FT                   SLGVENYEDIERDIIQALDKAQIGEIV"
FT   misc_feature    complement(384782..385852)
FT                   /note="Pfam match to entry PF01053 Cys_Met_Meta_PP, Cys/Met
FT                   metabolism PLP-dependent enzyme, score 476.6, E-value
FT                   2.1e-140"
FT   misc_feature    complement(385262..385306)
FT                   /note="PS00868 Cys/Met metabolism enzymes
FT                   pyridoxal-phosphate attachment site."
FT   misc_RNA        complement(386022..386281)
FT                   /note="T-box leader as predicted by Rfam (RF00230), score
FT                   41.20"
FT   CDS_pept        386522..387367
FT                   /transl_table=11
FT                   /locus_tag="SAS0336"
FT                   /product="putative DNA-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0357"
FT                   /protein_id="CAG42107.1"
FT                   /translation="MSELSKSEDQRITKTKDEQIKQIDISDIKPNPYQPRKTFDENHLN
FT                   DLADSIKQYGILQPIVLRKTVQGYYIVVGERRFRASKIAGLKYVSAIIKDLTDEDMMEL
FT                   AVIENLQREDLNAIEEAESYQRLMTDLKITQQEVAKRLSKSRPYIANMLRLLHLPKKIA
FT                   DMVKDGRLTSAHGRTLLAIKDEQQMLRLAKRVVKEKWSVRYLENHVNELKNVSSKSETD
FT                   KVDITKPKFIKQQERQLREQYGTKVDISIKKSVGKISFEFDSQEDFLRIIEQLNRRYGK
FT                   "
FT   misc_feature    386582..386851
FT                   /note="Pfam match to entry PF02195 ParBc, ParB-like
FT                   nuclease domain, score 130.5, E-value 3.1e-36"
FT   misc_feature    386918..386983
FT                   /note="Predicted helix-turn-helix motif for SAS0336 with
FT                   score 1788.000, SD 5.28 at aa 133-154, sequence
FT                   ITQQEVAKRLSKSRPYIANMLR"
FT   CDS_pept        387524..388405
FT                   /transl_table=11
FT                   /locus_tag="SAS0337"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0358"
FT                   /protein_id="CAG42108.1"
FT                   /translation="MNQVMNIISSLFEPLTKIETYENIATKIAMIVIYIIVALIVIKIL
FT                   NKMIEQGFKIQNKSKKSNKKRSKTLISLVQNVVKYIVWFIVITTILSKFGISVEGVIAS
FT                   AGVVGLAVGFGAQTIVKDVITGFFIIFESQFDVGDYVKINNGGTTVAEGTVKSIGLRST
FT                   RINTISGELTILPNSSMGEITNYSITNGTAIVKIPVSVEENIDNVDKKLNKLFTSLRSK
FT                   YYLFVSDPVVIGIDAIEDTRVILRISAETIPGEGFAGARIIRKEVQKMFLQEGIKTPQP
FT                   IMTAYNHSENGV"
FT   misc_feature    order(387593..387661,387728..387796,387824..387883)
FT                   /note="3 probable transmembrane helices predicted for
FT                   SAS0337 by TMHMM2.0 at aa 24-46, 69-91 and 101-120"
FT   misc_feature    387749..388360
FT                   /note="Pfam match to entry PF00924 MS_channel,
FT                   Mechanosensitive ion channel, score 165.7, E-value 7.9e-47"
FT   CDS_pept        388435..388638
FT                   /transl_table=11
FT                   /locus_tag="SAS0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0359"
FT                   /protein_id="CAG42109.1"
FT                   /translation="MASKYGINDIVEMKKQHACGTNRFKIIRMGADIRIKCENCQRSIM
FT                   IPRQTFDKKLKKIIESHDDTQR"
FT   misc_feature    388444..388614
FT                   /note="Pfam match to entry PF06107 DUF951, Bacterial
FT                   protein of unknown function (DUF951), score 143.9, E-value
FT                   2.9e-40"
FT   CDS_pept        388650..389747
FT                   /transl_table=11
FT                   /locus_tag="SAS0339"
FT                   /product="putative GTP-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0360"
FT                   /protein_id="CAG42110.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGALAANYPFATIDPNVGIVE
FT                   VPDARLLKLEEMVQPKKTLPTTFEFTDIAGIVKGASKGEGLGNKFLSHIREVDAICQVV
FT                   RAFDDDNVTHVAGRVDPIDDIEVINMELVLADLESVEKRLPRIEKLARQKDKTAEMEVR
FT                   ILTTIKEALENGKPARSIDFNEEDQKWVNQAQLLTSKKMLYIANVGEDEIGDDDNDKVK
FT                   AIREYAAQEDSEVIVISAKIEEEIATLDDEDKEMFLEDLGIEEPGLDRLIRTTYELLGL
FT                   STYFTAGVQEVRAWTFKQGMTAPQCAGIIHTDFERGFIRAEVTSYDDYVQYGGESGAKE
FT                   AGRQRLEGKEYIMQDGDIVHFRFNV"
FT   misc_feature    388665..388931
FT                   /note="Pfam match to entry PF01018 GTP1_OBG, GTP1/OBG
FT                   family, score 21.0, E-value 1.9e-05"
FT   misc_feature    388674..388697
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    389019..389744
FT                   /note="Pfam match to entry PF06071 DUF933, Protein of
FT                   unknown function (DUF933), score 568.2, E-value 5.5e-168"
FT   CDS_pept        complement(389833..390024)
FT                   /transl_table=11
FT                   /locus_tag="SAS0340"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0361"
FT                   /protein_id="CAG42111.1"
FT                   /translation="MNLNIDWSKDFQEFQEILNSGIHPEWLYCAKANLVLEPAYTGEGK
FT                   QFFSTQDIINASKIIPFF"
FT   CDS_pept        390268..390564
FT                   /transl_table=11
FT                   /locus_tag="SAS0341"
FT                   /product="30S ribosomal protein S6"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0362"
FT                   /db_xref="GOA:Q6GCA7"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCA7"
FT                   /protein_id="CAG42112.1"
FT                   /translation="MRTYEVMYIVRPNIEEDAKKALVERFNGILATEGAEVLEAKDWGK
FT                   RRLAYEINDFKDGFYNIVRVKSDNNKATDEFQRLAKISDDIIRYMVIREDEDK"
FT   misc_feature    390271..390549
FT                   /note="Pfam match to entry PF01250 Ribosomal_S6, Ribosomal
FT                   protein S6, score 131.7, E-value 1.4e-36"
FT   misc_feature    390397..390426
FT                   /note="PS01048 Ribosomal protein S6 signature."
FT   CDS_pept        390585..391088
FT                   /transl_table=11
FT                   /locus_tag="SAS0342"
FT                   /product="putative single-strand DNA-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0363"
FT                   /db_xref="GOA:Q6GCA6"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCA6"
FT                   /protein_id="CAG42113.1"
FT                   /translation="MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGERE
FT                   ADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSRNYENQEGRRVFVTEVVCDSVQFLE
FT                   PKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDISDD
FT                   DLPF"
FT   misc_feature    390588..390626
FT                   /note="PS00735 Single-strand binding protein family
FT                   signature 1."
FT   misc_feature    390588..390896
FT                   /note="Pfam match to entry PF00436 SSB, Single-strand
FT                   binding protein family, score 140.7, E-value 2.7e-39"
FT   CDS_pept        391140..391382
FT                   /transl_table=11
FT                   /locus_tag="SAS0343"
FT                   /product="30S ribosomal protein S18"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0364"
FT                   /db_xref="GOA:Q6GCA5"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GCA5"
FT                   /protein_id="CAG42114.1"
FT                   /translation="MAGGPRRGGRRRKKVCYFTANGITHIDYKDTELLKRFISERGKIL
FT                   PRRVTGTSAKYQRMLTTAIKRSRHMALLPYVKEEQ"
FT   misc_feature    391197..391358
FT                   /note="Pfam match to entry PF01084 Ribosomal_S18, Ribosomal
FT                   protein S18, score 125.8, E-value 8.6e-35"
FT   misc_feature    391215..391286
FT                   /note="PS00057 Ribosomal protein S18 signature."
FT   CDS_pept        complement(391648..392640)
FT                   /transl_table=11
FT                   /locus_tag="SAS0344"
FT                   /product="hypothetical protein"
FT                   /note="N-terminal region is similar to Bacillus anthracis
FT                   hypothetical protein bxa0052 SWALL:Q9X309 (EMBL:AF065404)
FT                   (276 aa) fasta scores: E(): 1.7e-11, 38.26% id in 230 aa,
FT                   and to the N-terminal region of Enterococcus faecalis
FT                   hypothetical protein ef2085 SWALL:Q832Y3 (EMBL:AE016953)
FT                   (322 aa) fasta scores: E(): 0.0034, 26.37% id in 273 aa"
FT                   /protein_id="CAG42115.1"
FT                   /translation="MIGELKLEKDDTLAEIKPMLNFDEQIAKLKQMNIFFNIIDTEKAN
FT                   EILRKNNHFFKLAYFRKNFEKKNGGYFIEFAYLSDLATIDMKLRYTMLHLTLDIEHSLK
FT                   CLVLKLITENNQEDGYKIIDEFLCIDKSYSNSNFDTNSRTPEEVMETKIKNKNEIFKHM
FT                   NKRGQLPEKLNKYYQNPPAWVCIEFMQLGQFVSFLNFYYKKYNDEELRVANILMPLVKN
FT                   IRNKSAHNQPIIANLNYDSRSPQYLFEKGNNIGISRNMFGIKNFIDTFATLELHNQVCS
FT                   NAIIQARYHDLDQLQKRYKRNESYYNNALAIKRFFIALDKIIDFNRPKV"
FT   CDS_pept        complement(join(392920..393048,393048..393185))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SAS0345"
FT                   /product="putative integrase (fragment)"
FT                   /note="Probable gene remnant. Similar to internal regions
FT                   of bacteriophage L54a integrase Int SWALL:VINT_BPL54
FT                   (SWALL:P20709) (354 aa) fasta scores: E(): 0.00091, 34.56%
FT                   id in 81 aa, and Lactococcus lactis prophage PS2 probable
FT                   integrase ll0503 SWALL:P2IN_LACLA (SWALL:Q9CI63) (382 aa)
FT                   fasta scores: E(): 0.025, 31.16% id in 77 aa"
FT                   /db_xref="PSEUDO:CAG42116.1"
FT   CDS_pept        393545..394156
FT                   /transl_table=11
FT                   /locus_tag="SAS0347"
FT                   /product="putative exported protein"
FT                   /note="Poor database matches. C-terminus is similar to the
FT                   C-terminal region of Staphylococcus aureus exotoxin 1 Set1
FT                   SWALL:Q9RN32 (EMBL:AF188837) (231 aa) fasta scores: E():
FT                   0.034, 30.92% id in 152 aa"
FT                   /protein_id="CAG42117.1"
FT                   /translation="MFKKNDSKNSILLKSILSLGIIYGGTFGIYPKADASTQNSPSVQD
FT                   KQFQKVEEVPNNSEKALVKKLYDRYSQNTINGKSNKSRNWVYSERPLNENQVRINLEGT
FT                   YRVADRVYTPKRNITLNKEVVTLKELDHIIRFAHISYGLYMGEHLPKGNIVINTKDGGK
FT                   YTLESHKELQKDRENVKINTADIKNVTFKLVKSVNDIEQV"
FT   misc_feature    393545..393649
FT                   /note="Signal peptide predicted for SAS0347 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.948) with cleavage site
FT                   probability 0.882 between residues 35 and 36"
FT   misc_feature    393857..394126
FT                   /note="Pfam match to entry PF02876 Stap_Strp_tox_C,
FT                   Staphylococcal/Streptococcal toxin, beta-grasp domain,
FT                   score -22.7, E-value 0.076"
FT   CDS_pept        394525..394926
FT                   /transl_table=11
FT                   /locus_tag="SAS0348"
FT                   /product="putative exported protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0389"
FT                   /protein_id="CAG42118.1"
FT                   /translation="MKTILKTITYLALTIIGAYAALFILKTIDSHGITDQFNPLVKEDV
FT                   SYVKTTEVSTRMDDQLRSYSQSAFNKEGKETQLMYTATFDVKPHRYLKITHKGHHVETF
FT                   EEVEKGQVPKKSIRQIESIIACLYYMVQL"
FT   misc_feature    394525..394620
FT                   /note="Signal peptide predicted for SAS0348 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.738) with cleavage site
FT                   probability 0.547 between residues 32 and 33"
FT   misc_feature    394543..394596
FT                   /note="1 probable transmembrane helix predicted for SAS0348
FT                   by TMHMM2.0 at aa 7-24"
FT   CDS_pept        395074..395646
FT                   /transl_table=11
FT                   /locus_tag="SAS0349"
FT                   /product="putative lipoprotein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0390"
FT                   /protein_id="CAG42119.1"
FT                   /translation="MKLKSLAVLSMSAVVLTACGNDTPKDETKSTESNTNQDTNTTKDV
FT                   IALKDVKTSPEDAVKKAEETYKGQKLKGISFENSNGEWAYKVTQQKSGEESEVLVADKN
FT                   KKVINKKTEKEDTVNENDNFKYSDAIDYKKAIKEGQKEFDGDIKEWSLEKDDGKLVYNI
FT                   DLKKGNKKQEVTVDAKNGKVLKSEQDH"
FT   misc_feature    395074..395133
FT                   /note="Signal peptide predicted for SAS0349 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.578 between residues 20 and 21"
FT   misc_feature    395098..395130
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(395784..396047)
FT                   /transl_table=11
FT                   /locus_tag="SAS0350"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0391"
FT                   /protein_id="CAG42120.1"
FT                   /translation="MNMHILYNLRTKHNLEIDELAQQLNEKYGTKYEAHQIWEWENHHH
FT                   EPKFKDAMHLADFFDAPYEMFLESKVKEYQKHLEEVDIRMDK"
FT   CDS_pept        396341..396592
FT                   /transl_table=11
FT                   /locus_tag="SAS0351"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0392"
FT                   /protein_id="CAG42121.1"
FT                   /translation="MFGFIGMLIIGGLIGWAAGAIMGKDIPGGILGNIIAGIIGSWVGG
FT                   KLFGQWGPELGSIYILPALIGSIILIAIVTLILRAMRK"
FT   misc_feature    order(396350..396409,396428..396496,396506..396574)
FT                   /note="3 probable transmembrane helices predicted for
FT                   SAS0351 by TMHMM2.0 at aa 4-23, 30-52 and 56-78"
FT   misc_feature    396440..396577
FT                   /note="Pfam match to entry PF04226 Transgly_assoc,
FT                   Transglycosylase associated protein, score 68.2, E-value
FT                   1.8e-17"
FT   CDS_pept        complement(396631..396840)
FT                   /transl_table=11
FT                   /locus_tag="SAS0352"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0393"
FT                   /protein_id="CAG42122.1"
FT                   /translation="MTTQSFIFMNIILLDGATQRHPFFICQILAFLFPKFPHINLLLFN
FT                   PILSTFSNIIIHIDHFHANKKDDN"
FT   CDS_pept        397018..397599
FT                   /transl_table=11
FT                   /locus_tag="SAS0353"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0394"
FT                   /protein_id="CAG42123.1"
FT                   /translation="MTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTDTGTKSADDLCD
FT                   YFKEKQIKHVYVSDLLRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPK
FT                   YEKYFNDPNFKDFRHSFSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVV
FT                   IRCLMVYFNKVSREEAVDLKVENCKPYIIE"
FT   misc_feature    397018..397596
FT                   /note="Pfam match to entry PF00300 PGAM, Phosphoglycerate
FT                   mutase family, score 79.2, E-value 8.6e-21"
FT   misc_feature    397030..397059
FT                   /note="PS00175 Phosphoglycerate mutase family
FT                   phosphohistidine signature."
FT   CDS_pept        complement(397665..398048)
FT                   /transl_table=11
FT                   /locus_tag="SAS0354"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0395"
FT                   /protein_id="CAG42124.1"
FT                   /translation="MKVRITFIILAILSTIVCLFLTAMHPTGPNTVTFEQPYLFTLNII
FT                   IMVLVALPSLVLAIYDYMSFRISSAILQFLGAISWFFLSLILSLTQFTPFTLASFITSI
FT                   ILFVSAIITLAIGGKSVDKNDFH"
FT   misc_feature    complement(order(397701..397769,397782..397850,
FT                   397869..397937,397980..398036))
FT                   /note="4 probable transmembrane helices predicted for
FT                   SAS0354 by TMHMM2.0 at aa 5-23, 38-60, 67-89 and 94-116"
FT   misc_feature    complement(397944..398048)
FT                   /note="Signal peptide predicted for SAS0354 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.379 between residues 35 and 36"
FT   CDS_pept        398136..398234
FT                   /transl_table=11
FT                   /locus_tag="SAS0354a"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR395a"
FT                   /note="No significant database matches. Doubtful CDS"
FT                   /protein_id="CAG42125.1"
FT                   /translation="MDSEFKAIKKASNSNMLLDAQMMTLAKLISHF"
FT   CDS_pept        complement(398303..398929)
FT                   /transl_table=11
FT                   /locus_tag="SAS0355"
FT                   /product="putative lipoprotein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0396"
FT                   /protein_id="CAG42126.1"
FT                   /translation="MKKRLLLSTFLASALILTGCASDQSDNEDHHTSTGIHAPKSAKKL
FT                   ETKDIFNSDKKNSDISDAEMKQAIEKYLSVNSDILENKYIMQHKLDKQIDSQTKVTEKQ
FT                   AETLSHLSNLAVKNDLHFKKFVTENNIPKEYKKPVELMMNYFKALNSTIANVDEDIEKL
FT                   SYQPQNKINVVDVPTKYAGDVNKKQQDKIKDFLKSKGIKSDVIDK"
FT   misc_feature    complement(398867..398929)
FT                   /note="Signal peptide predicted for SAS0355 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.678 between residues 21 and 22"
FT   misc_feature    complement(398870..398902)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(399002..400612)
FT                   /transl_table=11
FT                   /locus_tag="SAS0356"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0397"
FT                   /protein_id="CAG42127.1"
FT                   /translation="MLDVHFIYPRKLQNACEYFNLPTQKEGFEVTMHALRPENIHKIYH
FT                   DMDKTEQKFIETLISNGNPVTIINKRDVNILKLTNHLGFVYQLNEDEFFVNNFFLRYIN
FT                   SEVLDNAYGEFESLDTINHMNLNEEVLRVRQHTRLNDVTLEHALLLKTNDELKTICRQY
FT                   GIKGFSNKNKQNLVELIMTAFFNNNHIIEQVFSNATLFEFDILSSILESDDNYRLNNEL
FT                   TKFEKLQLINFDNFLTIHFYYYYDFEYDCLILPNDVRKHIENFVNQVGNGDFEKAVNQF
FT                   VNEQTIENSLAEFKNALELSFMEDEVDLDMLLEDEDFGTTDSLRSDAITQLISEIKKGL
FT                   IDKKDILPLRIILGSVNLYGILSTNHLLYLLQRFYDATFSKEELQYSLDTLAGTELYYV
FT                   EDDFVFHPVLFDVVESEASGIDISDDGYYVPASVEELIYYDRHHYLKSDQAIKEITSYL
FT                   RKQINMKNDIEKEKYVNEIIMLLRTIPTSKLIQPIMQLFIDNAILNNVQNDALLIEKAT
FT                   HARNHLRLWSLQGHRDIPN"
FT   CDS_pept        complement(400727..402250)
FT                   /transl_table=11
FT                   /locus_tag="SAS0357"
FT                   /product="alkyl hydroperoxide reductase subunit F"
FT                   /note="EC_number 1.6.4.-"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0398"
FT                   /db_xref="GOA:Q6GC92"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GC92"
FT                   /protein_id="CAG42128.1"
FT                   /translation="MLNADLKQQLKQLLELMEGNVEFVASLGSDEKSKELKELLTEISD
FT                   MSPRLSLSEKSLKRTPSFSVNRPGEETGVTFAGIPLGHEFNSLVLAILQVSGRAPKEKQ
FT                   SIIDQIKNLEGSFHFETFISLTCQKCPDVVQALNLMSVINPNITHSMIDGAVFREESEN
FT                   IMAVPAVFLNGEEFGNGRMTIQDILSKLGSTADASEFENKEPYDVLIVGGGPASGSAAI
FT                   YTARKGLRTGIVADRIGGQVNDTAGIENFITVKETTGSEFSSNLAAHIDQYDIDAMTGI
FT                   RATDIEKTDEAIKVTLENGAVLESKTVIIATGAGWRKLNIPGEEQLINKGVAFCPHCDG
FT                   PLFENKDVAVIGGGNSGVEAAIDLAGIVNHVTLFEFASELKADNVLQDRLRSLSNVDIK
FT                   TNAKTTEVVGEDHVTGIRYEDMSTGEEHLLNLDGIFVQIGLLPNTSWLKDAVELNERGE
FT                   IVIDCNNNTNVPGIFAAGDVTDQKNKQIIISMGAGANAALNAFDYIIRN"
FT   misc_feature    complement(400787..401632)
FT                   /note="Pfam match to entry PF00070 pyr_redox, Pyridine
FT                   nucleotide-disulphide oxidoreductase, score 236.2, E-value
FT                   4.9e-68"
FT   misc_feature    complement(400958..400990)
FT                   /note="PS00626 Regulator of chromosome condensation (RCC1)
FT                   signature 2."
FT   misc_feature    complement(401186..401248)
FT                   /note="PS00573 Pyridine nucleotide-disulphide
FT                   oxidoreductases class-II active site."
FT   CDS_pept        complement(402266..402835)
FT                   /transl_table=11
FT                   /locus_tag="SAS0358"
FT                   /product="alkyl hydroperoxide reductase subunit C"
FT                   /note="EC_number 1.6.4.-"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0399"
FT                   /db_xref="GOA:Q6GC91"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GC91"
FT                   /protein_id="CAG42129.1"
FT                   /translation="MSLINKEILPFTAQAFDPKKDQFKEVTQEDLKGSWSVVCFYPADF
FT                   SFVCPTELEDLQNQYEELQKLGVNVFSVSTDTHFVHKAWHDHSDAISKITYTMIGDPSQ
FT                   TITRNFDVLDEATGLAQRGTFIIDPDGVVQASEINADGIGRDASTLAHKIKAAQYVRKN
FT                   PGEVCPAKWEEGAKTLQPGLDLVGKI"
FT   misc_feature    complement(402377..402826)
FT                   /note="Pfam match to entry PF00578 AhpC-TSA, AhpC/TSA
FT                   family, score 217.3, E-value 2.4e-62"
FT   CDS_pept        403327..404082
FT                   /transl_table=11
FT                   /locus_tag="SAS0359"
FT                   /product="nitroreductase family protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0400"
FT                   /db_xref="GOA:Q6GC90"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GC90"
FT                   /protein_id="CAG42130.1"
FT                   /translation="MSEHVYNLVKKHHSVRKFKNKPLSEDVVKKLVEAGQSASTSSFLQ
FT                   AYSIIGIDDEKIKENLREVSGQPYVVENGYLFVFVIDYYRHHLVDQHAETDMENAYGST
FT                   EGLLVGAIDAALVAENIAVTAEDMGYGIVFLGSLRNDVERVREILDLPDYVFPVFGMAV
FT                   GEPADDENGAAKPRLPFDHVFHHNKYHADKETQYAQMADYDQTISEYYNQRTNGNRKET
FT                   WSQQIEMFLGNKARLDMLEQLQKSGLIQR"
FT   misc_feature    403351..403821
FT                   /note="Pfam match to entry PF00881 Nitroreductase,
FT                   Nitroreductase family, score 106.4, E-value 5.9e-29"
FT   CDS_pept        complement(404163..405551)
FT                   /transl_table=11
FT                   /locus_tag="SAS0360"
FT                   /product="putative sodium:dicarboxylate symporter protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0401"
FT                   /protein_id="CAG42131.1"
FT                   /translation="MNAFLTLINIIVLVIFIVILHMMARKHISFAKRVFTALGIGIVFG
FT                   VLLHLVYGTHSNVITSTSDWFNIVGQGYVALLQMIVMPLIFISIVAAFTKIQIGEKFAK
FT                   IGSLIFIFLIGTVTIAAIVGVVYALVFGLDASTINLGNAEQARGSEIAKQAKDLTAHTL
FT                   PQQILELLPKNPFLDFTGQRATSTIAVVIFASFIGFAYLRVARKQPDHGELLKRAIDAI
FT                   YSLVMAIVTFVLRLTPYGVLAIMANTLSTSDFGAIWTLGKFLIASYAALITMYIIHLII
FT                   LSLLGISPIRYVKKTLEVLIFAFTSRSSAGALPLNVQTQTRRLGVPEGIANFAATFGLS
FT                   IGQNGCAGIYPAMLAIMVAPVANVEIDLQFIVTLIAVVIISSFGVAGVGGGATFASILV
FT                   LSTLNLPVALAGVLISVEPLIDMGRTALNVNDSMLAGTGTAKLTKHWDKDTFDSNDNAA
FT                   LTSH"
FT   misc_feature    complement(404226..405464)
FT                   /note="Pfam match to entry PF00375 SDF,
FT                   Sodium:dicarboxylate symporter family, score 284.3, E-value
FT                   1.6e-82"
FT   misc_feature    complement(order(404304..404372,404382..404450,
FT                   404694..404762,404820..404888,404946..405014,
FT                   405159..405227,405282..405350,405393..405452,
FT                   405489..405542))
FT                   /note="9 probable transmembrane helices predicted for
FT                   SAS0360 by TMHMM2.0 at aa 4-21, 34-53, 68-90, 109-131,
FT                   180-202, 222-244, 264-286, 368-390 and 394-416"
FT   CDS_pept        405636..405734
FT                   /transl_table=11
FT                   /locus_tag="SAS0360a"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0401a"
FT                   /note="No significant database matches. Doubtful CDS"
FT                   /protein_id="CAG42132.1"
FT                   /translation="MQLNVNMMKFDRWHKGICKQIVLNLVEKGEKG"
FT   CDS_pept        complement(406725..407681)
FT                   /transl_table=11
FT                   /locus_tag="SAS0361"
FT                   /product="putative DNA-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0403"
FT                   /protein_id="CAG42133.1"
FT                   /translation="MLTKEFAQRVELSEKQVRKIVQHLEERGYQLSKTEYRGREATDFK
FT                   EEDIELFKDIADKVKQTNSYDLAFDELEKEKDFLQVIVKNDDKNLPTNQNVAQLVEDLR
FT                   LEIQKMREERHLLGQMMNQVHQQQQELKELQNQLTSKIDSNSESLKAIQTSQEAIQEAQ
FT                   ASQAKVLAESTNKVEKNAVTEDKADSKDSKVAGVNTSTDAKTDTKADNAGDGTTTKVDK
FT                   EDQISATEAIEKASVEQSKNGNAAETSNKEATIDAEAQHDAEQQVAEAHAEASKQATSN
FT                   DSLEAKAENDSTASQSEMSEPKPQEEKKGFFARLFNL"
FT   misc_feature    complement(407616..407681)
FT                   /note="Predicted helix-turn-helix motif for SAS0361 with
FT                   score 1266.000, SD 3.50 at aa 1-22, sequence
FT                   MLTKEFAQRVELSEKQVRKIVQ"
FT   CDS_pept        complement(407799..408461)
FT                   /transl_table=11
FT                   /locus_tag="SAS0362"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0404"
FT                   /protein_id="CAG42134.1"
FT                   /translation="MEFKTIQSVKDPHYNEALKLYDTKLNLSLTEDKRIIKRSLENNKT
FT                   ENDYVFIVGLENDVVVSLATAHYEATTNSAFLIYLFAKDLPNHDELMTQTLHQIEHELN
FT                   LLSNLVHSRSINFLMMEVPKEPADLTQDNGLIIEHRRQFLYEHQFERQTEIDYIHPTND
FT                   GHTKKVDLFLKKNIKLTKDIYGTSVKSNYILKYVFANGIAREIIYALLEEMDLRKPF"
FT   CDS_pept        complement(408604..409011)
FT                   /transl_table=11
FT                   /locus_tag="SAS0363"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0405"
FT                   /db_xref="InterPro:IPR025889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GC85"
FT                   /protein_id="CAG42135.1"
FT                   /translation="MADITVVNDTGELYNVINQKKSEGYLESELTIISKSKLHLNDLHD
FT                   SEISLISTSGTFSDRMTKLLTGEDGEHAVLSRYNLAPDELEKYKQLILDDKMLVVAVRD
FT                   KSSHQEVHENNSAYEEIDITHFAEASKGPKA"
FT   misc_RNA        409191..409294
FT                   /note="Purine riboswitch as predicted by Rfam (RF00167),
FT                   score 73.10"
FT   CDS_pept        409524..410102
FT                   /transl_table=11
FT                   /locus_tag="SAS0364"
FT                   /product="putative xanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.-"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0406"
FT                   /db_xref="GOA:Q6GC84"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010079"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GC84"
FT                   /protein_id="CAG42136.1"
FT                   /translation="MELLGQKVKEDGVVIDEKILKVDGFLNHQIDAKLMNEVGRTFYEQ
FT                   FKDKGITKILTIEASGIAPAIMAALHFDVPCLFAKKAKPSTLTDGYYETSIHSFTKNKT
FT                   STVIVSKEFLSEEDTVLIIDDFLANGDASLGLYDIAQQANAKTAGIGIVVEKSFQNGHQ
FT                   RLEEAGLTVSSLCKVASLEGNKVTLVGEE"
FT   misc_feature    409587..410060
FT                   /note="Pfam match to entry PF00156 Pribosyltran,
FT                   Phosphoribosyl transferase domain, score 55.4, E-value
FT                   1.3e-13"
FT   CDS_pept        410102..411370
FT                   /transl_table=11
FT                   /locus_tag="SAS0365"
FT                   /product="putative xanthine permease"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0407"
FT                   /protein_id="CAG42137.1"
FT                   /translation="MKNLILSVQHLLAMYAGAILVPIIVGTSLKFTPEQIAYLVTVDIF
FT                   MCGVATFLQANKVTGTGLPIVLGCTFTAVAPMILIGQTKGIDVLYGSLFLSGILVIIIA
FT                   PFFSHLVKFFPPVVTGSVVTIIGINLMPVAMNYLAGGQGAKDYGDVKNILLGLMTLIII
FT                   LVLQRFTTGFIKSIAILIGLVLGTIGAGLLGMVDINQVNHAGWLGIPVPFRFSGFSFDV
FT                   TSTLVFFIVAIVSLIESTGVYHALSEITGKKLERKDFRKGYTAEGLAIVLGSIFNSFPY
FT                   TAYSQNVGLVSLSGAKKNNVIYGMVVLLLICGCIPKLGALANIIPLPVLGGAMIAMFGM
FT                   VMAYGVSILGHIDFKNQNNLLIIAVSVGLGTGISAVPQAFKGLGEQFAWLTQNGIVLGA
FT                   ISAIILNFFFNGIKYKQTEENVK"
FT   misc_feature    410102..411238
FT                   /note="Pfam match to entry PF00860 xan_ur_permease,
FT                   Permease family, score 426.0, E-value 3.6e-125"
FT   misc_feature    order(410129..410188,410207..410266,410276..410344,
FT                   410363..410422,410450..410518,410555..410614,
FT                   410627..410686,410744..410812,410903..410971,
FT                   411008..411076,411086..411154,411173..411241,
FT                   411269..411337)
FT                   /note="13 probable transmembrane helices predicted for
FT                   SAS0365 by TMHMM2.0 at aa 10-29, 36-55, 59-81, 88-107,
FT                   117-139, 152-171, 176-195, 215-237, 268-290, 303-325,
FT                   329-351, 358-380 and 390-412"
FT   misc_feature    411074..411136
FT                   /note="PS01116 Xanthine/uracil permeases family signature."
FT   CDS_pept        411408..412874
FT                   /transl_table=11
FT                   /locus_tag="SAS0366"
FT                   /product="putative inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0408"
FT                   /db_xref="GOA:Q6GC82"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GC82"
FT                   /protein_id="CAG42138.1"
FT                   /translation="MWESKFAKESLTFDDVLLIPAQSDILPKDVDLSVQLSDKVKLNIP
FT                   VISAGMDTVTESKMAIAMARQGGLGVIHKNMGVEEQADEVQKVKRSENGVISNPFFLTP
FT                   EESVYEAEALMGKYRISGVPIVDNKEDRNLVGILTNRDLRFIEDFSIKIVDVMTQENLI
FT                   TAPVNTTLEEAEKILQKHKIEKLPLVKDGRLEGLITIKDIEKVIEFPNAAKDEHGRLLV
FT                   AAAIGISKDTDIRAQKLVEAGVDVLVIDTAHGHSKGVIDQVKHIKKTYPEITLVAGNVA
FT                   TAEATKDLFEAGADIVKVGIGPGSICTTRVVAGVGVPQITAIYDCATEARKHGKAIIAD
FT                   GGIKFSGDIIKALAAGGHAVMLGSLLAGTEESPGATEIFQGRQYKVYRGMGSLGAMEKG
FT                   SNDRYFQEDKAPKKFVPEGIEGRTAYKGALQDTIYQLMGGVRAGMGYTGSHDLRELREE
FT                   AQFTRMGPAGLAESHPHNIQITKESPNYSF"
FT   misc_feature    411432..412832
FT                   /note="Pfam match to entry PF00478 IMPDH, IMP dehydrogenase
FT                   / GMP reductase domain, score 708.3, E-value 3.8e-210"
FT   misc_feature    411684..411851
FT                   /note="Pfam match to entry PF00571 CBS, CBS domain, score
FT                   52.0, E-value 1.4e-12"
FT   misc_feature    411873..412031
FT                   /note="Pfam match to entry PF00571 CBS, CBS domain, score
FT                   54.3, E-value 2.8e-13"
FT   misc_feature    412296..412334
FT                   /note="PS00487 IMP dehydrogenase / GMP reductase
FT                   signature."
FT   CDS_pept        412899..414440
FT                   /transl_table=11
FT                   /locus_tag="SAS0367"
FT                   /product="putative GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0409"
FT                   /db_xref="GOA:Q6GC81"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GC81"
FT                   /protein_id="CAG42139.1"
FT                   /translation="MEMAKEQELILVLDFGSQYNQLITRRIREMGVYSELHDHEISIEE
FT                   IKKMNPKGIILSGGPNSVYEEGSFTIDPEIYNLGIPVLGICYGMQLTTKLLGGKVERAN
FT                   EREYGKAIINAKSDELFAGLPAEQTVWMSHSDKVIEIPEGFEVIADSPSTDYAAIEDKK
FT                   RRIYGVQFHPEVRHTEYGNDLLNNFVRRVCECKGQWTMENFIEIEIEKIRQRVGDRRVL
FT                   CAMSGGVDSSVVAVLLHKAIGDQLTCIFVDHGLLRKGEGDMVMEQFGEGFNMNIIRVNA
FT                   KDRFMNKLKGVSDPEQKRKIIGNEFVYVFDDEASKLKGVDFLAQGTLYTDVIESGTKTA
FT                   QTIKSHHNVGGLPEDMEFELIEPINTLFKDEVRKLGIELGIPEHLVWRQPFPGPGLGIR
FT                   VLGEITEDKLEIVRESDAILRQVIREEGLEREIWQYFTVLPNIQSVGVMGDYRTYDHTV
FT                   GIRAVTSIDGMTSDFARIDWEVLQKISSRIVNEVDHVNRVVYDITSKPPSTIEWE"
FT   misc_feature    412929..413474
FT                   /note="Pfam match to entry PF00117 GATase, Glutamine
FT                   amidotransferase class-I, score 212.5, E-value 6.6e-61"
FT   misc_feature    413553..413621
FT                   /note="Pfam match to entry PF03054 tRNA_Me_trans, tRNA
FT                   methyl transferase, score 37.3, E-value 6.9e-12"
FT   misc_feature    414075..414434
FT                   /note="Pfam match to entry PF00958 GMP_synt_C, GMP synthase
FT                   C terminal domain, score 231.9, E-value 9.3e-67"
FT   CDS_pept        414952..416058
FT                   /transl_table=11
FT                   /locus_tag="SAS0368"
FT                   /product="hypothetical protein"
FT                   /protein_id="CAG42140.1"
FT                   /translation="MDKSLEINLKELEGIMYKEKVIDVKEYDNLKVTFETLNDAPKSEI
FT                   PTPFTIEQMLYKLETKNLYFPEIKSKEKCVELLHSVGYYNLKHFMYNEFGKDEPKNFDE
FT                   VYILYKFDRYLLKQLFSLVNMLETHIRNIILEVYMLEIEYNNKPSTLFYLDKDLYFEKV
FT                   NDEYKYSAKKLKEFNRLQNVFWRAIEKKKSNDNVKHNIKKYNIIPAWVLFQNFSFGDLS
FT                   TFYRTTLPTYRNKVSKRIENLIEKNTGISIKLPEKLLCAWLNSIRFLRNRIAHTDIIYG
FT                   INFTNTCAKHHSDEEMYVNIEKYKYQQRLVTFLLAMKKIFMSMPENNIIEWNETLTKIE
FT                   NKCSEHNFIKLSRLGVIENNLSYFKITK"
FT   CDS_pept        416502..416687
FT                   /transl_table=11
FT                   /locus_tag="SAS0369"
FT                   /product="putative membrane protein"
FT                   /note="Poor database matches. Weakly similar to the
FT                   C-terminal region of Buchnera aphidicola high-affinity zinc
FT                   uptake system membrane protein bbp294 SWALL:Q89AJ1
FT                   (EMBL:AE014017) (261 aa) fasta scores: E(): 4.7, 35.41% id
FT                   in 48 aa"
FT                   /protein_id="CAG42141.1"
FT                   /translation="MVRLVWATSCDEMMGVISVEIGVPISLCWGSAVNYYQYKIVEPTI
FT                   WILCPGIGFLFLLNSI"
FT   misc_feature    order(416538..416606,416619..416678)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SAS0369 by TMHMM2.0 at aa 13-35 and 40-59"
FT   CDS_pept        complement(416684..417076)
FT                   /transl_table=11
FT                   /locus_tag="SAS0370"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAG42142.1"
FT                   /translation="MLEDNGDIRLLYQSIEELASVLGQSQFETKTVSLIFVQMDLRYSV
FT                   FEKVQTDFMKYLAHKNSDEIKYIDLIKIIENALPEDKELSINVINSIIIGFANNYYPIL
FT                   QSLVPEIQSSYGITINKNFNIDSIDF"
FT   CDS_pept        complement(417098..417577)
FT                   /transl_table=11
FT                   /locus_tag="SAS0371"
FT                   /product="putative exported protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAG42143.1"
FT                   /translation="MKITKAIGSLVLTAVLLTSVSPLTNANEIQTNNTKTAHQSYENIN
FT                   GVKINRNPNLPMNPEAQQRIGGTKVVKTAIKLIINNRGKAKNVIQQVGGKKAATIFDKG
FT                   YSGIVKELKPLLKWSEVPANAVGDAVKRGAINAGLSKSDAGIISTVVKEAIAWLF"
FT   misc_feature    complement(417494..417577)
FT                   /note="Signal peptide predicted for SAS0371 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.563 between residues 28 and 29"
FT   CDS_pept        complement(417703..417960)
FT                   /transl_table=11
FT                   /locus_tag="SAS0372"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAG42144.1"
FT                   /translation="MKNLLVTGYTTGILKIIGQMLLAVAIFSLTIYFAYIMESLLFGFL
FT                   QTVTSLVLLICSLVLAWTSFIVTLLLIIVLSGIFYFGEND"
FT   misc_feature    complement(order(417721..417789,417832..417900))
FT                   /note="2 probable transmembrane helices predicted for
FT                   SAS0372 by TMHMM2.0 at aa 21-43 and 58-80"
FT   CDS_pept        418503..418835
FT                   /transl_table=11
FT                   /locus_tag="SAS0373"
FT                   /product="putative membrane protein"
FT                   /note="Poor database matches. C-terminus is similar to the
FT                   C-terminal region of Streptococcus mutans hypothetical
FT                   protein SMU.423 SWALL:Q8DVP7 (EMBL:AE014889) (76 aa) fasta
FT                   scores: E(): 0.062, 47.54% id in 61 aa"
FT                   /protein_id="CAG42145.1"
FT                   /translation="MATLKDVKTGKKEILPSTAKDKNGKNVTLIYFEKDGKLGFYVQKT
FT                   QKERGVGKCVSGIAGGAVTGGTTLGLAGAGVGTVTIPVIGTVSGGVVGAVGGAVGGGLT
FT                   GGATFC"
FT   misc_feature    order(418662..418730,418743..418811)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SAS0373 by TMHMM2.0 at aa 54-76 and 81-103"
FT   CDS_pept        419940..421766
FT                   /transl_table=11
FT                   /locus_tag="SAS0375"
FT                   /product="hypothetical protein"
FT                   /note="Poor database matches. Similar to Campylobacter
FT                   jejuni rloF protein SWALL:Q8G8B7 (EMBL:AF542644) (554 aa)
FT                   fasta scores: E(): 0.054, 25.08% id in 606 aa"
FT                   /protein_id="CAG42146.1"
FT                   /translation="MGYRIETRTFEELEGKLKLPTFQRALVWSNNQKQEFFSTLKDGFP
FT                   FGSILLYEYENDNKYSLIDGLQRYSTMVDFMENPTNYIEFEDFTLKIAELYKGASESTK
FT                   AEVVNYAEDILLKIIEKYIDSTKENVKVNELAKKMVDKFPVLGETDIRDEITQIQSDVI
FT                   TYFNNQLDISNVKIPCIFFEGEETELAEVFQRLNSGGKKLSKYQVFAAHWDRYEVELGD
FT                   LKYSDEILKNVIERYERLNNDRGILIENFDPKEMETSRVINLSELCYGLGKVISDELQA
FT                   FFKESTEDICNELGFQTMLIVFGIPTNKMNELPYKYQYMKNKNNIEILFEKIVKIYKII
FT                   NNKFKEAFSMVVSSREDKYETKSFTRLQIMSFFSSLWISSYSIELDENKNTFSIKQTKS
FT                   LKKNQQVILSNIIIYAIYDVIRKYWSGTGDRKLMDIYISQNNRYLKPLAKEVFRNELLR
FT                   WNEENINKTSINIQTDEKMIITFIANKFRSFYSSLNDNLDYEHIFSRKLYKLHKGNAII
FT                   PAGSLGNIMLLDSGINRRKKEKFLYSAIDIDKASITGTIENQYVNNSFYPDKRTIDTIE
FT                   IDIIDEKYDSLIKMIKNRGDKLIEEVVRELYK"
FT   misc_feature    419955..420599
FT                   /note="Pfam match to entry PF03235 DUF262, Protein of
FT                   unknown function DUF262, score -27.9, E-value 0.0037"
FT   CDS_pept        complement(422304..422726)
FT                   /transl_table=11
FT                   /locus_tag="SAS0376"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to Clostridium perfringens
FT                   hypothetical protein cpe1491 SWALL:Q8XKA9 (EMBL:AP003190)
FT                   (140 aa) fasta scores: E(): 1.7, 24.82% id in 141 aa"
FT                   /protein_id="CAG42147.1"
FT                   /translation="MKSVNILLNLLPTELKNMLENKDMENILTYFMSNEISDEKLVSYL
FT                   SNLANQINTIEYHEMVASIYHFHFNYIDNAYDLAYYHYWQSLEISQFNNANLLYEFLEI
FT                   LGEPDFNMISHENIQLVANKILERDPNNKLAIKYIN"
FT   CDS_pept        complement(423051..423599)
FT                   /transl_table=11
FT                   /locus_tag="SAS0377"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAG42148.1"
FT                   /translation="MKTKNLNHFIYSISDLRNLIKDNALFHNYISQETKKFQTSLNPSI
FT                   AHFLKHKAIKMNDQNSIRTYLIIDKSDLEIMGYFCLKIVNIKLEKDVSGKTKKDIDLDK
FT                   NIQYDLNTNTMDDKGRYVDENGKLINKDYDVFVEQFENEEYEATLIDKETGEIIKFNSI
FT                   EAKSSALPLVILAAVADTE"
FT   CDS_pept        complement(423580..423741)
FT                   /transl_table=11
FT                   /locus_tag="SAS0378"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0418"
FT                   /protein_id="CAG42149.1"
FT                   /translation="MNIMVPEEKGSITLSKEAAIIFATAKFKPFHNRIKNNPQKTNPFL
FT                   KLHENKKS"
FT   CDS_pept        424095..424502
FT                   /transl_table=11
FT                   /locus_tag="SAS0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Clostridium tetani conserved protein
FT                   ctc00602 SWALL:Q897W9 (EMBL:AE015938) (138 aa) fasta
FT                   scores: E(): 9.2e-11, 41.3% id in 138 aa, and to Bacillus
FT                   anthracis hypothetical protein ba4379 SWALL:Q81M73
FT                   (EMBL:AE017037) (135 aa) fasta scores: E(): 8e-10, 38.97%
FT                   id in 136 aa"
FT                   /protein_id="CAG42150.1"
FT                   /translation="MELSIFYNGQFFVALVEYKMENKSKFIQYTFGNEPDDIEVLDFIH
FT                   HQLMKMIDDVQTIVYTKNISRKVNPKKLQRQIAKEQKKPKYSTQAQIAIKKELELKKKQ
FT                   KRKRYKEKRDAFQKRKREIKKVKAKEKHKGH"
FT   CDS_pept        424549..425031
FT                   /transl_table=11
FT                   /locus_tag="SAS0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Enterococcus faecalis hypothetical
FT                   protein ef1702 SWALL:Q834F3 (EMBL:AE016952) (154 aa) fasta
FT                   scores: E(): 1.9e-27, 58.5% id in 147 aa, and to Bacillus
FT                   subtilis hypothetical protein YbbK or bsu01720
FT                   SWALL:YBBK_BACSU (SWALL:Q45584) (151 aa) fasta scores: E():
FT                   9.4e-25, 53.02% id in 149 aa"
FT                   /protein_id="CAG42151.1"
FT                   /translation="MILISSCLIGDNVRYDGGNQLNVRLKKLIDSGKAIHACPELLGGL
FT                   LIPREPAEIIGGDGFDVWNDAAKVVTISNKDVTDDYKHGAIVTLKILKKYQCDTVILKA
FT                   NSPSCGSQEIYDGNFTGNKKKGVGVATALLINEGIKVYDENTFFDQNMNETIVHEK"
FT   misc_feature    424549..424968
FT                   /note="Pfam match to entry PF04463 DUF523, Protein of
FT                   unknown function (DUF523), score 203.5, E-value 3.3e-58"
FT   CDS_pept        425231..425920
FT                   /transl_table=11
FT                   /locus_tag="SAS0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Neisseria meningitidis hypothetical
FT                   protein nma2192 or rei1 SWALL:Q9JQX9 (EMBL:AL162758) (219
FT                   aa) fasta scores: E(): 1.1e-26, 43.83% id in 219 aa, and to
FT                   the C-terminal region of Corynebacterium efficiens
FT                   conserved hypothetical protein ce0348 SWALL:Q8FSN5
FT                   (EMBL:AP005215) (281 aa) fasta scores: E(): 7.7e-37, 48.9%
FT                   id in 229 aa"
FT                   /protein_id="CAG42152.1"
FT                   /translation="MEKVAILVDGGYYRKISAKVYGKVTAKERADELYSYCNRHLKETH
FT                   FKEEIYNKLYRIFYYDCPPIDKIVYHPLLKKNVNFSNTDTKKWTEDFFKEMSKKRKVAL
FT                   RLGELSEYSVEYNLKYSITKKLLNGSIDLNDLKEKDFSLSLQQKGVDMKIGLDIASLSF
FT                   KHQVDKIILIAGDSDFVPAAKLARTEGIDFVLDSLGADIRNNLSLHIDGRRTCDEKFKF
FT                   YLNQLFK"
FT   CDS_pept        complement(426094..426201)
FT                   /transl_table=11
FT                   /locus_tag="SAS0381a"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS. No significant database hits"
FT                   /protein_id="CAG42153.1"
FT                   /translation="MVNIGVWGFGGLEVWRFGGLEVWRFGGCERIGCGL"
FT   CDS_pept        complement(426195..426554)
FT                   /transl_table=11
FT                   /locus_tag="SAS0382"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0420"
FT                   /protein_id="CAG42154.1"
FT                   /translation="MNIISTILIIFVALEFFYIMYLETIATTSKKTSETFNISVDKLKD
FT                   KNINLLLKNQGVYNGLIGILLIYGLFISSNPKEICAAILVYIIGVAIYGGLSSNISIFF
FT                   KQGTLPVLALISMLW"
FT   misc_feature    complement(order(426243..426311,426339..426407,
FT                   426489..426545))
FT                   /note="3 probable transmembrane helices predicted for
FT                   SAS0382 by TMHMM2.0 at aa 4-22, 50-72 and 82-104"
FT   CDS_pept        complement(426573..427418)
FT                   /transl_table=11
FT                   /locus_tag="SAS0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0421"
FT                   /protein_id="CAG42155.1"
FT                   /translation="MNIMLTGATGHLGTHITNQAIANHIDHFHIGVRNVEKVPEDWRGK
FT                   VPVRQLDYFNPESMVEVFKGMDTVVFIPSIIHPSFKRIPEVENLVYAAKQSGVAHIIFI
FT                   GYYADQHNNPFHMSPYFGYAARLLATSGIDYTYVRMAMYMDPLKPYLPELMNMHKLIYP
FT                   AGDGRINYITRNDIARGVIAIIKNPDTWGKRYLLSGYSYDMKELAAILSEASGTEIKYE
FT                   PVSLETFAEMYDEPKGFGALLASMYDAGARGLLDQESNDFQQLVNDQPQTLQSFLQENI
FT                   "
FT   CDS_pept        427890..428570
FT                   /transl_table=11
FT                   /locus_tag="SAS0384"
FT                   /product="exotoxin"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0422"
FT                   /protein_id="CAG42156.1"
FT                   /translation="MKFKAIAKASLALGMLATGVITSNVQSVQAKTEVKQQSEADLKLY
FT                   YNGPSFEYKKVTGYGFIEGKDRFIDFIYNGQYNKISLVGSDKDKYNEEVNPDIDVFVVR
FT                   EGNGRQADNHSIGGITKTNRGVYYDYIHTPILEIKKGKEEPQSSLYQIYKEDISLKELD
FT                   FKLRKQLISQSGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGRQIQKIL
FT                   VEMK"
FT   misc_feature    427890..427979
FT                   /note="Signal peptide predicted for SAS0384 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.978 between residues 30 and 31"
FT   misc_feature    428280..428567
FT                   /note="Pfam match to entry PF02876 Stap_Strp_tox_C,
FT                   Staphylococcal/Streptococcal toxin, beta-grasp domain,
FT                   score -8.3, E-value 0.0056"
FT   misc_feature    428349..428420
FT                   /note="PS00278 Staphyloccocal enterotoxin/Streptococcal
FT                   pyrogenic exotoxin signature 2."
FT   CDS_pept        428856..429551
FT                   /transl_table=11
FT                   /locus_tag="SAS0385"
FT                   /product="exotoxin"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0423"
FT                   /protein_id="CAG42157.1"
FT                   /translation="MKMKSIVKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLK
FT                   AYYTQPSIEYKNVTGYISFIQPSIKFMNIIDGNSVNNIALIGKDKQHYHTGVHRNLNIF
FT                   YVNEDKRFEGAKYSIGGITSANDKAVDLIAEARVIKADHIGEYDYDFFPFKIDKEAMSL
FT                   KEIDFKLRKYLIDNYGLYGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDID
FT                   RIEIKVRKA"
FT   misc_feature    428856..428945
FT                   /note="Signal peptide predicted for SAS0385 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.996 between residues 30 and 31"
FT   misc_feature    429267..429536
FT                   /note="Pfam match to entry PF02876 Stap_Strp_tox_C,
FT                   Staphylococcal/Streptococcal toxin, beta-grasp domain,
FT                   score -29.4, E-value 0.26"
FT   CDS_pept        429842..430912
FT                   /transl_table=11
FT                   /locus_tag="SAS0386"
FT                   /product="exotoxin"
FT                   /protein_id="CAG42158.1"
FT                   /translation="MKMRTITKTSLALGLLTTGAITVTTQSVKAEKIQSTKVDKVPTLK
FT                   AERLAMINITAGANSATTQAANTRQERTPKLEKAPNTNEEKTSASKIEKISQPKQEEQK
FT                   TLNISATPAPKQEQSQTTTESTTQQTKMTTPPSTNTPQPMQSTKSDTPQSPTIKQAQTD
FT                   MTPKYEDLRAYYTKPSFEFEKQFGFLLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKD
FT                   GPYDNIDVFIVLEDNKYQLKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEY
FT                   MITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMA
FT                   DVIDGTNIDNIEVNIK"
FT   misc_feature    429842..429931
FT                   /note="Signal peptide predicted for SAS0386 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.881 between residues 30 and 31"
FT   misc_feature    430604..430909
FT                   /note="Pfam match to entry PF02876 Stap_Strp_tox_C,
FT                   Staphylococcal/Streptococcal toxin, beta-grasp domain,
FT                   score -4.3, E-value 0.0027"
FT   misc_feature    430694..430765
FT                   /note="PS00278 Staphyloccocal enterotoxin/Streptococcal
FT                   pyrogenic exotoxin signature 2."
FT   CDS_pept        431277..432224
FT                   /transl_table=11
FT                   /locus_tag="SAS0387"
FT                   /product="exotoxin"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0424"
FT                   /protein_id="CAG42159.1"
FT                   /translation="MKITTIAKTSLALGLLTTGVITTTTQAANATTPPSTKVETPQQVA
FT                   NATTPSSTKVEAPQQAANATTPSSTKVEAPQSKPNATTPSSTKVEAPQQAANATTPPSS
FT                   NVDTSPPQSPTTKQVPTEINPKFKDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPD
FT                   YFIYKIALVGKDDKKYGEGVHRNVDVFVVLEENNYNLEKYSVGGITKSNSKKVDHKAGV
FT                   RITKEDNKGTISHDVSEFKITKEQISLKELDFKLRKQLIEKNNLYGNVGSGKIVIKMKN
FT                   GGKYTFELHKKLQENRMADVIDGTNIDNIEVNIK"
FT   misc_feature    431277..431366
FT                   /note="Signal peptide predicted for SAS0387 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.592 between residues 30 and 31"
FT   misc_feature    431928..432221
FT                   /note="Pfam match to entry PF02876 Stap_Strp_tox_C,
FT                   Staphylococcal/Streptococcal toxin, beta-grasp domain,
FT                   score -0.3, E-value 0.0013"
FT   misc_feature    432006..432077
FT                   /note="PS00278 Staphyloccocal enterotoxin/Streptococcal
FT                   pyrogenic exotoxin signature 2."
FT   CDS_pept        432588..433292
FT                   /transl_table=11
FT                   /locus_tag="SAS0388"
FT                   /product="exotoxin 3"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0427"
FT                   /protein_id="CAG42160.1"
FT                   /translation="MKMAAIAKASLALGILATGTITSLHQTVNASEHEAKYENVTKDIF
FT                   DLRDYYSGASKELKNVTGYRYSKGGKHYLIFDKHQKFTRIQIFGKDIERFKARKNPGLD
FT                   IFVVKEAENRNGTVFSYGGVTKKNQDAYYDYINAPRFQIKRDEGDGIATYGRVHYIYKE
FT                   EISLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQTNRMSDVID
FT                   GRNIEKIEANIR"
FT   misc_feature    432588..432677
FT                   /note="Signal peptide predicted for SAS0388 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.985 between residues 30 and 31"
FT   misc_feature    433038..433283
FT                   /note="Pfam match to entry PF02876 Stap_Strp_tox_C,
FT                   Staphylococcal/Streptococcal toxin, beta-grasp domain,
FT                   score -31.0, E-value 0.34"
FT   misc_feature    433071..433142
FT                   /note="PS00278 Staphyloccocal enterotoxin/Streptococcal
FT                   pyrogenic exotoxin signature 2."
FT   CDS_pept        433738..434436
FT                   /transl_table=11
FT                   /locus_tag="SAS0389"
FT                   /product="exotoxin"
FT                   /protein_id="CAG42161.1"
FT                   /translation="MKLKALAKATLVLGLLATGVITTESQTVKAAESTQGQHNYKSLKY
FT                   YYSKPSIELINVDGLYRQHLTDKGAYVWKNLKDYYIGLLGEDSKKFKSDVYGDLDAFLV
FT                   IEEEPVKGRQYSIGGISKTNSKEFKEREVDVKVTRKADRDTTSTKDSKFKITKEEISLK
FT                   ELDFKLRQKLMKEENLYDAINHRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKI
FT                   KEINVELEYK"
FT   misc_feature    433738..433827
FT                   /note="Signal peptide predicted for SAS0389 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 30 and 31"
FT   misc_feature    434128..434427
FT                   /note="Pfam match to entry PF02876 Stap_Strp_tox_C,
FT                   Staphylococcal/Streptococcal toxin, beta-grasp domain,
FT                   score -17.3, E-value 0.029"
FT   misc_feature    434206..434277
FT                   /note="PS00278 Staphyloccocal enterotoxin/Streptococcal
FT                   pyrogenic exotoxin signature 2."
FT   CDS_pept        434858..435553
FT                   /transl_table=11
FT                   /locus_tag="SAS0390"
FT                   /product="exotoxin 1"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0428"
FT                   /protein_id="CAG42162.1"
FT                   /translation="MKLKTLAKATLALGLLTTGVITSEGQAVQAKEKQERVQHLYDIKD
FT                   LHRYYSSESFEFSNISGKVENYNGSNVVRFNQENQNHQLFLSGKDKDKYKEGLEGQNVF
FT                   VVKELIDPNGRLSTVGGVTKKNNQSSETNTPLFIKKVYGGNLDASIESFLINKEEVSLK
FT                   ELDFKIRQHLVKNYGLYKGTTKYGKITFNLKDGEKQEIDLGDKLQFEHMGDVLNSKDIQ
FT                   NIAVTINQI"
FT   misc_feature    434858..434947
FT                   /note="Signal peptide predicted for SAS0390 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.939 between residues 30 and 31"
FT   misc_feature    435257..435544
FT                   /note="Pfam match to entry PF02876 Stap_Strp_tox_C,
FT                   Staphylococcal/Streptococcal toxin, beta-grasp domain,
FT                   score 5.6, E-value 0.00044"
FT   misc_feature    435326..435397
FT                   /note="PS00278 Staphyloccocal enterotoxin/Streptococcal
FT                   pyrogenic exotoxin signature 2."
FT   CDS_pept        435886..436590
FT                   /transl_table=11
FT                   /locus_tag="SAS0391"
FT                   /product="exotoxin"
FT                   /protein_id="CAG42163.1"
FT                   /translation="MNMKFTAIAKAIFVLGILTTSVMITENQSVNAKGKYEKMNRLYDT
FT                   NKLHQYYSGPSYELTNVSGQSQGYYDSNVLLFNQQNQKFQVFLLGKDENKYKEKTHGLD
FT                   VFAVPELVDLDGRIFSVSGVTKKNVKSIFESLRTPNLLVKKIDDKDGFSYDEFFFIQKE
FT                   EVSLKELDFKIRKLLIKKYKLYEGAADKGRIVINMKDENKYEIDLSDKLGFERMADVIN
FT                   SEQIKNIEVNLK"
FT   misc_feature    435886..435981
FT                   /note="Signal peptide predicted for SAS0391 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.914 between residues 32 and 33"
FT   misc_feature    436300..436587
FT                   /note="Pfam match to entry PF02876 Stap_Strp_tox_C,
FT                   Staphylococcal/Streptococcal toxin, beta-grasp domain,
FT                   score 25.4, E-value 1.2e-05"
FT   misc_feature    436369..436440
FT                   /note="PS00278 Staphyloccocal enterotoxin/Streptococcal
FT                   pyrogenic exotoxin signature 2."
FT   CDS_pept        436969..437667
FT                   /transl_table=11
FT                   /locus_tag="SAS0392"
FT                   /product="exotoxin 5"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0429"
FT                   /protein_id="CAG42164.1"
FT                   /translation="MKFTALAKATLALGILTTGVFTTESKAVHAKVELDETQRKYYINM
FT                   LHQYYSEESFEPTNISVKSEDYYGSNVLNFKQRNKAFKVFLLGDDKNKYKEKTHGLDVF
FT                   AVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKIDPKHGFSINELFFIQKEEV
FT                   SLKELDFKIRKMLVEKYRLYKGASDKGRIVINMKDEKKYVIDLSEKLSFDRMFDVMDSK
FT                   QIKNIEVNLN"
FT   misc_feature    436969..437049
FT                   /note="Signal peptide predicted for SAS0392 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.600 between residues 27 and 28"
FT   misc_feature    437377..437664
FT                   /note="Pfam match to entry PF02876 Stap_Strp_tox_C,
FT                   Staphylococcal/Streptococcal toxin, beta-grasp domain,
FT                   score 12.1, E-value 0.00014"
FT   misc_feature    437446..437517
FT                   /note="PS00278 Staphyloccocal enterotoxin/Streptococcal
FT                   pyrogenic exotoxin signature 2."
FT   CDS_pept        438026..438709
FT                   /transl_table=11
FT                   /locus_tag="SAS0393"
FT                   /product="exotoxin 4"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0431"
FT                   /protein_id="CAG42165.1"
FT                   /translation="MKLTAIAKAALALGILTTGTLTTEVHSGHAKQNQKSVNKHDKEAL
FT                   YRYYTGKTMEMKNISALKHGKNNLRFKFRGIKIQVLLPGNDKSKFQQRSYEGLDVFFVQ
FT                   EKRDKHDIFYTVGGVIQNNKTSGVVSAPILNISKEKGEDAFVKGYPYYIKKEKITLKEL
FT                   DYKLRKHLIEKYGLYKTISKDGRVKISLKDGSFYNLDLRSKLKFKYMGEVIESKQIKDI
FT                   EVNLK"
FT   misc_feature    438026..438106
FT                   /note="Signal peptide predicted for SAS0393 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.992) with cleavage site
FT                   probability 0.575 between residues 27 and 28"
FT   misc_feature    438416..438706
FT                   /note="Pfam match to entry PF02876 Stap_Strp_tox_C,
FT                   Staphylococcal/Streptococcal toxin, beta-grasp domain,
FT                   score -1.6, E-value 0.0016"
FT   misc_feature    438488..438559
FT                   /note="PS00278 Staphyloccocal enterotoxin/Streptococcal
FT                   pyrogenic exotoxin signature 2."
FT   CDS_pept        438787..438918
FT                   /transl_table=11
FT                   /locus_tag="SAS0393a"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0432"
FT                   /note="Doubtful CDS. No significant database hits"
FT                   /protein_id="CAG42166.1"
FT                   /translation="MHQSISSLSCFGLRFMDSTPIFINIKIPPPTSKFSTSQHTQML"
FT   CDS_pept        438971..440527
FT                   /transl_table=11
FT                   /locus_tag="SAS0394"
FT                   /product="putative restriction enzyme modification protein"
FT                   /protein_id="CAG42167.1"
FT                   /translation="MSITEKQRQQQAELHKKLWSIANDLRGNMDASEFRNYILGLIFYR
FT                   FLSEKAEQEYADALAGEDITYQETWADEEYREDLKAELIDQVGYFIEPQDLFSAMIREI
FT                   ETQDFDIEHLATAIRKVETSTLGEESENDFIGLFSDMDLSSTRLGNNVKERTALISKVM
FT                   VNLDDLPFVHSDMEIDMLGDAYEFLIGRFAATAGKKAGEFYTPQQVSKILAKIVTDGKD
FT                   KLRHVYDPTCGSGSLLLRVGKETQVYRYFGQERNNTTYNLARMNMLLHDVRYENFDIRN
FT                   DDTLENPAFLGHTFDAVIANPPYSAKWTADSKFENDERFSGYGKLAPKSKADFAFIQHM
FT                   VHYLDDEGTMAVVLPHGVLFRGAAEGVIRRYLIEEKNYLEAVIGLPANIFYGTSIPTCI
FT                   LVFKKCRQQEDYVLFIDASNDFEKGKNQNHLTDAQVERIINTYKRKETIDKYSYSATLQ
FT                   EIADNDYNLNIPRYVDTFEEEAPIDLDQVQQDLKNIDKEIAEVEQEINAYLKELGVLKD
FT                   E"
FT   misc_feature    438998..439738
FT                   /note="Pfam match to entry PF02506 Methylase_M, Type I
FT                   restriction modification system, M protein, score 271.1,
FT                   E-value 1.6e-78"
FT   misc_feature    439862..439882
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT   misc_feature    439883..440368
FT                   /note="Pfam match to entry PF02384 N6_Mtase, N-6 DNA
FT                   Methylase, score 254.9, E-value 1.1e-73"
FT   CDS_pept        440520..441779
FT                   /transl_table=11
FT                   /locus_tag="SAS0395"
FT                   /product="putative restriction and modification system
FT                   specificity protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0434"
FT                   /protein_id="CAG42168.1"
FT                   /translation="MSNTQKKNVPELRFPGFEGEWEEKKLGDLTTKIGSGKTPKGGSEN
FT                   YTNKGIPFLRSQNIRNGKLNLNDLVYISKDIDDEMKNSRTYYGDVLLNITGASIGRTAI
FT                   NSIVEIHANLNQHVCIIRLKKEYYYNFFGQYLLSRKGKRKIFLAQSGGSREGLNFKEIA
FT                   NLKIFTPTIFEEQQKIGEFISKLDRQIELEEQKLELLQQQKKGYMQKIFSQELRFKDEE
FT                   GKDYPDWKSKSIQEIFENKGGTALETEFNFDGNYKVISIGSYSINSTYNDQNIRVNKNK
FT                   KTEKYILSKGDLAMVLNDKTKDGKIIGRSIFIDKDNQYIYNQRTERLIPFAENDNKFLW
FT                   FLMNTDLIRNKIKGMMQGATQVYINYSSIKLISIQLPLLEEQQKIRGFLEVLSGITTKQ
FT                   LHKIDQLKERKKAFLQKMFI"
FT   misc_feature    440580..441083
FT                   /note="Pfam match to entry PF01420 Methylase_S, Type I
FT                   restriction modification DNA specificity domain, score
FT                   82.9, E-value 6.9e-22"
FT   misc_feature    441204..441701
FT                   /note="Pfam match to entry PF01420 Methylase_S, Type I
FT                   restriction modification DNA specificity domain, score
FT                   68.4, E-value 1.6e-17"
FT   CDS_pept        442185..442877
FT                   /transl_table=11
FT                   /locus_tag="SAS0396"
FT                   /product="exotoxin"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0435"
FT                   /protein_id="CAG42169.1"
FT                   /translation="MKLKNIAKASLALGILTTGMITTTAQPVKAIEQSRLSVTSKDTQE
FT                   LKKYYSGTGYNFQNVSGYREGNKMNIIDGPQLNVVTLLGTDKERFKDDEDYEGLDVFVV
FT                   REGSGKHADNISIGGITKTNKNQYKDPVQNVNLLTSKSNGQNTASVTSEYYSINKEEIS
FT                   LKELDFKLRKQLIDKHDLYKTEPKDSKIKVSMKNGGYYTFELNKKLQPHRMGDTIDSRN
FT                   IKKIEVNL"
FT   misc_feature    442185..442274
FT                   /note="Signal peptide predicted for SAS0396 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.994 between residues 30 and 31"
FT   misc_feature    442581..442874
FT                   /note="Pfam match to entry PF02876 Stap_Strp_tox_C,
FT                   Staphylococcal/Streptococcal toxin, beta-grasp domain,
FT                   score -3.7, E-value 0.0024"
FT   misc_feature    442659..442730
FT                   /note="PS00278 Staphyloccocal enterotoxin/Streptococcal
FT                   pyrogenic exotoxin signature 2."
FT   CDS_pept        442899..444401
FT                   /transl_table=11
FT                   /locus_tag="SAS0397"
FT                   /product="putative exported protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0436"
FT                   /protein_id="CAG42170.1"
FT                   /translation="MRENFKLRKMKVGLVSVAITMLYIMTNGEAEASEGSQTVKNPKVN
FT                   ATEEIKVGSQPVQNNQEVSSEQTKKNFVNLDPIKPGAQKVTGTTLPSHIILMNIDGKSA
FT                   DSVDGGNSDLVFADENGRFEYPLHNRKIVHNQEIEVSSSSPDLGDDEEDEEVEEDSTEK
FT                   AGTEEENTDAKATYTTPRYEKAYEIPKEQLKEKDGHHQVFIEPITEGSGIIKGHTSVKG
FT                   KVALSINNKFINFEERAKDGISKEDTKASSDGVWMPINEKGYFDFDFKKNPFDNLELKK
FT                   NDEISLTFAPDDEDEALKSLIFKTKVTSLEDIDKAETKYDHTKVEKVKVLKDVKEDLHV
FT                   DEIYGSLYHTEQGKGILDKQGTKEITGKTKFANAVVKVYSDLGDAQLFPDIQVDENGKF
FT                   SFDAEKAGFRLQNGETLNFAVVKPITGELLHQGFVSKYIDVYESPEEKKEREFEEKLEN
FT                   TPAYHKLHGDKIVGYDVQGNPSTWFYPLGEKKVERKAPKLEK"
FT   misc_feature    442899..442994
FT                   /note="Signal peptide predicted for SAS0397 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.856 between residues 32 and 33"
FT   CDS_pept        complement(444508..444816)
FT                   /transl_table=11
FT                   /locus_tag="SAS0398"
FT                   /product="putative exported protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0437"
FT                   /protein_id="CAG42171.1"
FT                   /translation="MKFKKVLVATAMVGVLATGVVGYSNQADAKVYSQNGLVLHDDANF
FT                   LEHELSYIDVLLDKNADQATKDNLRSYFADKGLHSIKDIINKAKQDGFDVSKYEHVK"
FT   misc_feature    complement(444730..444816)
FT                   /note="Signal peptide predicted for SAS0398 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.788 between residues 29 and 30"
FT   CDS_pept        445152..445964
FT                   /transl_table=11
FT                   /locus_tag="SAS0399"
FT                   /product="putative lipoprotein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0440"
FT                   /db_xref="GOA:Q6GC48"
FT                   /db_xref="InterPro:IPR007595"
FT                   /db_xref="InterPro:IPR038641"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GC48"
FT                   /protein_id="CAG42172.1"
FT                   /translation="MKYKTERRETMGYLKGFALYISILILIVFIAGCGKSDKTKEDSKE
FT                   AQIKKSFEKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGTWTLLTSFAKSNKPGEIDDE
FT                   GMVLFLNRNIKKATGYYYTSKVHDEFNEKEHQKKYHVELKNNKIVLLDNVEDSKLKNKI
FT                   ENFKFFSQYADFRDFKNYKNGNISSADNVPSFDAEYQISNTDKNVKKLREVYPITTKKS
FT                   PVLKLHIDGDIKGSSIGYKNIEFNFSKVKDEETAVRDFVNFGPSDGVS"
FT   misc_feature    445182..445952
FT                   /note="Pfam match to entry PF04507 DUF576, Protein of
FT                   unknown function, DUF576, score 552.7, E-value 2.5e-163"
FT   misc_feature    445185..445253
FT                   /note="1 probable transmembrane helix predicted for SAS0399
FT                   by TMHMM2.0 at aa 12-34"
FT   misc_feature    445218..445250
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        446012..446782
FT                   /transl_table=11
FT                   /locus_tag="SAS0400"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0442"
FT                   /db_xref="GOA:Q6GC47"
FT                   /db_xref="InterPro:IPR007595"
FT                   /db_xref="InterPro:IPR038641"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GC47"
FT                   /protein_id="CAG42173.1"
FT                   /translation="MGYLKRIGMCISLLIVIIFVTSCGGGNKITGDSKETQIKKSFAKT
FT                   LDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKPGELDDEGMVLNLDRNT
FT                   RTAKGYYFVKKFYEKDKLPDRKNYKVEMKNNKSILLDKVEDPNLKKRIENFKFFGQYAN
FT                   FKDLENYNNGDVSINWNVPSYDVEYKMSNKDENVKQLRSRYNIPTDKAPMLKMHIDGDL
FT                   KGSSVGYKRLEIDFSKEDRDISVIDYLSYKPAKK"
FT   misc_feature    446012..446104
FT                   /note="Signal peptide predicted for SAS0400 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.994) with cleavage site
FT                   probability 0.865 between residues 31 and 32"
FT   misc_feature    446012..446776
FT                   /note="Pfam match to entry PF04507 DUF576, Protein of
FT                   unknown function, DUF576, score 578.8, E-value 3.5e-171"
FT   misc_feature    446030..446098
FT                   /note="1 probable transmembrane helix predicted for SAS0400
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    446048..446080
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        446814..447605
FT                   /transl_table=11
FT                   /locus_tag="SAS0401"
FT                   /product="putative lipoprotein"
FT                   /db_xref="GOA:Q6GC46"
FT                   /db_xref="InterPro:IPR007595"
FT                   /db_xref="InterPro:IPR038641"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GC46"
FT                   /protein_id="CAG42174.1"
FT                   /translation="MEYLKRLALFISVIILTIFIMGCDSQSDTAENPKEGSKEAQIKKS
FT                   FSKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGTWTISTDFAKSNKPGEMDSEGMVLHL
FT                   NRNMRTATGHYTIRTTYDELGKMTREKNYRVELKNNKIVVLDKVEDVNLKHKIENFKFF
FT                   SQYADFKDLKNYKNGRISINENVPYYEAEYKRNNSDGNVKKLREKYPITTKQSPILKLH
FT                   IDGDIKGSSVGYKQIEYMFSKEKEDETFMSDFLNFGPSHSN"
FT   misc_feature    446814..446894
FT                   /note="Signal peptide predicted for SAS0401 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.992) with cleavage site
FT                   probability 0.487 between residues 27 and 28"
FT   misc_feature    446814..447596
FT                   /note="Pfam match to entry PF04507 DUF576, Protein of
FT                   unknown function, DUF576, score 598.9, E-value 3.3e-177"
FT   misc_feature    446850..446882
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        447657..448454
FT                   /transl_table=11
FT                   /locus_tag="SAS0402"
FT                   /product="putative lipoprotein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0444"
FT                   /db_xref="GOA:Q6GC45"
FT                   /db_xref="InterPro:IPR007595"
FT                   /db_xref="InterPro:IPR038641"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GC45"
FT                   /protein_id="CAG42175.1"
FT                   /translation="MGYFKRVLLYIIVMVLSVFIIGCDKSSDTSEKSKGDSKEAQIKKS
FT                   FAKTLDMYPTENLEDFYDKEGYRDGKFKKGDKGTWVIRSEMTTELKNENMVSKGMVIRL
FT                   NRNSRTCTGEYFVRIVKEDSEGKVYSDERKYPVKMENNKIIPLKPIDDEKVKKEIEEFK
FT                   FFVQYGNFKELENYKDGEVTYNPEAPIYSAQYQLKNSDYNVEQLRKRYNIPTQKAPKLL
FT                   LKGSGNLKGSSVGYKNIEFTFVENKEENIYFTDSVYFNPSEDK"
FT   misc_feature    447657..447734
FT                   /note="Signal peptide predicted for SAS0402 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.758) with cleavage site
FT                   probability 0.372 between residues 26 and 27"
FT   misc_feature    447657..448445
FT                   /note="Pfam match to entry PF04507 DUF576, Protein of
FT                   unknown function, DUF576, score 617.6, E-value 7.5e-183"
FT   misc_feature    447675..447728
FT                   /note="1 probable transmembrane helix predicted for SAS0402
FT                   by TMHMM2.0 at aa 7-24"
FT   misc_feature    447693..447725
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        448633..449448
FT                   /transl_table=11
FT                   /locus_tag="SAS0403"
FT                   /product="putative lipoprotein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0443"
FT                   /db_xref="GOA:Q6GC44"
FT                   /db_xref="InterPro:IPR007595"
FT                   /db_xref="InterPro:IPR038641"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GC44"
FT                   /protein_id="CAG42176.1"
FT                   /translation="MMEYIKKIALYMSVLLLIIFIGGCGNMKDEQKKEEQTNKTDSKEE
FT                   QIKKSFAKTLDMYPIKNLEDLYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKADELSNEG
FT                   MVLYLDRNTRTAKGHYFVKTFYEKDKFPDRKKYKVEMKNNKIILLDKVEDPKLKKRIEN
FT                   FKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPV
FT                   LKMHIDGNLKGSSVGYKKLEIDFSKGEKSDLSVIDSLNFQPAKVDEDER"
FT   misc_feature    448636..449427
FT                   /note="Pfam match to entry PF04507 DUF576, Protein of
FT                   unknown function, DUF576, score 604.2, E-value 8.4e-179"
FT   misc_feature    448651..448704
FT                   /note="1 probable transmembrane helix predicted for SAS0403
FT                   by TMHMM2.0 at aa 7-24"
FT   misc_feature    448672..448704
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        449438..450763
FT                   /transl_table=11
FT                   /locus_tag="SAS0404"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0446"
FT                   /protein_id="CAG42177.1"
FT                   /translation="MKDKYKIDPGPIKYNTEETTAISKISYEIENAKLYGIKSKTIGRQ
FT                   IDQLKEAKKFPSNLEYVDSYTDSLNGVTTSAFLNKDTGKVTLGMTGTNIQGEAFKKLKE
FT                   GEFSRQNFTNALETVKDGYADLKILYSPASDQNYRYANTQEFINKIKSKYDIDFITGHS
FT                   LGGRDAVVLGMSNGIPNIVVYNPAPISITSLNPNSPDGKRLLELYKNYKGNITRFVAEN
FT                   DALTENLKKYKHYVFFGNDKVFKNGKGHEMEGFLTEEEQKAIKKELKKLQGYAEENNKS
FT                   FVKHSNNAISKLASIELLRANMMTTNGGGLSSSQQKVLESLTALTIAQSFSQLIDDEIN
FT                   QIKKMYNEKKKKFGKNWEDAQKAGKAVGEDLSVNGVLNALDEGQVNESSMVREPEQMIS
FT                   AKERQLSTIGSSVSNYIMRVRLSINEIVDKDQVLASQIGGLL"
FT   CDS_pept        450760..451083
FT                   /transl_table=11
FT                   /locus_tag="SAS0405"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0447"
FT                   /protein_id="CAG42178.1"
FT                   /translation="MMFNQINNKNELEESYESEKKRIENELQNLNELRHRTRKENERSY
FT                   DVFQYLKHEMNYSEDAQRKMTRNIEAYEQEINEIIRKQEWKLEEYKEDLKKSYEKQLDK
FT                   LSD"
FT   CDS_pept        451102..451416
FT                   /transl_table=11
FT                   /locus_tag="SAS0406"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0448"
FT                   /protein_id="CAG42179.1"
FT                   /translation="MTLIEPDMTLRMPDISTTVETLNLISKMNAQKENIRSVVAPEHKH
FT                   KYKDIENGLKGEEKVLIEQMAHHCEAFKANFKGAAQGDWVKSAMSEIDSIKDDLKKINS
FT                   "
FT   CDS_pept        complement(451700..451894)
FT                   /transl_table=11
FT                   /locus_tag="SAS0407"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0449"
FT                   /protein_id="CAG42180.1"
FT                   /translation="MLFVILVLYIIGITFILLSVFGSKTEGLSTKHTLYTIGSAIITIA
FT                   IFISIGYAIQYLTAALYGL"
FT   misc_feature    complement(order(451727..451795,451832..451885))
FT                   /note="2 probable transmembrane helices predicted for
FT                   SAS0407 by TMHMM2.0 at aa 4-21 and 34-56"
FT   misc_feature    complement(451811..451894)
FT                   /note="Signal peptide predicted for SAS0407 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.835) with cleavage site
FT                   probability 0.293 between residues 28 and 29"
FT   CDS_pept        452092..453294
FT                   /transl_table=11
FT                   /locus_tag="SAS0408"
FT                   /product="putative cobalamin synthesis protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0450"
FT                   /protein_id="CAG42181.1"
FT                   /translation="MAKIPVTVLSGYLGSGKTTLLNHILQNREGRRIAVIVNDMSEVNI
FT                   DKDLVADGGGLSRTDEKLVELSNGCICCTLRDDLLKEVERLVKKGGIDQIVIESTGISE
FT                   PVPVAQTFSYIDDELGIDLTAICRLDTMVTVVDANRFVHDINSEDLLMDRDQSVDETDE
FT                   RSIADLLIDQVEFCDVLIINKIDLISEEELAKLEKVLSALQPTAKIIKTINSEVDLKEV
FT                   LNTQRFDFEKASESAGWIKELESGGHASHTPETEEYGISSFVYKRRLPFHAKRFNDWLE
FT                   TMPNNVVRSKGIVWLAQYNHVACLLSQAGSSCNIHPVTYWVASMSEAQQTQILAERQDV
FT                   AAEWDPEYGDRHTQFVIIGTDLDEEKLTKELDACLVNAQEIDADWQQFEDPYQWQIRPA
FT                   R"
FT   misc_feature    452098..453216
FT                   /note="Pfam match to entry PF02492 cobW, Cobalamin
FT                   synthesis protein/P47K, score 644.3, E-value 6.8e-191"
FT   misc_feature    452122..452145
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        453563..453691
FT                   /transl_table=11
FT                   /locus_tag="SAS0409"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0451"
FT                   /protein_id="CAG42182.1"
FT                   /translation="MSEVNAAINVLLTLTVTRVFQSKRATQFCTWPIYLGIDYENH"
FT   CDS_pept        454880..456364
FT                   /transl_table=11
FT                   /locus_tag="SAS0410"
FT                   /product="putative NADH-Ubiquinone/plastoquinone (complex
FT                   I) protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0452"
FT                   /protein_id="CAG42183.1"
FT                   /translation="MLSFQLLFSLFVIALIIALISGLLFLAPVMPMRYIKLHLYILVMP
FT                   VLFAVIGFFGIHGQHVLGPFKIDRLSWLLAGFVMALGFIIQKFSMRYLLGDHHYRHYFP
FT                   LFTAITSFASLAWMSEDLRLMALCWGMTLLCLTLLMNVNRFWKVPRESAKLSSMTFLCG
FT                   WLAFVGAIVTIYIATGEWRVPQHMSNSTWSLLTNVLLVLAVMIPAAQFPFHRWLIESVT
FT                   APTPVSAIMHAGIVNAGGVILTRFAPIFDNGFALSLLLILSSISVLLGSGISLVQVDYK
FT                   RQLVGSTMSQMGFMLVQCALGVYSAAIIHLILHGIFKATLFLQSGSIVKRFNIPKQASA
FT                   KDAYGWIVMGRVLAIIVAFLFWMSSDRSAYEVLSALILAWSLLVSWNQMVAFSKGRMAR
FT                   LVGMILIAIVTFIYVITHNYFYDVLQNITTHATTPPTVSVIISVVILIFGSLLSIWVAR
FT                   HRYSKGFAVLYVWLVNLGEARSKAIESHPNYLKKYL"
FT   misc_feature    454880..454957
FT                   /note="Signal peptide predicted for SAS0410 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.983) with cleavage site
FT                   probability 0.396 between residues 26 and 27"
FT   misc_feature    order(454898..454966,454979..455047,455084..455137,
FT                   455180..455233,455252..455305,455348..455416,
FT                   455450..455518,455561..455620,455639..455707,
FT                   455750..455818,455906..455974,455984..456037,
FT                   456071..456139,456182..456250)
FT                   /note="14 probable transmembrane helices predicted for
FT                   SAS0410 by TMHMM2.0 at aa 7-29, 34-56, 69-86, 101-118,
FT                   125-142, 157-179, 191-213, 228-247, 254-276, 291-313,
FT                   343-365, 369-386, 398-420 and 435-457"
FT   misc_feature    455234..456118
FT                   /note="Pfam match to entry PF00361 oxidored_q1,
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains,
FT                   score 157.9, E-value 1.9e-44"
FT   CDS_pept        456377..459082
FT                   /transl_table=11
FT                   /locus_tag="SAS0411"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0453"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GC36"
FT                   /protein_id="CAG42184.1"
FT                   /translation="MTTQLNINSVIENAKRVITPLSPISIFAARNPWEGLEADTFEDVA
FT                   KWLRDVRDVDIFPNKALIESAVARGELDESVFNQLVTDMLLEHHYNIPQHYINLYIDNI
FT                   KTLKDVPASYMNHSNVDVVADLLLEKSKRDMADSYHHYDVRPMSDAIIDEQGEPLSEQV
FT                   NRQMIKWTKLYIDQFLSSWTMPKREQSFYHAWLHLAQHDHSFTKAQRQVIKGLPNDPKM
FT                   TIESVLTHFSIDQEDYQAYVEGHLLALPGWAGMLYYRSQQHHFEQHLLTDYLAIRLVVE
FT                   QLLVGDEFKSVTKDCESRSENWFKQTVASWCYYSDMPSDVLLQHDVNEIQTFIHFAATM
FT                   NKNVFKNLWLIAWEMTYESQLKQKIKAGHESVAGALDVNQVNVSENDNANQPHSVLLND
FT                   TQAVDENNSELNQVGTSTKAQIAFCIDVRSEPFRRHIEAAGPFETIGIAGFFGLPIQKD
FT                   AVDEQFKHDSLPVMVPPAYRIKEFADRYDMNVYRQQQQTMSSMFYTFKLMKNNVMPSLL
FT                   LPELSGPFLSLSTIVNSIMPRKSRASLQKITQKWLKKPETKLTIDREFDRTSDLPVGFT
FT                   EQEQIDFALQALKLMDLTEAFAPFVVLAGHASHSHNNPHHASLECGACGGASSGFNAKL
FT                   LAMICNRPNVRQGLKQSGVYIPETTVFAAAEHHTSTDTLAWVYVPDTLSSIALDAYESL
FT                   NDAMPMISEHANRERLDKLPTIGRVNHPVEEAQRFASDWSEVRPEWGLAKNASFIIGRR
FT                   QLTKGIDLEGRTFLHNYDWRKDKDGKLLNTIISGPALVAQWINLQYYASTVAPHFYGSG
FT                   NKATQTVTSGVGVMQGNASDLMYGLSWQSVMAADRTMYHSPIRLLVVVQAPDYVVARLL
FT                   ANNDHFARKVSNHWLRLMSVNEEGRFKSWI"
FT   CDS_pept        459244..459606
FT                   /transl_table=11
FT                   /locus_tag="SAS0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0454"
FT                   /protein_id="CAG42185.1"
FT                   /translation="MKRTKGEIEAEISKAITQWEKDFLGRGSLSVKSDILRDMVIISLQ
FT                   GILTPAEYRVCSTNEGLLNIKRTRSELVESGEQDLNDIIFKITGIKVMSFHSDLSTVTG
FT                   ERIIVFKLEDNLEKHI"
FT   CDS_pept        complement(459835..460182)
FT                   /transl_table=11
FT                   /locus_tag="SAS0413"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0455"
FT                   /protein_id="CAG42186.1"
FT                   /translation="MLCILQIKHCIIEITIFCYFQFSTIYIYYTEGVRRINRVIFVYIA
FT                   LIITLVRFFTPIHPSFSNLIYWIFVLYFIPIILCVIGFKAEKLIATMVIIPNFLGILYR
FT                   LYAYVTHILFM"
FT   misc_feature    complement(order(459853..459921,459934..459993,
FT                   460021..460077,460096..460155))
FT                   /note="4 probable transmembrane helices predicted for
FT                   SAS0413 by TMHMM2.0 at aa 10-29, 36-54, 64-83 and 88-110"
FT   CDS_pept        460289..460963
FT                   /transl_table=11
FT                   /locus_tag="SAS0414"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0456"
FT                   /protein_id="CAG42187.1"
FT                   /translation="MIDKKLTSPKMTVPLFLIALIVFIGMFYSVVTNQEWLKNIDMGSL
FT                   TWFTDYFGEPQRQYVNNLFNYYMTFSAEIGDVKGVVLISIIVTIILFIKQRHLAVWFVT
FT                   YLVSGVIMNKLIKDTVLRPRPYNHLAVDTGFSFPSGHSNASTLLYFALMIIIISLAAKT
FT                   ITKVLSALVMGILWLSILFCRLYFHAHYFSDVIGGTSLAIIWVALFLMVYPYFINHRRQ
FT                   RV"
FT   misc_feature    460289..460375
FT                   /note="Signal peptide predicted for SAS0414 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.887) with cleavage site
FT                   probability 0.558 between residues 29 and 30"
FT   misc_feature    order(460325..460384,460508..460567,460580..460636,
FT                   460718..460771,460790..460858,460871..460939)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SAS0414 by TMHMM2.0 at aa 13-32, 74-93, 98-116, 144-161,
FT                   168-190 and 195-217"
FT   misc_feature    460538..460939
FT                   /note="Pfam match to entry PF01569 PAP2, PAP2 superfamily,
FT                   score 67.7, E-value 2.6e-17"
FT   CDS_pept        461000..461734
FT                   /transl_table=11
FT                   /locus_tag="SAS0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0457"
FT                   /protein_id="CAG42188.1"
FT                   /translation="MRIKTPSPSYLKGTNGHAILLLHSFTGTNRDVKHLAAELNDQGFS
FT                   CYAPNYPGHGLLLKDFMTYNVDDWWEEVEKAYQFLVNEGYESISATGVSLGGLMTLKLA
FT                   QHYPLKRIAVMSAPKEKSDDGLIEHLVYYSQRMSDILNLDQQASSAQLAAIDDYEGEIT
FT                   KFQHFIDDIMTNLNVIKMPANILFGGKDAPSYETSAHFIYEHLGSVDKELNGLKDSHHL
FT                   MTHGEGRDILEENVIRFFNALT"
FT   CDS_pept        461912..462025
FT                   /transl_table=11
FT                   /locus_tag="SAS0415a"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS. No database matches"
FT                   /protein_id="CAG42189.1"
FT                   /translation="MGIAPEVVMWRDVGDIDGVVCGEILAHVYSVEPGILM"
FT   CDS_pept        462187..463527
FT                   /transl_table=11
FT                   /locus_tag="SAS0416"
FT                   /product="sodium:neurotransmitter symporter family protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0458"
FT                   /protein_id="CAG42190.1"
FT                   /translation="MMKRQQSQWKSSTGFILASAGSAIGLGAMWKFPYMAGIYGGGAFL
FT                   AMFLIFTIFVGLPLLIMEFTVGKMGRTYTTQIYSKLTGKKWLNIIGWNGNLAVFILFGF
FT                   YSVIGGWIVIYIGQVLWQLVIFQRINHLQEMNFEAVISNPWLTVLGQGIFIFATMIIVM
FT                   LGVEKGLEKASKVMMPLLFVFLIIIVIKSLTLDGALEGVKFILQPRVSEITADGILFAL
FT                   GQSFFTLSLGTTGMITYASYASKDMTIKSSAISIVVMNIFVSVLAGLAIFPALHSFGYE
FT                   PQEGPGLLFKVLPMVFSQMHLGTLFYLGFLVLFLFAALTSSISLLELNVSNFTKNDNTK
FT                   RKKVAVIGSILVFIISIPATLSFGILKDVRFGAGTIFDNMDFIVSNVLMPLGALGTTLV
FT                   VGQLLDKKLLQQYFGKDRFRLFSGWYYLIKYAMPVVIILVFIVQLFS"
FT   misc_feature    462187..462255
FT                   /note="Signal peptide predicted for SAS0416 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.730) with cleavage site
FT                   probability 0.246 between residues 23 and 24"
FT   misc_feature    462196..463524
FT                   /note="Pfam match to entry PF00209 SNF,
FT                   Sodium:neurotransmitter symporter family, score -98.9,
FT                   E-value 9.6e-14"
FT   misc_feature    order(462223..462276,462319..462387,462466..462534,
FT                   462616..462684,462721..462780,462838..462906,
FT                   462943..463011,463093..463161,463216..463284,
FT                   463327..463395,463453..463521)
FT                   /note="11 probable transmembrane helices predicted for
FT                   SAS0416 by TMHMM2.0 at aa 13-30, 45-67, 94-116, 144-166,
FT                   179-198, 218-240, 253-275, 303-325, 344-366, 381-403 and
FT                   423-445"
FT   CDS_pept        463744..464649
FT                   /transl_table=11
FT                   /locus_tag="SAS0417"
FT                   /product="pyridoxal-phosphate dependent enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0459"
FT                   /protein_id="CAG42191.1"
FT                   /translation="MITYDLIGNTPLVLLEHYSDDKVKIYAKLEQWNPGGSVKDRLGKY
FT                   LVEKAIQEGRVRAGQTIVEATAGNTGIGLAIAANRHHLKCKIFAPYGFSEEKINIMIAL
FT                   GADVSRTSQSEGMHGAQLAARSYAEKYGAVYMNQFESEHNPDTYFHTLGPELTSALQQI
FT                   DYFVAGIGSGGTFTGTARYLKQHHVQCYAVEPEGSVLNGGPAHAHDTEGIGSEKWPIFL
FT                   ERRLVDGIFTIKDQDAFRNVKSLAINEGLLVGSSSGAALQGALNLKAQLSEGTIVVVFP
FT                   DGSDRYMSKQIFNYEENDYE"
FT   misc_feature    463750..464592
FT                   /note="Pfam match to entry PF00291 PALP,
FT                   Pyridoxal-phosphate dependent enzyme, score 296.6, E-value
FT                   3.2e-86"
FT   misc_feature    463825..463881
FT                   /note="PS00901 Cysteine synthase/cystathionine
FT                   beta-synthase P-phosphate attachment site."
FT   CDS_pept        464642..465784
FT                   /transl_table=11
FT                   /locus_tag="SAS0418"
FT                   /product="putative Cys/Met metabolism PLP-dependent enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0460"
FT                   /protein_id="CAG42192.1"
FT                   /translation="MNKKTKLIHGGHTTDDYTGAVTTPIYQTSTYLQDDIGDLRQGYEY
FT                   SRTANPTRSSVESVITALENGKHGFAFSSGVAAISAVVMLLDKGDHIILNSDVYGGTYR
FT                   ALTKVFTRFGIEVDFVDTTHTDSIVQAIRPTTKMLFIETPSNPLLRVTDIKKSAEIAKE
FT                   HGLISVVDNTFMTPYYQNPLDLGIDIVLHSATKYLGGHSDVVAGLVATSDDKLAERLAF
FT                   ISNSTGGILGPQDSYLLVRGIKTLGLRMEQINRSVIEIIKMLQAHPAVQQVFHPSIESH
FT                   LNHDVHMAQADGHTGVIAFEVKNTESAKQLIKATSYYTLAESLGAVESLISVPALMTHA
FT                   SIPADIRAKEGITDGLVRISVGIEDTEDLVDDLKQALDTL"
FT   misc_feature    464651..465775
FT                   /note="Pfam match to entry PF01053 Cys_Met_Meta_PP, Cys/Met
FT                   metabolism PLP-dependent enzyme, score 671.8, E-value
FT                   3.7e-199"
FT   misc_feature    465203..465247
FT                   /note="PS00868 Cys/Met metabolism enzymes
FT                   pyridoxal-phosphate attachment site."
FT   CDS_pept        466081..467106
FT                   /transl_table=11
FT                   /locus_tag="SAS0419"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0461"
FT                   /db_xref="GOA:Q6GC27"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GC27"
FT                   /protein_id="CAG42193.1"
FT                   /translation="MIEFRQVSKTFNKKKQKIDALKDVSFTVNRNDIFGVIGYSGAGKS
FT                   TLVRLVNHLEAASNGQVIVDGHDITNYSDKMMRDIKKDIGMIFQHFNLLNSATVFKNVA
FT                   MPLILSKKSKTEIKQRVTEMLEFVGLSDKKDQFPEELSGGQKQRVAIARALVTNPKILL
FT                   CDEATSALDPATTASILTLLKNVNQTFGITIMMITHEMRVIKDICNRVAVMEKGQVVET
FT                   GTVKEVFSHPKTTIAQNFVSTVIQTEPSTSLIRRLNDEQVGDFKDYKIFVEETQVTQPI
FT                   INDLIQICGREVKILFSSMSEIQGNTVCYMWLRFNMDQQFDDTAINQYFKEKNIQFEEV
FT                   H"
FT   misc_feature    466171..466731
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 224.7, E-value 1.4e-64"
FT   misc_feature    466192..466215
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    466501..466545
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        467110..467769
FT                   /transl_table=11
FT                   /locus_tag="SAS0420"
FT                   /product="putative transport system membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0462"
FT                   /protein_id="CAG42194.1"
FT                   /translation="MFGSDLDSAQLLQALYETLYMVSIALFLGAVIGIPLGVLLVITRK
FT                   QGIWPNIVIHQVLNPIINILRSLPFIILLIAIVPFTKLVVGTSIGTTAAIVPLTVYVAP
FT                   YIARLVENSLLEVDEGIIEAAKAMGASPLQIIRYFLIPEALGSLVLAITTAIIGLIGST
FT                   AMAGAVGGGGIGDLALVYGYQRFDTTVIIITVIVLVIIVQVIQTLGNVLARFIRRH"
FT   misc_feature    467152..467763
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport system inner membrane
FT                   component, score 62.8, E-value 7.8e-16"
FT   misc_feature    order(467167..467235,467293..467346,467356..467424,
FT                   467551..467619,467677..467745)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SAS0420 by TMHMM2.0 at aa 20-42, 62-79, 83-105, 148-170 and
FT                   190-212"
FT   misc_feature    467449..467535
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        467806..468648
FT                   /transl_table=11
FT                   /locus_tag="SAS0421"
FT                   /product="putative lipoprotein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0463"
FT                   /protein_id="CAG42195.1"
FT                   /translation="MKRLIGLVIVALVLLAACGSNNDKKVTIGVASNDTKAWEKVKELA
FT                   KKDDIDVEIKHFSDYNLPNKALNDGDIDMNAFQHFAFLDQYKKAHKGTKISALSTTVLA
FT                   PLGIYSDKIKDVKKVKDGAKVVIPNDVSNQARALKLLEAAGLIKLKKDFGLAGTVKAIT
FT                   SNPKHLKITAVDAQQTARALSDVDIAVINNGVATKAGKDPKNDPIFLEKSNSDAVKPYI
FT                   KIVAVNDKDLDNKTYAKIVELYHSKEAQKALQEDVKDGEKPVNLSKDEIKAIETSLAK"
FT   misc_feature    467806..467880
FT                   /note="Signal peptide predicted for SAS0421 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.271 between residues 25 and 26"
FT   misc_feature    467827..467859
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    467881..468600
FT                   /note="Pfam match to entry PF03180 Lipoprotein_9, NLPA
FT                   lipoprotein, score 385.8, E-value 4.4e-113"
FT   CDS_pept        468980..469984
FT                   /transl_table=11
FT                   /locus_tag="SAS0422"
FT                   /product="putative exported protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0464"
FT                   /db_xref="GOA:Q6GC24"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GC24"
FT                   /protein_id="CAG42196.1"
FT                   /translation="MQKKVIAAIIGTSAISAVAATQANAATTHTVKPGESVWAISNKYG
FT                   ISIAKLKSLNNLTSNLIFPNQVLKVSGSSNSTSNSSRPSTNSGGGSYYTVQAGDSLSLI
FT                   ASKYGTTYQNIMRLNGLNNFFIYPGQKLKVSGTASSSNAASNSSRPSTNSGGGSYYTVQ
FT                   AGDSLSLIASKYGTTYQKIMSLNGLNNFFIYPGQKLKVTGNASTNSGSATTTNRGYNTP
FT                   VFSHQNLYTWGQCTYHVFNRRAEIGKGISTYWWNANNWDNAAAADGYTIDNRPTVGSIA
FT                   QTDVGYYGHVMFVERVNNDGSILVSEMNYSAAPGILTYRTVPAYQVNNYRYIH"
FT   misc_feature    468980..469054
FT                   /note="Signal peptide predicted for SAS0422 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.995 between residues 25 and 26"
FT   misc_feature    469064..469192
FT                   /note="Pfam match to entry PF01476 LysM, LysM domain, score
FT                   69.6, E-value 6.9e-18"
FT   misc_feature    469256..469384
FT                   /note="Pfam match to entry PF01476 LysM, LysM domain, score
FT                   71.3, E-value 2.2e-18"
FT   misc_feature    469457..469585
FT                   /note="Pfam match to entry PF01476 LysM, LysM domain, score
FT                   71.9, E-value 1.4e-18"
FT   misc_feature    469622..469981
FT                   /note="Pfam match to entry PF05257 CHAP, CHAP domain, score
FT                   165.4, E-value 1e-46"
FT   CDS_pept        complement(470169..470438)
FT                   /transl_table=11
FT                   /locus_tag="SAS0423"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0465"
FT                   /protein_id="CAG42197.1"
FT                   /translation="MAKRSKSQRLSSLLNVAGFIVDGYNGYKYHAKNKKLVYLSLGLST
FT                   VGTVLDFYISIKSPRKFKKAVAVVTLITNGARLFTSIRKVKHEY"
FT   misc_feature    complement(470274..470333)
FT                   /note="1 probable transmembrane helix predicted for SAS0423
FT                   by TMHMM2.0 at aa 36-55"
FT   CDS_pept        470578..470982
FT                   /transl_table=11
FT                   /locus_tag="SAS0424"
FT                   /product="MutT domain containing protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0466"
FT                   /protein_id="CAG42198.1"
FT                   /translation="MSKMIKCVCLVEETADKILLVQVRNREKYYFPGGKIEEGESRVQA
FT                   LLREVKEELNLTLTMDEIEYIGTIVGPAYPQQDMLTELNGFRALTKIDWENVTINNEIT
FT                   DIRWIDKDNDALIAPAVKVWIETYGGKHDK"
FT   misc_feature    470584..470970
FT                   /note="Pfam match to entry PF00293 NUDIX, NUDIX domain,
FT                   score 44.0, E-value 3.5e-10"
FT   misc_feature    470677..470736
FT                   /note="PS00893 mutT domain signature."
FT   CDS_pept        470972..471457
FT                   /transl_table=11
FT                   /locus_tag="SAS0425"
FT                   /product="putative acetyltransferase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0467"
FT                   /protein_id="CAG42199.1"
FT                   /translation="MTNNDTIMLRHYVPQDYSMLEAFQLSESDLKFVKTPEENITAAMS
FT                   DNERYPIVVMDGRQCVAFFTLHRGKGVAPFSDNQDAVFFRSFSVDQRYRNRGIGKVVME
FT                   KLASFITSTFQDINEIVLTVNTDNPHAMALYRQQGYQYMGDSMFIGRPVHIMALTIK"
FT   misc_feature    471125..471394
FT                   /note="Pfam match to entry PF00583 Acetyltransf,
FT                   Acetyltransferase (GNAT) family, score 43.1, E-value
FT                   6.4e-10"
FT   CDS_pept        complement(471626..472408)
FT                   /transl_table=11
FT                   /locus_tag="SAS0426"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0468"
FT                   /protein_id="CAG42200.1"
FT                   /translation="MNAVFILALLLLFLMIIFGGRKGFISYLTLFLNFAILIISIVLII
FT                   FGVPIYVVTFFFCIIIGACNLFVLNSYNVKTQAAFISTIVTTILLITLIYLSVYFGHLQ
FT                   GFSTEQQDETYVYSMNIGIDMVQFMVFTIILAVIAAVIDLTITISSPIYELHQVNPTLT
FT                   QYELFQSGMRVGREILATSANTIYLAFFGGQLALFIWFFKLKYSFGHIINSKIFAQEFI
FT                   SIILGGIAVAISIPITAWITAFLIKRPSRQRKNDESIN"
FT   misc_feature    complement(order(471677..471745,471803..471871,
FT                   471995..472063,472106..472174,472193..472261,
FT                   472271..472339,472352..472399))
FT                   /note="7 probable transmembrane helices predicted for
FT                   SAS0426 by TMHMM2.0 at aa 4-19, 24-46, 50-72, 79-101,
FT                   116-138, 180-202 and 222-244"
FT   misc_feature    complement(472340..472408)
FT                   /note="Signal peptide predicted for SAS0426 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.636) with cleavage site
FT                   probability 0.234 between residues 23 and 24"
FT   CDS_pept        complement(472405..473523)
FT                   /transl_table=11
FT                   /locus_tag="SAS0427"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0469"
FT                   /protein_id="CAG42201.1"
FT                   /translation="MFLKYRNLFTKPFNIILGLFCIAFIGAILFTFNNENFYNKPIGQI
FT                   IDVKHVSSTPTKDAQNNRDIKYKNQLKVKILNGQFAGETTTINHQYVKSQADSEAFRTH
FT                   EKVLLHISNKPSDAYIIEKKRDTLTVIITGLFLLTVLLVGRKVGLQSILSLILNSIAIL
FT                   IAIYIHIQHSNINLFLLMTIAMICSTILTLLLVTGWHMRTLITIASTIIGTFLSIGLTE
FT                   LIIYMTDGKGIKYETMNFLSLPPKDIFLASVLIGSLGAIMDVAITIASGMHEILQRTPH
FT                   ISMRRWALAGRNIGQDIMGTMTNILLFSYLSGALPMFLIFLKNANTVTYTISMNWSLEI
FT                   ARALTGGIGIVLTIPITILFMEIFETLRRAKQ"
FT   misc_feature    complement(order(472432..472500,472558..472626,
FT                   472714..472782,472846..472914,472933..473001,
FT                   473014..473073,473092..473145,473428..473487))
FT                   /note="8 probable transmembrane helices predicted for
FT                   SAS0427 by TMHMM2.0 at aa 13-32, 127-144, 151-170, 175-197,
FT                   204-226, 248-270, 300-322 and 342-364"
FT   misc_feature    complement(473407..473523)
FT                   /note="Signal peptide predicted for SAS0427 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.980) with cleavage site
FT                   probability 0.295 between residues 39 and 40"
FT   CDS_pept        complement(473638..474522)
FT                   /transl_table=11
FT                   /locus_tag="SAS0428"
FT                   /product="LysR family regulatory protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0470"
FT                   /protein_id="CAG42202.1"
FT                   /translation="MEIKQLRYFIEVAKREHISETALELNIAQSAISRQITLLEQELNV
FT                   SLFKKQGRNITLTSEGKLLFNEALRIIEHLDSTIEQFQSHGLTKNKSIYIGYDESDVSH
FT                   MLLPLIQTFHLQNDTHVIPNLLDHDTIINSVLNGNIDIGFTELTPEIRKHKQLHMLPLF
FT                   EEHYHLYAPSDDPITMATHPPLIQFEHSHIYCLAPFAETVKKQLRKITKSDVYTISSQP
FT                   LAQYLLRQKEGYIISSQNIHLPESKSWIDIKLDHTELKRTICAITKEPYTKSDIGILLT
FT                   LIQQLMTKTSTFH"
FT   misc_feature    complement(474337..474516)
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family, score
FT                   88.4, E-value 1.5e-23"
FT   misc_feature    complement(474382..474474)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(474412..474477)
FT                   /note="Predicted helix-turn-helix motif for SAS0428 with
FT                   score 1683.000, SD 4.92 at aa 16-37, sequence
FT                   EHISETALELNIAQSAISRQIT"
FT   CDS_pept        474704..479203
FT                   /transl_table=11
FT                   /locus_tag="SAS0429"
FT                   /product="glutamate synthase, large subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0471"
FT                   /protein_id="CAG42203.1"
FT                   /translation="MHNEKLIKGLYDYREEHDACGIGFYANMDNKRSHDIIDKSLEMLR
FT                   RLDHRGGVGADGITGDGAGIMTEIPFAFFKQHVTDFDIPGEGEYAVGLFFSKERILGSE
FT                   HEAVFKKYFEGEGLSILGYRNVPVNKDAIAKHVADTMPVIQQVFIDIRDIEDVEKRLFL
FT                   ARKQLEFYSTQCDLELYFTSLSRKTIVYKGWLRSDQIKKLYTDLSDDLYQSKLGLVHSR
FT                   FSTNTFPSWKRAHPNRMLMHNGEINTIKGNVNWMRARQHKLIETLFGEDQHKVFQIVDE
FT                   DGSDSAIVDNALEFLSLAMEPEKAAMLLIPEPWLYNEANDANVRAFYEFYSYLMEPWDG
FT                   PTMISFCNGDKLGALTDRNGLRPGRYTITKDNFIVFSSEVGVVDVPESNVAFKGQLNPG
FT                   KLLLVDFKQNKVIENNDLKGAIAGELPYKAWIDNHKVDFDFENIQYQDSQWKDETLFKL
FT                   QRQFAYTKEEIHKYIQELVEGKKDPIGAMGYDAPIAVLNERPESLFNYFKQLFAQVTNP
FT                   PIDAYREKIVTSELSYLGGEGNLLAPDETVLDRIQLKRPVLNESHIAAIDQEHFKLTYL
FT                   STVYEGDLEDALEALGREAVNAVKQGAQILVLDDSGLVDSNGFAMPMLLAISHVHQLLI
FT                   KADLRMSTSLVAKSGETREVHHVACLLAYGANAIVPYLAQRTVEQLTLTEGLQGTVVDN
FT                   VKTYTDVLSEGVIKVMAKMGISTVQSYQGAQIFEAIGLSHDVIDRYFTGIQSKLSGISI
FT                   DQIDAENKARQQSDDNYLASGSTFQWRQQGQHHAFNPESIFLLQHACKENDYAQFKAYS
FT                   EAVNKNRTDHIRHLLEFKACTPIDIDQVEPVSDIVKRFNTGAMSYGSISAEAHETLAQA
FT                   MNQLGGKSNSGEGGEDAKRYEVQVDGSNKVSAIKQVASGRFGVTSDYLQHAKEIQIKVA
FT                   QGAKPGEGGQLPGTKVYPWIAKTRGSTPGIGLISPPPHHDIYSIEDLAQLIHDLKNANK
FT                   DADIAVKLVSKTGVGTIASGVAKAFADKIVISGYDGGTGASPKTSIQHAGVPWEIGLAE
FT                   THQTLKLNDLRSRVKLETDGKLLTGKDVAYACALGAEEFGFATAPLVVLGCIMMRVCHK
FT                   DTCPVGVATQNKDLRALYRGKAHHVVNFMHFIAQELREILASLGLKRVEDLVGRTDLLQ
FT                   RSSTLKVNSKAASIDVEKLLCPFDGPNTKEIQQNHNLEHGFDLTNLYEVTKPYIAEGRR
FT                   YTGSFTVNNEQRDVGVITGSEISKQYGEAGLPENTINVYTNGHAGQSLAAYAPKGLMIH
FT                   HTGDANDYVGKGLSGGTVIVKAPFEERQNEIIAGNVSFYGATGGKAFINGSAGERFCIR
FT                   NSGVDVVVEGIGDHGLEYMTGGHVINLGDVGKNFGQGMSGGIAYVIPSDVEAFVENNQL
FT                   DTLSFTKIKHQEEKAFIKQMLEEHVSHTNSTRAIHVLKHFDRIEDVVVKVIPKDYQLMM
FT                   QKIHLHKSLHDNEDEAMLAAFYDDSKTIDAKHKPAVVY"
FT   misc_feature    474761..476029
FT                   /note="Pfam match to entry PF04897 Glu_synth_NTN, Glutamate
FT                   synthase amidotransferase domain, score 881.9, E-value
FT                   2e-262"
FT   misc_feature    476066..476905
FT                   /note="Pfam match to entry PF04898 Glu_syn_central,
FT                   Glutamate synthase central domain, score 528.1, E-value
FT                   6.8e-156"
FT   misc_feature    477059..478162
FT                   /note="Pfam match to entry PF01645 Glu_synthase, Conserved
FT                   region in glutamate synthase, score 757.5, E-value
FT                   5.6e-225"
FT   misc_feature    478385..478969
FT                   /note="Pfam match to entry PF01493 GXGXG, GXGXG motif,
FT                   score 219.1, E-value 6.8e-63"
FT   CDS_pept        479221..480684
FT                   /transl_table=11
FT                   /locus_tag="SAS0430"
FT                   /product="glutamate synthase, small subunit"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0472"
FT                   /protein_id="CAG42204.1"
FT                   /translation="MGEFKGFMKYDKQYLGELSLVDRLKHHKAYQQRFTKEDASIQGAR
FT                   CMDCGTPFCQTGQQYGRETIGCPIGNYIPEWNDLVYHQDFKTAYERLSETNNFPDFTGR
FT                   VCPAPCESACVMKINRESIAIKGIERTIIDEAFENGWVAPKVPSRRRDEKVAIVGSGPA
FT                   GLAAAEELNLLGYQVTIYERARESGGLLMYGIPNMKLDKDVVRRRIKLMEEAGITFING
FT                   VEVGVDIDKATLESEYDAIILCTGAQKGRDLPLEGRMGDGIHFAMDYLTEQTQLLNGEI
FT                   DDITITAKDKNVIIIGAGDTGADCVATALRENCKSIVQFNKYTKLPEAITFTENASWPL
FT                   AMPVFKMDYAHQEYEAKFGKEPRAYGVQTMRYDVDDKGHIRGLYTQILEQGENGMVMKE
FT                   GPERFWPADLVLLSIGFEGTEPTVPNAFNIKTDRNRIVADDTNYQTNNEKVFAAGDARR
FT                   GQSLVVWAIKEGRGVAKAVDQYLASKVCV"
FT   misc_feature    479680..480615
FT                   /note="Pfam match to entry PF00070 pyr_redox, Pyridine
FT                   nucleotide-disulphide oxidoreductase, score 77.0, E-value
FT                   4e-20"
FT   tRNA            480953..481045
FT                   /note="tRNA Ser anticodon TGA, Cove score 69.34"
FT   CDS_pept        481515..482942
FT                   /transl_table=11
FT                   /locus_tag="SAS0431"
FT                   /product="sugar-specific PTS transport system, IIBC
FT                   component"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0473"
FT                   /protein_id="CAG42205.1"
FT                   /translation="MAVKREDVKAIVSAIGGKENLEAATHCVTRLRLVLKDESKVDKDA
FT                   LSNNALVKGQFKADHQYQIVIGPGTVDEVYKQFIDETGAQEASKDEAKQAAAQKGNPVQ
FT                   RLIKLLGDIFIPILPAIVTAGLLMGINNLLTMKGLFGPKALIEMYPQIADISNIINVIA
FT                   STAFIFLPALIGWSSMRVFGGSPILGIVLGLILMHPQLVSQYDLAKGNIPTWNLFGLEI
FT                   KQLNYQGQVLPVLIAAYVLAKIEKGLNKVVHDSIKMLVVGPVALLVTGFLAFIIIGPVA
FT                   LLIGTGITSGVTFIFQHAGWLGGAIYGLLYAPLVITGLHHMFLAVDFQLMGSSLGGTYL
FT                   WPIVAISNICQGSAAFGAWFVYKRRKMVKEEGLALTSCISGMLGVTEPAMFGVNLPLKY
FT                   PFIAAISTSCVLGAIVGMNNVLGKVGVGGVPAFISIQKEFWPVYLIVTAIAIVVPCILT
FT                   IVMSHFSKQKAKEIVED"
FT   misc_feature    481536..481640
FT                   /note="Pfam match to entry PF00367 PTS_EIIB,
FT                   phosphotransferase system, EIIB, score 68.2, E-value
FT                   1.8e-17"
FT   misc_feature    481572..481625
FT                   /note="PS01035 PTS EIIB domains cysteine phosphorylation
FT                   site signature."
FT   misc_feature    481845..482738
FT                   /note="Pfam match to entry PF02378 PTS_EIIC,
FT                   Phosphotransferase system, EIIC, score 159.0, E-value
FT                   8.6e-45"
FT   misc_feature    order(481851..481919,481977..482036,482055..482123,
FT                   482310..482378,482415..482483,482526..482594,
FT                   482631..482699,482712..482780,482829..482897)
FT                   /note="9 probable transmembrane helices predicted for
FT                   SAS0431 by TMHMM2.0 at aa 113-135, 155-174, 181-203,
FT                   266-288, 301-323, 338-360, 373-395, 400-422 and 439-461"
FT   CDS_pept        483006..484646
FT                   /transl_table=11
FT                   /locus_tag="SAS0432"
FT                   /product="putative glycosyl hydrolase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0474"
FT                   /protein_id="CAG42206.1"
FT                   /translation="MSKEIDWRKSVVYQIYPKSFNDTTGNGIGDINGIIEKLDYIKLLG
FT                   VDYIWLTPVYESPMNDNGYDISNYLEINEDFGTMDDFEKLIKVAHQKDLKVMLDIVINH
FT                   TSTEHEWFKEARKSKDNPYRDYYFFRSSEDGPPTNWHSKFGGNAWKFDSETDEYYLHLF
FT                   DVSQADLNWDNPEVRQSLYRIVNHWIDFGVDGFRFDVINLISKGEFKDSDKIGKEFYTD
FT                   GPRVHEFLHELNRQTFGNTDMMTVGEMSSTTIENCIKYTQPERQELNSVFNFHHLKVDY
FT                   VDGEKWTNAKLDFHKLKKILMQWQRGIYDGGGWNAIFWCNHDQPRVVSRFGDDTSEEMR
FT                   IQSAKMLAIALHMLQGTPYIYQGEEIGMTDPHFTSIAQYRDVESINAYHQLLSEGHAEA
FT                   DVLTILGQKSRDNSRTPMQWSDDVNAGFTAGKPWIDISENYHQVNVRQALQNKESIFYT
FT                   YQKLIQLRHTHDIITYGDIVPRFMDHDHLFVYERHYKNQQWLVIANFSASAVDLPEGLA
FT                   REGRVVIQTGTVENNTISGFGAIVIETNA"
FT   misc_feature    483045..484247
FT                   /note="Pfam match to entry PF00128 alpha-amylase, Alpha
FT                   amylase, catalytic domain, score 443.1, E-value 2.5e-130"
FT   CDS_pept        484671..485399
FT                   /transl_table=11
FT                   /locus_tag="SAS0433"
FT                   /product="GntR family regulatory protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0475"
FT                   /protein_id="CAG42207.1"
FT                   /translation="MAKQKKFMKIYEALKEDILNGQIQYGEQIPSEHDLVQLYQSSRET
FT                   VRKALDLLALDGMIQKIHGKGSLVIYQEVTEFPFSELVSFKEMQEEMGVAYLTEVVVNE
FT                   VVEAHEVPEVQHALNINSSESLIHIVRTRRLNQHVKIVDEDYFLKSIVSDIGNDVASDS
FT                   IYDYLEKVLNLNISYSSKSITFEPFDEQAYQLFGDVSVAYSATVRSIVYLENTMPFQYN
FT                   ISKHLANEFKFNDFSRRRIK"
FT   misc_feature    484686..484877
FT                   /note="Pfam match to entry PF00392 gntR, Bacterial
FT                   regulatory proteins, gntR family, score 57.6, E-value
FT                   2.7e-14"
FT   misc_RNA        485578..485680
FT                   /note="Small cytoplasmic RNA (scRNA, 4.5S RNA), signal
FT                   recognition particle (SRP) as predicted by Rfam (RF00169),
FT                   score 77.94"
FT   CDS_pept        485839..485904
FT                   /transl_table=11
FT                   /locus_tag="SAS0433a"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0475a"
FT                   /note="Doubtful CDS. No database matches"
FT                   /protein_id="CAG42208.1"
FT                   /translation="MWEVAFLYVKFDSSEIDVQFE"
FT   CDS_pept        486042..486566
FT                   /transl_table=11
FT                   /locus_tag="SAS0434"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0476"
FT                   /protein_id="CAG42209.1"
FT                   /translation="MQIYLSTLTELDYDKSLNSIEESFDDNPETSWQALAKVKHLRKSP
FT                   CYNFELEVIAKNENNDVVGHVLLIEVEINSDDKTYYGLAIASLSVHPELRGQKLGRGLV
FT                   QAVEERAKAQEYSTVVVDHCFDYFEKLGYQNAAEHDIKLESGDAPLLVKYLWDNLTDAP
FT                   HGIVKFPEHFY"
FT   misc_feature    486201..486443
FT                   /note="Pfam match to entry PF00583 Acetyltransf,
FT                   Acetyltransferase (GNAT) family, score 52.6, E-value
FT                   8.9e-13"
FT   CDS_pept        486635..488332
FT                   /transl_table=11
FT                   /locus_tag="SAS0435"
FT                   /product="DNA polymerase III, tau subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0477"
FT                   /protein_id="CAG42210.1"
FT                   /translation="MNYQALYRMYRPQSFEDVVGQEHVTKTLRNAISKEKQSHAYIFSG
FT                   PRGTGKTSIAKVFAKAINCLNSTDGEPCNECHICKGITQGTNSDVIEIDAASNNGVDEI
FT                   RNIRDKVKYAPSELKYKVYIIDEVHMLTTGAFNALLKTLEEPPAHAIFILATTEPHKIP
FT                   PTIISRAQRFDFKAISLNQIVERLKFVADAQQIECEDEALAFIAKASEGGMRDALSIMD
FT                   QAIAFGDGTLTLQDALNVTGSVHDEALDHLFDDIVQGDVQASFKKYHQFITEGKEVNRL
FT                   INDMIYFVRDTIMNKTSEKDTEYRALMNLELDMLYQMIDLINDTLVSIRFSVNQNVHFE
FT                   VLLVKLAEQIKGQPQVIANVAEPAQIASSPNTDVLLQRMEQLEQELKTLKAQGVSVAPV
FT                   QKSSKKPARGIQKSKNAFSMQQIAKVLDKANKADIKLLKDHWQEVIDHAKNNDKKSLVS
FT                   LLQNSEPVAASEDHVLVKFEEEIHCEIVNKDDEKRSSIESVVCNIVNKNVKVVGVPSDQ
FT                   WQRVRTEYLQNRKNEGDDMPKQQAQQTDIAQKAKDLFGEETVHVIDEE"
FT   misc_feature    486752..487324
FT                   /note="Pfam match to entry PF00004 AAA, ATPase family
FT                   associated with various cellular activities (AAA), score
FT                   47.8, E-value 2.6e-11"
FT   misc_feature    486767..486790
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    486851..486868
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    487619..487672
FT                   /note="PS00214 Cytosolic fatty-acid binding proteins
FT                   signature."
FT   CDS_pept        488422..488739
FT                   /transl_table=11
FT                   /locus_tag="SAS0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0478"
FT                   /db_xref="GOA:Q6GC09"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GC09"
FT                   /protein_id="CAG42211.1"
FT                   /translation="MRGGGNMQQMMKQMQKMQKKMAQEQEKLKEERIVGTAGGGMVAVT
FT                   VTGHKEVVDVEIKEEAVDPDDIEMLQDLVLAATNEAMNKADELTQERLGKHTQGLNIPG
FT                   M"
FT   misc_feature    488452..488730
FT                   /note="Pfam match to entry PF02575 DUF149, Uncharacterised
FT                   BCR, YbaB family COG0718, score 176.6, E-value 4.3e-50"
FT   CDS_pept        488746..489342
FT                   /transl_table=11
FT                   /locus_tag="SAS0437"
FT                   /product="putative recombination protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0479"
FT                   /db_xref="GOA:Q6GC08"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GC08"
FT                   /protein_id="CAG42212.1"
FT                   /translation="MHYPEPISKLIDSFMKLPGIGPKTAQRLAFHTLDMKEDDVVQFAK
FT                   ALVDVKRELTYCSVCGHITENDPCYICEDKQRDRSVICVVEDDKDVIAMEKMREYKGLY
FT                   HVLHGSISPMDGIGPEDINIPSLIERLKNDEVSELILAMNPNLEGESTAMYISRLVKPI
FT                   GIKVTRLAQGLSVGGDLEYADEVTLSKAIAGRTEM"
FT   misc_feature    488857..488982
FT                   /note="Pfam match to entry PF02132 RecR, RecR protein,
FT                   score 75.4, E-value 1.3e-19"
FT   misc_feature    488914..488976
FT                   /note="PS01300 RecR protein signature."
FT   misc_feature    488983..489264
FT                   /note="Pfam match to entry PF01751 Toprim, Toprim domain,
FT                   score 61.8, E-value 1.6e-15"
FT   rRNA            490196..491750
FT   rRNA            492053..494975
FT   rRNA            495048..495162
FT   CDS_pept        496066..497403
FT                   /transl_table=11
FT                   /locus_tag="SAS0438"
FT                   /product="Orn/Lys/Arg decarboxylase family protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0482"
FT                   /protein_id="CAG42213.1"
FT                   /translation="MKQPILNKLESLNQEEAISLHVPGHKNMTIGHLSQLSMTMDKTEI
FT                   PGLDDLHHPEEVILESMKQVEKHSDYDAYFLVNGTTSGILSVIQSFSQKKGDILMARNV
FT                   HKSVLHALDISQQEGHFIETHQSPLTNHYNKVNLSRLNNDGHKLAVLTYPNYYGETFNV
FT                   EEVIKSLHQLNIPVLIDEAHGAHFGLQGFPDSTLNYQADYVVQSFHKTLPALTMGSVLY
FT                   IHKNAPYRETIIEYLSYFQTSSPSYLIMASLESAAEFYKTYDSTVFFDKRAQLIECLEK
FT                   KGFEMLQVDDPLKLLIKYEGFTGHDIQNWFMNAHIYLELADDYQVLAVLPLWHHDDTYL
FT                   FDSLLRKIEDMILPKKSVSKVKQTQLLTTEGNYKPKRFEYVTWCDLKKAKGKVLARHIV
FT                   PYPPGIPIIFKGETITENMIELVNEYLETGMIVEGIKNNKILVEDE"
FT   misc_feature    496072..497124
FT                   /note="Pfam match to entry PF01276 OKR_DC_1, Orn/Lys/Arg
FT                   decarboxylase, major domain, score 78.3, E-value 1.7e-20"
FT   misc_feature    497215..497313
FT                   /note="Pfam match to entry PF03711 OKR_DC_1_C, Orn/Lys/Arg
FT                   decarboxylase, C-terminal domain, score 24.3, E-value
FT                   1.9e-06"
FT   CDS_pept        497405..498022
FT                   /transl_table=11
FT                   /locus_tag="SAS0439"
FT                   /product="putative thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0483"
FT                   /db_xref="GOA:Q6GC06"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GC06"
FT                   /protein_id="CAG42214.1"
FT                   /translation="MSAFITFEGPEGSGKTTVINKVYHRLVKDYDVIMTREPGGVPTGE
FT                   EIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYA
FT                   RGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNSRDQNRLDQEDLKFHEKV
FT                   IEGYQEIIHNESQRFKSVNADQPLENVVEDTYQTIIKYLEKI"
FT   misc_feature    497423..497986
FT                   /note="Pfam match to entry PF02223 Thymidylate_kin,
FT                   Thymidylate kinase, score 219.6, E-value 4.8e-63"
FT   misc_feature    497429..497452
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    497669..497707
FT                   /note="PS01331 Thymidylate kinase signature."
FT   CDS_pept        498050..498379
FT                   /transl_table=11
FT                   /locus_tag="SAS0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0484"
FT                   /protein_id="CAG42215.1"
FT                   /translation="MKMIIAIVQDQDSQELADQLVKNNFRATKLATTGGFLRAGNTTFL
FT                   CGVNDDRVDEILSVINQTCGNREQLVSPITPMGGSADSYIPYPVEVEVGGATVFVMPVD
FT                   AFHQF"
FT   misc_feature    498050..498376
FT                   /note="Pfam match to entry PF06153 DUF970, Protein of
FT                   unknown function (DUF970), score 278.1, E-value 1.2e-80"
FT   CDS_pept        498593..499519
FT                   /transl_table=11
FT                   /locus_tag="SAS0441"
FT                   /product="putative DNA polymerase III, delta' subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0485"
FT                   /protein_id="CAG42216.1"
FT                   /translation="MDEQQQLTNAYHSNKLSHAYLFEGDDAQTMKQVAINFAKLILCQT
FT                   DSQCETKVSTYNHPDFMYISTTENAIKKEQVEQLVRHMNQLPIESTNKVYIIEDFEKLT
FT                   VQGENSILKFLEEPPDNTIAILLSTKPEQILDTIHSRCQHVYFKPIDKEKFINRLVEQD
FT                   MSKPVAEMISTYTTQIDNAMALNEEFDLLALRKSVIRWCELLLTNKPMALIGIIDLLKQ
FT                   AKNKKLQSLTIAAVNGFFEDIIHTKVNVEDKQIYSDLKNDIDQYAQKLSFNQLILMFDQ
FT                   LTEAHKKLNQNVNPTLVFEQIVIKGVS"
FT   CDS_pept        499520..500323
FT                   /transl_table=11
FT                   /locus_tag="SAS0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0486"
FT                   /protein_id="CAG42217.1"
FT                   /translation="MPNVIGVQFQKAGKLEYYTPNDIQVDIDDWVVVESKRGIEIGIVK
FT                   NPLMDIAEEDVVLPLKNIIRVADDKDIDKFNCNERDAENALILCKDIVREQGLDMRLVN
FT                   CEYTLDKSKVIFNFTADDRIDFRKLVKILAQHLKTRIELRQIGVRDEAKLLGGIGPCGR
FT                   SLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGACGRLMCCLKYENDYYEEVRAQLPDI
FT                   GEAIETPDGNGKVVALNILDISMQVKLEGHEQPLEYKLEEIETMH"
FT   misc_feature    499694..499957
FT                   /note="Pfam match to entry PF04468 PSP1, PSP1 C-terminal
FT                   conserved region, score 180.8, E-value 2.3e-51"
FT   CDS_pept        500340..500687
FT                   /transl_table=11
FT                   /locus_tag="SAS0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0487"
FT                   /db_xref="GOA:Q6GC02"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GC02"
FT                   /protein_id="CAG42218.1"
FT                   /translation="MDRNEIFEKIMRLEMNVNQLSKETSELKALAVELVEENVALQLEN
FT                   DNLKKVLGNDEPTTIDTANSKPAKAVKKPLPSKDNLAILYGEGFHICKGELFGKHRHGE
FT                   DCLFCLEVLSD"
FT   misc_feature    500340..500684
FT                   /note="Pfam match to entry PF06156 DUF972, Protein of
FT                   unknown function (DUF972), score 224.5, E-value 1.6e-64"
FT   CDS_pept        500961..501686
FT                   /transl_table=11
FT                   /locus_tag="SAS0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0488"
FT                   /protein_id="CAG42219.1"
FT                   /translation="MLKENERFDQLIKEDFSIIQNDDVFSFSTDALLLGHFTKPRTKDI
FT                   VLDLCSGNGVIPLLLFAKHPRHIEGVEIQKTLVDMARRTFQFNDVDEYITMHHMDLKNV
FT                   TKVFKPSQYTLVTCNPPYFKENQQHQHQKEAHKIARHEIMCTLEDCMIAARHLLKEGGR
FT                   LNMVHRAERLMDVLFEMRKVNIEPKKVVFIYSKVGKSAQTIVVEGRKGGNQGLEIMPPF
FT                   YIYNEDGNYSEEMKEVYYG"
FT   CDS_pept        501679..501927
FT                   /transl_table=11
FT                   /locus_tag="SAS0445"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0489"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GC00"
FT                   /protein_id="CAG42220.1"
FT                   /translation="MDSHFVYIVKCSDGSLYTGYAKDVNARVEKHNRGQGAKYTKVRRP
FT                   VHLVYQEMYETKSEALKREYEIKTYTRQKKLRLIKER"
FT   misc_feature    501685..501924
FT                   /note="Pfam match to entry PF01541 Exci_endo_N,
FT                   Endo/excinuclease amino terminal domain, score 80.2,
FT                   E-value 4.3e-21"
FT   CDS_pept        501929..502768
FT                   /transl_table=11
FT                   /locus_tag="SAS0446"
FT                   /product="tetrapyrrole (corrin/porphyrin) methylase family
FT                   protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0490"
FT                   /protein_id="CAG42221.1"
FT                   /translation="MAVLYLVGTPIGNLADITYRAVDVLKRVDMIACEDTRVTSKLCNH
FT                   YDIPTPLKSYHEHNKDKQTAFIIEQLELGLDVALVSDAGLPLISDPGYELVVAAREANI
FT                   KVETVPGPNAGLTALMASGLPSYVYTFLGFLPRKEKEKSAVLEQRMHENSTLIIYESPH
FT                   RVTDTLKTIAKIDATRQVSLGRELTKKFEQIVTDDVTQLQALIQQGDVPLKGEFVILIE
FT                   GAKANNEISWFDDLSINEHVDHYIQTSQMKPKQAIKKVAEERQLKTNEVYNIYHQIS"
FT   misc_feature    501935..502537
FT                   /note="Pfam match to entry PF00590 TP_methylase,
FT                   Tetrapyrrole (Corrin/Porphyrin) Methylases, score 149.5,
FT                   E-value 6e-42"
FT   misc_feature    502169..502204
FT                   /note="PS01296 Uncharacterized protein family UPF0011
FT                   signature."
FT   CDS_pept        503053..505026
FT                   /transl_table=11
FT                   /locus_tag="SAS0447"
FT                   /product="putative methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0491"
FT                   /db_xref="GOA:Q6GBZ8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBZ8"
FT                   /protein_id="CAG42222.1"
FT                   /translation="MAKETFYITTPIYYPSGNLHIGHAYSTVAGDVIARYKRMQGYDVR
FT                   YLTGTDEHGQKIQEKAQKAGKTEIEYLDEMIAGIKQLWAKLEISNDDFIRTTEERHKHV
FT                   VEQVFERLLKQGDIYLGEYEGWYSVPDETYYTESQLVDPQYENGKIIGGKSPDSGHEVE
FT                   LVKEESYFFNISKYTDRLLEFYDQNPDFIQPPSRKNEMINNFIKPGLADLAVSRTSFNW
FT                   GVHVPSNPKHVVYVWIDALVNYISALGYLSDDESLFNKYWPADIHLMAKEIVRFHSIIW
FT                   PILLMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPNILIDRYGLDATRYYLMRELP
FT                   FGSDGVFTPEAFVERTNFDLANDLGNLVNRTISMVNKYFDGELPAYQGPLHELDEEMEA
FT                   MALETVKSYTESMESLQFSVALSTVWKFISRTNKYIDETTPWVLAKDDSQKDMLGNVMA
FT                   HLVENIRYAAVLLRPFLTHAPKEIFEQLNINNPQFMEFSSLEQYGVLTESIMVTGQPKP
FT                   IFPRLDSEAEIAYIKESMQPPATEEEKEEIPSKPQIDIKDFDKVEIKAATIINAEHVKK
FT                   SDKLLKIQVDLDSEQRQIVSGIAKFYTPDDIIGKKVAVVTNLKPAKLMGQKSEGMILSA
FT                   EKDGVLTLVSLPSAIPNGAVIK"
FT   misc_feature    503056..504093
FT                   /note="Pfam match to entry PF00133 tRNA-synt_1, tRNA
FT                   synthetases class I (I, L, M and V), score -106.3, E-value
FT                   3.6e-10"
FT   misc_feature    503095..503124
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT   misc_feature    503494..503517
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    504739..505017
FT                   /note="Pfam match to entry PF01588 tRNA_bind, Putative tRNA
FT                   binding domain, score 130.7, E-value 2.9e-36"
FT   CDS_pept        505057..505830
FT                   /transl_table=11
FT                   /locus_tag="SAS0448"
FT                   /product="putative TatD related DNase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0492"
FT                   /protein_id="CAG42223.1"
FT                   /translation="MLIDTHVHLNDEQYDDDLSEVITRAREAGVDRMFVVGFNKSTIER
FT                   AMKLIDEYDFLYGIIGWHPVDAIDFTEEHLEWIESLAQHPKVIGIGEMGLDYHWDKSPA
FT                   DVQKEVFRKQIALAKRLKLPIIIHNREATQDCIDILLEEHAEEVGGIMHSFSGSPEIAD
FT                   IVTNKLNFYISLGGPVTFKNAKQPKEVAKHVSMERLLVETDAPYLSPHPYRGKRNEPAR
FT                   VTLVAEQIAELKGLSYEEVCEQTTKNAEKLFNLNS"
FT   misc_feature    505057..505821
FT                   /note="Pfam match to entry PF01026 TatD_DNase, TatD related
FT                   DNase, score 394.3, E-value 1.2e-115"
FT   misc_feature    505060..505086
FT                   /note="PS01137 Uncharacterized protein family UPF0006
FT                   signature 1."
FT   misc_feature    505624..505674
FT                   /note="PS01091 Uncharacterized protein family UPF0006
FT                   signature 3."
FT   CDS_pept        505997..506533
FT                   /transl_table=11
FT                   /locus_tag="SAS0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0493"
FT                   /protein_id="CAG42224.1"
FT                   /translation="MKINEFIVVEGRDDTERVKRAVECDTIETNGSAINEQTLEVIRNA
FT                   QQSRGVIVLTDPDFPGDKIRSTITEHVKGVKHAYIDREKAKNKKGKIGVEHADLIDIKE
FT                   ALMHVSSPFDEAYESIDKSVLIELGLIVGKDARRRREILSRKLRIGHSNGKQLLKKLNA
FT                   FGYTEADVRQALEDE"
FT   misc_feature    506006..506239
FT                   /note="Pfam match to entry PF01751 Toprim, Toprim domain,
FT                   score 30.5, E-value 4.2e-06"
FT   CDS_pept        506544..507437
FT                   /transl_table=11
FT                   /locus_tag="SAS0450"
FT                   /product="ribosomal RNA adenine dimethylase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0494"
FT                   /db_xref="GOA:Q6GBZ5"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBZ5"
FT                   /protein_id="CAG42225.1"
FT                   /translation="MLDNKDIATPSRTRALLDKYGFNFKKSLGQNFLIDVNIINNIIDA
FT                   SDIDAQTGVIEIGPGMGSLTEQLARHAKRVLAFEIDQRLIPVLNDTLSPYDNVTVINED
FT                   ILKANIKEAVENHLQDCEKIMVVANLPYYITTPILLNLMQQDIPIDGYVVMMQKEVGER
FT                   LNAEVGSKAYGSLSIVVQYYTETSKVLTVPKSVFMPPPNVDSIVVKLMQRTEPLVTVDN
FT                   EEAFFKLAKAAFAQRRKTINNNYQNYFKDGKQHKEVILQWLEQAGIDPRRRGETLSIQD
FT                   FAKLYEEKKKFPQLEN"
FT   misc_feature    506631..507404
FT                   /note="Pfam match to entry PF00398 RrnaAD, Ribosomal RNA
FT                   adenine dimethylase, score 289.0, E-value 6.2e-84"
FT   misc_feature    506703..506786
FT                   /note="PS01131 Ribosomal RNA adenine dimethylases
FT                   signature."
FT   CDS_pept        507537..507800
FT                   /transl_table=11
FT                   /locus_tag="SAS0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0495"
FT                   /protein_id="CAG42226.1"
FT                   /translation="MPKSILDIKNSIDCHVGNRIVLKANGGRKKTIKRSGILKETYPSV
FT                   FIVELDQDKHNFERVSYTYTDVLTENVQVSFEEDNHHESIAH"
FT   misc_feature    507549..507770
FT                   /note="Pfam match to entry PF06257 DUF1021, Protein of
FT                   unknown function (DUF1021), score 169.2, E-value 7.2e-48"
FT   CDS_pept        508110..508958
FT                   /transl_table=11
FT                   /locus_tag="SAS0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0496"
FT                   /db_xref="GOA:Q6GBZ3"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBZ3"
FT                   /protein_id="CAG42227.1"
FT                   /translation="MIYETAPAKINFTLDTLFKRNDGYHEIEMIMTTVDLNDRLTFHKR
FT                   KDRKIVVEIEHNYVPSNHKNLAYRAAQLFIEQYQLKQGVTISIDKEIPVSAGLAGGSAD
FT                   AAATLRGLNRLFDIGASLEELALLGSKIGTDIPFCIYNKTALCTGRGEKIEFLNKPPSA
FT                   WVILAKPNLGISSPDIFKLINLDKRYDVHTKMCYEALENRDYQQLCQSLSNRLEPISVS
FT                   KHPQIDKLKNNMLKSGADGALMSGSGPTVYGLARKESQAKNIYNAVNGCCNEVYLVRLL
FT                   G"
FT   misc_feature    508356..508955
FT                   /note="Pfam match to entry PF00288 GHMP_kinases, GHMP
FT                   kinases putative ATP-binding protein, score 137.8, E-value
FT                   2.1e-38"
FT   CDS_pept        508972..509796
FT                   /transl_table=11
FT                   /locus_tag="SAS0453"
FT                   /product="putative pur operon repressor"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0497"
FT                   /protein_id="CAG42228.1"
FT                   /translation="MRYKRSERIVFMTQYLMNHPNKLIPLTFFVKKFKQAKSSISEDVQ
FT                   IIKNTFQKEKLGTVITTAGASGGVTYKPMMSKEEATEVVNEVITLLEEKERLLPGGYLF
FT                   LSDLVGNPSLLNKVGKLIASIYMEEKLDAVVTIATKGISLANAVANILNLPVVVIRKDN
FT                   KVTEGSTVSINYVSGSSRKIETMVLSKRTLAENSNVLVVDDFMRAGGSINGVMNLMNEF
FT                   KAHVKGVSVLVESKEVKQRLIEDYTSLVKLSDVDEYNQEFNVEPGNSLSKFS"
FT   misc_feature    509275..509739
FT                   /note="Pfam match to entry PF00156 Pribosyltran,
FT                   Phosphoribosyl transferase domain, score 88.7, E-value
FT                   1.2e-23"
FT   CDS_pept        509813..510193
FT                   /transl_table=11
FT                   /locus_tag="SAS0454"
FT                   /product="putative regulatory protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0498"
FT                   /protein_id="CAG42229.1"
FT                   /translation="MKIINTTRLPEALGPYSHATVVNGMVYTSGQIPLNVDGEIVSADV
FT                   QAQTKQVLENLKVVLEEAGSDLNSVAKATIFIKDMNDFQKINEVYGQYFNEHKPARSCV
FT                   EVARLPKDVKVEIELVSKIKEL"
FT   misc_feature    509834..510181
FT                   /note="Pfam match to entry PF01042 ribonuc_L-PSP,
FT                   Endoribonuclease L-PSP, score 207.5, E-value 2.1e-59"
FT   misc_feature    510107..510163
FT                   /note="PS01094 Uncharacterized protein family UPF0076
FT                   signature."
FT   CDS_pept        510265..510567
FT                   /transl_table=11
FT                   /locus_tag="SAS0455"
FT                   /product="stage V sporulation protein G"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0499"
FT                   /db_xref="GOA:Q6GBZ0"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBZ0"
FT                   /protein_id="CAG42230.1"
FT                   /translation="MKVTDVRLRKIQTDGRMKALVSITLDEAFVIHDLRVIEGNSGLFV
FT                   AMPSKRTPDGEFRDIAHPINSDMRQEIQDAVMKVYDETDEVVPDKNATSEDSEEA"
FT   misc_feature    510265..510516
FT                   /note="Pfam match to entry PF04026 SpoVG, SpoVG, score
FT                   228.3, E-value 1.2e-65"
FT   CDS_pept        510911..512263
FT                   /transl_table=11
FT                   /locus_tag="SAS0456"
FT                   /product="putative UDP-N-acetylglucosamine
FT                   pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0500"
FT                   /db_xref="GOA:Q6GBY9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBY9"
FT                   /protein_id="CAG42231.1"
FT                   /translation="MRRHAIILAAGKGTRMKSKKYKVLHEVAGKPMVEHVLESVKGSGV
FT                   DQVVTIVGHGAESVKGHLGERSLYSFQEEQLGTAHAVQMAKSHLEDKEGTTIVVCGDTP
FT                   LITKETLETLIAHHEDANAQATVLSASIQQPYGYGRIVRNASGRLERIVEEKDATQAEK
FT                   DINEISSGIFAFNNKTLFEKLTQVKNDNAQGEYYLPDVLSLILNDGGIVEVYRTNDVEE
FT                   IMGVNDRVMLSQAEKAMQRRTNHYHMLNGVTIIDPDSTYIGPDVTIGSDTVIEPGVRIN
FT                   GRTEIGEDVVIGQYSEINNSTIENGACIQQSVVNDASVGANTKVGPFAQLRPGAQLGAD
FT                   VKVGNFVEIKKADLKDGAKVSHLSYIGDAVIGERTNIGCGTITVNYDGENKFKTIVGKD
FT                   SFVGCNVNLVAPVTIGDDVLVAAGSTITDDVPNDSLAVARARQTTKEGYRK"
FT   misc_feature    510920..511597
FT                   /note="Pfam match to entry PF00483 NTP_transferase,
FT                   Nucleotidyl transferase, score 33.8, E-value 6.9e-13"
FT   misc_feature    511676..511759
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT   misc_feature    511703..511756
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 18.6,
FT                   E-value 0.015"
FT   misc_feature    511757..511810
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 14.3,
FT                   E-value 0.3"
FT   misc_feature    511856..511909
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 11.6,
FT                   E-value 1.9"
FT   misc_feature    511910..511963
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 12.2,
FT                   E-value 1.3"
FT   misc_feature    512012..512065
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 4.7, E-value
FT                   26"
FT   misc_feature    512087..512140
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 3.8, E-value
FT                   34"
FT   misc_feature    512114..512200
FT                   /note="PS00101 Hexapeptide-repeat containing-transferases
FT                   signature."
FT   misc_feature    512141..512194
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 15.2,
FT                   E-value 0.17"
FT   CDS_pept        512410..513375
FT                   /transl_table=11
FT                   /locus_tag="SAS0457"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0501"
FT                   /db_xref="GOA:Q6GBY8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBY8"
FT                   /protein_id="CAG42232.1"
FT                   /translation="MLNNEYKNSSLKIFSLKGNEALAQEVADQVGIELGKCSVKRFSDG
FT                   EIQINIEESIRGCDVFIIQPTSYPVNLHLMELLIMIDACKRASAATINIVVPYYGYARQ
FT                   DRKARSREPITAKLVANLIETAGATRMIALDLHAPQIQGFFDIPIDHLMGVPILAKHFK
FT                   DDPNINPEECVVVSPDHGGVTRARKLADILKTPIAIIDKRRPRPNVAEVMNIVGEIEGR
FT                   TAIIIDDIIDTAGTITLAAQALKDKGAKEVYACCTHPVLSGPAKERIENSAIKELIVTN
FT                   SIHLDEDRKPSNTKELSVAGLIAQAIIRVYERESVSVLFD"
FT   misc_feature    512812..512859
FT                   /note="PS00114 Phosphoribosyl pyrophosphate synthetase
FT                   signature."
FT   misc_feature    512839..513252
FT                   /note="Pfam match to entry PF00156 Pribosyltran,
FT                   Phosphoribosyl transferase domain, score 144.5, E-value
FT                   1.9e-40"
FT   misc_feature    513079..513117
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT   CDS_pept        513525..514178
FT                   /transl_table=11
FT                   /locus_tag="SAS0458"
FT                   /product="putative 50S ribosomal protein L25"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0502"
FT                   /db_xref="GOA:Q6GBY7"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBY7"
FT                   /protein_id="CAG42233.1"
FT                   /translation="MASLKSIIRQGKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDE
FT                   VEFIKVIREVGRNGVIELGVGSKTIKVMVADYQFDPLKNQITHIDFLAINMSEERTVEV
FT                   PVQLVGEAVGAKEGGVVEQPLFNLEVTATPDNIPEAIEVDITELNINDSLTVADVKVTG
FT                   DFKIENDSAESVVTVVAPTEEPTEEEIEAMEGEQQTEEPEVVGESKEDEEKTEE"
FT   misc_feature    513534..513797
FT                   /note="Pfam match to entry PF01386 Ribosomal_L25p,
FT                   Ribosomal L25p family, score 110.6, E-value 3.2e-30"
FT   misc_feature    513942..513974
FT                   /note="PS00591 Glycosyl hydrolases family 10 active site."
FT   CDS_pept        514458..515030
FT                   /transl_table=11
FT                   /locus_tag="SAS0459"
FT                   /product="putative peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0503"
FT                   /db_xref="GOA:Q6GBY6"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBY6"
FT                   /protein_id="CAG42234.1"
FT                   /translation="MKCIVGLGNIGKRFELTRHNIGFEVVDYILEKNNFSLDKQKFKGA
FT                   YTIERMNGDKVLFIEPMTMMNLSGEAVAPIMDYYNVNPEDLIVLYDDLDLEQGQVRLRQ
FT                   KGSAGGHNGMKSIIKMLGTDQFKRIRIGVGRPTNGMTVPDYVLQRFSNDEMVTMEKVIE
FT                   HAARAIEKFVETSRFDHVMNEFNGEVK"
FT   misc_feature    514458..515015
FT                   /note="Pfam match to entry PF01195 Pept_tRNA_hydro,
FT                   Peptidyl-tRNA hydrolase, score 279.8, E-value 3.8e-81"
FT   misc_feature    514497..514538
FT                   /note="PS01195 Peptidyl-tRNA hydrolase signature 1."
FT   misc_feature    514776..514808
FT                   /note="PS01196 Peptidyl-tRNA hydrolase signature 2."
FT   CDS_pept        515030..518536
FT                   /transl_table=11
FT                   /locus_tag="SAS0460"
FT                   /product="putative transcription-repair coupling factor"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0504"
FT                   /db_xref="GOA:Q6GBY5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBY5"
FT                   /protein_id="CAG42235.1"
FT                   /translation="MTILTTLIKEDNHFQDLNQVFGQANTLVTGLSPSAKVTMIAEKYA
FT                   QSNQQLLLITNNLYQADKLETDLLQFIDAEELYKYPVQDIMTEEFSTQSPQLMSERIRT
FT                   LTALAQGKKGLFIVPLNGLKKWLTPVEMWQNHQMTLRVGEDIDVDQFLNKLVNMGYKRE
FT                   SVVSHIGEFSLRGGIIDIFPLIGEPIRIELFDTKIDSIRDFDVETQRSKDNVEEVDITT
FT                   ASDYIITEEVISHLKEELKTAYENTRPKIDKSVRNDLKETYESFKLFESTYFDHQILRR
FT                   LVAFMYETPSTIIEYFQKDAIIAVDEFNRIKETEESLTVESDSFISNIIESGNGFIGQS
FT                   FIKYDDFETLIEGYPVTYFSLFATTMPIKLNHIIKFSCKPVQQFYGQYDIMRSEFQRYV
FT                   NQNYHIVVLVETETKVERMQAMLSEMHIPSITKLHRSMSSGQAVIIEGSLSEGFELPDM
FT                   GLVVITERELFKSKQKKQRKRTKAISNAEKIKSYQDLNVGDYIVHVHHGVGRYLGVETL
FT                   EVGQTHRDYIKLQYKGTDQLFVPVDQMDQVQKYVASEDKTPKLNKLGGSEWKKTKAKVQ
FT                   QSVEDIAEELIDLYKEREMAEGYQYGEDTAEQTTFELDFPYELTPDQAKSIDEIKDDMQ
FT                   KSRPMDRLLCGDVGYGKTEVAVRAAFKAVMEGKQVAFLVPTTILAQQHYETLIERMQDF
FT                   PVEIQLMSRFRTPKEIKQTKEGLKTGFVDIVVGTHKLLSKDIQYKDLGLLIVDEEQRFG
FT                   VRHKERIKTLKHNVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTYVLEQN
FT                   MSFIKEALERELSRDGQVFYLYNKVQSIYEKREQLQMLMPDANIAVAHGQMTERDLEET
FT                   MLSFINNEYDILVTTTIIETGVDVPNANTLIIEDADRFGLSQLYQLRGRVGRSSRIGYA
FT                   YFLHPANKVLTETAEDRLQAIKEFTELGSGFKIAMRDLNIRGAGNLLGKQQHGFIDTVG
FT                   FDLYSQMLEEAVNEKRGIKEPESEVPEVEVDLNLDAYLPTEYIANEQAKIEIYKKLRKT
FT                   ETFDQIIDIKDELIDRFNDYPVEVARLLDIVEIKVHALHSGITLIKDKGKIIDIHLSVK
FT                   ATENIDGEVLFKATQPLGRTMKVGVQNNAMTITLTKQNQWLDSLKFLVKCIEESMRISD
FT                   EA"
FT   misc_feature    516509..516802
FT                   /note="Pfam match to entry PF02559 CarD_TRCF,
FT                   CarD-like/TRCF domain, score 180.9, E-value 2.2e-51"
FT   misc_feature    516854..517444
FT                   /note="Pfam match to entry PF00270 DEAD, DEAD/DEAH box
FT                   helicase, score 132.1, E-value 1.1e-36"
FT   misc_feature    516965..516988
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    517571..517804
FT                   /note="Pfam match to entry PF00271 helicase_C, Helicase
FT                   conserved C-terminal domain, score 80.6, E-value 3.4e-21"
FT   misc_feature    518087..518446
FT                   /note="Pfam match to entry PF03461 TRCF, TRCF domain, score
FT                   180.9, E-value 2.2e-51"
FT   CDS_pept        518526..520052
FT                   /transl_table=11
FT                   /locus_tag="SAS0461"
FT                   /product="putative polysaccharide biosynthesis protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0505"
FT                   /protein_id="CAG42236.1"
FT                   /translation="MKHKEAFNGVVVLTAALIVIKILSAVYRIPYQNILGDTGLYAYQQ
FT                   VYPIVALGMILSMNAIPSAITQNIGKYHSDEAYAKAVAYIQLVGILLFIAIFVFANNIA
FT                   HMMGDSHLTPMIQAASLSFIFIGMLGVLRGYYQSANNMTVPAISQVIEQVIRVGIIIVT
FT                   IVIFVDRGWTIYEAGTIAILASTIGFLGSSIYLVAHRPFKFKMVNNTAKIVWKQFALSV
FT                   LIFAISQLIVILWQVIDSVTIIKSLQAIRVPFDVAITEKGVYDRGASFIQMGLIVTTTF
FT                   SFALIPLLSDAIKMNNQVLMNRYANASLKITILISTAAGIGLINLLPLMNGVFFKTNDL
FT                   TLTLSVYMITVICVSLIMMDMALLQAQHAVRPIFVGMTAGLVIKFILNIILIRLSGIIG
FT                   ASISTVVSLIIFGTIIHIAVTRKYHLHAMRRFFINVVLGMVFMSIVVQCVLNIVTTHGR
FT                   FTGLIELLCAAVLGIIALFFYIFRFNVLTYKELTYLPFGSKLYQIKKGRR"
FT   misc_feature    518541..519404
FT                   /note="Pfam match to entry PF01943 Polysacc_synt,
FT                   Polysaccharide biosynthesis protein, score 65.8, E-value
FT                   9.8e-17"
FT   misc_feature    order(518544..518612,518640..518708,518769..518837,
FT                   518865..518933,518994..519047,519060..519119,
FT                   519180..519239,519327..519395,519456..519515,
FT                   519543..519596,519633..519701,519714..519782,
FT                   519819..519887,519900..519968)
FT                   /note="14 probable transmembrane helices predicted for
FT                   SAS0461 by TMHMM2.0 at aa 7-29, 39-61, 82-104, 114-136,
FT                   157-174, 179-198, 219-238, 268-290, 311-330, 340-357,
FT                   370-392, 397-419, 432-454 and 459-481"
FT   misc_feature    519321..519344
FT                   /note="PS00030 Eukaryotic putative RNA-binding region RNP-1
FT                   signature."
FT   CDS_pept        520052..521245
FT                   /transl_table=11
FT                   /locus_tag="SAS0462"
FT                   /product="putative tetrapyrrole (corrin/porphyrin)
FT                   methylases"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0506"
FT                   /protein_id="CAG42237.1"
FT                   /translation="MAHTITIVGLGNYGIDDLPLGIYKFLKTQDKVYARTLDHPVIESL
FT                   QDELTFQSFDHVYEAHDQFEDVYNDIVAQLVEAANEKDIVYAVPGHPRVAETTTVKLLA
FT                   LAKDNTDIDVKVLGGKSFIDDVFEAVNVDPNDGFTLLDATSLQEVTLNVRTHTLITQVY
FT                   SAMVAANLKITLMERYPDDYPVQIVTGARSDGADNVVTCPLYELDHDENAFNNLTSVFV
FT                   PKIITSTYLYHDFDFATEVIDTLVDEDKGCPWDKVQTHETLKRYLLEETFELFEAIDNE
FT                   DDWHMIEELGDILLQVLLHTSIGKKEGYIDIKEVITSLNAKMIRRHPHIFGDANAETID
FT                   DLKEIWSKAKDAEGKQPRVKFEKVFAEHFLNLYEKTKDKSFDEASLKQWLEKGESNT"
FT   misc_feature    520061..520675
FT                   /note="Pfam match to entry PF00590 TP_methylase,
FT                   Tetrapyrrole (Corrin/Porphyrin) Methylases, score 18.5,
FT                   E-value 2.8e-06"
FT   misc_feature    520826..521044
FT                   /note="Pfam match to entry PF03819 MazG, MazG nucleotide
FT                   pyrophosphohydrolase domain, score 111.6, E-value 1.6e-30"
FT   CDS_pept        521242..521505
FT                   /transl_table=11
FT                   /locus_tag="SAS0463"
FT                   /product="S4 domain containing protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0507"
FT                   /protein_id="CAG42238.1"
FT                   /translation="MRLDKYLKVSRLIKRRTLAKEVSDQGRITINGNVAKAGSDVKVED
FT                   VLTIRFGQKLVTVKVTALNEHASKDNAKGMYEIIEERRLEEA"
FT   misc_feature    521242..521382
FT                   /note="Pfam match to entry PF01479 S4, S4 domain, score
FT                   37.0, E-value 4.4e-08"
FT   CDS_pept        521523..521915
FT                   /transl_table=11
FT                   /locus_tag="SAS0464"
FT                   /product="putative cell division protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0508"
FT                   /protein_id="CAG42239.1"
FT                   /translation="MKNKVEHIENQYTSQENKKKQRQKMKMRVVRRRITVFAGVLLAII
FT                   VVLSILLVVQKHRNDIDAQERKAKEAQFQKQQNEEIALKEKLNNLNDKDYIEKIARDDY
FT                   YLSNKGEVIFRLPEDKDSSSSKSSKK"
FT   misc_feature    521523..521690
FT                   /note="Signal peptide predicted for SAS0464 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.991) with cleavage site
FT                   probability 0.494 between residues 56 and 57"
FT   misc_feature    521601..521879
FT                   /note="Pfam match to entry PF04977 DivIC, Septum formation
FT                   initiator, score 113.1, E-value 5.6e-31"
FT   misc_feature    521622..521681
FT                   /note="1 probable transmembrane helix predicted for SAS0464
FT                   by TMHMM2.0 at aa 34-53"
FT   CDS_pept        522020..522421
FT                   /transl_table=11
FT                   /locus_tag="SAS0465"
FT                   /product="putative RNA binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0509"
FT                   /protein_id="CAG42240.1"
FT                   /translation="MSIEVGNKLKGKVTGIKKFGAFVELPEGKSGLVHISEVADNYVEN
FT                   VEEHLSVGDEVDVKVLSIADDGKISLSIKKAKDRPRRQHTSKPSHQKPVQKAEDFEKKL
FT                   SNFLKDSEDKLTSIKRQTESRRGGKGSRR"
FT   misc_feature    522023..522241
FT                   /note="Pfam match to entry PF00575 S1, S1 RNA binding
FT                   domain, score 91.9, E-value 1.3e-24"
FT   CDS_pept        522601..523896
FT                   /transl_table=11
FT                   /locus_tag="SAS0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0510"
FT                   /db_xref="GOA:Q6GBX9"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBX9"
FT                   /protein_id="CAG42241.1"
FT                   /translation="MQLNSNGWHVDDHIVVAVSTGIDSMCLLYQLLNDYKDSYRKLTCL
FT                   HVNHGVRSASIEEARFLEVYCERHHIDLHIKKLDLSHSLDRNNSIQNEARIKRYEWFDE
FT                   MMNVLEADVLLTAHHLDDQLETIMYRIFNGKSTRNKLGFDELSKRKGYQIYRPLLAVSK
FT                   KEIKQFQERYHIPYFEDESNKDNKYVRNDIRNRIIPAIDENNQLKASHLLKLKQWHDEQ
FT                   YDILQYSAKQFIQEFVKFDEQSKYLEVSRQAFNNLPNSLKMVVLDCLLSKYYELFNISA
FT                   KTYEEWFKQFSSKKAQFSINLTDKWIIQIAYGKLIIMAKNNGDTYFRVQTIEKPGNYIF
FT                   NKYRLEIHSNLPKCLFPLTVRTRQSGDTFKLNGRDGYKKVNRLFIDCKVQQWVRDQMPI
FT                   VLDKQQRIIAVGDLYQQQTIKQWIIISKNGDE"
FT   misc_feature    522637..523284
FT                   /note="Pfam match to entry PF01171 ATP_bind3, PP-loop
FT                   family, score 327.5, E-value 1.6e-95"
FT   CDS_pept        523901..524440
FT                   /transl_table=11
FT                   /locus_tag="SAS0467"
FT                   /product="putative hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0511"
FT                   /db_xref="GOA:Q6GBX8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBX8"
FT                   /protein_id="CAG42242.1"
FT                   /translation="MHNDLKEVLLTEEDIQNICKELGAQLTKDYQGKPLVCVGILKGSA
FT                   MFMSDLIKRIDTHLSIDFMDVSSYHGGTESTGEVQIIKDLGSSIENKDVLIIEDILETG
FT                   TTLKSITELLQSRKVNSLEIVTLLDKPNRRKADIEAKYVGKKIPDEFVVGYGLDYRELY
FT                   RNLPYIGTLKPEVYSN"
FT   misc_feature    523904..524362
FT                   /note="Pfam match to entry PF00156 Pribosyltran,
FT                   Phosphoribosyl transferase domain, score 104.9, E-value
FT                   1.7e-28"
FT   CDS_pept        524697..526790
FT                   /transl_table=11
FT                   /locus_tag="SAS0468"
FT                   /product="putative cell division protein"
FT                   /EC_number="3.4.24.-"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0512"
FT                   /protein_id="CAG42243.1"
FT                   /translation="MQKAFRNVLVIVIIGVIIFGLFSYLNGNGNMPKQLTYNQFTEKLE
FT                   KGDLKTLEIQPQQNVYMVSGKTKNDEDYSSTILYNNEKELQKITDAAKKQNGVKLTIKE
FT                   EEKQSVFVSILSTLIPVVVIALLFIFFLSQAQGGGSGGRMMNFGKSKAKMYDNNKRRVR
FT                   FSDVAGADEEKQELIEIVDFLKDNKKFKEMGSRIPKGVLLVGPPGTGKTLLARAVAGEA
FT                   GAPFFSISGSDFVEMFVGVGASRVRDLFDNAKKNAPCIIFIDEIDAVGRQRGAGVGGGH
FT                   DEREQTLNQLLVEMDGFGENEGIIMIAATNRPDILDPALLRPGRFDRQIQVGRPDVKGR
FT                   EAILHVHAKNKPLDETVDLKAISQRTPGFSGADLENLLNEASLIAVREGKKKIDMRDIE
FT                   EATDRVIAGPAKKSRVISKKERNIVAHHEAGHTIIGMVLDEAEVVHKVTIVPRGQAGGY
FT                   AMMLPKQDRFLMTEQELLDKICGLLGGRVSEDINFNEVSTGASNDFERATQIARSMVTQ
FT                   YGMSKKLGPLQFGHSNGQVFLGKDMQGEPNYSSQIAYEIDKEVQRIVKEQYERCKQILL
FT                   EHKEQLILIAETLLTEETLVAEQIQSLFYEGKLPEIDYDAAKVVKDEDSEFNDGKFGKS
FT                   YEEIRKEQLEDGQRDESEDRKEEKDIAEDKKEADKSDEKDEPAHRQAPNIEKPYDPNHP
FT                   DNK"
FT   misc_feature    524697..524771
FT                   /note="Signal peptide predicted for SAS0468 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.753) with cleavage site
FT                   probability 0.375 between residues 25 and 26"
FT   misc_feature    order(524706..524774,525024..525092)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SAS0468 by TMHMM2.0 at aa 4-26 and 110-132"
FT   misc_feature    525294..525857
FT                   /note="Pfam match to entry PF00004 AAA, ATPase family
FT                   associated with various cellular activities (AAA), score
FT                   339.0, E-value 5.4e-99"
FT   misc_feature    525309..525332
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    525606..525662
FT                   /note="PS00674 AAA-protein family signature."
FT   misc_feature    525873..526505
FT                   /note="Pfam match to entry PF01434 Peptidase_M41, Peptidase
FT                   family M41, score 427.4, E-value 1.4e-125"
FT   CDS_pept        527019..527900
FT                   /transl_table=11
FT                   /locus_tag="SAS0469"
FT                   /product="putative chaperonin"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0513"
FT                   /db_xref="GOA:Q6GBX6"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBX6"
FT                   /protein_id="CAG42244.1"
FT                   /translation="MTHDYIVKALAFDGEIRAYAALTTETVQEAQTRHYTWPTASAAMG
FT                   RTMTATAMMGAMLKGDQKLTVTVDGQGPIGRIIADANAKGEVRAYVDHPQTHFPLNEQG
FT                   KLDVRRAVGTNGSIMVVKDVGMKDYFSGASPIVSGELGEDFTYYYATSEQTPSSVGLGV
FT                   LVNPDNTIKAAGGFIIQVMPGAKDETISKLEKAISEMTPVSKLIEQGLTPEGLLNEILG
FT                   EDHVQILEKMPVQFECNCSHEKFLNAIKGLGEAEIQNMIKEDHGAEAVCHFCGNKYKYT
FT                   EEELNVLLESLA"
FT   misc_feature    527025..527864
FT                   /note="Pfam match to entry PF01430 HSP33, Hsp33 protein,
FT                   score 579.8, E-value 1.8e-171"
FT   CDS_pept        528079..529011
FT                   /transl_table=11
FT                   /locus_tag="SAS0470"
FT                   /product="putative O-acetylserine (thiol)-lyase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0514"
FT                   /db_xref="GOA:Q6GBX5"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBX5"
FT                   /protein_id="CAG42245.1"
FT                   /translation="MAQKPVDNITQIIGGTPVVKLRNVVDDNAADVYVKLEYQNPGGSV
FT                   KDRIALAMIEKAEREGKIKPGDTIVEPTSGNTGIGLAFVCAAKGYKAVFTMPETMSQER
FT                   RNLLKAYGAELVLTPGSEAMKGAIKKAKELKEEHGYFEPQQFENPANPEVHELTTGPEL
FT                   LQQFEGKTIDAFLAGVGTGGTLSGVGKVLKKEYPNIEIVAIEPEASPVLSGGEPGPHKL
FT                   QGLGAGFIPGTLNTEIYDSIIKVGNDTAMEMSRRVAKEEGILAGISSGAAIYAAIQKAK
FT                   ELGKGKTVVTVLPSNGERYLSTPLYSFDD"
FT   misc_feature    528103..528966
FT                   /note="Pfam match to entry PF00291 PALP,
FT                   Pyridoxal-phosphate dependent enzyme, score 434.5, E-value
FT                   9.7e-128"
FT   misc_feature    528181..528237
FT                   /note="PS00901 Cysteine synthase/cystathionine
FT                   beta-synthase P-phosphate attachment site."
FT   CDS_pept        529227..530030
FT                   /transl_table=11
FT                   /locus_tag="SAS0471"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0515"
FT                   /db_xref="GOA:Q6GBX4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBX4"
FT                   /protein_id="CAG42246.1"
FT                   /translation="MTKTKIMGILNVTPDSFSDGGKFNNVESAINRVKAMIDEGVDIID
FT                   VGGVSTRPGHEMVSLEEEMNRVLPVVEAIVGFDVKISVDTFRSEVAEACLKLGVDMIND
FT                   QWAGLYDHRMFQIVAKYDAEIILMHNGNGNRDEPVVEEMLTSLLAQAHQAKIAGIPSNK
FT                   IWLDPGIGFAKTRNEEAEVMARLDELVATEYPVLLATSRKRFTKEMMGYDTTPVERDEV
FT                   TAATTAYGIMKGVRAVRVHNVELNAKLAKGIDFLKENENARHNLS"
FT   misc_feature    529242..529289
FT                   /note="PS00792 Dihydropteroate synthase signature 1."
FT   misc_feature    529251..529961
FT                   /note="Pfam match to entry PF00809 Pterin_bind, Pterin
FT                   binding enzyme, score 408.0, E-value 9.5e-120"
FT   CDS_pept        530008..530373
FT                   /transl_table=11
FT                   /locus_tag="SAS0472"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0516"
FT                   /db_xref="GOA:Q6GBX3"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBX3"
FT                   /protein_id="CAG42247.1"
FT                   /translation="MQDTIFLKGMRFYGYHGALSAENEIGQIFKVDVTLKVDLAEAGRT
FT                   DNVIDTVHYGEVFEEVKSIMEGKAVNLLEHLAERIANRINSQYNRVMETKVRITKENPP
FT                   IPGHYDGVGIEIVRENK"
FT   misc_feature    530035..530361
FT                   /note="Pfam match to entry PF02152 FolB, Dihydroneopterin
FT                   aldolase, score 127.2, E-value 3.2e-35"
FT   CDS_pept        530370..530846
FT                   /transl_table=11
FT                   /locus_tag="SAS0473"
FT                   /product="putative
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0517"
FT                   /protein_id="CAG42248.1"
FT                   /translation="MIQAYLGLGSNIGDRESQLNDAIKILNEYDGINVSNISPIYETAP
FT                   VGYTEQPNFLNLCVEIQTTLTVLQLLECCLKTEECLHRIRKERWGPRTLDVDILLYGEE
FT                   MIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRYK"
FT   misc_feature    530376..530765
FT                   /note="Pfam match to entry PF01288 HPPK,
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK),
FT                   score 202.5, E-value 6.7e-58"
FT   misc_feature    530631..530666
FT                   /note="PS00794
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
FT                   signature."
FT   CDS_pept        531385..532872
FT                   /transl_table=11
FT                   /locus_tag="SAS0474"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0518"
FT                   /db_xref="GOA:Q6GBX1"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBX1"
FT                   /protein_id="CAG42249.1"
FT                   /translation="MSEEMNDQMLVRRQKLQELYDLGIDPFGSKFDRSGLSSDLKEEWD
FT                   QYSKEELVEKEADSHVAIAGRLMTKRGKGKAGFAHVQDLAGQIQIYVRKDQVGDDEFDL
FT                   WKNADLGDIVGVEGVMFKTNTGELSVKAKKFTLLTKSLRPLPDKFHGLQDIEQRYRQRY
FT                   LDLITNEDSTRTFINRSKIIQEMRNYLNNKGFLEVETPMMHQIAGGAAARPFVTHHNAL
FT                   DATLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHD
FT                   IMDLTESMVRHIANEVLGSAKVQYNGETIDLESAWTRLHIVDAVKEATGVDFYEVKSDD
FT                   EAKALAKEHGIEIKDTMKYGHILNEFFEQKVEETLIQPTFIYGHPTEISPLAKKNPEDP
FT                   RFTDRFELFIVGREHANAFTELNDPIDQKGRFEAQLVEKAQGNDEAHEMDEDYIEALEY
FT                   GMPPTGGLGIGIDRLVMLLTDSPSIRDVLLFPYMRQK"
FT   misc_feature    531565..531798
FT                   /note="Pfam match to entry PF01336 tRNA_anti, OB-fold
FT                   nucleic acid binding domain, score 77.9, E-value 2.2e-20"
FT   misc_feature    531844..532866
FT                   /note="Pfam match to entry PF00152 tRNA-synt_2, tRNA
FT                   synthetases class II (D, K and N), score 671.4, E-value
FT                   4.7e-199"
FT   misc_feature    532144..532197
FT                   /note="PS00179 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 1."
FT   misc_feature    532783..532812
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT   rRNA            533430..533544
FT   tRNA            533557..533632
FT                   /note="tRNA Val anticodon TAC, Cove score 95.74"
FT   tRNA            533649..533724
FT                   /note="tRNA Thr anticodon TGT, Cove score 92.93"
FT   tRNA            533731..533803
FT                   /note="tRNA Lys anticodon TTT, Cove score 89.08"
FT   tRNA            533837..533911
FT                   /note="tRNA Gly anticodon GCC, Cove score 86.82"
FT   tRNA            533919..534007
FT                   /note="tRNA Leu anticodon TAA, Cove score 75.33"
FT   tRNA            534013..534089
FT                   /note="tRNA Arg anticodon ACG, Cove score 77.53"
FT   tRNA            534110..534183
FT                   /note="tRNA Pro anticodon TGG, Cove score 86.85"
FT   tRNA            534207..534282
FT                   /note="tRNA Ala anticodon TGC, Cove score 89.05"
FT   rRNA            534404..535958
FT   tRNA            536050..536126
FT                   /note="tRNA Ile anticodon GAT, Cove score 101.60"
FT   rRNA            536294..539216
FT   rRNA            539289..539403
FT   rRNA            539615..541169
FT   rRNA            541488..544410
FT   rRNA            544483..544597
FT   CDS_pept        complement(545308..546690)
FT                   /transl_table=11
FT                   /locus_tag="SAS0475"
FT                   /product="GntR family regulatory protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0521"
FT                   /protein_id="CAG42250.1"
FT                   /translation="MKNTLYHQLYEKLKKQIIEGQFKEGDKFYSKRQLSKHLSISQTTV
FT                   EHAYQLLLDEGYIYSRPRSGYFVSEIESLTILNNQPIPSLFDDDSYKPKASDEAYDYAF
FT                   NLDEIDTKHFPIELFRKYSKDLYDTNHLNQLRRGHFQGELHLRFQLAFYLFTNRGVICD
FT                   PNQIIIGSSTEQLVNQLVDLLYTSTFIIEKPSYPPIKNILDKKQVEYEQIEVEDNGINV
FT                   DEVIKSQKNIVYITPSHQFPTGYVMDLKKRTQLIQWAQEKEERFIIEDDYDSEFRYFGK
FT                   PIPAIQGLYSRGEKVIYISTFSKSIFPSCRVAYMVLPYSIMKKYHSQNHIEGNTVPVHM
FT                   QNLIATFISSGGFERHLNKMRRIYRRKLTYILKRLKPYKEQLDIQGAETGMHFTITVKN
FT                   GLTLQECLDRANKVKLKLQVYNFDDDQDYKKTPKFILGFGGIDDDALKPHVDALIKSLI
FT                   IK"
FT   misc_feature    complement(546487..546678)
FT                   /note="Pfam match to entry PF00392 gntR, Bacterial
FT                   regulatory proteins, gntR family, score 42.7, E-value
FT                   8.8e-10"
FT   misc_feature    complement(546541..546606)
FT                   /note="Predicted helix-turn-helix motif for SAS0475 with
FT                   score 1366.000, SD 3.84 at aa 29-50, sequence
FT                   YSKRQLSKHLSISQTTVEHAYQ"
FT   CDS_pept        546794..547681
FT                   /transl_table=11
FT                   /locus_tag="SAS0476"
FT                   /product="putative pyridoxine biosynthesis protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0522"
FT                   /db_xref="GOA:Q6GBW9"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBW9"
FT                   /protein_id="CAG42251.1"
FT                   /translation="MSKIIGSDRVKRGMAEMQKGGVIMDVVNAEQARIAEEAGAVAVMA
FT                   LERVPSDIRAAGGVARMANPKIVEEVMNAVSIPVMAKARIGHITEARVLEAMGVDYIDE
FT                   SEVLTPADEEYHLRKDQFTVPFVCGCRNLGEAARRIGEGAAMLRTKGEPGTGNIVEAVR
FT                   HMRQVNSEVSRLTVMNDDEIMTFAKDIGAPYEILKQIKDNGRLPVVNFAAGGVATPQDA
FT                   ALMMELGADGVFVGSGIFKSEDPEKFAKAIVQATTHYQDYELIGRLASELGTAMKGLDI
FT                   NQLSLEERMQERGW"
FT   misc_feature    546812..547432
FT                   /note="Pfam match to entry PF01680 SOR_SNZ, SOR/SNZ family,
FT                   score 431.9, E-value 6.2e-127"
FT   misc_feature    547436..547549
FT                   /note="Pfam match to entry PF00218 IGPS, Indole-3-glycerol
FT                   phosphate synthase, score 22.4, E-value 2.4e-06"
FT   CDS_pept        547685..548245
FT                   /transl_table=11
FT                   /locus_tag="SAS0477"
FT                   /product="SNO glutamine amidotransferase family protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0523"
FT                   /db_xref="GOA:Q6GBW8"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBW8"
FT                   /protein_id="CAG42252.1"
FT                   /translation="MKIGVLALQGAVREHIRHIELSGHEGIAVKKVEQLEEIEGLILPG
FT                   GESTTLRRLMNLYGFKEALQNSTLPMFGTCAGLIVLAQDIVGEEGYLNKLNITVQRNSF
FT                   GRQVDSFETELDIKGIATDIEGVFIRAPHIEKVGQGVDILCKVNEKIVAVQQGKYLGVS
FT                   FHPELTDDYRVTDYFINHIVKKA"
FT   misc_feature    547697..548236
FT                   /note="Pfam match to entry PF01174 SNO, SNO glutamine
FT                   amidotransferase family, score 329.7, E-value 3.4e-96"
FT   misc_feature    547802..547834
FT                   /note="PS01236 Uncharacterized protein family UPF0030
FT                   signature."
FT   CDS_pept        complement(548451..549665)
FT                   /transl_table=11
FT                   /locus_tag="SAS0478"
FT                   /product="nucleoside permease"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0524"
FT                   /protein_id="CAG42253.1"
FT                   /translation="MHILIGIIGIIFFLALAFLFSSDRKNIRWKYVGILLAIQLIFAFI
FT                   LLKTTMGIKVIGGISNGFNYLLLKAADGVNFVFGGIQYIDPKQPPFFFSVLLPIVFISA
FT                   IIGILQYTKILPLIINVLGFLISKINGMGRLESYNAVAAAILGQSEVFISIKKQLPYIP
FT                   KQRLYTLTASAMSTVSASIIGAYFTLIEPKYVVTAVVLNLFGGFIIASIINPYKVNEED
FT                   DKLLVEETEERQQSFFEMLGEYILDGFKVAVIVGAMLIGYIAIIALLNGIVSNIFSTVS
FT                   GGAISWDFQTLIGFVFAPFAFLVGVPWQDAVQAGSVMATKLLSNEFVAMQALGKLSDLS
FT                   EHAKGVTSVFLVSFANFSSIGIISGAIKSLNDKKGDTVARFGLKLLFGATLVSFISAAI
FT                   AGFFI"
FT   misc_feature    complement(548454..549665)
FT                   /note="Pfam match to entry PF01773 Nucleoside_tra2, Na+
FT                   dependent nucleoside transporter, score 610.6, E-value
FT                   9.9e-181"
FT   misc_feature    complement(order(548457..548525,548562..548630,
FT                   548742..548810,548847..548915,549018..549086,
FT                   549099..549167,549267..549326,549339..549398,
FT                   549507..549575,549600..549656))
FT                   /note="10 probable transmembrane helices predicted for
FT                   SAS0478 by TMHMM2.0 at aa 4-22, 31-53, 90-109, 114-133,
FT                   167-189, 194-216, 251-273, 286-308, 346-368 and 381-403"
FT   misc_feature    complement(549600..549665)
FT                   /note="Signal peptide predicted for SAS0478 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.715) with cleavage site
FT                   probability 0.273 between residues 22 and 23"
FT   CDS_pept        549823..550284
FT                   /transl_table=11
FT                   /locus_tag="SAS0479"
FT                   /product="putative DNA-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0525"
FT                   /db_xref="GOA:Q6GBW6"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBW6"
FT                   /protein_id="CAG42254.1"
FT                   /translation="MHNMSDIIEQYIKRLFEESNEDVVEIQRANIAQRFDCVPSQLNYV
FT                   IKTRFTNEHGYEIESKRGGGGYIRITKIENKDATGYINHLLQLIGPSISQQQAYYIIDG
FT                   LLDKMLINEREAKMIQAVIDRETLSMDMVSRDIIRANILKRLLPVINYY"
FT   misc_feature    549823..550278
FT                   /note="Pfam match to entry PF05848 CtsR, Firmicute
FT                   transcriptional repressor of class III stress genes (CtsR),
FT                   score 362.8, E-value 3.8e-106"
FT   misc_feature    549898..549963
FT                   /note="Predicted helix-turn-helix motif for SAS0479 with
FT                   score 1132.000, SD 3.04 at aa 26-47, sequence
FT                   IQRANIAQRFDCVPSQLNYVIK"
FT   CDS_pept        550303..550869
FT                   /transl_table=11
FT                   /locus_tag="SAS0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0526"
FT                   /protein_id="CAG42255.1"
FT                   /translation="MLCENCQLNEAELKVKVTSKNKTEEKMVCQTCAEGHHPWNQANEQ
FT                   PEYQEHQDNFEEAFVVKQILQHLATKHGINFQEVAFKEEKRCPSCHMTLKDIAHVGKFG
FT                   CANCYATFKDDIIDIVRRVQGGQFEHVGKTPHSSHKKIALKRKIEEKNEYLKKLIEIQD
FT                   FEEAAIVRDEIKALKAESEVQHDDA"
FT   misc_feature    550735..550842
FT                   /note="Pfam match to entry PF02151 UVR, UvrB/uvrC motif,
FT                   score 26.3, E-value 7.3e-05"
FT   CDS_pept        550859..551866
FT                   /transl_table=11
FT                   /locus_tag="SAS0481"
FT                   /product="putative phosphotransferase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0527"
FT                   /db_xref="GOA:Q6GBW4"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBW4"
FT                   /protein_id="CAG42256.1"
FT                   /translation="MTHNIHDNISQWMKSNEETPIVMSSRIRLARNLENHVHPLMYATE
FT                   NDGFRVINEVQDALPNFELMRLDQMDQQSKMKMVAKHLISPELIKQPAAAVLVNDDESL
FT                   SVMINEEDHIRIQAMGTDTTLQALYNQASSIDDELDRSLDISYDEQLGYLTTCPTNIGT
FT                   GMRASVMLHLPGLSIMKRMTRIAQTINRFGYTIRGIYGEGSQVYGHTYQVSNQLTLGKS
FT                   ELEIIETLTEVVNQIIHEEKQIRQKLDTYNQLETQDRVFRSLGILQNCRMITMEEASYR
FT                   LSEVKLGIDLNYIELQNFKFNELMVAIQSPFLLDEEDDKSVKEKRADILREHIK"
FT   misc_feature    550880..551632
FT                   /note="Pfam match to entry PF00217 ATP-gua_Ptrans,
FT                   ATP:guanido phosphotransferase, C-terminal catalytic
FT                   domain, score 36.3, E-value 6.6e-16"
FT   misc_feature    551327..551347
FT                   /note="PS00112 ATP:guanido phosphotransferases active
FT                   site."
FT   CDS_pept        551880..554336
FT                   /transl_table=11
FT                   /locus_tag="SAS0482"
FT                   /product="putative stress response-related Clp ATPase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0528"
FT                   /db_xref="GOA:Q6GBW3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBW3"
FT                   /protein_id="CAG42257.1"
FT                   /translation="MLFGRLTERAQRVLAHAQEEAIRLNHSNIGTEHLLLGLMKEPEGI
FT                   AAKVLESFNITEDKVIEEVEKLIGHGQDHVGTLHYTPRAKKVIELSMDEARKLHHNFVG
FT                   TEHILLGLIRENEGVAARVFANLDLNITKARAQVVKALGNPEMSNKNAQASKSNNTPTL
FT                   DSLARDLTVIAKDGTLDPVIGRDKEITRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLA
FT                   QAIVNNEVPETLKDKRVMSLDMGTVVAGTKYRGEFEERLKKVMEEIQQAGNVILFIDEL
FT                   HTLVGAGGAEGAIDASNILKPALARGELQCIGATTLDEYRKNIEKDAALERRFQPVQVD
FT                   EPSVVDTVAILKGLRDRYEAHHRINISDEAIEAAVKLSNRYVSDRFLPDKAIDLIDEAS
FT                   SKVRLKSHTTPNNLKEIEQEIEKVKNEKDAAVHAQEFENAANLRDKQTKLEKQYEEAKN
FT                   EWKNAQNGMSTSLSEEDIAEVIAGWTGIPLTKINETESEKLLSLEDTLHERVIGQKDAV
FT                   NSISKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGDDDAMIRVDMSE
FT                   FMEKHAVSRLVGAPPGYVGHDDGGQLTEKVRRKPYSVILFDEIEKAHPDVFNILLQVLD
FT                   DGHLTDTKGRTVDFRNTIIIMTSNVGAQELQDQRFAGFGGSSDGQDYETIRKTMLKELK
FT                   NSFRPEFLNRVDDIIVFHKLTKEELKEIVTMMVNKLTNRLSEQNINIIVTDKAKDKIAE
FT                   EGYDPEYGARPLIRAIQKTIEDNLSELILDGNQIEGKKVTVDHDGKEFKYDIAEQTSET
FT                   KTPSQA"
FT   misc_feature    551928..552086
FT                   /note="Pfam match to entry PF02861 Clp_N, Clp amino
FT                   terminal domain, score 80.6, E-value 3.5e-21"
FT   misc_feature    552150..552308
FT                   /note="Pfam match to entry PF02861 Clp_N, Clp amino
FT                   terminal domain, score 68.8, E-value 1.2e-17"
FT   misc_feature    552486..553067
FT                   /note="Pfam match to entry PF00004 AAA, ATPase family
FT                   associated with various cellular activities (AAA), score
FT                   53.6, E-value 4.5e-13"
FT   misc_feature    552501..552524
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    552762..552800
FT                   /note="PS00870 Chaperonins clpA/B signature 1."
FT   misc_feature    553128..553235
FT                   /note="Pfam match to entry PF02151 UVR, UvrB/uvrC motif,
FT                   score 34.8, E-value 2.1e-07"
FT   misc_feature    553497..554213
FT                   /note="Pfam match to entry PF00004 AAA, ATPase family
FT                   associated with various cellular activities (AAA), score
FT                   8.4, E-value 7.6e-05"
FT   misc_feature    553512..553535
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    553590..553646
FT                   /note="PS00871 Chaperonins clpA/B signature 2."
FT   CDS_pept        554820..556184
FT                   /transl_table=11
FT                   /locus_tag="SAS0483"
FT                   /product="putative DNA repair protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0529"
FT                   /protein_id="CAG42258.1"
FT                   /translation="MAKKKVIFECMACGYQSPKWMGKCPNCGAWNQMEEIVEKAANPKH
FT                   GVKTKELAGKVQKLNSIKHETTPRVLTDSAEFNRVLGGGIVSGSLVLIGGDPGIGKSTL
FT                   LLQICASLSQKKKVLYITGEESLSQTKLRAERLDEDSSELQVLAETDLEVIYQTVKEEQ
FT                   PDLLVVDSIQTIYHPEISSAPGSVSQVRESTQSLMNIAKQMNIATFIVGHVTKEGQIAG
FT                   PRLLEHMVDTVLYFEGDEHHAYRILRAVKNRFGSTNEMGIFEMKQSGLKGVNNPSEMFL
FT                   EERSTNVPGSTIVATMEGTRPLLIEVQALVTPTTFNNPRRMATGIDHNRLSLLMAVLEK
FT                   KENYLLQQQDAYIKVAGGVKLTEPAVDLSVIVATASSFKDKAVDGLDCYIGEVGLTGEV
FT                   RRVSRIEQRVQEAAKLGFKRVIIPKNNIGGWTYPEGIQVIGVTTVHEALSFALHS"
FT   misc_feature    555015..555440
FT                   /note="Pfam match to entry PF03796 DnaB_C, DnaB-like
FT                   helicase C terminal domain, score -98.0, E-value 2.6e-05"
FT   misc_feature    555102..555125
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        556209..557282
FT                   /transl_table=11
FT                   /locus_tag="SAS0484"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0530"
FT                   /protein_id="CAG42259.1"
FT                   /translation="MNIVKLMVIIIYLIIGSALGIIIIPEIANDLGLQNSSFLKNHYVD
FT                   GIIGSIFMFLIFGVFIRRVTNAIKGLEHFIMRRSAVEILFATIGLIIGLLISVMVSFIL
FT                   ESIGNSIFNHFIPVIITILLCYFGFQFGLKKRDEMLMFLPENIARSMSQHTKSATPKII
FT                   DTSAIIDGRILEVIRCGFIDGNILIPQGVINELQIVADSNDSVKREKGKRGLDILNELY
FT                   DLDYPTKVIHPTKTHSDIDTMLLKLAKQYHASIITTDFNLNKVCHVHGIKALNVNDLSE
FT                   AIKPNVHQGDQLHILLTKMGKEPGQAVGYLDDGTMVVVDNAKNLIGSHVNLEVVSLLQT
FT                   SSGRIVFAKKIEDTVSL"
FT   misc_feature    556209..556292
FT                   /note="Signal peptide predicted for SAS0484 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.781) with cleavage site
FT                   probability 0.676 between residues 28 and 29"
FT   misc_feature    order(556227..556295,556338..556391,556452..556520,
FT                   556548..556607)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SAS0484 by TMHMM2.0 at aa 7-29, 44-61, 82-104 and 114-133"
FT   misc_feature    556689..557036
FT                   /note="Pfam match to entry PF01850 PIN, PIN domain, score
FT                   56.0, E-value 8.5e-14"
FT   misc_feature    557064..557264
FT                   /note="Pfam match to entry PF01938 TRAM, TRAM domain, score
FT                   15.5, E-value 0.0062"
FT   CDS_pept        557839..559293
FT                   /transl_table=11
FT                   /locus_tag="SAS0485"
FT                   /product="putative glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0531"
FT                   /db_xref="GOA:Q6GBW0"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBW0"
FT                   /protein_id="CAG42260.1"
FT                   /translation="MSDRIRVRYAPSPTGYLHIGNARTALFNYLYAKHYNGDFVIRIED
FT                   TDKKRNLEDGETSQFDNLKWLGLDWDESVDKDNGYGPYRQSERQHIYQPLIDQLLAEDK
FT                   AYKCYMTEEELEAEREAQIARGEMPRYGGQHAHLTEEQRQQFEAEGRQPSIRFRVPQNQ
FT                   TYSFDDMVKGNISFDSNGIGDWVIVKKDGIPTYNFAVAIDDHYMQISDVIRGDDHISNT
FT                   PKQIMIYEAFGWEPPRFGHMSLIVNEERKKLSKRDGQILQFIEQYRDLGYLPEALFNFI
FT                   ALLGWSPEGEEEIFSKEEFIKIFDEKRLSKSPAFFDKQKLAWVNNQYMKQKDTETVFQL
FT                   ALPHLIKANLIPEVPSEEDLSWGRKLIALYQKEMSYAGEIVPLSEMFFKEMPALGEEEQ
FT                   QVINGEQVPELMTHLFSKLEALEPFEAAEIKKTIKEVQKETGIKGKQLFMPIRVAVTGQ
FT                   MHGPELPNTIEVLGKEKVLNRLKQYK"
FT   misc_feature    557848..558807
FT                   /note="Pfam match to entry PF00749 tRNA-synt_1c, tRNA
FT                   synthetases class I (E and Q), catalytic domain, score
FT                   640.3, E-value 1.1e-189"
FT   misc_feature    557869..557904
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT   CDS_pept        559716..560363
FT                   /transl_table=11
FT                   /locus_tag="SAS0486"
FT                   /product="serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0532"
FT                   /db_xref="GOA:Q6GBV9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBV9"
FT                   /protein_id="CAG42261.1"
FT                   /translation="MILLKRMRDDIKMVFEQDPAARSTLEVITTYAGLHAVWSHLIAHK
FT                   LYNQKKYVAARAISQISRFFTGIEIHPGAKIGKRLFIDHGMGVVIGETCTIGDNVTIYQ
FT                   GVTLGGTGKERGKRHPDIGDNVLIAAGAKVLGNIKINSNVNIGANSVVLQSVPSYSTVV
FT                   GIPGHIVKQDGVRVGKTFDHRHLPDPIYEQIKHLERQLEKTRNGEIQDDYII"
FT   misc_feature    559914..559967
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 6.2, E-value
FT                   17"
FT   misc_feature    559992..560045
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 21.9,
FT                   E-value 0.0016"
FT   misc_feature    560070..560123
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 2.7, E-value
FT                   46"
FT   misc_feature    560124..560177
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (three repeats), score 9.1, E-value
FT                   7.7"
FT   CDS_pept        560347..561747
FT                   /transl_table=11
FT                   /locus_tag="SAS0487"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0533"
FT                   /db_xref="GOA:Q6GBV8"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBV8"
FT                   /protein_id="CAG42262.1"
FT                   /translation="MITLYNTLTRQKEVFKPIEPGKVKMYVCGPTVYNYIHIGNARPAI
FT                   NYDVVRRYFEYQGYNVEYVSNFTDVDDKLIKRSQELNQSVPEIAEKYIAAFHEDVGALN
FT                   VRKATSNPRVMDHMDDIIQFIKDLVDRGYAYESGGDVYFRTRKFEGYGKLSHQSIDDLK
FT                   VGARIDAGEHKEDALDFTLWKKAKPGEISWDSPFGEGRPGWHIECSVMAFHELGPTIDI
FT                   HAGGSDLQFPHHENEIAQSEAHNHAPFANYWMHNGFINIDNEKMSKSLGNFILVHDIIK
FT                   EVDPDVLRFFMISVHYRSPINYNLELVESARSGLERIRNSYQLIEERAQIATNIENQQT
FT                   YIDQIDAILNRFETVMNDDFNTANAITAWYDLAKLANKYVLENTTSTEVIDKFKAVYQI
FT                   FSDVLGVPLKSKNADELLDEDVEKLIEERNEARKNKDFARADEIRDMLKSQNIILEDTP
FT                   QGVRFKRG"
FT   misc_feature    560386..561702
FT                   /note="Pfam match to entry PF01406 tRNA-synt_1e, tRNA
FT                   synthetases class I (C), score 723.0, E-value 1.4e-214"
FT   CDS_pept        561740..562144
FT                   /transl_table=11
FT                   /locus_tag="SAS0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0534"
FT                   /protein_id="CAG42263.1"
FT                   /translation="MDNQQDNHIKLLNPLTLAYMGDAVLDQYVRTYIVLKLKSKPNKLH
FT                   QMSKKYVSAKSQAQTLEYLMEQEWFTDEEMDILKRGRNAKSHTKAKNTDVQTYRKSSAI
FT                   EAVIGFLYLEKREERLEALLNKIITIVNER"
FT   misc_feature    561758..562117
FT                   /note="Pfam match to entry PF05948 DUF880, Protein of
FT                   unknown function (DUF880), score 269.2, E-value 5.6e-78"
FT   CDS_pept        562152..562898
FT                   /transl_table=11
FT                   /locus_tag="SAS0489"
FT                   /product="SpoU rRNA Methylase family protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0535"
FT                   /db_xref="GOA:Q6GBV6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBV6"
FT                   /protein_id="CAG42264.1"
FT                   /translation="MEDTVIVGRHAVREAIITGHPINKILIQEGIKKQQINEILKNAKD
FT                   QKIIVQTVPKSKLDFLANAPHQGVAALIAPYEYADFDQFLKQQKEKEGLSTVLILDGLE
FT                   DPHNLGSILRTADATGVDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDE
FT                   LKDNGFWVAGTEANNATDYRNLEADMSLAIVIGSEGQGMSRLVSDKCDFYIKIPMVGHV
FT                   NSLNASVAASLMMYEVFRKRHDVGEI"
FT   misc_feature    562434..562859
FT                   /note="Pfam match to entry PF00588 SpoU_methylase, SpoU
FT                   rRNA Methylase family, score 198.1, E-value 1.5e-56"
FT   CDS_pept        562898..563422
FT                   /transl_table=11
FT                   /locus_tag="SAS0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0536"
FT                   /protein_id="CAG42265.1"
FT                   /translation="MKERYLIIDGYNMIGQSPTLSAIAKENLEEARMQLIDAIANYNAV
FT                   ISDEIICVFDAYDQSGVEREYMYHGVKTIFTKEKETADSFIERYVYELYDKHTKHITVV
FT                   TSDMSEQHAIFGSGAYRISSREMWRDLKENEIDVSKSLDDISENKPRTRIPLSSEILAE
FT                   FEKIRRGHHKK"
FT   misc_feature    562904..563410
FT                   /note="Pfam match to entry PF05991 DUF901, Protein of
FT                   unknown function (DUF901), score 320.7, E-value 1.8e-93"
FT   CDS_pept        563503..564072
FT                   /transl_table=11
FT                   /locus_tag="SAS0491"
FT                   /product="putative DNA-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0537"
FT                   /protein_id="CAG42266.1"
FT                   /translation="MKYDLTTQDSTIKRNNAINDKDFEKLVMDLQPLIIRRIKTFGFNH
FT                   YDLEDLYQEILIRMYRSVQTFDFSGEQPFTNYVQCLITSVKYDYLRKYLATNKRMDNLI
FT                   NEYRVTYPCAIKRYDVENNYLNKLAIKELIRQFKYLSVFEKDVMYLMCEQYKPREIAQL
FT                   MHVKEKVIYNAIQRCKNKIKRYFKMI"
FT   misc_feature    563578..563790
FT                   /note="Pfam match to entry PF04542 sigma70_r2, Sigma-70
FT                   region 2, score 49.4, E-value 8.4e-12"
FT   misc_feature    563965..564030
FT                   /note="Predicted helix-turn-helix motif for SAS0491 with
FT                   score 1274.000, SD 3.53 at aa 155-176, sequence
FT                   YKPREIAQLMHVKEKVIYNAIQ"
FT   CDS_pept        564187..564330
FT                   /transl_table=11
FT                   /locus_tag="SAS0492"
FT                   /product="50S ribosomal protein L33 type 3"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0538"
FT                   /db_xref="GOA:Q6GBV3"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBV3"
FT                   /protein_id="CAG42267.1"
FT                   /translation="MRKIPLNCEACGNRNYNVPKQEGSATRLTLKKYCPKCNAHTIHKE
FT                   SK"
FT   misc_feature    564187..564327
FT                   /note="Pfam match to entry PF00471 Ribosomal_L33, Ribosomal
FT                   protein L33, score 49.4, E-value 8.6e-12"
FT   CDS_pept        564386..564568
FT                   /transl_table=11
FT                   /locus_tag="SAS0493"
FT                   /product="preprotein translocase SecE subunit"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0539"
FT                   /db_xref="GOA:Q6GBV2"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBV2"
FT                   /protein_id="CAG42268.1"
FT                   /translation="MAKKESFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFY
FT                   ALDLGITALKNLLFG"
FT   misc_feature    564392..564562
FT                   /note="Pfam match to entry PF00584 SecE, SecE/Sec61-gamma
FT                   subunits of protein translocation complex, score 58.6,
FT                   E-value 1.4e-14"
FT   misc_feature    564404..564490
FT                   /note="PS01067 Protein secE/sec61-gamma signature."
FT   misc_feature    564476..564544
FT                   /note="1 probable transmembrane helix predicted for SAS0493
FT                   by TMHMM2.0 at aa 31-53"
FT   CDS_pept        564581..565129
FT                   /transl_table=11
FT                   /locus_tag="SAS0494"
FT                   /product="transcription antitermination protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0540"
FT                   /db_xref="GOA:Q6GBV1"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBV1"
FT                   /protein_id="CAG42269.1"
FT                   /translation="MSEEVGAKRWYAVHTYSGYENKVKKNLEKRVESMNMTEQIFRVVI
FT                   PEEEETQVKDGKAKTTVKKTFPGYVLVELIMTDESWYVVRNTPGVTGFVGSAGAGSKPN
FT                   PLLPEEVRFILKQMGLKEKTIDVELEVGEQVRIKSGPFANQVGEVQEIETDKFKLTVLV
FT                   DMFGRETPVEVEFDQIEKL"
FT   misc_feature    564599..564730
FT                   /note="Pfam match to entry PF02357 NusG, Transcription
FT                   termination factor nusG, score 94.4, E-value 2.3e-25"
FT   misc_feature    564965..565072
FT                   /note="Pfam match to entry PF00467 KOW, KOW motif, score
FT                   44.2, E-value 3e-10"
FT   misc_feature    565073..565102
FT                   /note="PS01014 Transcription termination factor nusG
FT                   signature."
FT   CDS_pept        565310..565732
FT                   /transl_table=11
FT                   /locus_tag="SAS0495"
FT                   /product="50S ribosomal protein L11"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0542"
FT                   /db_xref="GOA:Q6GBV0"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBV0"
FT                   /protein_id="CAG42270.1"
FT                   /translation="MAKKVDKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TQDQAGLIIPVEISVYEDRSFTFITKTPPAPVLLKKAAGIEKGSGEPNKTKVATVTKDQ
FT                   VREIANSKMQDLNAADEEAAMRIIEGTARSMGIVVE"
FT   misc_feature    565331..565507
FT                   /note="Pfam match to entry PF03946 Ribosomal_L11_N,
FT                   Ribosomal protein L11, N-terminal domain, score 134.6,
FT                   E-value 1.9e-37"
FT   misc_feature    565520..565726
FT                   /note="Pfam match to entry PF00298 Ribosomal_L11, Ribosomal
FT                   protein L11, RNA binding domain, score 138.7, E-value
FT                   1.1e-38"
FT   misc_feature    565685..565726
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="PS00359 Ribosomal protein L11 signature."
FT   CDS_pept        565940..566632
FT                   /transl_table=11
FT                   /locus_tag="SAS0496"
FT                   /product="50S ribosomal protein L1"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0543"
FT                   /db_xref="GOA:Q6GBU9"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBU9"
FT                   /protein_id="CAG42271.1"
FT                   /translation="MAKKGKKYQEAASKVDRTQHYSVEEAIKLAKETSIANFDASVEVA
FT                   FRLGIDTRKNDQQIRGAVVLPNGTGKSQSVLVFAKGDKIAEAEAAGADYVGEAEYVQKI
FT                   QQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTMDVKKAVEEIKAGKVEY
FT                   RAEKAGIVHASIGKVSFTDEQLIENFNTLQDVLAKAKPSSAKGTYFKSVAVTTTMGPGV
FT                   KIDTASFK"
FT   misc_feature    565982..566602
FT                   /note="Pfam match to entry PF00687 Ribosomal_L1, Ribosomal
FT                   protein L1p/L10e family, score 434.9, E-value 7.7e-128"
FT   misc_feature    566300..566356
FT                   /note="PS01199 Ribosomal protein L1 signature."
FT   CDS_pept        566904..567404
FT                   /transl_table=11
FT                   /locus_tag="SAS0497"
FT                   /product="50S ribosomal protein L10"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0544"
FT                   /db_xref="GOA:Q6GBU8"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBU8"
FT                   /protein_id="CAG42272.1"
FT                   /translation="MSAIIEAKKQLVDEIAEVLSNSVSTVIVDYRGLTVAEVTDLRSQL
FT                   REAGVEYKVYKNTMVRRAAEKAGIEGLDEFLTGPTAIATSSEDAVAAAKVISGFAKDHE
FT                   ALEIKSGVMEGNVITAEEVKTVGSLPSHDGLVSMLLSVLQAPVRNFAYAVKAIGEQKEE
FT                   SAE"
FT   misc_feature    566910..567206
FT                   /note="Pfam match to entry PF00466 Ribosomal_L10, Ribosomal
FT                   protein L10, score 131.1, E-value 2.1e-36"
FT   misc_feature    566988..567029
FT                   /note="PS01109 Ribosomal protein L10 signature."
FT   CDS_pept        567447..567815
FT                   /transl_table=11
FT                   /locus_tag="SAS0498"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0545"
FT                   /db_xref="GOA:Q6GBU7"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBU7"
FT                   /protein_id="CAG42273.1"
FT                   /translation="MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAG
FT                   GADAAAEKTEFDVELTSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEE
FT                   AEKLKEQLEEVGATVELK"
FT   misc_feature    567609..567812
FT                   /note="Pfam match to entry PF00542 Ribosomal_L12, Ribosomal
FT                   protein L7/L12 C-terminal domain, score 135.5, E-value
FT                   1e-37"
FT   CDS_pept        567990..568598
FT                   /transl_table=11
FT                   /locus_tag="SAS0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0546"
FT                   /protein_id="CAG42274.1"
FT                   /translation="MSHYYDEDPSVISNEQRIQYQLNHHKIDLITDNGVFSKDKVDYGS
FT                   DVLVQTFLKAHPPGPSKRIADVGCGYGPIGLMIAKVSPHHSITMLDVNHRALALVEKNK
FT                   KINGIDNAIVKESDALSAVEDKSFDFILTNPPIRAGKETVHRIFEQALHRLDSNGELFV
FT                   VIQKKQGMPSAKKRMNELFGNVEVVNKDKGYYILRSIKA"
FT   misc_feature    568431..568592
FT                   /note="Pfam match to entry PF05175 MTS, Methyltransferase
FT                   small domain, score 90.7, E-value 3.1e-24"
FT   CDS_pept        568813..572364
FT                   /transl_table=11
FT                   /locus_tag="SAS0500"
FT                   /product="DNA-directed RNA polymerase beta chain protein"
FT                   /EC_number="2.7.7.6"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0547"
FT                   /db_xref="GOA:Q6GBU5"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBU5"
FT                   /protein_id="CAG42275.1"
FT                   /translation="MAGQVVQYGRHRKRRNYARISEVLELPNLIEIQTKSYEWFLREGL
FT                   IEMFRDISPIEDFTGNLSLEFVDYRLGEPKYDLEESKNRDATYAAPLRVKVRLIIKETG
FT                   EVKEQEVFMGDFPLMTDTGTFVINGAERVIVSQLVRSPSVYFNEKIDKNGRENYDATII
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPLTVLLRALGFSSDQEIVDLLGDNEYLRNTLE
FT                   KDGTENTEQALLEIYERLRPGEPPTVENAKSLLYSRFFDPKRYDLASVGRYKTNKKLHL
FT                   KHRLFNQKLAEPIVNTETGEIVVEEGTVLDRRKIDEIMDVLESNANSEVFELHGSVIDE
FT                   PVEIQSIKVYVPNDDEGRTTTVIGNAFPDSEVKCITPADIIASMSYFFNLLSGIGYTDD
FT                   IDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTESITPQQLINIRPVIASIK
FT                   EFFGSSQLSQFMDQANPLAELTHKRRLSALGPGGLTRERAQMEVRDVHYSHYGRMCPIE
FT                   TPEGPNIGLINSLSSYARVNEFGFIETPYRKVDLDTHAITDQIDYLTADEEDSYVVAQA
FT                   NSKLDENGRFMDDEVVCRFRGNNTVMAKEKMDYMDVSPKQVVSAATACIPFLENDDSNR
FT                   ALMGANMQRQAVPLMNPEAPFVGTGMEHVAARDSGAAITAKHRGRVEHVESNEILVRRL
FT                   VEENGVEHEGELDRYPLAKFKRSNSGTCYNQRPIVAVGDVVEYNEILADGPSMELGEMA
FT                   LGRNVVVGFMTWDGYNYEDAVIMSERLVKDDVYTSIHIEEYESEARDTKLGPEEITRDI
FT                   PNVSESALKNLDDRGIVYIGAEVKDGDILVGKVTPKGVTELTAEERLLHAIFGEKAREV
FT                   RDTSLRVPHGAGGIVLDVKVFNREEGDDTLSPGVNQLVRVYIVQKRKIHVGDKMCGRHG
FT                   NKGVISKIVPEEDMPYLPDGRPIDIMLNPLGVPSRMNIGQVLELHLGMAAKNLGIHVAS
FT                   PVFDGANDDDVWSTIEEAGMARDGKTVLYDGRTGEPFDNRISVGVMYMLKLAHMVDDKL
FT                   HARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTYKSDDTVGRV
FT                   KTYEAIVKGENISRPSVPESFRVLMKELQSLGLDVKVMDEQDNEIEMTDVDDDDVVERK
FT                   VDLQQNDAPETQKEVTD"
FT   misc_feature    568894..570204
FT                   /note="Pfam match to entry PF04563 RNA_pol_Rpb2_1, RNA
FT                   polymerase beta subunit, score 64.9, E-value 1.7e-16"
FT   misc_feature    569230..569778
FT                   /note="Pfam match to entry PF04561 RNA_pol_Rpb2_2, RNA
FT                   polymerase Rpb2, domain 2, score 89.3, E-value 8.2e-24"
FT   misc_feature    569938..570039
FT                   /note="Pfam match to entry PF04561 RNA_pol_Rpb2_2, RNA
FT                   polymerase Rpb2, domain 2, score 26.4, E-value 1.6e-08"
FT   misc_feature    570205..570423
FT                   /note="Pfam match to entry PF04565 RNA_pol_Rpb2_3, RNA
FT                   polymerase Rpb2, domain 3, score 155.6, E-value 8.8e-44"
FT   misc_feature    570826..572019
FT                   /note="Pfam match to entry PF00562 RNA_pol_Rpb2_6, RNA
FT                   polymerase Rpb2, domain 6, score 854.0, E-value 5e-254"
FT   misc_feature    571576..571614
FT                   /note="PS01166 RNA polymerases beta chain signature."
FT   misc_feature    571834..571857
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    572023..572253
FT                   /note="Pfam match to entry PF04560 RNA_pol_Rpb2_7, RNA
FT                   polymerase Rpb2, domain 7, score 175.6, E-value 8.6e-50"
FT   CDS_pept        572501..576124
FT                   /transl_table=11
FT                   /locus_tag="SAS0501"
FT                   /product="DNA-directed RNA polymerase beta' chain protein"
FT                   /EC_number="2.7.7.6"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0548"
FT                   /db_xref="GOA:Q6GBU4"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBU4"
FT                   /protein_id="CAG42276.1"
FT                   /translation="MIDVNNFHYMKIGLASPEKIRSWSFGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPTKDWECSCGKYKRVRYKGMVCDRCGVEVTKSKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLLLDMSPRALEEVIYFASYVVVDPGPTGLEKKTLLSEAEFRDYYDKYP
FT                   GQFVAKMGAEGIKDLLEEIDLDEELKLLRDELESATGQRLTRAIKRLEVVESFRNSGNK
FT                   PSWMILDVLPIIPPEIRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPGIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIAVGPSLKMYQCGLPKEMALELFKPFVMKELVQREIATNIKNAKSKIERMDDEVWD
FT                   VLEEVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVTTAYNADFDGDQMAVH
FT                   VPLSKEAQAEARMLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERKDAVNTGAIFN
FT                   NTNEVLKAYANGFVHLHTRIGVHASSFNNPTFTEEQNKKILATSVGKIIFNEIIPDSFA
FT                   YINEPTQENLERKTPNRYFIDPTTLGEGGLKEYFENEELIEPFNKKFLGNIIAEVFNRF
FT                   SITDTSMMLDRMKDLGFKFSSKAGITVGVADIVVLPDKQQILDEHEKLVDRITKQFNRG
FT                   LITEEERYNAVVEIWTDAKDQIQGELMQSLDKTNPIFMMSDSGARGNASNFTQLAGMRG
FT                   LMAAPSGKIIELPITSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVA
FT                   QDVIVREEDCGTDRGLLVSDIKEGTEMIEPFIERIEGRYSKETIRHPETDEIIIRPDEL
FT                   ITPEIAKKITDAGIEQMYIRSAFTCNARHGVCEKCYGKNLATGEKVEVGEAVGTIAAQS
FT                   IGEPGTQLTMRTFHTGGVAGSDITQGLPRIQEIFEARNPKGQAVITEIEGVVEDIKLAK
FT                   DRQQEIVVKGANETRSYLASGTSRIIVEIGQPVQRGEVLTEGSIEPKNYLSVAGLNATE
FT                   SYLLKEVQKVYRMQGVEIDDKHVEVMVRQMLRKVRIIEAGDTKLLPGSLVDIHNFTDAN
FT                   REAFKHRKRPATAKPVLLGITKASLETESFLSAASFQETTRVLTDAAIKGKRDDLLGLK
FT                   ENVIIGKLIPAGTGMRRYSDVKYEKTAKPVAEVESQTEVTE"
FT   misc_feature    572510..573493
FT                   /note="Pfam match to entry PF04997 RNA_pol_Rpb1_1, RNA
FT                   polymerase Rpb1, domain 1, score 519.1, E-value 3.3e-153"
FT   misc_feature    573497..573925
FT                   /note="Pfam match to entry PF00623 RNA_pol_Rpb1_2, RNA
FT                   polymerase Rpb1, domain 2, score 288.5, E-value 8.7e-84"
FT   misc_feature    573932..574501
FT                   /note="Pfam match to entry PF04983 RNA_pol_Rpb1_3, RNA
FT                   polymerase Rpb1, domain 3, score 231.1, E-value 1.6e-66"
FT   misc_feature    574574..574816
FT                   /note="Pfam match to entry PF05000 RNA_pol_Rpb1_4, RNA
FT                   polymerase Rpb1, domain 4, score 111.7, E-value 1.4e-30"
FT   misc_feature    574820..575920
FT                   /note="Pfam match to entry PF04998 RNA_pol_Rpb1_5, RNA
FT                   polymerase Rpb1, domain 5, score 198.6, E-value 1e-56"
FT   misc_feature    575180..575200
FT                   /note="PS00290 Immunoglobulins and major histocompatibility
FT                   complex proteins signature."
FT   CDS_pept        576204..576515
FT                   /transl_table=11
FT                   /locus_tag="SAS0502"
FT                   /product="putative ribosomal protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0549"
FT                   /db_xref="GOA:Q6GBU3"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR023460"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBU3"
FT                   /protein_id="CAG42277.1"
FT                   /translation="MFNVNILKVDASRTLEDKLLSKEKVARFNKQHFVVGLKETLKALK
FT                   KDQVTSLIIAEDVEVYLMTRVLSQINQKNIPVSFFKSKHALGKHVGINVNATIVALIK"
FT   misc_feature    576252..576512
FT                   /note="Pfam match to entry PF01248 Ribosomal_L7Ae,
FT                   Ribosomal protein L7Ae/L30e/S12e/Gadd45 family, score 66.0,
FT                   E-value 8.5e-17"
FT   CDS_pept        576613..577026
FT                   /transl_table=11
FT                   /locus_tag="SAS0503"
FT                   /product="30S ribosomal protein S12"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0550"
FT                   /db_xref="GOA:Q6GBU2"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBU2"
FT                   /protein_id="CAG42278.1"
FT                   /translation="MPTINQLVRKPRQSKIKKSDSPALNKGFNSKKKKFTDLNSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLSNNIEINAYIPGIGHNLQEHSVVLVRGGRVKDLP
FT                   GVRYHIVRGALDTSGVDGRRQGRSLYGTKKPKN"
FT   misc_feature    576619..577020
FT                   /note="Pfam match to entry PF00164 Ribosomal_S12, Ribosomal
FT                   protein S12, score 241.4, E-value 1.3e-69"
FT   misc_feature    576778..576801
FT                   /note="PS00055 Ribosomal protein S12 signature."
FT   CDS_pept        577092..577562
FT                   /transl_table=11
FT                   /locus_tag="SAS0504"
FT                   /product="30S ribosomal protein S7"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0551"
FT                   /db_xref="GOA:Q6GBU1"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBU1"
FT                   /protein_id="CAG42279.1"
FT                   /translation="MPRKGSVPKRDVLPDPIHNSKLVTKLINKIMLDGKRGTAQRILYS
FT                   AFDLVEQRSGRDALEVFEEAINNIMPVLEVKARRVGGSNYQVPVEVRPERRTTLGLRWL
FT                   VNYARLRGEKTMEDRLANEILDAANNTGGAVKKREDTHKMAEANKAFAHYRW"
FT   misc_feature    577092..577559
FT                   /note="Pfam match to entry PF00177 Ribosomal_S7, Ribosomal
FT                   protein S7p/S5e, score 327.8, E-value 1.3e-95"
FT   misc_feature    577149..577229
FT                   /note="PS00052 Ribosomal protein S7 signature."
FT   CDS_pept        577685..579766
FT                   /transl_table=11
FT                   /locus_tag="SAS0505"
FT                   /product="translation elongation factor G"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0552"
FT                   /db_xref="GOA:Q6GBU0"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBU0"
FT                   /protein_id="CAG42280.1"
FT                   /translation="MAREFSLEKTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHE
FT                   GASQMDWMEQEQDRGITITSAATTAAWEGHRVNIIDTPGHVDFTVEVERSLRVLDGAVT
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKLGANFEYSVSTLHDRLQANAAPIQ
FT                   LPIGAEDEFEAIIDLVEMKCFKYTNDLGTEIEEIEIPEDHLDRAEEARASLIEAVAETS
FT                   DELMEKYLGDEEISVSELKEAIRQATTNVEFYPVLCGTAFKNKGVQLMLDAVIDYLPSP
FT                   LDVKPIIGHRASNPEEEVIAKADDSAEFAALAFKVMTDPYVGKLTFFRVYSGTMTSGSY
FT                   VKNSTKGKRERVGRLLQMHANSRQEIDTVYSGDIAAAVGLKDTGTGDTLCGEKNDIILE
FT                   SMEFPEPVIHLSVEPKSKADQDKMTQALVKLQEEDPTFHAHTDEETGQVIIGGMGELHL
FT                   DILVDRMKKEFNVECNVGAPMVSYRETFKSSAQVQGKFSRQSGGRGQYGDVHIEFTPNE
FT                   TGAGFEFENAIVGGVVPREYIPSVEAGLKDAMENGVLAGYPLIDVKAKLYDGSYHDVDS
FT                   SEMAFKIAASLALKEAAKKCDPVILEPMMKVTIEMPEEYMGDIMGDVTSRRGRVDGMEP
FT                   RGNAQVVNAYVPLSEMFGYATSLRSNTQGRGTYTMYFDHYAEVPKSIAEDIIKKNKGE"
FT   misc_feature    577706..578530
FT                   /note="Pfam match to entry PF00009 GTP_EFTU, Elongation
FT                   factor Tu GTP binding domain, score 377.7, E-value
FT                   1.2e-110"
FT   misc_feature    577733..577756
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    577835..577882
FT                   /note="PS00301 GTP-binding elongation factors signature."
FT   misc_feature    578651..578854
FT                   /note="Pfam match to entry PF03144 GTP_EFTU_D2, Elongation
FT                   factor Tu domain 2, score 72.0, E-value 1.3e-18"
FT   misc_feature    579116..579475
FT                   /note="Pfam match to entry PF03764 EFG_IV, Elongation
FT                   factor G, domain IV, score 226.1, E-value 5.5e-65"
FT   misc_feature    579479..579742
FT                   /note="Pfam match to entry PF00679 EFG_C, Elongation factor
FT                   G C-terminus, score 174.2, E-value 2.2e-49"
FT   CDS_pept        579983..581167
FT                   /transl_table=11
FT                   /locus_tag="SAS0506"
FT                   /product="translation elongation factor Tu"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0553"
FT                   /db_xref="GOA:Q6GBT9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBT9"
FT                   /protein_id="CAG42281.1"
FT                   /translation="MAKEKFDRSKEHANIGTIGHVDHGKTTLTAAIATVLAKNGDSVAQ
FT                   SYDMIDNAPEEKERGITINTSHIEYQTDKRHYAHVDCPGHADYVKNMITGAAQMDGGIL
FT                   VVSAADGPMPQTREHILLSRNVGVPALVVFLNKVDMVDDEELLELVEMEVRDLLSEYDF
FT                   PGDDVPVIAGSALKALEGDAQYEEKILELMEAVDTYIPTPERDSDKPFMMPVEDVFSIT
FT                   GRGTVATGRVERGQIKVGEEVEIIGLHDTSKTTVTGVEMFRKLLDYAEAGDNIGALLRG
FT                   VAREDVQRGQVLAAPGSITPHTEFKAEVYVLSKDEGGRHTPFFSNYRPQFYFRTTDVTG
FT                   VVHLPEGTEMVMPGDNVEMTVELIAPIAIEDGTRFSIREGGRTVGSGVVTEIIK"
FT   misc_feature    580010..580594
FT                   /note="Pfam match to entry PF00009 GTP_EFTU, Elongation
FT                   factor Tu GTP binding domain, score 333.0, E-value 3.6e-97"
FT   misc_feature    580037..580060
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    580133..580180
FT                   /note="PS00301 GTP-binding elongation factors signature."
FT   misc_feature    580655..580864
FT                   /note="Pfam match to entry PF03144 GTP_EFTU_D2, Elongation
FT                   factor Tu domain 2, score 98.5, E-value 1.4e-26"
FT   misc_feature    580877..581161
FT                   /note="Pfam match to entry PF03143 GTP_EFTU_D3, Elongation
FT                   factor Tu C-terminal domain, score 215.9, E-value 6.5e-62"
FT   CDS_pept        complement(581449..582624)
FT                   /transl_table=11
FT                   /locus_tag="SAS0507"
FT                   /product="putative peptidase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0554"
FT                   /protein_id="CAG42282.1"
FT                   /translation="MLDWFQLANNKENKTIQLRRYLHQYPELSFEEFQTHDYIVNQLSQ
FT                   LSCDIETPIGRNGIKATFKGLGTGPTIALRADFDALPVEELNDVPYKSKNPGCMHACGH
FT                   DGHTAILLTVAEILDEHKHLLEGNVVLIFQYGEEIMPGGSQEMIDAGCLENVDRIYGTH
FT                   LWSGYPTGTIHSRAGAIMASPDEFSVTIKGRGGHGAKPHETIDPIVIMAEFILSAQKII
FT                   SRTIDPVKQAVLSFGMIQAGTTDSVIPDQAFCKGTVRTFDSDIQNHVMDKMDKLLQGLA
FT                   IANDINYDLNYIKGYLPVHNNEKAYQVIKEATNDLHVRFNESDLMMIGEDFSHYLKVRP
FT                   GAFFLTGCGNESKGITAPHHNPKFDIDEKSLKYAVAVFLKIIELEQVFKTN"
FT   misc_feature    complement(581464..582591)
FT                   /note="Pfam match to entry PF01546 Peptidase_M20, Peptidase
FT                   family M20/M25/M40, score 395.7, E-value 4.7e-116"
FT   CDS_pept        582795..583982
FT                   /transl_table=11
FT                   /locus_tag="SAS0508"
FT                   /product="putative 2-amino-3-ketobutyrate coenzyme A
FT                   ligase"
FT                   /EC_number="2.3.1.29"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0555"
FT                   /db_xref="GOA:Q6GBT7"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010962"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBT7"
FT                   /protein_id="CAG42283.1"
FT                   /translation="MVQSLHEFLEENINYLKENGLYNEIDTIEGANGPEIKINGKSYIN
FT                   LSSNNYLGLATNEDLKSAAKAAIDTHGVGAGAVRTINGTLDLHDELEETLAKFKGTEAA
FT                   IAYQSGFNCNMAAISAVMNKNDAILSDELNHASIIDGCRLSKAKIIRVNHSDMDDLRAK
FT                   AKEAVESGQYNKVMYITDGVFSMDGDVAKLPEIVEIAEEFGLLTYVDDAHGSGVMGKGA
FT                   GTVKHFGLQDKIDFQIGTLSKAIGVVGGYVAGTKELIDWLKAQSRPFLFSTSLAPGDTK
FT                   AITEAVKKLMDSTELHDKLWDNAQYLKNGLSKLGYDTGESETPITPVIIGDEKTTQEFS
FT                   KRLKDEGVYVKSIVFPTVPRGTGRVRNMPTAAHTKDMLDEAIAAYEKVGKEMKLI"
FT   misc_feature    583011..583952
FT                   /note="Pfam match to entry PF00155 aminotran_1_2,
FT                   Aminotransferase class I and II, score 149.4, E-value
FT                   6.5e-42"
FT   misc_feature    583512..583541
FT                   /note="PS00599 Aminotransferases class-II
FT                   pyridoxal-phosphate attachment site."
FT   CDS_pept        584249..585127
FT                   /transl_table=11
FT                   /locus_tag="SAS0509"
FT                   /product="ThiJ/PfpI family protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0556"
FT                   /db_xref="GOA:Q6GBT6"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR017283"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBT6"
FT                   /protein_id="CAG42284.1"
FT                   /translation="MSQDVNELSKQPTPDKAEDNAFFPSPYSLSQYTAPKTDFDGVEHK
FT                   GAYKDGKWKVLMIAAEERYVLLENGKMFSTGNHPVEMLLPLHHLMEAGFDVDVATLSGY
FT                   PVKLELWAMPTEDEAVISTYNKLKEKLKQPKKLADVIKNELGPDSDYLSVFIPGGHAAV
FT                   VGISESEDVQQTLDWALDNDRFIVTLCHGPAALLSAGLNREKSTLEGYSVCVFPDSLDE
FT                   GANIEIGYLPGRLKWLVADLLTKQGLKVVNDDMTGRTLKDRKLLTGDSPLASNELGKLA
FT                   VNEMLNAIQNK"
FT   misc_feature    584573..585106
FT                   /note="Pfam match to entry PF01965 DJ-1_PfpI, DJ-1/PfpI
FT                   family, score 11.3, E-value 5.7e-05"
FT   CDS_pept        585286..586923
FT                   /transl_table=11
FT                   /locus_tag="SAS0510"
FT                   /product="putative L-ribulokinase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0557"
FT                   /db_xref="GOA:Q6GBT5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBT5"
FT                   /protein_id="CAG42285.1"
FT                   /translation="MSYSIGIDYGTASGRVFLINTTNGQVVSKFVKPYTHGVIESELNG
FT                   LKIPHTYALQNSNDYLEIMEEGISYIVRESKIDPDNIVGIGIDFTSSTIIFTDENLNPV
FT                   HNLKQFKNNPHAYVKLWKHHGAYKEAEKLYQTAIENNNKWLGHYGYNVSSEWMIPKIME
FT                   VMNRAPEIMEKTAYIMEAGDWIVNKLTNKNIRSNCGLGFKAFWEEETGFHYDLFDKIDP
FT                   KLSKVIQDKVSAPVVNIGEAVGKLDDKMAQKLGLSKETMVSPFIIDAHASLLGIGSEKD
FT                   KEMTMVMGTSTCHLMLNEKQHQVPGISGSVKGAIIPELFAYEAGQSAVGDLFEYVAKQA
FT                   PKSYVDEAANRNMTVFELMNEKIKHQMPGESGLIALDWHNGNRSVLSDSNLTGCIFGLT
FT                   LQTKHEDIYRAYLEATAFGTKMIMQQYQDWHMEVEKVFACGGIPKKNAVMMDIYANVLN
FT                   KKLIVMDSEYAPAIGAAILGAVSGGAHNSINDAVDAMKEPILYEINPEAEKVQRYETLF
FT                   KAYKALHDIHGYKKANIMKDIQSLRVEG"
FT   misc_feature    585292..586110
FT                   /note="Pfam match to entry PF00370 FGGY, FGGY family of
FT                   carbohydrate kinases, N-terminal domain, score -43.3,
FT                   E-value 2e-07"
FT   misc_feature    586117..586818
FT                   /note="Pfam match to entry PF02782 FGGY_C, FGGY family of
FT                   carbohydrate kinases, C-terminal domain, score 32.2,
FT                   E-value 1.9e-10"
FT   CDS_pept        587137..588102
FT                   /transl_table=11
FT                   /locus_tag="SAS0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0558"
FT                   /db_xref="GOA:Q6GBT4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBT4"
FT                   /protein_id="CAG42286.1"
FT                   /translation="MKKIMITGALGQIGTELVVKCREIYGTDNVLATDIREPEADSPVQ
FT                   NGPFEILDVTDRDRMFELVRDFEADSLMHMAALLSATAEKNPILAWDLNMGGLMNALEA
FT                   ARTYNLHFFTPSSIGAFGDSTPKVNTPQVTIQQPTTMYGVNKVAGELLCQYYFKRFGVD
FT                   TRSVRFPGLISHVKEPGGGTTDYAVEIYFKAVREGHYTSFIDKGTYMDMMYMDDAIEAI
FT                   IKLMEADDAKLETRNGYNLSAMSFDPEMVKEAIQEYYPNFTLDYDVDPIRQGIANSWPD
FT                   SIDTSCSRGEWGFDPKYDLASMTKLMLEAIEQKDTVKNNN"
FT   CDS_pept        588437..589513
FT                   /transl_table=11
FT                   /locus_tag="SAS0512"
FT                   /product="putative aminotransferase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0559"
FT                   /db_xref="GOA:Q6GBT3"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBT3"
FT                   /protein_id="CAG42287.1"
FT                   /translation="MSQAVKVERRETLKQKPNTSQLGFGKYFTDYMLSYDYDADKGWHD
FT                   LKIVPYGPIEISPAAQGVHYGQSVFEGLKAYKRDGEVALFRPEENFKRLNNSLARLEMP
FT                   QVDEAELLEGLKQLVDIERDWIPEGEGQSLYIRPFVFATEGALGVGASHQYKLLIILSP
FT                   SGAYYGGETLKPTKIYVEDEYVRAVRGGVGFAKVAGNYAASLLAQTNANKLGYDQVLWL
FT                   DGVEQKYIEEVGSMNIFFVENGKVITPELNGSILPGITRKSIIELAKNLGYEVEERRVS
FT                   IDELFESYDKGELTEVFGSGTAAVISPVGTLRYEDREIVINNNETGEITQKLYDVYTGI
FT                   QNGTLEDKNGWRVVVPKY"
FT   misc_feature    588569..589450
FT                   /note="Pfam match to entry PF01063 aminotran_4,
FT                   Aminotransferase class IV, score 466.5, E-value 2.3e-137"
FT   misc_feature    589130..589219
FT                   /note="PS00770 Aminotransferases class-IV signature."
FT   CDS_pept        589764..590447
FT                   /transl_table=11
FT                   /locus_tag="SAS0513"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0560"
FT                   /protein_id="CAG42288.1"
FT                   /translation="MEWILFDKDGTLIEFDRSWEKIGVRFVQSLLETFPVHNKEAALRQ
FT                   LGVIKESIDPKSVMGSGSLQQIIQAFNDVTGQDTTDWSKSTSQKLVDERIPEINWVEGV
FT                   KEALIDLKAKGYQLGIVTSDTKKGVEQFLAHTNATSLFDLIISTEADAYEKPNPKVLSP
FT                   LFEQYNVDPQKVAIVGDTANDMKTASNANLGMAIGVLTGIATKEELHEADIILNSAADI
FT                   LEALN"
FT   misc_feature    589764..590366
FT                   /note="Pfam match to entry PF00702 Hydrolase, haloacid
FT                   dehalogenase-like hydrolase, score 99.3, E-value 7.9e-27"
FT   CDS_pept        complement(590563..591225)
FT                   /transl_table=11
FT                   /locus_tag="SAS0514"
FT                   /product="putative deoxyadenosine kinase protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0561"
FT                   /protein_id="CAG42289.1"
FT                   /translation="MNNYGIPQNAIITIAGTVGVGKSTLTQALADKLNFKTSFENVEHN
FT                   PYLDKFYSDFERWSFHLQIYFLAERFKEQKRMFEYGGGFVQDRSIYEDVDIFAKMHEEE
FT                   GTMSKEDFKTYSDLFNAMVMTPYFPKPDVMIYLECNYDEVIDRIIERGREMEINTDPEY
FT                   WKKLFKRYDDWINSFNACPVVRININEYDIHKDPESLNPMIDKIARIIQTYRQVDTR"
FT   misc_feature    complement(590599..591042)
FT                   /note="Pfam match to entry PF01712 dNK, Deoxynucleoside
FT                   kinase, score 167.9, E-value 1.8e-47"
FT   misc_feature    complement(591157..591180)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(591218..591835)
FT                   /transl_table=11
FT                   /locus_tag="SAS0515"
FT                   /product="putative deoxyadenosine kinase protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0562"
FT                   /protein_id="CAG42290.1"
FT                   /translation="MNKPFIAIEGPIGVGKSSLAHKLSQTLDFYEEKEIITENPFLSDF
FT                   YEDISKWSFQTEMFFLCNRYKQFQDVTQLNQGVVSDYHIHKNKIFAKNTLSSVEFQKFS
FT                   KIYDILTEDMIMPNMIIFLDADLDVLKSRIAKRNRSFEHQIEDEYLLKLKKDYREYYES
FT                   LQSNGSNVVLIDTTSIDFLKNEQDYEDILHIILPMIGDITNE"
FT   misc_feature    complement(591257..591670)
FT                   /note="Pfam match to entry PF01712 dNK, Deoxynucleoside
FT                   kinase, score 79.8, E-value 5.7e-21"
FT   misc_feature    complement(591785..591808)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        591902..592372
FT                   /transl_table=11
FT                   /locus_tag="SAS0516"
FT                   /product="putative deaminase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0563"
FT                   /protein_id="CAG42291.1"
FT                   /translation="MTNDIYFMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRE
FT                   TLQQPTAHAEHIAIERAAKVLGSWRLEGCTLYVTLEPCVMCAGTIVMSRIPRVVYGADD
FT                   PKGGCSGSLMNLLQQSNFNHRAIVDKGVLKEACSTLLTTFFKNLRANKKSTN"
FT   misc_feature    591923..592207
FT                   /note="Pfam match to entry PF00383 dCMP_cyt_deam, Cytidine
FT                   and deoxycytidylate deaminase zinc-binding region, score
FT                   125.2, E-value 1.3e-34"
FT   misc_feature    592058..592171
FT                   /note="PS00903 Cytidine and deoxycytidylate deaminases
FT                   zinc-binding region signature."
FT   CDS_pept        592519..593388
FT                   /transl_table=11
FT                   /locus_tag="SAS0517"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0564"
FT                   /protein_id="CAG42292.1"
FT                   /translation="MIKLIATDMDGTLLNAAHEISQPNIDAIKYAQEQGITVVIATGRA
FT                   FYEAQAPVADTDLTVPYICLNGAEVRDETFNVMSTSHLNKSLVHKITNVLKDAGIYYQV
FT                   YTSRAIYTEDPQRDLDIYIDIAERAGQHANVERIKNGIQRRIDNGTLKVVDNYDAIENI
FT                   PGELIMKILAFDGNLEKIDKASKILAESPNLAISSSSRGNIEITHSDAQKGIALETIAE
FT                   RLGIEMKEVMAIGDNLNDLSMLEKVGYPVAMENGAEEVKKIAKYVTDTNENSGVGKAIM
FT                   KLLREQQV"
FT   misc_feature    592522..593289
FT                   /note="Pfam match to entry PF00702 Hydrolase, haloacid
FT                   dehalogenase-like hydrolase, score 37.7, E-value 2.8e-08"
FT   misc_feature    592528..592563
FT                   /note="PS01228 Hypothetical cof family signature 1."
FT   misc_feature    593218..593286
FT                   /note="PS01229 Hypothetical cof family signature 2."
FT   CDS_pept        593409..593975
FT                   /transl_table=11
FT                   /locus_tag="SAS0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0565"
FT                   /db_xref="GOA:Q6GBS7"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBS7"
FT                   /protein_id="CAG42293.1"
FT                   /translation="MKGLIIIGSAQVNSHTSALARYLTEHFKTHDIEAEIFDLAEKPLN
FT                   QLDFSGTTPSIDEIKQNMKDLKEKAMAADFLILGTPNYHGSYSGILKNALDHLNMDYFK
FT                   MKPVGLIGNSGGIVSSEPLSHLRVIVRSLLGIAVPTQIATHDSDFAKNEDGSYYLNDSE
FT                   FQLRARLFVDQIVSFVNNSPYEHLK"
FT   misc_feature    593409..593939
FT                   /note="Pfam match to entry PF03358 FMN_red, NADPH-dependent
FT                   FMN reductase, score 59.8, E-value 6.2e-15"
FT   CDS_pept        594406..597279
FT                   /transl_table=11
FT                   /locus_tag="SAS0519"
FT                   /product="putative surface anchored protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0566"
FT                   /db_xref="GOA:Q6GBS6"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR011266"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBS6"
FT                   /protein_id="CAG42294.1"
FT                   /translation="MNNKKTVTNRKGMIPNRLNKFSIRKYSVGTASILVGTTLIFGLSG
FT                   HEAKAAEHTNGELNQSKNETTAPSENKTTEKVDSRQLKDNTQTATADQPKVTMSDSATV
FT                   KETSSNMQSPQNATASQSTTQTSNVTTNDKSSTTYSNETDKSNLTQAKDVSATPKTTTI
FT                   KPRTLNRMAVNTVAAPQQGTNVNDKVHFSNIDIAIDKGHLNKDTGKTEFWATSSDVLKL
FT                   KANYTIDDSVKEGDTFTFKYGQYFRPGSVRLPSQTQNLYNAQGNIIAKGIYDSTTNTTT
FT                   YTFTNYVDQYTNVSGSFEQVAFAKRENATTDKTAYKMEVSLGNDTYSEEIIVDYGNKKA
FT                   QPLISSTNYINNEDLSRNMTAYVNQPKNTYTKQTFVTNLTGYKFNPNAKNFKIYEVTDQ
FT                   NQFVDSFTPDTSKLKDVTNQFNITYSNDNKTATVDLMNGQTSSNKQYIIQQVAYPDNTS
FT                   TDNGKIDYTLDTDKTKYSWSNSYSNVNGSSTANGDQKKYNLGDYVWEDTNKDGKQDANE
FT                   KGIKGVYVILKDSNGKELDRTTTDENGKYQFTGLSNGTYSVEFSTPAGYTPTTANAGTD
FT                   DAVDSDGLTTTGVIKDADNMTLDSGFYKTPKYSLGDYVWYDSNKDGKQDSTEKGIKGVK
FT                   VTLQNEKGEVIGTTETDENGKYRFDNLDSGKYKVIFEKPAGLTQTGTNTTEDDKDADGG
FT                   EVDVTITDHDDFTLDNGYYEEETSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
FT                   SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
FT                   DSDSDSDSDSDSDSDSDSDSDTDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD
FT                   SDSDSDSDSDSDSESDADSDTDSDSDAGKHTPAKPMSTVKDQHKTAKALPETGSENNNS
FT                   NNGTLFGGLFAALGSLLLFGRRKKQNK"
FT   misc_feature    594406..594555
FT                   /note="Signal peptide predicted for SAS0519 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.966 between residues 50 and 51"
FT   misc_feature    594448..594528
FT                   /note="Pfam match to entry PF04650 YSIRK_signal, YSIRK type
FT                   signal peptide, score 53.1, E-value 6.2e-13"
FT   misc_feature    order(594466..594534,597202..597255)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SAS0519 by TMHMM2.0 at aa 21-43 and 933-950"
FT   misc_feature    595918..595956
FT                   /note="Pfam match to entry PF02412 tsp_3, Thrombospondin
FT                   type 3 repeat, score 7.0, E-value 6"
FT   misc_feature    595963..596178
FT                   /note="Pfam match to entry PF05738 Cna_B, Cna protein
FT                   B-type domain, score 78.2, E-value 1.8e-20"
FT   misc_feature    596251..596289
FT                   /note="Pfam match to entry PF02412 tsp_3, Thrombospondin
FT                   type 3 repeat, score 6.4, E-value 7.8"
FT   misc_feature    596296..596508
FT                   /note="Pfam match to entry PF05738 Cna_B, Cna protein
FT                   B-type domain, score 70.6, E-value 3.4e-18"
FT   misc_feature    597139..597264
FT                   /note="Pfam match to entry PF00746 Gram_pos_anchor, Gram
FT                   positive anchor, score 51.9, E-value 1.5e-12"
FT   misc_feature    597163..597180
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT   CDS_pept        597646..601743
FT                   /transl_table=11
FT                   /locus_tag="SAS0520"
FT                   /product="putative surface anchored protein"
FT                   /db_xref="GOA:Q6GBS5"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR011266"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBS5"
FT                   /protein_id="CAG42295.1"
FT                   /translation="MLNRENKTAITRKGMVSNRLNKFSIRKYTVGTASILVGTTLIFGL
FT                   GNQEAKAAESTNKELNEATTSASDNQSSDKVDMQQLNQEDNTKNDNQKEMVSSQGNETT
FT                   SNGNKSIEKESVQSTTGNKVEVSTAKSDEQASPKSTNEDLNTKQTISNQEALQPDLQEN
FT                   KSVVNAQPTNEENKKVDAKTESTTLNVKSDAIKSNAETLVDNNSNSNNENNADIILPKS
FT                   TAPKRLNTRMRIAAVQPSSTEAKNVNDLITSNTTLTVVDADKNNKIVPAQDYLELKSQI
FT                   KVDDKVKSGDYFTIKYSDTVQVYGLNPEDIKNIGDIKDPNNGETIATAKHDTANNLITY
FT                   TFTDYVDRFNSVQMGINYSIYMDADTIPVSKNDVEFNVTIGNTTTKTTANIQYPDYVVN
FT                   EKNSIGSAFTETVSHVGNKENPGYYKQTIYVNPSENSLTNAKLKVQAYHSSYPNNIGQI
FT                   NKEVTDIKIYQVPKGYTLNKGYDVNTKELTDVTNQYLQKITYGDNNSAVIDFGNADSAY
FT                   VVMVNTKFQYTTSESPTLVQMVTLSSNNSKSASMGNALGFTNNQSGGAGQEVYKIGNYV
FT                   WEDTNKNGVQELGEKGVGNVTVTVFDNNTNTKVGEAVTKEDGSYLIPNLPNGDYRVEFS
FT                   NLPKGYEVTPSKQGNNEELDSNGLSSVITVNGKDNLSADLGIYKPKYNLGDYVWEDTNK
FT                   NGIQDQDEKGISGVTVTLKDENGNVLKTVTTDADGKYKFTDLDNGNYKVEFTTPEGYTP
FT                   TTVTSGSDIEKDSNGLTTTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKDGKQDST
FT                   EKGISGVTVTLKNENGEVLQTTKTDKDGKYQFTGLENGTYKVEFETPSGYTPTQVGSGT
FT                   DEGIDSNGTSTTGVIKDKDNDTIDSGFYKPTYNLGDYVWEDTNKNGVQDKDEKGISGVT
FT                   VTLKDENDKVLKTVTTDENGKYQFTDLNNGTYKVEFETPSGYTPTSVTSGNDTEKDSNG
FT                   LTTTGVIKDADNMTLDSGFYKTPKYSLGDYVWYDSNKDGKQDSTEKGIKDVKVTLLNEK
FT                   GEVIGTTKTDENGKYRFDNLDSGKYKVIFEKPAGLTQTGTNTTEDDKDADGGEVDVTIT
FT                   DHDDFTLDNGYFEEDTSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
FT                   DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSE
FT                   SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
FT                   DSDSDSDSDSDSDSDSDSDSDAGKHTPVKPMSTTKDHHNKAKALPETGNENSGSNNATL
FT                   FGGLFAALGSLLLFGRRKKQNK"
FT   misc_feature    597646..597801
FT                   /note="Signal peptide predicted for SAS0520 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.996 between residues 52 and 53"
FT   misc_feature    597694..597774
FT                   /note="Pfam match to entry PF04650 YSIRK_signal, YSIRK type
FT                   signal peptide, score 51.2, E-value 2.5e-12"
FT   misc_feature    599422..599643
FT                   /note="Pfam match to entry PF05738 Cna_B, Cna protein
FT                   B-type domain, score 69.0, E-value 1.1e-17"
FT   misc_feature    599713..599757
FT                   /note="Pfam match to entry PF02412 tsp_3, Thrombospondin
FT                   type 3 repeat, score 4.8, E-value 17"
FT   misc_feature    599758..599973
FT                   /note="Pfam match to entry PF05738 Cna_B, Cna protein
FT                   B-type domain, score 85.5, E-value 1.1e-22"
FT   misc_feature    600046..600084
FT                   /note="Pfam match to entry PF02412 tsp_3, Thrombospondin
FT                   type 3 repeat, score 7.8, E-value 4.1"
FT   misc_feature    600091..600306
FT                   /note="Pfam match to entry PF05738 Cna_B, Cna protein
FT                   B-type domain, score 73.1, E-value 6.2e-19"
FT   misc_feature    600376..600420
FT                   /note="Pfam match to entry PF02412 tsp_3, Thrombospondin
FT                   type 3 repeat, score 5.6, E-value 12"
FT   misc_feature    600421..600636
FT                   /note="Pfam match to entry PF05738 Cna_B, Cna protein
FT                   B-type domain, score 76.1, E-value 7.5e-20"
FT   misc_feature    600709..600747
FT                   /note="Pfam match to entry PF02412 tsp_3, Thrombospondin
FT                   type 3 repeat, score 6.4, E-value 7.8"
FT   misc_feature    600754..600966
FT                   /note="Pfam match to entry PF05738 Cna_B, Cna protein
FT                   B-type domain, score 69.1, E-value 9.9e-18"
FT   misc_feature    601525..601569
FT                   /note="Pfam match to entry PF02412 tsp_3, Thrombospondin
FT                   type 3 repeat, score 0.8, E-value 1e+02"
FT   misc_feature    601603..601728
FT                   /note="Pfam match to entry PF00746 Gram_pos_anchor, Gram
FT                   positive anchor, score 51.4, E-value 2e-12"
FT   misc_feature    601666..601719
FT                   /note="1 probable transmembrane helix predicted for SAS0520
FT                   by TMHMM2.0 at aa 1341-1358"
FT   CDS_pept        602137..605562
FT                   /transl_table=11
FT                   /locus_tag="SAS0521"
FT                   /product="bone sialoprotein-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0567"
FT                   /db_xref="GOA:Q6GBS4"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR011266"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="PDB:5IHW"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBS4"
FT                   /protein_id="CAG42296.1"
FT                   /translation="MINRDNKKAITKKGMISNRLNKFSIRKYTVGTASILVGTTLIFGL
FT                   GNQEAKAAENTSTENAKQDDATTSDNKEVVSEAENNSTTENDSTNPIKKETNTDSQPEA
FT                   KEESTKSSTQQQQNNVTATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNNTNN
FT                   DVTTKPSTSEIQTKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEELKN
FT                   NPEKLKELVRNDSNTDHSTKPVATAPTSVAPKRVNAKMRFAVAQPAAVASNNVNDLIKV
FT                   TKQTIKVGDGKDNVAAAHDGKDIEYDTEFTIDNKVKKGDTMTINYDKNVIPSDLTDKND
FT                   PIDITDPSGEVIAKGTFDKATKQITYTFTDYVDKYEDIKSRLTLYSYIDKKTVPNETSL
FT                   NLTFATAGKETSQNVTVDYQDPMVHGDSNIQSIFTKLDEDKQTIEQQIYVNPLKKSATN
FT                   TKVDIAGSQVDDYGNIKLGNGSTIIDQNTEIKVYKVNSDQQLPQSNRIYDFSQYEDVTS
FT                   QFDNKKSFSNNVATLDFGDINSAYIIKVVSKYTPTSDGELDIAQGTSMRTTDKYGYYNY
FT                   AGYSNFIVTSNDSGGGDGTVKPEEKLYKIGDYVWEDVDKDGVQGTDSKEKPMANVLVTL
FT                   TYPDGTTKSVRTDAKGHYEFGGLKDGETYTVKFETPTGYLPTKVNGTTDGEKDSNGSSV
FT                   TVKINGKDDMSLDTGFYKEPKYNLGDYVWEDTNKDGIQDANEPGIKDVKVTLKDSTGKV
FT                   IGTTTTDASGKYKFTDLDNGNYTVEFETPAGYTPTVKNTTAEDKDSNGLTTTGVIKDAD
FT                   NMTLDSGFYKTPKYSLGDYVWYDSNKDGKQDSTEKGIKDVTVTLQNEKGEVIGTTKTDE
FT                   NGKYRFDNLDSGKYKVIFEKPAGLTQTVTNTTEDDKDADGGEVDVTITDHDDFTLDNGY
FT                   FEEDTSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD
FT                   SDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDS
FT                   DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDAGKHTPVKPMSTTKDHHNKAKALPET
FT                   GSENNGSNNATLFGGLFAALGSLLLFGRRKKQNK"
FT   misc_feature    602137..602292
FT                   /note="Signal peptide predicted for SAS0521 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.993 between residues 52 and 53"
FT   misc_feature    602185..602265
FT                   /note="Pfam match to entry PF04650 YSIRK_signal, YSIRK type
FT                   signal peptide, score 51.2, E-value 2.5e-12"
FT   misc_feature    order(602203..602271,605485..605538)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SAS0521 by TMHMM2.0 at aa 23-45 and 1117-1134"
FT   misc_feature    603967..604011
FT                   /note="Pfam match to entry PF02412 tsp_3, Thrombospondin
FT                   type 3 repeat, score 8.2, E-value 3.5"
FT   misc_feature    604018..604233
FT                   /note="Pfam match to entry PF05738 Cna_B, Cna protein
FT                   B-type domain, score 65.3, E-value 1.3e-16"
FT   misc_feature    604306..604344
FT                   /note="Pfam match to entry PF02412 tsp_3, Thrombospondin
FT                   type 3 repeat, score 8.8, E-value 2.6"
FT   misc_feature    604351..604563
FT                   /note="Pfam match to entry PF05738 Cna_B, Cna protein
FT                   B-type domain, score 68.0, E-value 2.1e-17"
FT   misc_feature    604636..604674
FT                   /note="Pfam match to entry PF02412 tsp_3, Thrombospondin
FT                   type 3 repeat, score 6.4, E-value 7.8"
FT   misc_feature    604681..604893
FT                   /note="Pfam match to entry PF05738 Cna_B, Cna protein
FT                   B-type domain, score 69.1, E-value 9.7e-18"
FT   misc_feature    605344..605388
FT                   /note="Pfam match to entry PF02412 tsp_3, Thrombospondin
FT                   type 3 repeat, score 0.8, E-value 1e+02"
FT   misc_feature    605422..605547
FT                   /note="Pfam match to entry PF00746 Gram_pos_anchor, Gram
FT                   positive anchor, score 51.7, E-value 1.7e-12"
FT   misc_feature    605446..605463
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT   CDS_pept        605681..607153
FT                   /transl_table=11
FT                   /locus_tag="SAS0522"
FT                   /product="putative glycosyl transferase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0568"
FT                   /protein_id="CAG42297.1"
FT                   /translation="MNYILGTILESKITGVEKAQINRLKLFKQHGISSKCVYVKWNPYS
FT                   YTYAKQHQIENDVFTMYDYFQKAINYKKTKQVNWIQYWEKSCRYTLKFVENSNDVRIYD
FT                   EEQFIMYAHFLDKQYHHLNYVNYFDHKRRKVKRELYDGRGFLSCSRILGEGQRIVLENY
FT                   YTPNGEIVIQKYFDDIKGKNTLTKVILNEDQHQQFFDTEDELVQYFLHQLCKNNDQIIL
FT                   DRPHELGNVIAGLNQSIPVIVVLHSTHLADTGNGIKSFYKTVFNNLTRYKAIVVSTEQQ
FT                   CQDISQYIENKIPVINIPVGYVANLKYQFDINQKEKNHIISIARLVENKQIKHQVEVIK
FT                   QLVTKHPNIQLNIYGHGNGLSEYRQLVEDYHLSEHVKFHGFKTHINEEIAKAELMLSTS
FT                   KMEGFGLAILESLSVGTPVISYDVDYGPSELIQDGFNGYLVPQGDINQMVEKVDQLLNN
FT                   TQKLQQFSINSIESAQQYNATTISTKWQNILN"
FT   misc_feature    606593..607096
FT                   /note="Pfam match to entry PF00534 Glycos_transf_1,
FT                   Glycosyl transferases group 1, score 156.7, E-value
FT                   4.2e-44"
FT   CDS_pept        complement(607277..608767)
FT                   /transl_table=11
FT                   /locus_tag="SAS0523"
FT                   /product="putative glycosyl transferase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0569"
FT                   /protein_id="CAG42298.1"
FT                   /translation="MNYFVGNSLGVNLTGIEKAIINRLNLFKEMGRPAQCVFLSWNRYL
FT                   YRNAQNYITSSDYINMYDFFQEATYLERNEPFDWLSYWTDECHYTLKHVENSHDFRIYD
FT                   QERFLMYAHFQDPKYRILDYVNHFDSQRRKVKRDFYDVRGFLSCSRILVDKQQTLCEFF
FT                   YNPEGDTKLEKYFSYKDGKPEVQKIIVYYANKQYFFNNETELGAFFIKQLYQHGDLFFS
FT                   DRNVYTAPIFNLTPESIPVVAVLHSTHIKNIDALDSSPFKNVYKAMFENLSRYRAIIVS
FT                   TEQQKLDIEKRINHTIPVVNIPVGYSETIDTPVQTLDQRSVKLISVARYSPEKQLHQQI
FT                   ELIKRLVSYVPKIELHMYGFGSESKKLNELIQKYGLENHVYLRGFLSNLDQEYSDAYLS
FT                   LITSNMEGFSLALLESLAHGVPVISYDIKYGPNELITPDFNGYLITKNDEDALFDKVKY
FT                   VIDHPEVQQRLSKGSLAKAQQYSKASLIKQWDQFVRLI"
FT   misc_feature    complement(607340..607846)
FT                   /note="Pfam match to entry PF00534 Glycos_transf_1,
FT                   Glycosyl transferases group 1, score 120.3, E-value
FT                   3.7e-33"
FT   CDS_pept        complement(609049..609927)
FT                   /transl_table=11
FT                   /locus_tag="SAS0524"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0570"
FT                   /db_xref="GOA:Q6GBS1"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBS1"
FT                   /protein_id="CAG42299.1"
FT                   /translation="MTEFDLSTREGRWKHFGSVDPIEGTKPTTKNEMTDLQSTHKDFLF
FT                   EIEEVGIKNLVYPVLVDQYQTAGTFSFSTSLTKDEKGINMSRIIESVEKHYDNGIELEF
FT                   NTLYQVLRTLQTNMKQNAAGVDVSGKWFFDRYSPTTNIKAVGNADVTYGLAIDGDKVTR
FT                   KELTIEATVTTLCPCSKEISEYSAHNQRGVVTVKTYINKDQDIVDDYKNKILDAMEANA
FT                   SSILYPILKRPDEKRVTERAYENPRFVEDLIRLIAADLVEFDWLDGFDIECRNEESIHQ
FT                   HDAFAKLKYRK"
FT   misc_feature    complement(609058..609834)
FT                   /note="Pfam match to entry PF02649 DUF198, Uncharacterized
FT                   ACR, COG1469, score 207.2, E-value 2.7e-59"
FT   CDS_pept        complement(609940..610605)
FT                   /transl_table=11
FT                   /locus_tag="SAS0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0571"
FT                   /protein_id="CAG42300.1"
FT                   /translation="MTDERHVLVIFPHPDDETFSSAGTLASYIQKGIPVTYACLTLGQM
FT                   GRNLGNPPFATRESLPSIRERELEEACKVIGITDLRKMGLRDKTVEFEPYEHIDGMIKS
FT                   LIDDTNPSLIISFYPGYAVHPDHEATADAVIRTVERMPKEERPRLTLVAFSNDATEALG
FT                   EPDIQNDITDFKELKIKAFEAHASQTGPFLKQLASPEIDGKQHSFLTVEPYWTYHFKS"
FT   misc_feature    complement(609964..610605)
FT                   /note="Pfam match to entry PF02585 DUF158, Uncharacterised
FT                   LmbE-like protein, COG2120, score 8.8, E-value 2.8e-08"
FT   CDS_pept        complement(610619..610978)
FT                   /transl_table=11
FT                   /locus_tag="SAS0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0572"
FT                   /protein_id="CAG42301.1"
FT                   /translation="MEPIKEQEVIDLLASFEHKPVYLHVETTNGAYANHFDQRVFNAGT
FT                   FLRNIQVTYTHAQLKGGNKEPYRIGLKLSNGGWVYVQGLTHFEVNEHDEFLIAGFNYEG
FT                   QLAAALQISERPFNL"
FT   CDS_pept        611257..612015
FT                   /transl_table=11
FT                   /locus_tag="SAS0527"
FT                   /product="putative glucosamine-6-phosphate isomerase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0573"
FT                   /db_xref="GOA:Q6GBR8"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBR8"
FT                   /protein_id="CAG42302.1"
FT                   /translation="MKVLNLGSKKQASFYVACELYKEMAFNQHCKLGLATGGTMTDLYE
FT                   QLVKLLNKNQLNVDNVSTFNLDEYVGLTASHPQSYHYYMDDMLFKQYPYFNRKNIHIPN
FT                   GDADDMNAEASKYNDVLEQQGQRDIQILGIGENGHIGFNEPGTPFDSVTHIVDLTESTI
FT                   KANSRYFKNEDDVPKQAISMGLANILQAKRIILLAFGEKKRAAITHLLNQEISVDVPAT
FT                   LLHKHPNVEIYLDDEACPKNVAKIHVDEMD"
FT   misc_feature    611299..611991
FT                   /note="Pfam match to entry PF01182 Glucosamine_iso,
FT                   Glucosamine-6-phosphate
FT                   isomerases/6-phosphogluconolactonase, score 193.7, E-value
FT                   3.1e-55"
FT   CDS_pept        612092..612724
FT                   /transl_table=11
FT                   /locus_tag="SAS0528"
FT                   /product="putative hexulose-6-phosphate synthase"
FT                   /EC_number="4.1.2.-"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0574"
FT                   /db_xref="GOA:Q6GBR7"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017553"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBR7"
FT                   /protein_id="CAG42303.1"
FT                   /translation="MELQLAIDLLNKEDAAELANKVKDYVDIVEIGTPIIYNEGLPAVK
FT                   HMADNISNVKVLADMKIMDAADYEVSQAIKFGADVITILGVAEDASIKAAIEEAHKNNK
FT                   QLLVDMIAVQDLEKRAKELDEMGADYIAVHTGYDLQAEGQSPLESLRTVKSVIKNSKVA
FT                   VAGGIKPDTIKEIVAESPDLVIVGGGIANADDPVEAAKQCRAAIEGK"
FT   misc_feature    612092..612700
FT                   /note="Pfam match to entry PF00215 OMPdecase, Orotidine
FT                   5'-phosphate decarboxylase / HUMPS family, score 196.9,
FT                   E-value 3.4e-56"
FT   CDS_pept        612726..613274
FT                   /transl_table=11
FT                   /locus_tag="SAS0529"
FT                   /product="putative 6-phospho-3-hexuloisomerase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0575"
FT                   /protein_id="CAG42304.1"
FT                   /translation="MAEFSDYQLILDELKMTLSHVEADEFSTFASKILHAEHIFVAGKG
FT                   RSGFVANSFAMRLNQLGKQAHVVGESTTPAIKSNDVFVIISGSGSTEHLRLLADKAKSV
FT                   GADIVLITTNKDSAIGNLAGTNIVLPAGTKYDEQGSAQPLGSLFEQASQLFLDSVVMGL
FT                   MTEMNVTEQTMQQNHANLE"
FT   misc_feature    612813..613196
FT                   /note="Pfam match to entry PF01380 SIS, SIS domain, score
FT                   47.7, E-value 2.8e-11"
FT   CDS_pept        613387..614034
FT                   /transl_table=11
FT                   /locus_tag="SAS0530"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0576"
FT                   /protein_id="CAG42305.1"
FT                   /translation="MKFDNYIFDFDGTLADTKKCGEVATQSAFKACGLTEPSSKEITHY
FT                   MGIPIEESFLKLADRPLDEAALAKLIDTFRHTYQSIEKDYIYEFAGITEAITSLYNQGK
FT                   KLFVVSSKKSDVLERNLSAIGLNHLITEAVGSDQVSAYKPNPEGIHTIVQRYNLNSQQT
FT                   VYIGDSTFDVEMAQHAGVPSAAVTWGAHDARSLLHSNPDFIINDPSEINTVL"
FT   misc_feature    613393..613953
FT                   /note="Pfam match to entry PF00702 Hydrolase, haloacid
FT                   dehalogenase-like hydrolase, score 104.5, E-value 2.1e-28"
FT   CDS_pept        614536..615936
FT                   /transl_table=11
FT                   /locus_tag="SAS0531"
FT                   /product="putative proline/betaine transporter"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0577"
FT                   /db_xref="GOA:Q6GBR4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBR4"
FT                   /protein_id="CAG42306.1"
FT                   /translation="MDFNKENINMVDAKKAKKTVVATGIGNAMEWFDFGVYAYTTAYIG
FT                   ANFFSPVENADIRQMLTFAALAIAFLLRPIGGVVFGIIGDKYGRKVVLTSTIILMAFST
FT                   LTIGLLPSYDQIGLWAPILLLLARVLQGFSTGGEYAGAMTYVAESSPDKRRNSLGSGLE
FT                   IGTLSGYIAASIMIAVLTFFLTDEQMASFGWRIPFLLGLFLGLFGLYLRRKLEESPVFE
FT                   NDVATQPERDNINFLQIIRFYYIDIFVCFVAVVFFNVTNYMVTAYLPTYLEQVIKLDAT
FT                   TTSVLITCVMAIMIPLALMFGKLADKIGEKKVFLIGTGGLTLFSIIAFMLLHSQSFVVI
FT                   VIGIFILGFFLSTYEATMPGSLPTMFYSHIRYRTLSVTFNISVSIFGGTTPLVATWLVT
FT                   KTGDPLAPAYYLTAISVIGFLVITFLHLSTAGKSLKGSYPNVDNEQDRAYYAEHPKEAL
FT                   WWVKERKN"
FT   misc_feature    614587..615882
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter, score 152.4, E-value 8.4e-43"
FT   misc_feature    order(614593..614661,614719..614787,614806..614874,
FT                   614887..614955,615013..615081,615109..615168,
FT                   615259..615327,615370..615438,615472..615531,
FT                   615544..615597,615658..615726,615754..615822)
FT                   /note="12 probable transmembrane helices predicted for
FT                   SAS0531 by TMHMM2.0 at aa 20-42, 62-84, 91-113, 118-140,
FT                   160-182, 192-211, 242-264, 279-301, 313-332, 337-354,
FT                   375-397 and 407-429"
FT   misc_feature    614923..615000
FT                   /note="PS00217 Sugar transport proteins signature 2."
FT   CDS_pept        616187..616480
FT                   /transl_table=11
FT                   /locus_tag="SAS0532"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0578"
FT                   /protein_id="CAG42307.1"
FT                   /translation="MSNAINIETLTFNIIIENTNLNRLGDLFVSVIAIAITSFLYIHIV
FT                   TSYLIKNMVLQYQIYLGLKFDFYNRQVYLIKILIHYIMLTICILKFTLSEGY"
FT   misc_feature    order(616268..616336,616397..616465)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SAS0532 by TMHMM2.0 at aa 28-50 and 71-93"
FT   CDS_pept        616480..617856
FT                   /transl_table=11
FT                   /locus_tag="SAS0533"
FT                   /product="putative AMP-binding enzyme"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0580"
FT                   /db_xref="GOA:Q6GBR2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBR2"
FT                   /protein_id="CAG42308.1"
FT                   /translation="MNVILEQLKTHTQNKPNDIALHIDDETITYSQLNARITSAVESLQ
FT                   KYSLNPVVAINMKSPVQSIICYLALHRLHKVPMMMEGKWQSTIHRQLIEKYGIKDVIGD
FT                   TGLMQNIDSPMFIDSTQLQHYPNLLHIGFTSGTTGLPKAYYRDEDSWLASFEVNEMLML
FT                   KNENAIAAPGPLSHSLTLYALLFALSSGRTFIGQTTFHPEKLLNQCHKISSYKVAMFLV
FT                   PTMIKSLLLVYNNEHTIQSFFSSGDKLHSSIFKKIKNQANDINLIEFFGTSETSFISYN
FT                   LNQQAPVESVGVLFPNVELKTTNHDHNGIGTICIKSNMMFSGYVSEQCINNDEWFVTND
FT                   NGYVKEQYLYLTGRQQDMLIIGGQNIYPAHVERLLTQSSSIDEAIIIGIPNERFGQIGV
FT                   LLYSGDVTLTHKNVKQFLKKKVKRYEIPSMIHHVEKMYYTASGKIAREKMMSMYLRGEL
FT                   "
FT   misc_feature    616564..617637
FT                   /note="Pfam match to entry PF00501 AMP-binding, AMP-binding
FT                   enzyme, score 100.2, E-value 4.4e-27"
FT   misc_feature    616870..616905
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT   CDS_pept        617858..618997
FT                   /transl_table=11
FT                   /locus_tag="SAS0534"
FT                   /product="putative ketoacyl-CoA thiolase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0581"
FT                   /db_xref="GOA:Q6GBR1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBR1"
FT                   /protein_id="CAG42309.1"
FT                   /translation="MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYLEVI
FT                   SKIDDVVLGNVVGNGGNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGA
FT                   GKVYIAGGVESTSRAPWKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMY
FT                   DVSRELQDEFAYRSHQLTAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRF
FT                   KPVIKGGTVTAANSCMKNDGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIG
FT                   PVPAISNLLKRNQLTIENIEVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPY
FT                   GASGAQLVTRLFYMFDKETMIASMGIGGGLGNAALFTRF"
FT   misc_feature    617858..618613
FT                   /note="Pfam match to entry PF00108 thiolase, Thiolase,
FT                   N-terminal domain, score 196.7, E-value 3.9e-56"
FT   misc_feature    618626..618991
FT                   /note="Pfam match to entry PF02803 thiolase_C, Thiolase,
FT                   C-terminal domain, score 113.0, E-value 5.8e-31"
FT   misc_feature    618839..618889
FT                   /note="PS00737 Thiolases signature 2."
FT   CDS_pept        618972..619337
FT                   /transl_table=11
FT                   /locus_tag="SAS0535"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0582"
FT                   /db_xref="InterPro:IPR016994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBR0"
FT                   /protein_id="CAG42310.1"
FT                   /translation="MQHYLLDSNQRLNVSFSKDSVAAYYQCFNQPYRKEVPPLMCASLW
FT                   PKFDLFKKYANSELILTKSAINQTQKIEVDTIYVGHLEDIECRQTRNITRYTMALTLTK
FT                   NDQHVITVTQTFIKAMK"
FT   CDS_pept        619340..619609
FT                   /transl_table=11
FT                   /locus_tag="SAS0536"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0583"
FT                   /protein_id="CAG42311.1"
FT                   /translation="MKFNEIWINEYLALVNDDNPIHNEIVPGQLVSQMMLMAMSLETNQ
FT                   CQINYVKPILINENIEFIEQHEHEIIAINDDGEIKIKISLSTKK"
FT   CDS_pept        complement(619810..619977)
FT                   /transl_table=11
FT                   /locus_tag="SAS0537"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0584"
FT                   /db_xref="InterPro:IPR035374"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBQ8"
FT                   /protein_id="CAG42312.1"
FT                   /translation="MIIYRQYHHEGAPVYEIITKTFQHVSIKCDDSFSDTEIFKLLSLL
FT                   QDDIDHMKVS"
FT   CDS_pept        complement(620484..621314)
FT                   /transl_table=11
FT                   /locus_tag="SAS0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0585"
FT                   /protein_id="CAG42313.1"
FT                   /translation="MALKKVLTIAGSDTSAGAGMQADLKTFQELDTYGMVALTAIVTMD
FT                   KDTWSHDVTPLPMDVFEKQLETALSIGPDAIKTGMLGTEEIIKRAGEVYEASNAQYFVV
FT                   DPVMVCKGEDEVLNPGNTEAMIKYLLPKATVVTPNLFEAGQLSGLGKLNSIEDMKKAAT
FT                   IIFDKGAQHVIIKGGKALDQDKSYDLYYDGQTFYQLTTDMFQQSYNHGAGCTFAAATTA
FT                   YLANGKSPKEAVISAKAFVASAIKNGWKMNDFVGPVDHGAYNRIEHIDVEVTEV"
FT   misc_feature    complement(620628..620651)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        621498..622154
FT                   /transl_table=11
FT                   /locus_tag="SAS0539"
FT                   /product="putative uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0586"
FT                   /db_xref="GOA:Q6GBQ6"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBQ6"
FT                   /protein_id="CAG42314.1"
FT                   /translation="MEWSQIFHDITTKHDFKAMHDFLEKEYSTAIVYPDRENIYQAFDL
FT                   TPFENIKVVILGQDPYHGPNQAHGLAFSVQPNAKFPPSLRNMYKELADDIGCVRQTPHL
FT                   QDWAREGVLLLNTVLTVRQGEANSHRDIGWETFTDEIIKAVSDYKEHVVFILWGKPAQQ
FT                   KIKLIDTSKHCIIKSVHPSPLSAYRGFFGSKPYSKANAYLESVGKLPINWCESEA"
FT   misc_feature    621633..622109
FT                   /note="Pfam match to entry PF03167 UDG, Uracil DNA
FT                   glycosylase superfamily, score 246.1, E-value 5e-71"
FT   misc_feature    621651..621680
FT                   /note="PS00130 Uracil-DNA glycosylase signature."
FT   CDS_pept        622155..622535
FT                   /transl_table=11
FT                   /locus_tag="SAS0540"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0587"
FT                   /protein_id="CAG42315.1"
FT                   /translation="MLNRETLIARIEQELVQAEQAQHDHDFEKHMYAIHILTSLYASTS
FT                   NTPHIGEQQMNRRIANHNQMPQSQITQPTHQVTAAEIEAMGGKVNTHSAHHHNKSYSQP
FT                   SNQQQRLATDDDIGNGESIFDF"
FT   CDS_pept        622668..623036
FT                   /transl_table=11
FT                   /locus_tag="SAS0541"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0588"
FT                   /db_xref="GOA:Q6GBQ4"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBQ4"
FT                   /protein_id="CAG42316.1"
FT                   /translation="MKLFIILGALNAMMAVGTGAFGAHGLQGKISDHYLSVWEKATTYQ
FT                   MYHGLALLIIGVISGTTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGAITPIGGV
FT                   LFIIGWIMLIIATFKFAG"
FT   misc_feature    622668..622733
FT                   /note="Signal peptide predicted for SAS0541 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.970) with cleavage site
FT                   probability 0.657 between residues 22 and 23"
FT   misc_feature    622677..623012
FT                   /note="Pfam match to entry PF04241 DUF423, Protein of
FT                   unknown function (DUF423), score 221.2, E-value 1.6e-63"
FT   misc_feature    order(622677..622745,622806..622859,622869..622928,
FT                   622947..623015)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SAS0541 by TMHMM2.0 at aa 4-26, 47-64, 68-87 and 94-116"
FT   CDS_pept        623157..624641
FT                   /transl_table=11
FT                   /locus_tag="SAS0542"
FT                   /product="putative amino acid permease"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0589"
FT                   /protein_id="CAG42317.1"
FT                   /translation="MEKKNKQIDRGDLKQNLSEKFVWAIAYGSCIGWGAFILPGDWIKQ
FT                   SGPIAASIGIVIGTLLMILIAVSYGALVERFPVSGGAFAFSFLSFGRYVSFFSSWFLTF
FT                   GYVCVVALNATAFSLLVKFLLPDVLNNGKLYTIAGWDVYITEIIIATVLLLVFMLVTIR
FT                   GASVSGSLQYYFCVAMVIVVLLMFFGSFFGNNFALENLQPLAEPSKGWLVSIVVIVSVA
FT                   PWAYVGFDNIPQTAEEFNFAPNKTFKLIVYSLLAASLTYVVMILYTGWLSTSHQSLNGQ
FT                   LWLTGAVTQTAFGYIGLGVLAIAIMMGIFTGLNGFLMSSSRLLFSMGRSGIMPTMFSKL
FT                   HSKYKTPYVAIIFLVGVSLIAPWLGRTALTWIVDMSSTGVSIAYFITCLSAAKLFSYNK
FT                   QSNTYAPVYKTFAIIGSFVSFIFLALLLVPGSPAALTAPSYIALLGWLIIGLIFFVIRY
FT                   PKLKNMDNDELSRLILNRSENEVDDMIEEPEKEKTK"
FT   misc_feature    order(623217..623276,623304..623372,623433..623501,
FT                   623568..623636,623673..623741,623784..623843,
FT                   623901..623969,624027..624095,624192..624251,
FT                   624279..624347,624384..624443,624456..624524)
FT                   /note="12 probable transmembrane helices predicted for
FT                   SAS0542 by TMHMM2.0 at aa 21-40, 50-72, 93-115, 138-160,
FT                   173-195, 210-229, 249-271, 291-313, 346-365, 375-397,
FT                   410-429 and 434-456"
FT   misc_feature    623217..624566
FT                   /note="Pfam match to entry PF00324 aa_permeases, Amino acid
FT                   permease, score -9.8, E-value 1.9e-07"
FT   CDS_pept        complement(624782..625234)
FT                   /transl_table=11
FT                   /locus_tag="SAS0543"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0590"
FT                   /protein_id="CAG42318.1"
FT                   /translation="MFWILNFIFSFLASMFFCVIFDAPRKLYLSCGFVGTCGWMVYTLF
FT                   FNGFNVHTIYSSFFGSLALGLLSHYMARKQKEPAIIFMVTGIIPLVPGGLAYDATKNLV
FT                   LLNFSTAINTMLEVTLIAGAIALGLLFADQISKLIVSGFVKSFKRL"
FT   misc_feature    complement(order(624839..624907,624935..625003,
FT                   625037..625105,625163..625231))
FT                   /note="4 probable transmembrane helices predicted for
FT                   SAS0543 by TMHMM2.0 at aa 2-24, 44-66, 78-100 and 110-132"
FT   CDS_pept        complement(625247..626011)
FT                   /transl_table=11
FT                   /locus_tag="SAS0544"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0591"
FT                   /protein_id="CAG42319.1"
FT                   /translation="MDINSEEYKQEVLIKDVVMLAARILLESGAEGTRVEDTMTRIAKK
FT                   LGYSESNSFVTNTVIQFTLHSESFPRIFRITSRDTNLIKISQANKISRQITNNEISLAE
FT                   AKTQLEKIYVAKRDSSLPFKGFAAAMIAMSFLYLQGGRLIDVLTAILAGSLGYLVTEIL
FT                   DRKLHAQFIPEFIGSLVIGIIAVIGHTLIPTGDLATIIIAAVMPIVPGVLITNAIQDLF
FT                   GGHMLMFTTKSLEALVTAFGIGAGVGSVLILV"
FT   misc_feature    complement(order(625253..625312,625355..625423,
FT                   625436..625504,625532..625600))
FT                   /note="4 probable transmembrane helices predicted for
FT                   SAS0544 by TMHMM2.0 at aa 138-160, 170-192, 197-219 and
FT                   234-253"
FT   CDS_pept        626322..626519
FT                   /transl_table=11
FT                   /locus_tag="SAS0545"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0592"
FT                   /protein_id="CAG42320.1"
FT                   /translation="MIVVKVLPRKTTRVHFAMSKVYFVIDNTLAHIYKFKHTDFNYLPN
FT                   HVLCIREYTEDKRKIPSLNR"
FT   CDS_pept        complement(626560..627312)
FT                   /transl_table=11
FT                   /locus_tag="SAS0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0593"
FT                   /db_xref="GOA:Q6GBP9"
FT                   /db_xref="InterPro:IPR010644"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR031332"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBP9"
FT                   /protein_id="CAG42321.1"
FT                   /translation="MSQAAETLDGWYSLHLFYAVDWASLRLVPKDERDALVTEFQSFLE
FT                   NTATVRSSKSGDQAIYNITGQKADLLLWFLRPEMKSLNHIENEFNKLRIADFLIPTYSY
FT                   VSVIELSNYLAGKSDEDPYENPHIKARLYPELPHSDYICFYPMNKRRNETYNWYMLTME
FT                   ERQKLMYDHGMIGRKYAGKIKQFITGSVGFDDFEWGVTLFSDDVLQFKKIVYEMRFDET
FT                   TARYGEFGSFFVGHLINTNEFDQFFAIS"
FT   CDS_pept        627480..628466
FT                   /transl_table=11
FT                   /locus_tag="SAS0547"
FT                   /product="putative phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0594"
FT                   /db_xref="GOA:Q6GBP8"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBP8"
FT                   /protein_id="CAG42322.1"
FT                   /translation="MADLLNVLKDKLSGKNVKIVLPEGEDERVLTAATQLQATDYVTPI
FT                   VLGDETKVQSLAQKLDLDISNIELINPATSELKAELVQSFVERRKGKATEEQAQELLNN
FT                   VNYFGTMLVYAGKADGLVSGAAHSTGDTVRPALQIIKTKPGVSRTSGIFFMIKGDVQYI
FT                   FGDCAINPELDSQGLAEIAVESAKSALSFGMDPKVAMLSFSTKGSAKSDDVTKVQEAVK
FT                   LAQQKAEEEKLEAIIDGEFQFDAAIVPGVAEKKAPGAKLQGDANVFVFPSLEAGNIGYK
FT                   IAQRLGGYDAVGPVLQGLNSPVNDLSRGCSIEDVYNLSIITAAQALQ"
FT   misc_feature    627486..628448
FT                   /note="Pfam match to entry PF01515 PTA_PTB, Phosphate
FT                   acetyl/butaryl transferase, score 541.8, E-value 4.9e-160"
FT   CDS_pept        628469..629305
FT                   /transl_table=11
FT                   /locus_tag="SAS0548"
FT                   /product="lipoate-protein ligase A protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0595"
FT                   /protein_id="CAG42323.1"
FT                   /translation="MDLASKYFNGVNWRYIDHSSGLEPMQSFAFDDTFCESVGKDISDN
FT                   VVRTWIHQHTVILGIHDSRLPFLKDGIDYLTNEIGYNAIVRNSGGLGVVLDQGVLNISL
FT                   MFKGQTETTIDEAFTVMYLLISKMFENENVDIDTMEIEHSYCPGKFDLSIDGKKFAGIS
FT                   QRRVRGGIAVQIYLCVEGSGSERALMMQTFYEHALKGEVTKFKYPEIEPSCMASLETLL
FT                   NKTITVQDVMFLLLYAIKDLGGVLNMTPITQEEWQRYDTYFDKMIERNKKMIDQMQ"
FT   misc_feature    628628..629023
FT                   /note="Pfam match to entry PF03099 BPL_LipA_LipB,
FT                   Biotin/lipoate A/B protein ligase family, score 27.9,
FT                   E-value 2.2e-05"
FT   CDS_pept        629892..630812
FT                   /transl_table=11
FT                   /locus_tag="SAS0549"
FT                   /product="mevalonate kinase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0596"
FT                   /protein_id="CAG42324.1"
FT                   /translation="MTRKGYGESTGKIILIGEHAVTFGEPAIAVPFNAGKIKVLIEALE
FT                   SGNYSSIKSDVYDGMLYDAPDHLKSLVNRFVELNNITEPLAVTIQTNLPPSRGLGSSAA
FT                   VAVAFVRASYDFLGKSLTKEELIEKANWAEQIAHGKPSGIDTQTIVSGKPVWFQKGHAE
FT                   TLKTLSLDGYMVVIDTGVKGSTRQAVEDVHKLCEDPQYMSHVKHIGKLVLRASDVIEHH
FT                   NFEALADIFNECHADLKALTVSHDKIEQLMKIGKENGAIAGKLTGAGRGGSMLLLAKDL
FT                   PTAKNIVKAVEKAGAAHTWIENLGG"
FT   misc_feature    630141..630794
FT                   /note="Pfam match to entry PF00288 GHMP_kinases, GHMP
FT                   kinases putative ATP-binding protein, score 149.4, E-value
FT                   6.4e-42"
FT   misc_feature    630168..630203
FT                   /note="PS00627 GHMP kinases putative ATP-binding domain."
FT   CDS_pept        630817..631800
FT                   /transl_table=11
FT                   /locus_tag="SAS0550"
FT                   /product="mevalonate diphosphate decarboxylase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0597"
FT                   /protein_id="CAG42325.1"
FT                   /translation="MIKSGKARAHTNIALIKYWGKKDEALIIPMNNSISVTLEKFYTET
FT                   KVTFNDQLTQDQFWLNGEKVSGKELEKISKYMDIVRNRAGIDWYAEIESDNFVPTAAGL
FT                   ASSASAYAALAAACNQALDMQLSDKDLSRLARIGSGSASRSIYGGFAEWEKGYSDETSY
FT                   AVPLESNHFEDDLAMIFVVINQHSKKVPSRYGMSLTRNTSRFYQYWLDHIDEDLAEAKA
FT                   AIQDKDFKRLGEVIEENGLRMHATNLGSTPPFTYLVQESYDVMALVHECREAGYPCYFT
FT                   MDAGPNVKILVEKKNKQQIIDKLLTQFDNNQIIDSDIIATGIEIIE"
FT   misc_feature    631081..631797
FT                   /note="Pfam match to entry PF00288 GHMP_kinases, GHMP
FT                   kinases putative ATP-binding protein, score 152.0, E-value
FT                   1.1e-42"
FT   CDS_pept        631813..632889
FT                   /transl_table=11
FT                   /locus_tag="SAS0551"
FT                   /product="phosphomevalonate kinase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0598"
FT                   /protein_id="CAG42326.1"
FT                   /translation="MIQVKAPGKLYIAGEYAVTEPGYKSVLIALDRFVTATIEEADQYK
FT                   GTIHSKALHHNPVTFSRDEDSIVISDPHAAKQLNYVVTAIEIFEQYAKSCDIAMKHFHL
FT                   TIDSNLDDSNGHKYGLGSSAAVLVSVIKVLNEFYDMKLSNLYIYKLAVIANMKLQSLSS
FT                   CGDIAVSVYSGWLAYSTFDHEWVKHQIEDTTVEEVLIKNWPGLHIEPLQAPENMEVLIG
FT                   WTGSPASSPHFVSEVKRLKSDPSFYGDFLEDSHHCVEKLIHAFKTNNIKGVQKMVRQNR
FT                   TIIQRMDKEATVDIETEKLKYLCDIAEKYHGASKTSGAGGGDCGITIINKDVDKEKIYD
FT                   EWTKHGIKPLKFNIYHGQ"
FT   misc_feature    632113..632856
FT                   /note="Pfam match to entry PF00288 GHMP_kinases, GHMP
FT                   kinases putative ATP-binding protein, score 134.3, E-value
FT                   2.4e-37"
FT   CDS_pept        633066..633407
FT                   /transl_table=11
FT                   /locus_tag="SAS0552"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0599"
FT                   /db_xref="InterPro:IPR009910"
FT                   /db_xref="InterPro:IPR020880"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBP3"
FT                   /protein_id="CAG42327.1"
FT                   /translation="MKNTFLICDECQAVNIRTLQKKLEKLDPDAEIVIGCQSYCGPGRR
FT                   KTFTFVNNRPLAALTEEELIEKVSQQLKKPRDPEEEERLRKRHEERKRRKEEQDRKLKE
FT                   KLEKRKAQQ"
FT   CDS_pept        complement(633459..634781)
FT                   /transl_table=11
FT                   /locus_tag="SAS0553"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0600"
FT                   /protein_id="CAG42328.1"
FT                   /translation="MKTYDLIVIGFGEAGKTLAKYAASTGQHVAVIEQSPKMYGGTCIN
FT                   IGCIASKTLVHDGLEGKSFEASYNRKNDVVNALNNKNYHLLADDNNIDVLDFKAQFKSN
FT                   TEVNLLDQHDDIADSITAPHIIINTGATSVIPNIKGLDQAKHVFDSTGLLNINYQPKHL
FT                   VIVGGGYIALEFASMFANLGSKVTVLERGESFMPREDQDVVAHAITDLENKGITLHTNV
FT                   ETTELSSDNHHTTVHTNVGNFEADAVLLAIGRKPNTDLALENTDIELGDRGEIKVNAHL
FT                   QTTVPHIYAAGDVKGGLQFTYISLDDYRIIKSALYGNQSRTTDNRGGVPYTVFIDPPLS
FT                   RVGLTSKEAAAQHYDYTEHQLLVSAIPRHKINNDPRGLFKVVINNENNMILGATLYGKQ
FT                   SEELINIIKLAIDQNIPYTVLRDNIYTHPTMAESFNDLFNF"
FT   misc_feature    complement(633468..633797)
FT                   /note="Pfam match to entry PF02852 pyr_redox_dim, Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain,
FT                   score 95.3, E-value 1.2e-25"
FT   misc_feature    complement(633873..634769)
FT                   /note="Pfam match to entry PF00070 pyr_redox, Pyridine
FT                   nucleotide-disulphide oxidoreductase, score 272.0, E-value
FT                   8.1e-79"
FT   misc_feature    complement(634731..634754)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(634768..635208)
FT                   /transl_table=11
FT                   /locus_tag="SAS0554"
FT                   /product="putative DNA-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0601"
FT                   /protein_id="CAG42329.1"
FT                   /translation="MNLEFNIAVHVLAFLTKHHSEKFNSSSLAELTCLNPVQLRRVTTQ
FT                   LVDLKMINTIRGKDGGYLSNDRSADVSLATLYKHFVLEKEHHTRLFTGDEGSHCQIARN
FT                   IATTMSHYEQDEQNIIINFYKGKTIKDVIEDIQKEDLCHENI"
FT   misc_feature    complement(635077..635142)
FT                   /note="Predicted helix-turn-helix motif for SAS0554 with
FT                   score 1199.000, SD 3.27 at aa 23-44, sequence
FT                   FNSSSLAELTCLNPVQLRRVTT"
FT   CDS_pept        635833..637242
FT                   /transl_table=11
FT                   /locus_tag="SAS0555"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0602"
FT                   /protein_id="CAG42330.1"
FT                   /translation="MSIDMYLDRSRNQASSVGNLSQTMNSNYDALEKAITQFINDDVLK
FT                   GKAYTSAKQFFSTVLIPLSTSMKTLSDLTKQACDNFVSRYTSEVDSISLKESELEEDIR
FT                   SLSQQITRYENLNNNLKKHASDNQQAISSNQQIIQTLGQQKHELEEKLRKLREFNQKSP
FT                   EIFKEVEEFQKIVQQGLTQAQNFWNFSTNQFNIPSGKELDWAKASHEKYLKVAMGKIEH
FT                   KAEKETLNKADFAVIKAYAKEHPEDDIPKSILKYINDNKDSIKRDIGLDITSTLLEQGG
FT                   INASKFGVFINTAGGVKGPAGPNSFVEVKRTSGNVFIENGSKFAKGGKYLGKGVAGVGF
FT                   GIGMYDDLANDDKTFGEALSHNGMTLAAGSAGTAVGAGLATFVLGSNPVGWVILAGLAM
FT                   STVFALGTDLIYQNNIFGLKDKVDWVGHKIDNSIDVVKKTTEKSMDSVGNAVSEAKNII
FT                   SNHINPMKWAW"
FT   misc_feature    636997..637065
FT                   /note="1 probable transmembrane helix predicted for SAS0555
FT                   by TMHMM2.0 at aa 389-411"
FT   CDS_pept        637246..637872
FT                   /transl_table=11
FT                   /locus_tag="SAS0556"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Staphylococcus haemolyticus hypothetical
FT                   protein SWALL:Q9F2H5 (EMBL:AJ302698) (220 aa) fasta scores:
FT                   E(): 6.1e-07, 23.28% id in 189 aa, and to Oceanobacillus
FT                   iheyensis hypothetical conserved protein ob3290
FT                   SWALL:Q8ELD9 (EMBL:AP004604) (212 aa) fasta scores: E():
FT                   3.6e-06, 21.56% id in 218 aa"
FT                   /protein_id="CAG42331.1"
FT                   /translation="MLFNVKVINKNPRYKVVQYNDEYLLIDLVSTWLVYFFPFINWFIP
FT                   KRYAKLSEKELENLNVDKQNKNNIFWPVTGSSFLFVVILRKYVHTFEVQLDNKILISLC
FT                   FIGFIGIAAFYIYLNKKLKLKIYDDNLDNENKVILVPTFKDGSFIVFTYLLLGGCSILF
FT                   LIWLMTIKPQNLLVFIMWIIITIFFFLISMGSISNKKVYAKLKKQ"
FT   misc_feature    637276..637869
FT                   /note="Pfam match to entry PF04276 DUF443, Protein of
FT                   unknown function (DUF443), score 245.1, E-value 1e-70"
FT   misc_feature    order(637312..637380,637444..637497,637540..637599,
FT                   637687..637755,637768..637836)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SAS0556 by TMHMM2.0 at aa 23-45, 67-84, 99-118, 148-170 and
FT                   175-197"
FT   CDS_pept        638008..638640
FT                   /transl_table=11
FT                   /locus_tag="SAS0557"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Oceanobacillus iheyensis hypothetical
FT                   conserved protein ob1330 SWALL:Q8ERH2 (EMBL:AP004597) (217
FT                   aa) fasta scores: E(): 2.9e-07, 26.6% id in 218 aa, and to
FT                   Staphylococcus haemolyticus hypothetical protein
FT                   SWALL:Q9F2H5 (EMBL:AJ302698) (220 aa) fasta scores: E():
FT                   5.3e-07, 27.55% id in 196 aa"
FT                   /protein_id="CAG42332.1"
FT                   /translation="MLYESNIINKNPRYRIIKYKNDYLMIDLVSTWLVLFFPFINWLIP
FT                   KKYVQISREEFDNLNIVKPVKNKALWPVIGSILLFGTMFRDKIYIPDSHLEKNCVIIIC
FT                   SVLLLSILVFYIYLNQKVKLSIYNNRSSNGKIMIFPSFKNLCFVLFSYFFCGGLSIMFL
FT                   DVLISLSIQNIIVFIAWVIMTMLFFFINMSSIIDKKIHVIYLRSYKY"
FT   misc_feature    638038..638628
FT                   /note="Pfam match to entry PF04276 DUF443, Protein of
FT                   unknown function (DUF443), score 294.3, E-value 1.5e-85"
FT   misc_feature    order(638074..638142,638200..638259,638302..638361,
FT                   638440..638508,638518..638577)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SAS0557 by TMHMM2.0 at aa 23-45, 65-84, 99-118, 145-167 and
FT                   171-190"
FT   CDS_pept        638728..639345
FT                   /transl_table=11
FT                   /locus_tag="SAS0558"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Oceanobacillus iheyensis hypothetical
FT                   conserved protein ob1336 SWALL:Q8ERG6 (EMBL:AP004597) (219
FT                   aa) fasta scores: E(): 2.3e-06, 25.58% id in 215 aa, and to
FT                   Staphylococcus haemolyticus hypothetical protein
FT                   SWALL:Q9F2H5 (EMBL:AJ302698) (220 aa) fasta scores: E():
FT                   1.3e-05, 21.1% id in 199 aa"
FT                   /protein_id="CAG42333.1"
FT                   /translation="MLCETEIINKNPKYRVIKYDDEYLMVDVISTWLVYFFPFINWFIP
FT                   KRCAKISREEYEKLNTVKPVKNKNFWPVVGGTILLGATSRKYIHLLNIQLEKRSVIFIC
FT                   FVVFLCILIFFVLLNRKLKLKVFDNKKEEQKIILVPTLKNAVLILYGYLLIGGMSILAL
FT                   SMLLTLENQNLITFIAWGMGLMLFFLMNITLIVNKTVKVIKR"
FT   misc_feature    638758..639342
FT                   /note="Pfam match to entry PF04276 DUF443, Protein of
FT                   unknown function (DUF443), score 290.1, E-value 3e-84"
FT   misc_feature    order(638794..638862,638935..638994,639022..639081,
FT                   639166..639234,639247..639315)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SAS0558 by TMHMM2.0 at aa 23-45, 70-89, 99-118, 147-169 and
FT                   174-196"
FT   CDS_pept        639420..640049
FT                   /transl_table=11
FT                   /locus_tag="SAS0559"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Oceanobacillus iheyensis hypothetical
FT                   conserved protein ob1320 SWALL:Q8ERI2 (EMBL:AP004597) (215
FT                   aa) fasta scores: E(): 5.8e-07, 24.17% id in 211 aa, and to
FT                   Staphylococcus haemolyticus hypothetical protein
FT                   SWALL:Q9F2H5 (EMBL:AJ302698) (220 aa) fasta scores: E():
FT                   2e-07, 22.48% id in 209 aa"
FT                   /protein_id="CAG42334.1"
FT                   /translation="MLCESRVINQNPKYRIIKYNNEYFMVDLVSTWIAYFLPMINWFIP
FT                   KKYAKISREEFESLNIVKPAKNNTFWPVAGFAVLLTTLTRKYIYLLNIHLEKEIVILTC
FT                   CMILLGVFALFIYINTKLKLHIFDKNKSNNEKIILIPTFKNICLSLFAYILFGGLSTMA
FT                   LSMLVTSSPQNIIEFLALIGMTACFFLLNMSSVLDKKIHVILKTNK"
FT   misc_feature    639450..640043
FT                   /note="Pfam match to entry PF04276 DUF443, Protein of
FT                   unknown function (DUF443), score 274.3, E-value 1.6e-79"
FT   misc_feature    order(639486..639554,639627..639686,639714..639773,
FT                   639831..639899,639942..640010)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SAS0559 by TMHMM2.0 at aa 23-45, 70-89, 99-118, 138-160 and
FT                   175-197"
FT   CDS_pept        join(640245..640670,640672..640866)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SAS0560"
FT                   /product="putative membrane protein (pseudogene)"
FT                   /note="Similar to Oceanobacillus iheyensis hypothetical
FT                   conserved protein ob3290 SWALL:Q8ELD9 (EMBL:AP004604) (212
FT                   aa) fasta scores: E(): 0.00024, 21.71% id in 221 aa, and to
FT                   Staphylococcus haemolyticus hypothetical protein
FT                   SWALL:Q9F2H5 (EMBL:AJ302698) (220 aa) fasta scores: E():
FT                   5.1e-07, 25.25% id in 198 aa. CDS contains a frameshift
FT                   after codon 142. Frameshift occurs at a poly A hexamer"
FT                   /db_xref="PSEUDO:CAG42335.1"
FT   misc_feature    640275..640694
FT                   /note="Pfam match to entry PF04276 DUF443, Protein of
FT                   unknown function (DUF443), score 211.2, E-value 1.7e-60"
FT   misc_feature    order(640311..640379,640449..640496,640539..640592,
FT                   640653..640721,640764..640832)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SAS0560 by TMHMM2.0 at aa 23-45, 69-84, 99-116, 137-159 and
FT                   174-196"
FT   CDS_pept        640997..641638
FT                   /transl_table=11
FT                   /locus_tag="SAS0562"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Staphylococcus haemolyticus hypothetical
FT                   protein SWALL:Q9F2H5 (EMBL:AJ302698) (220 aa) fasta scores:
FT                   E(): 3.4e-07, 22.91% id in 192 aa, and to Oceanobacillus
FT                   iheyensis hypothetical conserved protein ob3291
FT                   SWALL:Q8ELD8 (EMBL:AP004604) (216 aa) fasta scores: E():
FT                   9.7e-07, 24.51% id in 208 aa"
FT                   /protein_id="CAG42336.1"
FT                   /translation="METLLCESKVINKNPKYRIIKYDSEYLMIDLASNWIVFFFPFINW
FT                   LIPKTYVKITKNDYEKLNIVKPVKNKSIGWTIFAGIVLLGGTVRRNTYLFDFQLEELIV
FT                   WSSCFIGFLEIIFFYCYLNKKLTLNIYNESKNNELKLRLLPSFKNICFTIFYYLFTGFM
FT                   SYGAFYLLVFENVQNLILYVSWLFMTMLFMFMNMHSIIDKKVHIFLKSNK"
FT   misc_feature    641036..641632
FT                   /note="Pfam match to entry PF04276 DUF443, Protein of
FT                   unknown function (DUF443), score 435.6, E-value 4.6e-128"
FT   misc_feature    order(641072..641140,641210..641263,641300..641359,
FT                   641444..641512,641531..641599)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SAS0562 by TMHMM2.0 at aa 26-48, 72-89, 102-121, 150-172
FT                   and 179-201"
FT   CDS_pept        641685..642314
FT                   /transl_table=11
FT                   /locus_tag="SAS0563"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Oceanobacillus iheyensis hypothetical
FT                   conserved protein ob1336 SWALL:Q8ERG6 (EMBL:AP004597) (219
FT                   aa) fasta scores: E(): 8.9e-09, 24.88% id in 221 aa, and to
FT                   Staphylococcus haemolyticus hypothetical protein
FT                   SWALL:Q9F2H5 (EMBL:AJ302698) (220 aa) fasta scores: E():
FT                   1.1e-07, 25.26% id in 186 aa"
FT                   /protein_id="CAG42337.1"
FT                   /translation="MLCESRQIYKNPKYRVIRYNNEYFMVDLVSTWITYFFAMINWFLP
FT                   KKYAKISENEFERLNIVEPVKNNVFWPVAGSSVLFGIILRKYGNFFNVQFEKQLAITVF
FT                   FIMLIGMLIFYFYLNKKLTLKIFNTNVVNKNRVVLIPTFKQGLLIVFAYFFLGSASIFT
FT                   LTILLTTESQNIIIFLTWVIISMFFFLVNMASIGNKNVHVILRINE"
FT   misc_feature    641715..642308
FT                   /note="Pfam match to entry PF04276 DUF443, Protein of
FT                   unknown function (DUF443), score 252.8, E-value 5e-73"
FT   misc_feature    order(641751..641819,641877..641936,641979..642038,
FT                   642123..642191,642204..642272)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SAS0563 by TMHMM2.0 at aa 23-45, 65-84, 99-118, 147-169 and
FT                   174-196"
FT   CDS_pept        642767..643396
FT                   /transl_table=11
FT                   /locus_tag="SAS0564"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Staphylococcus haemolyticus hypothetical
FT                   protein SWALL:Q9F2H5 (EMBL:AJ302698) (220 aa) fasta scores:
FT                   E(): 8.2e-10, 27.6% id in 192 aa, and to Oceanobacillus
FT                   iheyensis hypothetical conserved protein ob3290
FT                   SWALL:Q8ELD9 (EMBL:AP004604) (212 aa) fasta scores: E():
FT                   1.1e-09, 26.31% id in 209 aa"
FT                   /protein_id="CAG42338.1"
FT                   /translation="MLLCDVRVIYKNPKYKVIQHNGEYLLVDLVSTWFVYFFPFINWFI
FT                   PKKYAIISEEEFENLNVVKPNKNNVFWSVIGSSVLFGVTLRKYIHVFDVQLDKLVVMIL
FT                   CALALICVIVFYFNLNRKLKLKVFDTNIEKNKRVILIPTFKLGCFLVFGYIFAGSFSIF
FT                   SLIALMTIEPQNIIIFIYWIMMTMLFFLLNMTSIGNEKVRVIMKNN"
FT   misc_feature    642800..643393
FT                   /note="Pfam match to entry PF04276 DUF443, Protein of
FT                   unknown function (DUF443), score 278.4, E-value 9.5e-81"
FT   misc_feature    order(642836..642904,642974..643033,643061..643120,
FT                   643178..643246,643289..643357)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SAS0564 by TMHMM2.0 at aa 24-46, 70-89, 99-118, 138-160 and
FT                   175-197"
FT   CDS_pept        643511..644161
FT                   /transl_table=11
FT                   /locus_tag="SAS0565"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Oceanobacillus iheyensis hypothetical
FT                   conserved protein ob1330 SWALL:Q8ERH2 (EMBL:AP004597) (217
FT                   aa) fasta scores: E(): 1.2e-09, 29.24% id in 212 aa, and to
FT                   Staphylococcus haemolyticus hypothetical protein
FT                   SWALL:Q9F2H5 (EMBL:AJ302698) (220 aa) fasta scores: E():
FT                   2.2e-07, 27.04% id in 196 aa"
FT                   /protein_id="CAG42339.1"
FT                   /translation="METLLCETENINKNPKYRIIKYKDEYLMIDLVSTWLALFFPMINW
FT                   LIPKKYVKISEKDFETLNIVKTAKINSFWPVAGSTVLFGVMLRRYSHLFIVKYEYSIVI
FT                   LICCIIILGIFLFFLYLNQKLKLQIYNENKNKSNKIIIFPTLKSLCLSIVLYIYLGGGS
FT                   FFTIYMLLTIEVQNIILFITLFVIFLFFLFLNMCSLYDNKVHVLFKSNGIEKF"
FT   misc_feature    643550..644143
FT                   /note="Pfam match to entry PF04276 DUF443, Protein of
FT                   unknown function (DUF443), score 270.6, E-value 2.1e-78"
FT   misc_feature    order(643586..643654,643718..643771,643814..643873,
FT                   643961..644029,644042..644110)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SAS0565 by TMHMM2.0 at aa 26-48, 70-87, 102-121, 151-173
FT                   and 178-200"
FT   CDS_pept        644198..644833
FT                   /transl_table=11
FT                   /locus_tag="SAS0566"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0603"
FT                   /protein_id="CAG42340.1"
FT                   /translation="MLCESKVINKNPKYRVIKYGDEYLMIDLVSTWLTLFLPMINWLIP
FT                   KKYVKISKKEFDDLNIVKPVKNKAFWPVAGSTILFGVTFRKYIPSLNIQLEKNMVIVIC
FT                   CAIFLGVLILFLFLNRKLRLEIYNNNSSKGKIILFPSLKNFCFTIFYYFLFGGLSIMAL
FT                   SMLLTLNPQNIIGFIGWLVMTAGFFLLNMSSIIDKKIYVLSKTNTVEK"
FT   misc_feature    644228..644818
FT                   /note="Pfam match to entry PF04276 DUF443, Protein of
FT                   unknown function (DUF443), score 293.0, E-value 3.8e-85"
FT   misc_feature    order(644264..644332,644405..644464,644492..644551,
FT                   644636..644704,644717..644785)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SAS0566 by TMHMM2.0 at aa 23-45, 70-89, 99-118, 147-169 and
FT                   174-196"
FT   CDS_pept        645068..645694
FT                   /transl_table=11
FT                   /locus_tag="SAS0567"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0605"
FT                   /protein_id="CAG42341.1"
FT                   /translation="MLLCESKIINKNPKYRIIKYNDEYLMVDIISTWISLFFPFINWFI
FT                   PKEYVKISREEFENLNIVKPAKKNVFWPVAGSSALLGVALRKYTHLLDIQLDKKLVIAI
FT                   CCITFIGILIFYVRLIKKSSLNIYNTKNKRSKIFLIPTLKNVCFTLFGYILFGGLTMLF
FT                   LDALLSMSYQNIIVYFVWIAVIMGFFLVNIALIIDKNIHVILKNQ"
FT   misc_feature    645101..645688
FT                   /note="Pfam match to entry PF04276 DUF443, Protein of
FT                   unknown function (DUF443), score 391.2, E-value 1.1e-114"
FT   misc_feature    order(645137..645205,645365..645418,645479..645547,
FT                   645590..645658)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SAS0567 by TMHMM2.0 at aa 24-46, 100-117, 138-160 and
FT                   175-197"
FT   CDS_pept        645964..646902
FT                   /transl_table=11
FT                   /locus_tag="SAS0568"
FT                   /product="aldo/keto reductase family protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0608"
FT                   /protein_id="CAG42342.1"
FT                   /translation="MKQFVNLGKSDVEVFPIALGTNAVGGHNLYPNLDEEQGKDVVRQA
FT                   INHGINLLDTAYIYGPERSEELVGEVVKEYPREQIKIATKGSHEFDENQEVHQNNQPEY
FT                   LKQQVENSLKRLQTDYIDLYYIHFPDNNTPKDQAVAALQELKEQGKIKAIGVSNFTLDQ
FT                   LKEANKDGYVDVVQLEYNLLHRENEAVLQYCVDHQITFIPYFPLASGILAGKYDENTKF
FT                   SDHRTTRRDFKPGVFEENVRRVKALESIAAAHQTSIANIVLAFYLTRPAIDVIIPGAKR
FT                   AEQVVENIKAADIVLSDDEIQYIDELFPIED"
FT   misc_feature    645985..646896
FT                   /note="Pfam match to entry PF00248 aldo_ket_red, Aldo/keto
FT                   reductase family, score 245.3, E-value 8.8e-71"
FT   misc_feature    646387..646440
FT                   /note="PS00062 Aldo/keto reductase family signature 2."
FT   CDS_pept        647113..647649
FT                   /transl_table=11
FT                   /locus_tag="SAS0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0609"
FT                   /protein_id="CAG42343.1"
FT                   /translation="MITVLFGGSRPNGNTAQLTKFALQDLEYQWIDVTQHQFKPIRDVR
FT                   HTAETITSYDDDYLPILDKILASDTIIFASPVYWYSISAPLKAFIEHWSETLQDKRYPN
FT                   FKAQMAEKDFRVILVGGDCPKIKAKPAITQMKYSLDFLGATLNGYIIGTAEKPGDIMKD
FT                   NYALARATEWNSILQ"
FT   CDS_pept        647818..648294
FT                   /transl_table=11
FT                   /locus_tag="SAS0570"
FT                   /product="putative acetyltransferase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0610"
FT                   /protein_id="CAG42344.1"
FT                   /translation="MFKVRQATEKDVVQIRDVATKAWFNTYLNIYAATTVNHLLEASYN
FT                   EHHLKKRLQEQLFLVVEEGNDIVGFANFIYGEELYLSAHYVKPESQHTGYGTALLNEGL
FT                   SRFEDKFEGVYLEVDNKNEEAVAYYKEQGFTILRSYEPEMYGEKLDLALMYKAF"
FT   misc_feature    647992..648222
FT                   /note="Pfam match to entry PF00583 Acetyltransf,
FT                   Acetyltransferase (GNAT) family, score 59.3, E-value
FT                   8.8e-15"
FT   CDS_pept        648334..649629
FT                   /transl_table=11
FT                   /locus_tag="SAS0571"
FT                   /product="putative phosphohydrolase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0611"
FT                   /protein_id="CAG42345.1"
FT                   /translation="MTNAYVDLKLVEEKVFKDPIHRYIHVEDQLIWDLIKTKEFQRLRR
FT                   IRQLGTLYLSFHTAEHSRFGHSLGVYEIVRRLIDESFIGHDAWDNKDRPLALCAALLHD
FT                   LGHGPFSHSFEKIFNTDHEAYTQAIITGDTEVNAVLRKVAPEFPREVAEVINKTHHNKL
FT                   VISMISSQIDADRMDYLQRDAYFTGVSYGAFDMERILRLMRPSKDEVLIKESGMHAVEN
FT                   FIMSRYQMYWQIYFHPVSRGGEVLLNNCLKRAKQLYNEGYEFKLHPHDFIPFFEETVTI
FT                   EQYVELDEAVVTYYLEKWTKEDDAILSDLASRFINRDLFKYIPFDGSIITISELQELFE
FT                   AGGINPDYYFVSEAFSDLPYDYDRPGSNRKPIHLLRQDGTIREISNQSLVIHSITGINR
FT                   QDYKLYYPREMVAKIKDKTIREAIENLINELN"
FT   misc_feature    648520..648882
FT                   /note="Pfam match to entry PF01966 HD, HD domain, score
FT                   47.6, E-value 2.9e-11"
FT   CDS_pept        649672..650178
FT                   /transl_table=11
FT                   /locus_tag="SAS0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0612"
FT                   /protein_id="CAG42346.1"
FT                   /translation="MSEKKGFNFNIIKNDPLDGHKGTNIGSISLDNIAPVFIDVANKEA
FT                   FIDIGGMHARAKVEKGVKWITDKAAVEGDEAKEYWLCWVTTERNEQGPYYAGLTACYLL
FT                   VNKAIRRGYKSMPEHVNMMDKSMKHHIIIDQIGDENKAILKDFLMNHDEGMWKHSSDAL
FT                   HQAFN"
FT   CDS_pept        650677..651687
FT                   /transl_table=11
FT                   /locus_tag="SAS0573"
FT                   /product="alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0613"
FT                   /db_xref="GOA:Q6GBM4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBM4"
FT                   /protein_id="CAG42347.1"
FT                   /translation="MRAAVVTKDHKVSIEDKKLRALKPGEALVQTEYCGVCHTDLHVKN
FT                   ADFGDVTGVTLGHEGIGKVIEVAEDVESLKIGDRVSIAWMFESCGRCEYCTTGRETLCR
FT                   SVKNAGYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTTYKAVKVSNVKPGQ
FT                   WLGVFGIGGLGNLALQYAKNVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPVAEV
FT                   MKLTDNKGLDATVVTSVAKTPFNQAVDVVKAGARVVAVGLPVDKMNLDIPRLVLDGIEV
FT                   VGSLVGTRQDLREAFEFAAENKVTPKVQLRKLEEINDIFEEMENGTITGRMVIKF"
FT   misc_feature    650698..651684
FT                   /note="Pfam match to entry PF00107 ADH_zinc_N, Zinc-binding
FT                   dehydrogenase, score 359.1, E-value 4.8e-105"
FT   misc_feature    650776..650793
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    650845..650889
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT   misc_feature    651169..651255
FT                   /note="PS00065 D-isomer specific 2-hydroxyacid
FT                   dehydrogenases NAD-binding signature."
FT   CDS_pept        651764..651871
FT                   /transl_table=11
FT                   /locus_tag="SAS0573a"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS. No database matches"
FT                   /protein_id="CAG42348.1"
FT                   /translation="MKDSENLVFFGFEVLFVFYKMAYIYEALIKYGIVN"
FT   misc_feature    651782..651850
FT                   /note="1 probable transmembrane helix predicted for
FT                   SAS0573a by TMHMM2.0 at aa 7-29"
FT   CDS_pept        651952..652380
FT                   /transl_table=11
FT                   /locus_tag="SAS0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0614"
FT                   /protein_id="CAG42349.1"
FT                   /translation="MSSKLDKKVSIQTKQVLKQHNEKEKFEFTTEGTWQQRQSNFIRYV
FT                   EQIEDATVNVTIKVDDDSVKLIRKGDINMNLHFVEGQTTTTFYDISAGRIPLDVKTLRI
FT                   LHFVSGDGGKLKIHYELYQDNEKMGSYQYEINYKEIGE"
FT   CDS_pept        652377..654038
FT                   /transl_table=11
FT                   /locus_tag="SAS0575"
FT                   /product="putative arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0615"
FT                   /db_xref="GOA:Q6GBM1"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBM1"
FT                   /protein_id="CAG42350.1"
FT                   /translation="MNIIDQVKQTLVEEIAASINKAGLADEIPDIKIEVPKDTKNGDYA
FT                   TNIAMVLTKIAKRNPREIAQAIVDNLDTEKAHVKQIDIAGPGFINFYLDNQYLTAIIPE
FT                   AIEKGDQFGHVNESKGQNVLLEYVSANPTGDLHIGHARNAAVGDALANILTAAGYNVTR
FT                   EYYINDAGNQITNLARSIETRFFEALGDNSYSMPEDGYNGKDIIEIGKDLAEKHPEIKD
FT                   YSEEARLKEFRKLGVEYEMAKLKNDLAEFNTHFDNWFSETSLYEKCEILEVLAKMKELG
FT                   YTYEADGATWLRTTDFKDDKDRVLIKNDGTYTYFLPDIAYHFDKVKRGNDILIDLFGAD
FT                   HHGYINRLKASLETFGVDSNRLEIQIMQMVRLMENGKEVKMSKRTGNAITLREIMDEVG
FT                   VDAARYFLTMRSPDSHFDFDMELAKEQSQDNPVYYAQYAHARICSILKQAKEQGIEVTA
FT                   ANDFTTITNEKAIELLKKVADFEPTIESAAEHRSAHRITNYIQDLASHFHKFYNAEKVL
FT                   TDDIEKTKAHVAMIEAVRITLKNALAMVGVSAPESM"
FT   misc_feature    652401..652655
FT                   /note="Pfam match to entry PF03485 N-Arg, Arginyl tRNA
FT                   synthetase N terminal domain, score 122.8, E-value 6.9e-34"
FT   misc_feature    652677..653636
FT                   /note="Pfam match to entry PF00750 tRNA-synt_1d, tRNA
FT                   synthetases class I (R), score 310.8, E-value 1.8e-90"
FT   misc_feature    652770..652799
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT   misc_feature    653679..654035
FT                   /note="Pfam match to entry PF05746 tRNA-synt_1d_C, Arginyl
FT                   tRNA synthetase anticodon binding domain, score 179.6,
FT                   E-value 5.3e-51"
FT   CDS_pept        654429..655064
FT                   /transl_table=11
FT                   /locus_tag="SAS0576"
FT                   /product="putative DNA repair protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0617"
FT                   /protein_id="CAG42351.1"
FT                   /translation="MLGTDELYKVLYEHLGPQFWWPADNDIEMMLGAILVQNTRWRNAE
FT                   IALNQVKEHTHFNPNHILELPIETLQSLIHSSGFYKSKSLTIKTLLTWLARHHFNYQEI
FT                   NERYKGGLRKELLSLKGIGSETADVLLVYIFGRIEFIPDSYTRKIYDKLGYENTKNYDQ
FT                   LKKVVTLPNHFTNQDANEFHALLDVFGKHYFRDKDIKNYDFLEPYFKK"
FT   CDS_pept        655315..656202
FT                   /transl_table=11
FT                   /locus_tag="SAS0577"
FT                   /product="putative transport system lipoprotein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0618"
FT                   /protein_id="CAG42352.1"
FT                   /translation="MKKSLIAFILIFMLVLSGCGMKDNDKQGSNDNGSSKSPYHRIVSL
FT                   MPSNTEILYELGLGKYIVGVSTVDDYPKDVKEGKKQFDALNLNKEELLKEKPDLILAHE
FT                   SQKATANKVLSSLEKQGIKVVYVKDAQSIDETYNTFKQIGKLTHHDKQAEQLVEETKDN
FT                   IDKVIDSIPAHHKKSKVFIEVSSKPEIYTAGKHTFFNDMLEKLEAQNVYSDINGWNPVT
FT                   KESIIKKNPDILISTEAKTRSDYMDIIKKRGGFNKINAVKNTRIEVVNGDEVSRPGPRI
FT                   DEGLKELRDAIYRK"
FT   misc_feature    655315..655392
FT                   /note="Signal peptide predicted for SAS0577 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.909) with cleavage site
FT                   probability 0.361 between residues 26 and 27"
FT   misc_feature    655339..655371
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    655426..656133
FT                   /note="Pfam match to entry PF01497 Peripla_BP_2,
FT                   Periplasmic binding protein, score 97.1, E-value 3.6e-26"
FT   CDS_pept        656351..657301
FT                   /transl_table=11
FT                   /locus_tag="SAS0578"
FT                   /product="FecCD transport family protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0619"
FT                   /protein_id="CAG42353.1"
FT                   /translation="MTFNKVLLSWIVILIITTSIYLFWQLGDINDVFNQSILINVRLPR
FT                   LLEALLTGMILTVAGLIFQTVLNNALADSFTLGLASGATFGSGLALFLGLTTLWIPVFS
FT                   ITFSLITLITVLVITSVLSQGYPVRILILSGLMIGALFNSLLYFLILLKPRKLNTIANY
FT                   LFGGFGDAEYSNVSIIAITFIIALFGIFIILNQLKLLQLGELKSQSLGLNVQLITYIAL
FT                   CIASMITAINVAYVGIIGFIGMVIPQLIRKWQWKQSLGRQLALNIVIGGQIMVMADFIG
FT                   SHILSPVQIPASIIIALIGIPVLFYMLISQSKRLH"
FT   misc_feature    order(656369..656428,656486..656554,656573..656641,
FT                   656651..656719,656738..656806,656873..656941,
FT                   656978..657037,657047..657100,657137..657205,
FT                   657218..657277)
FT                   /note="10 probable transmembrane helices predicted for
FT                   SAS0578 by TMHMM2.0 at aa 7-26, 46-68, 75-97, 101-123,
FT                   130-152, 175-197, 210-229, 233-250, 263-285 and 290-309"
FT   misc_feature    656384..657280
FT                   /note="Pfam match to entry PF01032 FecCD, FecCD transport
FT                   family, score 155.1, E-value 1.3e-43"
FT   CDS_pept        657356..658075
FT                   /transl_table=11
FT                   /locus_tag="SAS0579"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0620"
FT                   /protein_id="CAG42354.1"
FT                   /translation="MDLNQIKAVVFDLEGTLLDRVKSREKFIEEQYERFHDYLIHVQLA
FT                   DFKKAFIELDDDEDNDKPDLYKEIIKRFHVDRLTWKDLFNDFEMHFYRYVFPYYDTLYT
FT                   LEKLSQKGFQIGVIANGKSKIKQFRLHSLGLMHVINYLSTSETVGFRKPHPKIFEDMID
FT                   QLGVLPEQIMYVGDDALNDVAPARAMGMVSVWYKQEDAEIEPLEEEVDFTITTVEELLT
FT                   ILPIKNDNKGENYGSIY"
FT   misc_feature    657371..657952
FT                   /note="Pfam match to entry PF00702 Hydrolase, haloacid
FT                   dehalogenase-like hydrolase, score 82.8, E-value 7.3e-22"
FT   misc_feature    657701..657724
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        658059..658859
FT                   /transl_table=11
FT                   /locus_tag="SAS0580"
FT                   /product="putative hydrolase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0621"
FT                   /protein_id="CAG42355.1"
FT                   /translation="MDLFTRKDGTSIHYSTLGEGYPIVLIHTVLDNYSVFNKLAAQLAK
FT                   SFQVVLIDLRGHGYSDKPRHIEIKDFSDDIVELLKYLYIEEVAFVCHEMGGIIGADISV
FT                   RYPEFTSSLMLVNPTSIEGELPEERLFRKYAHIIRNWDPEKQDKFLNKRKYYRPRKMNR
FT                   FLKHVVDTNEISTKEEIQAVKEVFKNADISQTYRNVVVPTKIIAGEFGERTTRLEAKEV
FT                   ADLIQNADFEVYQESSAFPFVEEQERFVEDTASFINKHHDEKHV"
FT   misc_feature    658197..658823
FT                   /note="Pfam match to entry PF00561 abhydrolase, alpha/beta
FT                   hydrolase fold, score 44.3, E-value 2.9e-10"
FT   CDS_pept        658995..659501
FT                   /transl_table=11
FT                   /locus_tag="SAS0581"
FT                   /product="putative exported protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0622"
FT                   /protein_id="CAG42356.1"
FT                   /translation="MKKLLTASIIACSVVMGVGLVNTSAEAASGNSIDTVKQLIKGDQS
FT                   LENVKIGESIKDVLTKYKNPMYSYNEDGTEHYYEFHTKKGMLLVTTDGKKNNGKVTHIS
FT                   MMYNDANGPTYQAVKNYVGKAVTHTEYSKVAGNFGYIEKGKTTYQFASAPKDKNIKLYR
FT                   IDLEK"
FT   misc_feature    658995..659075
FT                   /note="Signal peptide predicted for SAS0581 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.887 between residues 27 and 28"
FT   misc_feature    659409..659432
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        659663..660379
FT                   /transl_table=11
FT                   /locus_tag="SAS0582"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0623"
FT                   /protein_id="CAG42357.1"
FT                   /translation="MRINDKILLENIEDYFNHKGLSPHLIDDIKEKVITDIKNSEKKDQ
FT                   DYIEYKRKSPAQIILMIQRNLFALQMNPVIFFIINFILISYLYDKQYVQFQAITGMSLF
FT                   YCLVIFPMTIVVYLRVSQKNYLRSNKIEMIMGTIIAIISLLLIILQAFNITWGVIPITN
FT                   FGHQFFFFIGIILVIAGIFYKRLEFSGIGLLFCQKTVDAMIHNPQSAQIFSLIIWILLV
FT                   VLVIYFTIRLSSRTRL"
FT   misc_feature    order(659858..659926,659954..660022,660056..660124,
FT                   660152..660211,660296..660364)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SAS0582 by TMHMM2.0 at aa 66-88, 98-120, 132-154, 164-183
FT                   and 212-234"
FT   CDS_pept        660548..661336
FT                   /transl_table=11
FT                   /locus_tag="SAS0583"
FT                   /product="putative esterase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0624"
FT                   /protein_id="CAG42358.1"
FT                   /translation="MNKVTINPQIQLTYQIEGKGDPIILLHGLDGNLAGFEDLQHQLAS
FT                   SYKVLTYDLRGHGKSSKSESYDLNDHVEDLKILMEKLNIHEAHILGHDLGGVVAKLFTD
FT                   KYAYRVKSLTTIASKKDDLIHSFTQLLIQYQDDIAGFNKSEAYILLFSKLFRNQEKTMK
FT                   WYQKQRIYSIKSEDDSAVAIRSLILHKDEPMYLKKRTCVPTLLINGEHDPLIKDKNHFK
FT                   LEAHFLNVTKKIFEHSGHAPHIEEPEAFMNYYLNFLKSVS"
FT   misc_feature    660686..661315
FT                   /note="Pfam match to entry PF00561 abhydrolase, alpha/beta
FT                   hydrolase fold, score 102.8, E-value 7.2e-28"
FT   CDS_pept        complement(661586..661960)
FT                   /transl_table=11
FT                   /locus_tag="SAS0584"
FT                   /product="staphylococcal accessory regulator A"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0625"
FT                   /db_xref="GOA:Q6GBL2"
FT                   /db_xref="InterPro:IPR010166"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBL2"
FT                   /protein_id="CAG42359.1"
FT                   /translation="MAITKINDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISE
FT                   NKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQQRKKI
FT                   ESLLSRVNKRITEANNEIEL"
FT   CDS_pept        complement(662908..663837)
FT                   /transl_table=11
FT                   /locus_tag="SAS0585"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0626"
FT                   /protein_id="CAG42360.1"
FT                   /translation="MLLFYIIGVLVGMLIPIQTSVNSRLSLYTKSPFYTSFISFSVGTI
FT                   CLIILNIIINPEVFTIHFYNNQSFNYTWVVGGLLGVSFLTGNLLLLPKLGATLTVIATV
FT                   AGQIIMGVIIDTFGLFGATIHDFNLIKAIGVLLLIVGIVIMNQFNKNNLLLTDQKYLLF
FT                   WLLLGFIFGFFPPIQTTINSALASHTHSPAFASLVSFTIGSITLLILTAIFNRSLKLKT
FT                   SHLKFGKLKPIYFTGGILGMAFVTANIILMPHMGAALTTLIGMFGQILMGILIDHFGLF
FT                   GSPKIAMTSRKTIGLLCILTGIILLRLF"
FT   misc_feature    complement(order(662914..662958,662995..663063,
FT                   663073..663141,663196..663264,663292..663360,
FT                   663394..663450,663478..663546,663565..663633,
FT                   663676..663741,663760..663828))
FT                   /note="10 probable transmembrane helices predicted for
FT                   SAS0585 by TMHMM2.0 at aa 4-26, 33-54, 69-91, 98-120,
FT                   130-148, 160-182, 192-214, 233-255, 259-281 and 294-308"
FT   misc_feature    complement(662923..663354)
FT                   /note="Pfam match to entry PF04657 DUF606, Protein of
FT                   unknown function, DUF606, score 120.0, E-value 4.5e-33"
FT   misc_feature    complement(663406..663834)
FT                   /note="Pfam match to entry PF04657 DUF606, Protein of
FT                   unknown function, DUF606, score 237.7, E-value 1.7e-68"
FT   CDS_pept        complement(664032..664256)
FT                   /transl_table=11
FT                   /locus_tag="SAS0586"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0627"
FT                   /protein_id="CAG42361.1"
FT                   /translation="MTKTLELSFKSSLDKPVKLQLPQLNNVVTEQVARDSMNALVDLNI
FT                   IKSNSGTITKVHSAQIIDKTTTVLFEDKK"
FT   CDS_pept        complement(664273..664476)
FT                   /transl_table=11
FT                   /locus_tag="SAS0587"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0628"
FT                   /protein_id="CAG42362.1"
FT                   /translation="MSKINHITIVLSFTKVDANGKQTEFKRRFANINPDASNDQIKTFS
FT                   KLIERLTGETYNNIELIKSLSI"
FT   CDS_pept        664635..665195
FT                   /transl_table=11
FT                   /locus_tag="SAS0588"
FT                   /product="phage integrase family protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0629"
FT                   /protein_id="CAG42363.1"
FT                   /translation="MNKVEAIKFNDDIVKMYEALKIKSERDYLFFKLAIHSGLKVSELL
FT                   TITVSQVKRLIEKCTLSEMCKAHFHSLIKIRLPETLSKELLQYIEDRSLSNEDVLFQSL
FT                   RTNQVLSRQQAYRIIHQASIEAGIDNVGLTTLRKTFAYHAYQKGIPIPVIQKYLGHQSA
FT                   IETLNFIGLENECEHSIYISLQL"
FT   misc_feature    664635..665156
FT                   /note="Pfam match to entry PF00589 Phage_integrase, Phage
FT                   integrase family, score 42.5, E-value 9.7e-10"
FT   misc_feature    664740..664805
FT                   /note="Predicted helix-turn-helix motif for SAS0588 with
FT                   score 1046.000, SD 2.75 at aa 36-57, sequence
FT                   HSGLKVSELLTITVSQVKRLIE"
FT   CDS_pept        665214..667616
FT                   /transl_table=11
FT                   /locus_tag="SAS0589"
FT                   /product="putative NADH-Ubiquinone/plastoquinone (complex
FT                   I) oxidoreductase protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0630"
FT                   /db_xref="GOA:Q6GBK7"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBK7"
FT                   /protein_id="CAG42364.1"
FT                   /translation="MSLVYLLIAILVIMAMILLMSKRRALAKYAGYIALVAPVISSIYF
FT                   LIQIPSVAKLQYLSTSIPWIKTLDINLDLRLDGLSLMFSLIISLIGIAVFFYATQYLSS
FT                   RKDNLPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYWYNNGDSQFGA
FT                   MQSFMITVFGGLALLVGFIMLYIMTGTNNITEILGQADHIKNHGLFIPMIFMFLLGAFT
FT                   KSAQFPFHIWLPRAMAAPTPVSAYLHSATMVKAGIFLLLRFTPLLGLSNMYVYIVTFVG
FT                   LITMLFGSITALKQWDLKGILAYSTISQLGMIMAMVGIGGGYAQHQQDAIASIYVFVLF
FT                   GALFHLMNHAIFKCALFMGVGILDHEAGSRDIRILSGMRQLFPKMNLVMTIAALSMAGV
FT                   PFLNGFLSKEMFLDALTQTGQLSQFSLISMIAIVFVGVIASVFTFTYALYMVKEVFWTK
FT                   YDSKVFTKKNIHEPWLFSLPSLILMVLVPVIFFVPNIFGKGIIVLALRAVSGGNHQIDQ
FT                   LAPHVSQWHGFNIPLLLTIIIILLGSVLAIKVDWKKVFTGKIRQISVSKSYEMVYRHFE
FT                   KFATKRFKRVMQDRLNQYIIMTLGIFMIIIGYGYIRIGLPKVHQLHVSEFGALEIILAI
FT                   VTVTIGISLIFIRQRLTMVILNGVIGFVVTLFFIAMKAPDLALTQLVVETITTILFIVS
FT                   FSRLPNVPRSNANKKREIIKISVSLLMALIVVSLIFITQQTDGLSSISDFYLKADKLTG
FT                   GKNIVNAILGDFRALDTLFEGLVLIITGLGIYTLLNYQDRRGQDERE"
FT   misc_feature    665214..665294
FT                   /note="Signal peptide predicted for SAS0589 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.994) with cleavage site
FT                   probability 0.771 between residues 27 and 28"
FT   misc_feature    order(665223..665276,665301..665369,665439..665507,
FT                   665544..665597,665607..665675,665712..665780,
FT                   665838..665906,665943..666011,666024..666092,
FT                   666111..666173,666201..666269,666366..666434,
FT                   666492..666560,666630..666698,666786..666854,
FT                   666984..667052,667095..667154,667173..667226,
FT                   667239..667307,667344..667412,667521..667580)
FT                   /note="21 probable transmembrane helices predicted for
FT                   SAS0589 by TMHMM2.0 at aa 4-21, 30-52, 76-98, 111-128,
FT                   132-154, 167-189, 209-231, 244-266, 271-293, 300-320,
FT                   330-352, 385-407, 427-449, 473-495, 525-547, 591-613,
FT                   628-647, 654-671, 676-698, 711-733 and 770-789"
FT   misc_feature    665376..665567
FT                   /note="Pfam match to entry PF00662 oxidored_q1_N,
FT                   NADH-Ubiquinone oxidoreductase (complex I), chain 5
FT                   N-terminus, score 31.1, E-value 2.8e-06"
FT   misc_feature    665598..666530
FT                   /note="Pfam match to entry PF00361 oxidored_q1,
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains,
FT                   score 246.8, E-value 3.1e-71"
FT   CDS_pept        667603..668028
FT                   /transl_table=11
FT                   /locus_tag="SAS0590"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0631"
FT                   /db_xref="GOA:Q6GBK6"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBK6"
FT                   /protein_id="CAG42365.1"
FT                   /translation="MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFS
FT                   SAFILMFLAFNVEEVLESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILP
FT                   ILGQIHVSTITLFELGILFSVVGVIVTVMLSLSGGRS"
FT   misc_feature    667621..668001
FT                   /note="Pfam match to entry PF04039 MnhB, Domain related to
FT                   MnhB subunit of Na+/H+ antiporter, score 152.2, E-value
FT                   9.5e-43"
FT   misc_feature    order(667621..667689,667702..667770,667804..667872,
FT                   667942..668010)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SAS0590 by TMHMM2.0 at aa 7-29, 34-56, 68-90 and 114-136"
FT   CDS_pept        668025..668369
FT                   /transl_table=11
FT                   /locus_tag="SAS0591"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0632"
FT                   /db_xref="GOA:Q6GBK5"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBK5"
FT                   /protein_id="CAG42366.1"
FT                   /translation="MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMS
FT                   MGTYGSSRSEPLITGGNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEI
FT                   EGLRGEDDAK"
FT   misc_feature    order(668034..668102,668106..668174,668232..668300)
FT                   /note="3 probable transmembrane helices predicted for
FT                   SAS0591 by TMHMM2.0 at aa 4-26, 28-50 and 70-92"
FT   misc_feature    668034..668351
FT                   /note="Pfam match to entry PF00420 oxidored_q2,
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 4L,
FT                   score 65.6, E-value 1.1e-16"
FT   CDS_pept        668359..669855
FT                   /transl_table=11
FT                   /locus_tag="SAS0592"
FT                   /product="putative NADH-Ubiquinone/plastoquinone (complex
FT                   I) oxidoreductase protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0633"
FT                   /db_xref="GOA:Q6GBK4"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBK4"
FT                   /protein_id="CAG42367.1"
FT                   /translation="MLSNLLILPMLLPFLCALILVFLKNNDRISKYLYLGTMTITTIIS
FT                   LMLLIYVQRHRPITLDFGGWSAPFGIQFLGDSLSLIMVTTASFVITLIMAYGFGRGEHK
FT                   ANRYHLPSFILFLSVGVIGSFLTSDLFNLYVMFEIMLLASFVLITLGQSVEQLRAAIIY
FT                   VVLNIIGSWLFLLGIGLLYKTVGTLNFSHIAMRLNDMGDNRTVTMISLIFLVAFSAKAA
FT                   LVLFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAAI
FT                   TMVIGAIGVIAYKDIKKIAAYQVIISIGFIILGLGTNTFAGINGAIFYLVNDIVVKTLL
FT                   FFIIGSLVYITGYRQYQYLNGLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGA
FT                   LQNGNYIGLALMIITSLIAMYSLFRILFYMYFGDKDGEEVNFKKIPLYRKRILSILVVV
FT                   VIAIGIAAPVVLNVTSDATELNTSDQLYQKLVNPHLKGED"
FT   misc_feature    668359..668427
FT                   /note="Signal peptide predicted for SAS0592 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.945) with cleavage site
FT                   probability 0.581 between residues 23 and 24"
FT   misc_feature    order(668371..668427,668446..668514,668587..668655,
FT                   668680..668739,668749..668817,668836..668904,
FT                   668974..669042,669061..669129,669166..669234,
FT                   669253..669321,669334..669402,669460..669528,
FT                   669571..669639,669709..669777)
FT                   /note="14 probable transmembrane helices predicted for
FT                   SAS0592 by TMHMM2.0 at aa 5-23, 30-52, 77-99, 108-127,
FT                   131-153, 160-182, 206-228, 235-257, 270-292, 299-321,
FT                   326-348, 368-390, 405-427 and 451-473"
FT   misc_feature    668737..669600
FT                   /note="Pfam match to entry PF00361 oxidored_q1,
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains,
FT                   score 176.3, E-value 5.1e-50"
FT   CDS_pept        669856..670338
FT                   /transl_table=11
FT                   /locus_tag="SAS0593"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0634"
FT                   /db_xref="GOA:Q6GBK3"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBK3"
FT                   /protein_id="CAG42368.1"
FT                   /translation="MNQIVLNIIIAFLWVLFQDEDHFKFSTFFSGYLIGLIVIYILHRF
FT                   FSDDFYVRKIWVAIKFLGVYLYQLITSSISTINYILFKTKDMNPGLLSYETRLTSDWSI
FT                   TFLTILIIITPGSTVIRISQDSKKFFIHSIDVSEKEKDSLLRSIKHYEDLILEVSR"
FT   misc_feature    order(669928..669996,670033..670101,670159..670215)
FT                   /note="3 probable transmembrane helices predicted for
FT                   SAS0593 by TMHMM2.0 at aa 25-47, 60-82 and 102-120"
FT   misc_feature    670012..670326
FT                   /note="Pfam match to entry PF01899 MNHE, Na+/H+ ion
FT                   antiporter subunit, score 0.1, E-value 3.7e-05"
FT   CDS_pept        670335..670637
FT                   /transl_table=11
FT                   /locus_tag="SAS0594"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0635"
FT                   /db_xref="GOA:Q6GBK2"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBK2"
FT                   /protein_id="CAG42369.1"
FT                   /translation="MIQTITHIMIISSLIIFGIALIICLFRLIKGPTTADRVVTFDTTS
FT                   AVVMSIVGVLSVLMGTVSFLDSIMLIAIISFVSSVSISRFIGGGHVFNGNNKRNL"
FT   misc_feature    670335..670439
FT                   /note="Signal peptide predicted for SAS0594 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.792) with cleavage site
FT                   probability 0.468 between residues 35 and 36"
FT   misc_feature    order(670344..670412,670446..670514,670542..670610)
FT                   /note="3 probable transmembrane helices predicted for
FT                   SAS0594 by TMHMM2.0 at aa 4-26, 38-60 and 70-92"
FT   misc_feature    670434..670598
FT                   /note="Pfam match to entry PF04066 MrpF_PhaF, Multiple
FT                   resistance and pH regulation protein F (MrpF / PhaF), score
FT                   82.3, E-value 1e-21"
FT   CDS_pept        670612..671049
FT                   /transl_table=11
FT                   /locus_tag="SAS0595"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0636"
FT                   /db_xref="GOA:Q6GBK1"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBK1"
FT                   /protein_id="CAG42370.1"
FT                   /translation="MEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATK
FT                   SSTLSVLLTLIGVLIYFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYR
FT                   KNDAHTHASILLSSNEQNSTEALQLRAEKREEHRKKWYQND"
FT   misc_feature    670612..670692
FT                   /note="Signal peptide predicted for SAS0595 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.983) with cleavage site
FT                   probability 0.512 between residues 27 and 28"
FT   misc_feature    670612..670926
FT                   /note="Pfam match to entry PF03334 PhaG_MnhG_YufB, Na+/H+
FT                   antiporter subunit, score 88.4, E-value 1.6e-23"
FT   misc_feature    order(670630..670698,670756..670824,670828..670896)
FT                   /note="3 probable transmembrane helices predicted for
FT                   SAS0595 by TMHMM2.0 at aa 7-29, 49-71 and 73-95"
FT   CDS_pept        671389..673431
FT                   /transl_table=11
FT                   /locus_tag="SAS0596"
FT                   /product="sodium/hydrogen exchanger family protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0637"
FT                   /protein_id="CAG42371.1"
FT                   /translation="MEIFETILIFIAVVILSSFVHTFIPKVPLAFIQIFLGMLLFITPI
FT                   PVQFNFDSELFMVTMIAPLLFVEGVNVSRVHLRKYIKPVMMMALGLVITTVIGVGLFIH
FT                   WIWPDLPIGAAFAIAAILCPTDAVAVQAITKGKVLPKGAMTILEGESLLNDAAGIISFK
FT                   IAVGVLVTGAFSLVDAVQLFLIASIGGAVVGLLIGMALVRFRLTLMRRGYENINMFTII
FT                   QLLTPFVTYLIAELFHASGIIAAVVAGLVHGFERDRIMQVRTQLQMSYNHTWNILGYVL
FT                   NGFVFSILGFLVPEVIIKIIKTEPHNLIFLIGITIVVALAVYLFRFVWVYVLYPYFYLA
FT                   ISPFQKMMTKNDDDNPTTEKPPKRSLYALIMTLCGVHGTISLAIALTLPYFLAGHHAFT
FT                   YRNDLLFIASGMVIISLVVAQVLLPLLTKPAPKTVIGNMSFKVARIYILEQVIDYLNQK
FT                   STFETSFKYGNVIKEYHDKLAFLKTVEKDDENSKELERLQKIAFNVETKTLESLVDEGQ
FT                   ITNSVLENYMRYAERTQVYRQASLIRRMIVLLRGALLKRRVQTRVNSASSLSVTDNLME
FT                   LNKINKLVHYNVVSRLSKETTKDNTLEVGMVCDGYLMRIENLTPSNFFNSASEDTITKI
FT                   KLNALREQRRILRELIDTDEVSEGTALKLREAINYDEMVIVDSMT"
FT   misc_feature    671395..672690
FT                   /note="Pfam match to entry PF00999 Na_H_Exchanger,
FT                   Sodium/hydrogen exchanger family, score 214.0, E-value
FT                   2.4e-61"
FT   misc_feature    order(671407..671460,671473..671541,671638..671706,
FT                   671719..671787,671845..671913,671926..671994,
FT                   672031..672090,672100..672153,672214..672282,
FT                   672310..672363,672367..672435,672493..672561,
FT                   672598..672666)
FT                   /note="13 probable transmembrane helices predicted for
FT                   SAS0596 by TMHMM2.0 at aa 7-24, 29-51, 84-106, 111-133,
FT                   153-175, 180-202, 215-234, 238-255, 276-298, 308-325,
FT                   327-349, 369-391 and 404-426"
FT   CDS_pept        complement(674592..675521)
FT                   /transl_table=11
FT                   /locus_tag="SAS0597"
FT                   /product="ABC transporter extracellular binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0641"
FT                   /protein_id="CAG42372.1"
FT                   /translation="MKKLVPLLLALLLLVAACGTGGKQSSDKSNGKLKVVTTNSILYDM
FT                   AKNVGGDNVDIHSIVPVGQDPHEYEVKPKDIKKLTDADVILYNGLNLETGNGWFEKALE
FT                   QAGKSLKDKKVIAVSKDVKPIYLNGEEGNKDKQDPHAWLSLDNGIKYVKTIQQTFIDND
FT                   KKHKADYEKQGNKYIAQLEKLNNDSKDKFNDIPKEQRAMITSEGAFKYFSKQYGITPGY
FT                   IWEINTEKQGTPEQMRQAIEFVKKHKLKHLLVETSVDKKAMESLSEETKKDIFGEVYTD
FT                   SIGKEGTKGDSYYKMMKSNIETVHGSMK"
FT   misc_feature    complement(674595..675506)
FT                   /note="Pfam match to entry PF01297 SBP_bac_9, Periplasmic
FT                   solute binding protein family, score 486.0, E-value
FT                   3.1e-143"
FT   misc_feature    complement(675195..675218)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(675450..675521)
FT                   /note="Signal peptide predicted for SAS0597 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.322 between residues 24 and 25"
FT   misc_feature    complement(675468..675500)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(675518..676354)
FT                   /transl_table=11
FT                   /locus_tag="SAS0598"
FT                   /product="ABC transporter permease protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0642"
FT                   /protein_id="CAG42373.1"
FT                   /translation="MLEFVEHLFTYQFLNRALITSIIVGIVCGTVGSLIVLRGLSLMGD
FT                   AMSHAVLPGVALSFLFGIPMFVGALITGMIASIFIGYITSSSKTKPDAAIGISFTAFLA
FT                   SGIIIISLINTTTDLYHILFGNLLAITNSAFLTTIVIGSIVLILIIIFYRPLMISTFDP
FT                   TFSRMSGLNTTLLHYFVMLLLSLVTVASIQTVGIILVVALLITPASTAFLISKKLYSMM
FT                   IIASLISVISSIVGLYYSYIYNIPSGATIVLCTFVIYIITLFFTKFTNRKKRGSLT"
FT   misc_feature    complement(675557..676327)
FT                   /note="Pfam match to entry PF00950 ABC-3, ABC 3 transport
FT                   family, score 362.1, E-value 6e-106"
FT   misc_feature    complement(order(675560..675613,675626..675694,
FT                   675713..675781,675794..675862,675899..675967,
FT                   676010..676078,676112..676207,676250..676318))
FT                   /note="8 probable transmembrane helices predicted for
FT                   SAS0598 by TMHMM2.0 at aa 13-35, 50-81, 93-115, 130-152,
FT                   165-187, 192-214, 221-243 and 248-265"
FT   CDS_pept        complement(676348..677091)
FT                   /transl_table=11
FT                   /locus_tag="SAS0599"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0643"
FT                   /protein_id="CAG42374.1"
FT                   /translation="MLETKDLNLFLGNKHVLKNISLSIPVRGEIIGIMGPNGAGKSSLI
FT                   KSLIGEFNATGTKLLYNKPIQQQLQHITYIPQKAHIDLDFPISVEQVILSGCYKEIGWF
FT                   RRPNKSARDKLKQLLSDLELESLRHRQISELSGGQLQRVLVARALMSESEVYFLDEPFV
FT                   GIDFSSEKLIMTKIENLKQQGKLILIIHHDLSKAKQYFDRIILLNQTLRYFGDSEEAMS
FT                   VTRLNETFMSSTDCSDPSQRSNITC"
FT   misc_feature    complement(676462..677010)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 156.6, E-value 4.6e-44"
FT   misc_feature    complement(676645..676689)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(676966..676989)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        677213..677857
FT                   /transl_table=11
FT                   /locus_tag="SAS0600"
FT                   /product="putative metalloregulator"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0644"
FT                   /protein_id="CAG42375.1"
FT                   /translation="MLTEEKEDYLKAILTNNGDKNFVTNKILSQFLNIKPPSVSEMVGR
FT                   LEKAGYVETKPYKGVRLTEDGLTHTLDIIKRHRLLELFLIEILKYNWEEVHQEAEILEH
FT                   RISDLFVERLDSLLNFPETCPHGGVIPRNNEYKEKYITTILNYEPGDIVTIKRVRDKTD
FT                   LLIYLSSKDISIGNEVEIVSKDEMNKVIIIKRNDNVIIVSYENAMNMFAEK"
FT   misc_feature    677213..677395
FT                   /note="Pfam match to entry PF01325 Fe_dep_repress, Iron
FT                   dependent repressor, N-terminal DNA binding domain, score
FT                   110.6, E-value 3.1e-30"
FT   misc_feature    677399..677611
FT                   /note="Pfam match to entry PF02742 Fe_dep_repr_C, Iron
FT                   dependent repressor, metal binding and dimerisation domain,
FT                   score 115.7, E-value 9.3e-32"
FT   CDS_pept        complement(677937..678689)
FT                   /transl_table=11
FT                   /locus_tag="SAS0601"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0645"
FT                   /protein_id="CAG42376.1"
FT                   /translation="MNYLSNFFNTTIQLNIYIIVIVAACYIAIHQYRHKPVLNYLDVIL
FT                   NYIPVLTHEFGHVLFNKLAGGRAKDLVIVTSPRERQQTLQQGFAITQSRHLAGQWLTTI
FT                   GGYLMPPIMLLIGLASSHYQIPSFFIFTYLLIFIYFLILTSRKGSPIVVITLISIMLYF
FT                   ILKDENIVEIQLLVTMSYQYILGVLLGEVLQSSWTIAKLTFQRPSPQWDGSALKELSHV
FT                   PIFIYSTIWIIFNLYAVNILLKYTHLIN"
FT   misc_feature    complement(order(677961..678029,678114..678182,
FT                   678195..678248,678258..678317,678336..678404,
FT                   678603..678671))
FT                   /note="6 probable transmembrane helices predicted for
FT                   SAS0601 by TMHMM2.0 at aa 7-29, 96-118, 125-144, 148-165,
FT                   170-192 and 221-243"
FT   misc_feature    complement(678513..678542)
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT   CDS_pept        678925..679689
FT                   /transl_table=11
FT                   /locus_tag="SAS0602"
FT                   /product="teichoic acid biosynthesis protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0646"
FT                   /db_xref="GOA:Q6GBJ4"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR034714"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBJ4"
FT                   /protein_id="CAG42377.1"
FT                   /translation="MTVEERSNTAKVDILGVDFDNTTMLQMVENIKTFFANQSTNNLFI
FT                   VTANPEIVNYATTHQAYLELINQASYIVADGTGVVKASHRLKQPLAHRIPGIELMDECL
FT                   KIAHVNHQKVFLLGATNEVVEAAQYALQQRYPNISFAHHHGYIDLEDETVVKRIKLFKP
FT                   DYIFVGMGFPKQEEWIMTHENQFESTVMMGVGGSLEVFAGAKKRAPYIFRKLNIEWIYR
FT                   ALIDWKRIGRLKSIPIFMYKIAKAKRKIKKAK"
FT   misc_feature    679114..679623
FT                   /note="Pfam match to entry PF03808 Glyco_tran_WecB,
FT                   Glycosyl transferase WecB/TagA/CpsF family, score 313.8,
FT                   E-value 2.1e-91"
FT   CDS_pept        complement(679750..680544)
FT                   /transl_table=11
FT                   /locus_tag="SAS0603"
FT                   /product="teichoic acid ABC transporter ATP-binding
FT                   protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0647"
FT                   /db_xref="GOA:Q6GBJ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015860"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBJ3"
FT                   /protein_id="CAG42378.1"
FT                   /translation="MNVSVNIKNVTKEYRIYRTNKERMKDALIPKHKNKTFFALDDISL
FT                   KAYEGDVIGLVGINGSGKSTLSNIIGGSLSPTVGKVDRNGEVSVIAISAGLSGQLTGIE
FT                   NIEFKMLCMGFKRKEIKAMTPKIIEFSELGEFIYQPVKKYSSGMRAKLGFSINITVNPD
FT                   ILVIDEALSVGDQTFAQKCLDKIYEFKEQNKTIFFVSHNLGQVRQFCTKIAWIEGGKLK
FT                   DYGELDDVLPKYEAFLNDFKKKSKAEQKEFRNKLDESRFVIK"
FT   misc_feature    complement(679888..680397)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 104.0, E-value 3.1e-28"
FT   misc_feature    complement(680071..680115)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(680353..680376)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        680870..681703
FT                   /transl_table=11
FT                   /locus_tag="SAS0604"
FT                   /product="teichoic acid ABC transporter permease protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0648"
FT                   /protein_id="CAG42379.1"
FT                   /translation="MKVWFNGMSAIGTVFKEHVKNFYLIQRLAQFQVKIINHSNYLGVA
FT                   WELINPVMQIMVYWMVFGLGIRSNAPIHGVPFVYWLLVGISMWFFINQGILEGTKAITQ
FT                   KFNQVSKMNFPLSIIPTYIVTSRFYGHLGLLLLVIIACMFTGIYPSIHIIQLLIYVPFC
FT                   FFLTASVTLLTSTLGVLVRDTQMLMQAILRILFYFSPILWLPKNHGISGLIHEMMKYNP
FT                   VYFIAESYRAAILYHEWYFMDHWKLMLYNFGIVAIFFAIGAYLHMKYRDQFADFL"
FT   misc_feature    680912..681691
FT                   /note="Pfam match to entry PF01061 ABC2_membrane, ABC-2
FT                   type transporter, score 142.7, E-value 6.7e-40"
FT   misc_feature    order(680987..681055,681098..681157,681263..681331,
FT                   681341..681409,681443..681511,681608..681667)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SAS0604 by TMHMM2.0 at aa 40-62, 77-96, 132-154, 158-180,
FT                   192-214 and 247-266"
FT   CDS_pept        681802..682905
FT                   /transl_table=11
FT                   /locus_tag="SAS0605"
FT                   /product="teichoic acid biosynthesis protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0649"
FT                   /protein_id="CAG42380.1"
FT                   /translation="MNVLIKKFYHLVVRILSKMITPQVIDKPHIVFMMTFPEDIKPIIK
FT                   ALNNSSYQKTVLTTPKQAPYLSELSDDVDVIEMTNRTLVKQIKALKSAQMIIIDNYYLL
FT                   LGGYNKTSNQHIVQTWHASGALKNFGLTDHQVDVSDKTMVQQYRKVYQATDFYLVGCEQ
FT                   MSQCFKQSLGATEEQMLYFGLPRINKYYTADRATVKAELKDKYGITNKLALYVPTYRED
FT                   KADNRAIDKAYFEKCLPGYTLINKLHPSIEHSDIDDVSSIDTSTLMLMSDIIISDYSSL
FT                   PIEASLLDIPTIFYVYDEGTYDKVRGLNQFYKAIPDSYKVYTEEDLIMTIQEKEHLLNP
FT                   LFKDWHKYNTDKSLHQLTEYIDKMVTK"
FT   misc_feature    682405..682890
FT                   /note="Pfam match to entry PF04464 glyphos_transf,
FT                   CDP-Glycerol:Poly(glycerophosphate)
FT                   glycerophosphotransferase, score 62.0, E-value 1.3e-15"
FT   CDS_pept        682902..683963
FT                   /transl_table=11
FT                   /locus_tag="SAS0606"
FT                   /product="putative glycosyl transferase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0650"
FT                   /db_xref="GOA:Q6GBJ0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBJ0"
FT                   /protein_id="CAG42381.1"
FT                   /translation="MRLTIIIPTCNNEATIRQLLISIESKEHYRILCIDGGSTDQTIPM
FT                   IERLPRELKHISLIQLQNASIATCINKGLMDIKMTDPHDSDAFMVINPTSIVLPGKLDR
FT                   LTAAFKNNDNIDMVIGQRAYNYHGEWKLKSADEFIKDNRIVTLTEQPDLLSMMSFDGKL
FT                   FSAKFAELQCDETLANTYNHTILVKAMQKATDIHLVSQMIVGDNDIDTHATSNDEDFNR
FT                   YITEIMKIRQRVMEMLLLPEQRLLYSDMVDRILFNNSLKYYMNEHPAVTHTTIQLVKDY
FT                   IMSMQHSDYVSQNMFDIINTVEFIGENWDREIYELWRQTLIQVGINRPTYKKFLIQLKG
FT                   RKFAHRTKSMLKR"
FT   misc_feature    682911..683405
FT                   /note="Pfam match to entry PF00535 Glycos_transf_2,
FT                   Glycosyl transferase, score 33.4, E-value 5.4e-07"
FT   CDS_pept        684026..684424
FT                   /transl_table=11
FT                   /locus_tag="SAS0607"
FT                   /product="glycerol-3-phosphate cytidylyltransferase"
FT                   /EC_number="2.7.7.39"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0651"
FT                   /protein_id="CAG42382.1"
FT                   /translation="MKRVITYGTYDLLHYGHIELLRRAREMGDYLIVALSTDEFNQIKH
FT                   KKSYYDYEQRKMMLESIRYVDLVIPEKGWGQKEDDVEKFDVDVFVMGHDWEGEFDFLKD
FT                   KCEVIYLKRTEGISTTKIKQELYGKDAK"
FT   misc_feature    684038..684421
FT                   /note="Pfam match to entry PF01467 CTP_transf_2,
FT                   Cytidylyltransferase, score 96.9, E-value 4.3e-26"
FT   CDS_pept        complement(684541..685836)
FT                   /transl_table=11
FT                   /locus_tag="SAS0608"
FT                   /product="penicillin-binding protein 4"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0652"
FT                   /protein_id="CAG42383.1"
FT                   /translation="MKNLISIIIILCLTLSIMTPYAQAANSDVTPVQAANQYGYAGLSA
FT                   AYEPTSAVNVSQTGQLLYQYNIDTKWNPASMTKLMTMYLTLEAVNKGQLSLDDTVTMTN
FT                   KEYIMSTLPELSNTKLYPGQVWTIADLLQITVSNSSNAAALILAKKVSKNTSDFVDLMN
FT                   NKAKAIGMKNTHFVNPTGAENSRLRSFAPTKYKDQERTVTTARDYAILDLHVIKETPKI
FT                   LDFTKQLAPTTHAVTYYTFNFSLEGAKMSLPGTDGLKTGSSDTANYNHTITTKRGKFRI
FT                   NQVIMGAGDYKNLGGEKQRNMMGNALMERSFDQYKYVKILSKGEQRINGKKYYVENDLY
FT                   DVLPSDFSKKDYKLVVEDGKVHADYPREFINKDYGPPTVEVHQPIIQKANTVAKSMWEE
FT                   HPLFTIIGGACLVAGLALIVHMIINRLFRKRK"
FT   misc_feature    complement(684568..684636)
FT                   /note="1 probable transmembrane helix predicted for SAS0608
FT                   by TMHMM2.0 at aa 401-423"
FT   misc_feature    complement(684886..685713)
FT                   /note="Pfam match to entry PF00768 Peptidase_S11,
FT                   D-alanyl-D-alanine carboxypeptidase, score 279.8, E-value
FT                   3.7e-81"
FT   misc_feature    complement(685765..685836)
FT                   /note="Signal peptide predicted for SAS0608 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.630 between residues 24 and 25"
FT   CDS_pept        686257..687984
FT                   /transl_table=11
FT                   /locus_tag="SAS0609"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0653"
FT                   /protein_id="CAG42384.1"
FT                   /translation="MKRENPLFFLFKKLSWPVGLIVAAITISSLGSLSGLLVPLFTGRI
FT                   VDKFSVSHINWNLIALFGGIFVINALLSGLGLYLLSKIGEKIIYAIRSVLWEHIIQLKM
FT                   PFFDKNESGQLMSRLTDDTKVINEFISQKLPNLLPSIVTLVGSLIMLFILDWKMTLLTF
FT                   ITIPIFVLIMIPLGRIMQKISTSTQSEIANFSGLLGRVLTEMRLVKISNTERLELDNAH
FT                   KNLNEIYKLGLKQAKIAAVVQPISGIVMLLTIAIILGFGALEIATGAITAGTLIAMIFY
FT                   VIQLSMPLINLSTLVTDYKKAVGASSRIYEIMQEPIEPTEALEDSENVLIDDGVLSFEH
FT                   VDFKYDVKKILDDVSFQIPQGQVSAFVGPSGSGKSTIFNLIERMYEIESGDIKYGLESV
FT                   YNIPLSKWRRKIGYVMQSNSMMSGTIRDNILYGINRHVSDEELINYAKLANCHDFIMQF
FT                   DEGYDTLVGERGLKLSGGQRQRIDIARSFVKNPDILLLDEATANLDSESELKIQEALET
FT                   LMEGRTTIVIAHRLSTIKKAGQIIFLDKGQVTGKGTHSELMASHAKYKNFVVSQKLTD"
FT   misc_feature    686257..686388
FT                   /note="Signal peptide predicted for SAS0609 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.937) with cleavage site
FT                   probability 0.397 between residues 44 and 45"
FT   misc_feature    686317..687123
FT                   /note="Pfam match to entry PF00664 ABC_membrane, ABC
FT                   transporter transmembrane region, score 150.1, E-value
FT                   3.9e-42"
FT   misc_feature    order(686317..686385,686428..686496,686656..686715,
FT                   686728..686796,686968..687036,687064..687132)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SAS0609 by TMHMM2.0 at aa 21-43, 58-80, 134-153, 158-180,
FT                   238-260 and 270-292"
FT   misc_feature    687337..687894
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 205.0, E-value 1.2e-58"
FT   misc_feature    687358..687381
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    687673..687717
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        688053..688133
FT                   /transl_table=11
FT                   /locus_tag="SAS0610a"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0654"
FT                   /note="No significant database hits"
FT                   /protein_id="CAG42385.1"
FT                   /translation="MDIDVNKLLQAFVYFKSFEKLRHNNS"
FT   CDS_pept        688341..689570
FT                   /transl_table=11
FT                   /locus_tag="SAS0610"
FT                   /product="putative Na+ dependent nucleoside transporter"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0655"
FT                   /protein_id="CAG42386.1"
FT                   /translation="MFLLINIIGLIVFLGIAVLFSRDRKNIQWQSIGILVVLNLFLAWF
FT                   FIYFDWGQKAVRGAANGIAWVVQSAHAGTGFAFASLTNVKMMDMAVAALFPILLIVPLF
FT                   DILMYFNILPKIIGGIGWLLAKVTRQPKFESFFGIEMMFLGNTEALAVSSEQLKRMNEM
FT                   RVLTIAMMSMSSVSGAIVGAYVQMVPGELVLTAIPLNIVNAIIVSCLLNPVSVEEKEDI
FT                   IYSLKNNEVERQPFFSFLGDSVLAAGKLVLIIIAFVISFVALADLFDRFINLITGMIAG
FT                   WIGIKGSFGLNQILGVFMYPFALLLGLPYDEAWLVAQQMAKKIVTNEFVVMGEISKDIA
FT                   SYTPHHRAVITTFLISFANFSTIGMIIGTLKGIVDKKTSDFVSKYVPMMLLSGILVSLL
FT                   TAAFVGLFAW"
FT   misc_feature    688341..689564
FT                   /note="Pfam match to entry PF01773 Nucleoside_tra2, Na+
FT                   dependent nucleoside transporter, score 332.2, E-value
FT                   5.9e-97"
FT   misc_feature    order(688344..688403,688419..688487,688524..688583,
FT                   688611..688679,688833..688901,688914..688982,
FT                   689067..689135,689220..689288,689382..689450,
FT                   689493..689561)
FT                   /note="10 probable transmembrane helices predicted for
FT                   SAS0610 by TMHMM2.0 at aa 2-21, 27-49, 62-81, 91-113,
FT                   165-187, 192-214, 243-265, 294-316, 348-370 and 385-407"
FT   CDS_pept        690095..690928
FT                   /transl_table=11
FT                   /locus_tag="SAS0611"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0656"
FT                   /protein_id="CAG42387.1"
FT                   /translation="MNKTVKDLILVVLGSFIFAAGVNAFIISGNLGEGGVTGLAIILYY
FT                   AFHISPAITNFLVNAVLIAIGYKFLSKRSMYLTILVTILISIFLSLTESWQVETGNSIV
FT                   NAIFGGVSVGLGIGVIILAGGTTAGTTILARIATKYLDVSTPYALLFFDMIVVAISLTV
FT                   IPLDKVLVTVISLYIGTKVMEYVIEGLNTKKAMTIISTNPDKLAKAIDEQIGRGLTILN
FT                   GHGYYTREEKDVLYVVISKTQVSKAKRLIKQIDKDAFLVIHDVRDVYGNGFLADE"
FT   misc_feature    690095..690166
FT                   /note="Signal peptide predicted for SAS0611 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.965) with cleavage site
FT                   probability 0.569 between residues 24 and 25"
FT   misc_feature    690113..690361
FT                   /note="Pfam match to entry PF02588 DUF161, Uncharacterized
FT                   BCR, YitT family COG1284, score 89.7, E-value 6.1e-24"
FT   misc_feature    order(690119..690187,690215..690283,690317..690385,
FT                   690428..690496,690533..690592)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SAS0611 by TMHMM2.0 at aa 9-31, 41-63, 75-97, 112-134 and
FT                   147-166"
FT   misc_feature    690398..690643
FT                   /note="Pfam match to entry PF02588 DUF161, Uncharacterized
FT                   BCR, YitT family COG1284, score 64.7, E-value 2.1e-16"
FT   CDS_pept        691210..692007
FT                   /transl_table=11
FT                   /locus_tag="SAS0612"
FT                   /product="ferrichrome transport ATP-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0657"
FT                   /protein_id="CAG42388.1"
FT                   /translation="MNRLHGQQVKIGYGDNTIINKLDVEIPDGKVTSIIGPNGCGKSTL
FT                   LKALSRLLAVKEGEVFLDGENIHTQSTKEIAKKIAILPQSPEVADGLTVGELVSYGRFP
FT                   HQKGFGRLTAEDKKEIDWAMEVTGTDTFRHRSINDLSGGQRQRVWIAMALAQRTDIIFL
FT                   DEPTTYLDICHQLEILELVQKLNQEQGCTIVMVLHDINQAIRFSDHLIAMKEGDIIATG
FT                   STEDVLTQEILEKVFNIDVVLSKDPKTGKPLLVTYDLCRRAYS"
FT   misc_feature    691294..691857
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 217.9, E-value 1.5e-62"
FT   misc_feature    691315..691338
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    691627..691671
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        692043..693047
FT                   /transl_table=11
FT                   /locus_tag="SAS0613"
FT                   /product="ferrichrome transport permease"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0658"
FT                   /protein_id="CAG42389.1"
FT                   /translation="MTNRENSTPLKFLAYIIGLSMILLITLFISTLIGDAKIQASTIIE
FT                   AIFNYNPSNQQQNIINEIRIPRNIAAVIVGMALAVSGAIIQGVTRNSLADPALIGLNSG
FT                   ASFALALTYAVLPNTSFLILMFAGFLGAILGGAIVLMIGRSRRDGFNPMRIILAGAAVS
FT                   AMLAALSQGIALAFRLNQTVTFWTAGGVSGTTWSHLKWAIPLIGIALFIILTISKQLTI
FT                   LNLGESLAKGLGQNVTMIRGICLIIAMILAGIAVAIAGQVAFVGLMVPHIARFLIGTDY
FT                   AKILPLTALLGGILVLVADVIARYLGEAPVGAIISFIGVPYFLYLVKKGGRSI"
FT   misc_feature    692043..692162
FT                   /note="Signal peptide predicted for SAS0613 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.995) with cleavage site
FT                   probability 0.880 between residues 40 and 41"
FT   misc_feature    order(692076..692144,692229..692297,692334..692393,
FT                   692403..692471,692505..692573,692643..692711,
FT                   692772..692840,692868..692936,692955..693023)
FT                   /note="9 probable transmembrane helices predicted for
FT                   SAS0613 by TMHMM2.0 at aa 12-34, 63-85, 98-117, 121-143,
FT                   155-177, 201-223, 244-266, 276-298 and 305-327"
FT   misc_feature    692142..693029
FT                   /note="Pfam match to entry PF01032 FecCD, FecCD transport
FT                   family, score 381.8, E-value 7.5e-112"
FT   CDS_pept        693044..694060
FT                   /transl_table=11
FT                   /locus_tag="SAS0614"
FT                   /product="ferrichrome transport permease"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0659"
FT                   /protein_id="CAG42390.1"
FT                   /translation="MISSNNKRRQWIALAVFSILLFLGCTWSITSGEYNIPVERFFKTL
FT                   IGQGDAIDELILLDFRLPRMMITILAGAALSISGAIVQSVTKNPIAEPGILGINAGGGF
FT                   AIALFIAIGKINADNFVYVLPLISILGGIATALIIFIFSFNKNEGVTPASMVLIGVGLQ
FT                   TALYGGSITIMSKFDDKQSDFIAAWFAGNIWGDEWPFVIAFLPWVLIIIPYLLFKSNTL
FT                   NIIHTGDNIARGLGVRLSRERLILFFIAVMLSSAAVAVAGSISFIGLMGPHIAKRIVGP
FT                   RHQLFLPIAILVGACLLVIADTIGKIVLQPGGVPAGIVVAIIGAPYFLYLMYKTKNV"
FT   misc_feature    693044..693127
FT                   /note="Signal peptide predicted for SAS0614 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.246 between residues 28 and 29"
FT   misc_feature    order(693077..693136,693236..693289,693326..693379,
FT                   693407..693475,693494..693562,693635..693694,
FT                   693782..693850,693893..693946,693965..694033)
FT                   /note="9 probable transmembrane helices predicted for
FT                   SAS0614 by TMHMM2.0 at aa 12-31, 65-82, 95-112, 122-144,
FT                   151-173, 198-217, 247-269, 284-301 and 308-330"
FT   misc_feature    693137..694045
FT                   /note="Pfam match to entry PF01032 FecCD, FecCD transport
FT                   family, score 356.9, E-value 2.3e-104"
FT   misc_feature    693839..693856
FT                   /note="PS00267 Tachykinin family signature."
FT   CDS_pept        694294..695262
FT                   /transl_table=11
FT                   /locus_tag="SAS0615"
FT                   /product="putative dihydroxyacetone kinase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0660"
FT                   /protein_id="CAG42391.1"
FT                   /translation="MMKKLINKKETFLTDMLEGLLIAHPELDLIANTVIVKKAKKEHGV
FT                   AIVSGGGSGHEPAHAGFVAEGMLDAAVCGEVFTSPTPDKILEAIKAVDTGDGVLLVVKN
FT                   YAGDVMNFEMAQELAEMEGINVQTVIVRDDIAVTNEVQRRGVAGTVFVHKLAGYLAEKG
FT                   YSLTEIKSRVEALLPEIKSIGMAIEPPLVPTTGKYGFDIEDDKMEIGIGIHGEKGIHRE
FT                   EVKDIDHIVGTLLDELYKEVTANDVILMVNGMGGTPLSELNIVTKYIQQNLAARTVNVA
FT                   KWFVGDYMTSLDMQGFSITIVPNKPEYLEAFLAPTTSQYFK"
FT   misc_feature    694324..695259
FT                   /note="Pfam match to entry PF02733 Dak1, Dak1 domain, score
FT                   357.9, E-value 1.1e-104"
FT   CDS_pept        695304..695888
FT                   /transl_table=11
FT                   /locus_tag="SAS0616"
FT                   /product="putative dihydroxyacetone kinase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0661"
FT                   /protein_id="CAG42392.1"
FT                   /translation="MKVNDMKARLLNLEETFKKHESELTELDRAIGDGDHGVNMVRGFS
FT                   SLKDKLDDSSMQSLFKSTGMALMSNVGGASGPLYGFSFVKMSAVTKDDMDNQDFITLIQ
FT                   AFAEAVESRGKVTLNEKTMYDVVARAAEKLENGETLTFNDLQQLADNTKDMVATKGRAA
FT                   YFGEESKGYIDPGAQSMVYILNALIGDEDNA"
FT   misc_feature    695388..695870
FT                   /note="Pfam match to entry PF02734 Dak2, DAK2 domain, score
FT                   78.7, E-value 1.3e-20"
FT   CDS_pept        695881..696243
FT                   /transl_table=11
FT                   /locus_tag="SAS0617"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0662"
FT                   /protein_id="CAG42393.1"
FT                   /translation="MPKIILVSHSKEIASGTKSLLKQMAGDVDIIPIGGLPDGSIGTSF
FT                   DIIQEVLTKLEDDALCFYDIGSSEMNVDMAIEMYDGNHRVLKVDAPIVEGSFIAAVKLS
FT                   IGGSIDDALAEIKQSF"
FT   misc_feature    695884..696219
FT                   /note="Pfam match to entry PF03610 EIIA-man, PTS system
FT                   fructose IIA component, score 146.2, E-value 5.9e-41"
FT   CDS_pept        696359..696856
FT                   /transl_table=11
FT                   /locus_tag="SAS0618"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0663"
FT                   /protein_id="CAG42394.1"
FT                   /translation="MQHLIKKHVLNGEFDLVRQLMSETDFMEFEEAYISSAHEVESMMF
FT                   YTCILDMIKYEESSEMHDLAFLLLVYPLSEYEGALDSAYYHADASIKLTDGKEVKSLLQ
FT                   MLLLHAIPTPVISDKKAFDIAKQILKLDPNNNVARNVLKDTAKRMDNVVVDINELHQRN
FT                   AR"
FT   CDS_pept        697313..698380
FT                   /transl_table=11
FT                   /locus_tag="SAS0619"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0664"
FT                   /protein_id="CAG42395.1"
FT                   /translation="MMMNKEATKIGFAYVGIVVGAGFSTGQEVMQFFTKYGLWAYLGVI
FT                   ISGFILAFIGRQVAKIGTAFEATNHESTLQYVFGEKFSKVFDYILIFFLFGIAVTMIAG
FT                   AGATFEESYNIPTWLGALIMTLAIYITLLLDFNKIVRALGIVTPFLIVLVVLIAGVYLF
FT                   KGHVSLAEVNQVVPEASIWKGIWFGTIYGGLAFSVGFSTIVAIGGDTEKRTVSGAGAMY
FT                   GGIIYTVLLALINFALQSEYPTIKNASIPTLTLANNIHPLIATVLSVIMLAVMYNTILG
FT                   LMYSFAARFTEPYSKNYHIFIIIMMVAGYLLSFVGFAELINKLYTIMGYVGLFIVVAVI
FT                   IKYFKRKNADKKHIA"
FT   misc_feature    697319..698359
FT                   /note="Pfam match to entry PF05525 Branch_AA_trans,
FT                   Branched-chain amino acid transport protein, score -306.9,
FT                   E-value 0.0023"
FT   misc_feature    order(697331..697390,697418..697477,697565..697633,
FT                   697661..697714,697733..697801,697868..697936,
FT                   697955..698023,698102..698170,698207..698275,
FT                   698285..698344)
FT                   /note="10 probable transmembrane helices predicted for
FT                   SAS0619 by TMHMM2.0 at aa 7-26, 36-55, 85-107, 117-134,
FT                   141-163, 186-208, 215-237, 264-286, 299-321 and 325-344"
FT   misc_feature    697769..697819
FT                   /note="PS00251 TNF family signature."
FT   CDS_pept        698531..699574
FT                   /transl_table=11
FT                   /locus_tag="SAS0620"
FT                   /product="putative esterase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0665"
FT                   /protein_id="CAG42396.1"
FT                   /translation="MNKDNKWTMITALFITVISVLLAFHLKQHYDQITNENHANKDKIN
FT                   IKNKNVRIYQNLTYNRVFPNSKLDIITPVDMSSNAKLPVIFWMHGGGYIAGDKQYKNPL
FT                   LAKIAEQGYIVVNVNYALAPQYKYPTPLIQMNQATQFIKENKMNLPIDFNQVIIGGDSA
FT                   GAQLASQFTAIQTNDRLREAMKFDQSFKPSQIKGAILFGGFYNMQTVRETEFPRIQLFM
FT                   KSYTGEEDWEKSFKNISQMSTVKQSTKNYPPTFLSVGDSDPFESQNIEFSKKLQELNVP
FT                   VDTLFYDGTHHLHHQYQFHLNKPESIDNIKKVLLFLSRNTSSSGIQTEEKPQIENPSNE
FT                   LPLNPLN"
FT   misc_feature    698549..698608
FT                   /note="1 probable transmembrane helix predicted for SAS0620
FT                   by TMHMM2.0 at aa 7-26"
FT   misc_feature    698732..698890
FT                   /note="Pfam match to entry PF00135 COesterase,
FT                   Carboxylesterase, score 12.8, E-value 0.00042"
FT   CDS_pept        699903..700331
FT                   /transl_table=11
FT                   /locus_tag="SAS0621"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0666"
FT                   /protein_id="CAG42397.1"
FT                   /translation="MTRSALKPFKNKRVMVTGRIQRVLFKNYLDRHSTFKPNVRILLKD
FT                   VFVSGVSIDHLWLYETNKYYALAMELIHQRVKFSANVVPYYKINRNNNLFVQDYGIKRK
FT                   GRLITEEAYNQNNQYQDKIYEKLPDIDFRLEDFYSKEN"
FT   CDS_pept        complement(700540..701046)
FT                   /transl_table=11
FT                   /locus_tag="SAS0622"
FT                   /product="putative acetyltransferase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0667"
FT                   /protein_id="CAG42398.1"
FT                   /translation="MAHIIRRVSIKDVENFISMLAKIYDESPYMFYTPGEYDPSVTSAS
FT                   KQLEEYITSPHKVIFVAESDEQLVGFAFVNTTPFQRIKHVAKIDLGVKKLYQHRGIGQA
FT                   LLDAIMAWCLNNQIHRIEANVPLNNQPALELFKSADFQIEGVLKDKLFIDGKYYDDYMM
FT                   AKILN"
FT   misc_feature    complement(700621..700869)
FT                   /note="Pfam match to entry PF00583 Acetyltransf,
FT                   Acetyltransferase (GNAT) family, score 64.3, E-value
FT                   2.7e-16"
FT   CDS_pept        701159..702082
FT                   /transl_table=11
FT                   /locus_tag="SAS0623"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0668"
FT                   /protein_id="CAG42399.1"
FT                   /translation="MKPKVLLAGGTGYIGKYLSEVIENDAELFTISKYPDNKKTDDVEM
FT                   TWIQCDIFHYEQVVAAMNQIDIAVFFIDPTKNSAKITQSSARDLTLIAADNFGRAAAIN
FT                   QVKKVIYIPGSRYDNETIERLGAYGTPVETTNLVFKRSLVNVELQVSKYDDVRSTMKVV
FT                   LPKGWTLKNVVNHFIAWMGYTKGTFVKTEKSHDQFKIYIKNKVRPLAVFKIEETADGII
FT                   TLILLSGSLVKKYTVNQGKLEFRLIKESAVVYIHLYDYIPRLFWPIYYFIQAPMQKMMI
FT                   HGFEVDCRIKDFQSRLKSGENMKYTK"
FT   CDS_pept        702098..702772
FT                   /transl_table=11
FT                   /locus_tag="SAS0624"
FT                   /product="putative response regulator protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0669"
FT                   /db_xref="GOA:Q6GBH1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBH1"
FT                   /protein_id="CAG42400.1"
FT                   /translation="MQILLVEDDNTLFQELKKELEQWDFNVAGIEDFGKVMDTFESFNP
FT                   EIVILDVQLPKYDGFYWCRKMREVSNVPILFLSSRDNPMDQVMSMELGADDYMQKPFYT
FT                   NVLIAKLQAIYRRVYEFTAEEKRTLTWQDAVVDLSKDSIQKGDDTIFLSKTEMIILEIL
FT                   ITKKNQIVSRDTIITALWDDEAFVSDNTLTVNVNRLRKKLSEISMDSAIETKVGKGYMA
FT                   HE"
FT   misc_feature    702098..702454
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 78.2, E-value 1.8e-20"
FT   misc_feature    702536..702763
FT                   /note="Pfam match to entry PF00486 trans_reg_C,
FT                   Transcriptional regulatory protein, C terminal, score 72.9,
FT                   E-value 7.1e-19"
FT   CDS_pept        702765..703805
FT                   /transl_table=11
FT                   /locus_tag="SAS0625"
FT                   /product="putative sensor histidine kinase protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0670"
FT                   /db_xref="GOA:Q6GBH0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBH0"
FT                   /protein_id="CAG42401.1"
FT                   /translation="MNNLKWVAYFLKSRMNWIFWILFLNLLMLGISLIDYDFPIDSLFY
FT                   IVSLNLSLTMIFLILTYFKEVKLYKHFDKDKEIEEIKHKDLAETPFQRHTVDYLYRQIS
FT                   AHKEKVVEQQLQLNMHEQTITEFVHDIKTPVTAMKLLIDQEKNQERKQALLYEWSRINS
FT                   MLDTQLYITRLESQRKDMYFDYVSLKRMVIDEIQLTRHISQVKGIGFDVDFKVDDYVYT
FT                   DIKWCRMIIRQILSNALKYSENFNIEIGTELNDQHVSLYIKDYGRGISKKDMPRIFERG
FT                   FTSTANRNETTSSGMGLYLVNSVKDQLGIHLQVTSTVGKGTTVRLIFPLQNEIVERMSE
FT                   VTNLSF"
FT   misc_feature    order(702813..702866,702894..702953)
FT                   /note="2 probable transmembrane helices predicted for
FT                   SAS0625 by TMHMM2.0 at aa 17-34 and 44-63"
FT   misc_feature    703119..703295
FT                   /note="Pfam match to entry PF00512 HisKA, His Kinase A
FT                   (phosphoacceptor) domain, score 23.3, E-value 0.00036"
FT   misc_feature    703428..703757
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase, score 104.3,
FT                   E-value 2.5e-28"
FT   CDS_pept        703949..704710
FT                   /transl_table=11
FT                   /locus_tag="SAS0626"
FT                   /product="putative ABC transporter protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0671"
FT                   /protein_id="CAG42402.1"
FT                   /translation="MAILEVKQLTKIYGTKKMAQEVLRDINMSIEEGEFIAIMGPSGSG
FT                   KTTLLNVLSSIDYISQGSITLKGKKLEKLSNKELSDIRKHDIGFIFQEYNLLHTLTVKE
FT                   NIMLPLTVQKLDKEHMLNRYEKVAEALNILDISDKYPSELSGGQRQRTSAARAFITLPS
FT                   IIFADEPTGALDSKSTQDLLKRLTRMNEAFKSTIIMVTHDPVAASYANRVVMLKDGQIF
FT                   TELYQGDDDKHTFFKEIIRVQSVLGGVNYDL"
FT   misc_feature    704045..704605
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 198.6, E-value 1e-56"
FT   misc_feature    704066..704089
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        704700..706589
FT                   /transl_table=11
FT                   /locus_tag="SAS0627"
FT                   /product="putative ABC transporter permease"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0672"
FT                   /protein_id="CAG42403.1"
FT                   /translation="MTFNEIIFKNFRQNLSHYAIYLFSLITSVVLYFSFVALKYAHKLN
FT                   MTESYPIIKEGSQVGSYFLFFIIIAFLLYANVLFIKRRSYELALYQTLGLSKFNIIYIL
FT                   MLEQLLIFIITAILGIIIGIFGSKLLLMIVFTLLGIKEKVPIIFSLRAVFETLMLIGVA
FT                   YFLTSAQNFILVFKQSISQMSKNNQVKETNHNKITFEEVVLGILGIVLITTGYYLSLNI
FT                   VQYYDSIGILMFILLSTVIGAYLFFKSSVSLVFKMVKKFRKGVISVNDVMFSSSIMYRI
FT                   KKNAFSLTVMAIISAITVSVLCFAAISRASLSSEIKYTAPHDVTIKDQQKANQLASELN
FT                   NQKIPHFYNYKEVIHTKLYKDNLFDVKAKEPYNVTITSDKYIPNTDLKRGQADLFVAEG
FT                   SIKDLVKHKKHGKAVIGTKKHHVNIKLRKDINKIYFMTDVDLGGPTFVLNDKDYQEIRK
FT                   YTKAKHIVSQFGFDLKHKKDALALEKVKNKVDKSIKTRSEAISSISSLTGILLFVTSFL
FT                   GITFLIAVCCIIYIKQIDETEDELENYSILRKLGFTQKDMARGLKFKIMFNFGLPLVIA
FT                   LSHAYFTSLAYMKLMGTTNQIPVFIVMGLYICMYAVFAVTAYNHSKRTIRHSI"
FT   misc_feature    order(704757..704813,704871..704939,704997..705065,
FT                   705159..705227,705288..705356,705384..705452,
FT                   705555..705623,706224..706292,706392..706460,
FT                   706488..706556)
FT                   /note="10 probable transmembrane helices predicted for
FT                   SAS0627 by TMHMM2.0 at aa 20-38, 58-80, 100-122, 154-176,
FT                   197-219, 229-251, 286-308, 509-531, 565-587 and 597-619"
FT   misc_feature    704868..705239
FT                   /note="Pfam match to entry PF02687 FtsX, Predicted
FT                   permease, score 7.6, E-value 0.00012"
FT   CDS_pept        707314..707931
FT                   /transl_table=11
FT                   /locus_tag="SAS0628"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0673"
FT                   /protein_id="CAG42404.1"
FT                   /translation="MFSKKKDKFMVQLEEMVFNLDRAAIEFGKMDFNTHLDLKAYSDNI
FT                   KTYESHGDELVHQVITDLNQTFITPIEREDILSLCDAIDDVLDAIEETAAMFEMYSIEY
FT                   TDEYMAEFVDNIQKAVAEMKLAVGLLVDKKLSHMRIHSINIKEFETNCDGILRQSIKHI
FT                   FNSETDPITLIKIKDIYESMEEIADKCQIVANNFETIIMKNS"
FT   misc_feature    707341..707922
FT                   /note="Pfam match to entry PF01865 PhoU_div, Protein of
FT                   unknown function DUF47, score 6.9, E-value 3.8e-06"
FT   CDS_pept        707947..708954
FT                   /transl_table=11
FT                   /locus_tag="SAS0629"
FT                   /product="putative phosphate transport protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0674"
FT                   /protein_id="CAG42405.1"
FT                   /translation="MSYIIIVTIAVVIFSLIFDFINGFHDTANAVATAVSTRALTPKTA
FT                   ILMAAVMNFIGALTFTGVAGTITKDIVDPFKLENGLVVVLAAILAAIIWNLATWFYGIP
FT                   SSSSHALIGSIAGAAIASEGSFGVLHYQGFTKIIIVLIVSPIIAFCVGFLMYSIFKVIF
FT                   KNANLTRANRNFRFFQIFTAALQSFSHGTNDAQKSMGIITLALIVANVQNDGSVEPQLW
FT                   VKFACATAMGLGTAIGGWKIIKTVGGNIMKIRPANGAAADLSSALTIFVASSLHFPLST
FT                   THVVSSSILGVGASNRAKGVKWSTAQRMIITWVITLPISALLAGLLFYILNLFF"
FT   misc_feature    707947..708036
FT                   /note="Signal peptide predicted for SAS0629 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.965) with cleavage site
FT                   probability 0.858 between residues 30 and 31"
FT   misc_feature    order(707950..708018,708082..708150,708187..708255,
FT                   708268..708336,708355..708423,708607..708675,
FT                   708871..708939)
FT                   /note="7 probable transmembrane helices predicted for
FT                   SAS0629 by TMHMM2.0 at aa 2-24, 46-68, 81-103, 108-130,
FT                   137-159, 221-243 and 309-331"
FT   misc_feature    708010..708918
FT                   /note="Pfam match to entry PF01384 PHO4, Phosphate
FT                   transporter family, score 343.2, E-value 2.9e-100"
FT   CDS_pept        complement(709542..710339)
FT                   /transl_table=11
FT                   /locus_tag="SAS0630"
FT                   /product="putative exported protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0675"
FT                   /protein_id="CAG42406.1"
FT                   /translation="MKKLAFAITATSGAAAFLTHHDAQASTQHTVQSGESLWSIAQKYN
FT                   TSVESIKQNNQLDNNLVFPGQVISVGGSDAQNSSNTSPQAGSASSHTVQAGESLNIIAS
FT                   RYGVSVDQLMAANNLRGYLIMPNQTLQIPNGGSGGTTPTATTGSNGNASSFNHQNLYTA
FT                   GQCTWYVFDRRAQAGSPISTYWSDAKYWAGNAANDGYQVNNTPSVGSIMQSTPGPYGHV
FT                   AYVERVNGDGSILISEMNYTYGPYNMNYRTIPASEVSSYAFIH"
FT   misc_feature    complement(709545..709904)
FT                   /note="Pfam match to entry PF05257 CHAP, CHAP domain, score
FT                   186.2, E-value 5.3e-53"
FT   misc_feature    complement(709941..710069)
FT                   /note="Pfam match to entry PF01476 LysM, LysM domain, score
FT                   65.4, E-value 1.3e-16"
FT   misc_feature    complement(710127..710255)
FT                   /note="Pfam match to entry PF01476 LysM, LysM domain, score
FT                   65.8, E-value 9.6e-17"
FT   misc_feature    complement(710265..710339)
FT                   /note="Signal peptide predicted for SAS0630 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.996 between residues 25 and 26"
FT   CDS_pept        710700..711344
FT                   /transl_table=11
FT                   /locus_tag="SAS0631"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0676"
FT                   /protein_id="CAG42407.1"
FT                   /translation="MSQNTNHSYYHQNQHAQSISKVWLYFMYYWIIFGIGCYLGQFLPL
FT                   SWRQPLSFGLLIIILATLVFERARRFGLIISHIYAVVIGLLSYATFTTYLQNLGPDIFY
FT                   KNIALAIFAFIAFGIIGYFFVGDASSIGKYLFVTLITLIIASLIGIFLQNPIFYTIITV
FT                   VSLLLFLLYTLYDFNRLKRGDYSPREMGFNLFINLLNIIKDILYLANMFRR"
FT   misc_feature    order(710760..710828,710838..710891,710910..710978,
FT                   711006..711074,711087..711155,711165..711224)
FT                   /note="6 probable transmembrane helices predicted for
FT                   SAS0631 by TMHMM2.0 at aa 21-43, 47-64, 71-93, 103-125,
FT                   130-152 and 156-175"
FT   CDS_pept        712041..714191
FT                   /transl_table=11
FT                   /locus_tag="SAS0632"
FT                   /product="AraC family regulatory protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0677"
FT                   /protein_id="CAG42408.1"
FT                   /translation="MAKSCLHILTNNEYATTRCQDGIVLFWPIDGEIELQKFRKSKIIE
FT                   DDIYIINHLDVFSIKNNKKTIMLYLSSDWFAELGFTFFNYHYTAKLIKSSYNLKCLLLK
FT                   LTYRYLDNQPLNDADIRKLQDIIKIIAKEASMDKKIAQNQYRYAYYGDLRDELEYIYQN
FT                   VNQRLTLKSVADKLFVSKSNLSSQFHLLMGMGFKKYIDTLKIGKSIEILLTTDSTISNI
FT                   SEHLGFSSSSTYSKMFKSYMDITPNEYRNLSKYNKCLMLKPEPLVGKMVQEVKEIILNY
FT                   IEHYKNHLTDVIHIDEDKFETPKLFQTVIQINTYTEMKLVFLEGIFKTLLNKNSQVVFF
FT                   IMPSILKSKNTMSEEEKFTIIKTIIESDLKIAFNINDIETTYFVEEAFMSVFRQISPNE
FT                   LSNHNNYEVHFVFDLSLMEIRTIYRMILKLHNIMLNVKLGLNITCLFEKPSVFKSLVSQ
FT                   IKRLKFDSLIIDNANLSSPYLMGESDELLLKNILHFKNLKQVINELDIEQEKLIFLNVE
FT                   NHKLLNNKERDLSNSAPLIYKTLSALYHNFDGFGLNIFDNHHTFNAMHLYDKNGFKTTL
FT                   GLILEKFIEYVSKPKYENSYYSIFDIENYYCLVIYDWRVIESETIMSNFEDSQVYINFK
FT                   NNVLNDKYLIVIETLDENSGNINHLISKELRDKYEWNPSLLSKIDNYLKPAIEIKEHNF
FT                   SDNSLNINVTFNALYIIKIGKK"
FT   misc_feature    712509..712643
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   22.4, E-value 0.0011"
FT   misc_feature    712542..712607
FT                   /note="Predicted helix-turn-helix motif for SAS0632 with
FT                   score 1764.000, SD 5.19 at aa 168-189, sequence
FT                   LTLKSVADKLFVSKSNLSSQFH"
FT   misc_feature    712650..712778
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT   misc_feature    712659..712793
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   48.1, E-value 2.1e-11"
FT   CDS_pept        714271..714696
FT                   /transl_table=11
FT                   /locus_tag="SAS0633"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0679"
FT                   /db_xref="GOA:Q6GBG2"
FT                   /db_xref="InterPro:IPR010166"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBG2"
FT                   /protein_id="CAG42409.1"
FT                   /translation="MAKKFKIIMTEALSLYIWGCNILNTEKLETLLGFYKQYKALSEYI
FT                   DKKYKLSLNDLAVLDLTMKHCKDEKVLMQSFLKTAMDELDLSRTKLLVSIRRLIEKERL
FT                   SKVRSSKDERKIYIYLNNDDISKFNALFEDVEQFLNI"
FT   CDS_pept        714886..715602
FT                   /transl_table=11
FT                   /locus_tag="SAS0634"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0680"
FT                   /db_xref="GOA:Q6GBG1"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBG1"
FT                   /protein_id="CAG42410.1"
FT                   /translation="MGRKWNNIKEKKAQKDKNTSRIYAKFGKEIYVAAKSGEPNPESNQ
FT                   ALRLVLERAKTYSVPNHIIEKAIDKAKGAGDENFDHLRYEGFGPSGSMLIVDALTNNVN
FT                   RTASDVRAAFGKNGGNMGVSGSVAYMFDHVATFGIEGKSVDEILETLMEQDVDVNDVID
FT                   DNGLTIVYAEPDQFAVVQDALRAAGVEEFKVAEFEMLPQTDIELSEADQVTFEKLIDAL
FT                   EDLEDVQNVFHNVDLK"
FT   misc_feature    714892..715593
FT                   /note="Pfam match to entry PF01709 DUF28, Domain of unknown
FT                   function DUF28, score 402.1, E-value 5.7e-118"
FT   CDS_pept        715602..716075
FT                   /transl_table=11
FT                   /locus_tag="SAS0635"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0681"
FT                   /protein_id="CAG42411.1"
FT                   /translation="MKSAEQWIDELQLESHPEGGFYRETIREVLKDGRRAPFSSIYFLL
FT                   TDDNISHFHRIDADEVWYYHAGDSLTIHMINPDGEYTTATLGTDIQNGDVLQYVVPKGT
FT                   IFASSIEFSNTYSLVGCMCQPAFEFKQFELFKQSELITQYPHLKSVIEKYALK"
FT   misc_feature    715611..716009
FT                   /note="Pfam match to entry PF06172 DUF985, Protein of
FT                   unknown function (DUF985), score 301.8, E-value 8.9e-88"
FT   CDS_pept        716428..717072
FT                   /transl_table=11
FT                   /locus_tag="SAS0636"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0682"
FT                   /protein_id="CAG42412.1"
FT                   /translation="MKVKYIDKRHWRRLIDREYTEVKVNNNRFKGIIGLVTMKKVRDPL
FT                   EVTVVGQNIIVADDNYKWLQILPEKKRYSITVMFDNKGNPLEYYFDINIKNITQKGNAR
FT                   TVDLCLDVLALPSGEYELVDEDDLMFALESEQITKKQFHEAYMIAHQIMAELENDFKGF
FT                   QKKIMYCFNKINAKAQKNHQKPQNKTNIEKSKQIKPKQYNQTKNHQQQKKN"
FT   misc_feature    716539..716841
FT                   /note="Pfam match to entry PF04167 DUF402, Protein of
FT                   unknown function (DUF402), score 128.9, E-value 1e-35"
FT   CDS_pept        717188..718054
FT                   /transl_table=11
FT                   /locus_tag="SAS0637"
FT                   /product="LysR family regulatory protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0683"
FT                   /protein_id="CAG42413.1"
FT                   /translation="MKIEDYRLLITLDETKTLRKAAEILYISQPAVTQRLKAIENAFGV
FT                   DIFIRTKKQLITTTEGTMIIEHARDMLKRERLFFDKMQAHIGEVNGTISIGCSSLIGQT
FT                   LLPEVLSLYNAQFPNVEIQVQVGSTEQIKANHRDYHVMITRGNKVMNLANTHLFNDDHY
FT                   FIFPKNRRDDVTKLPFIEFQADPIYINQIKQWYNDNLEQDYHATITVDQVATCKEMLIS
FT                   GVGVTILPEIMMKNISKEQFEFEKVEIDNEPLIRSTFMSYDPSMLQLPQVDSFVNLMAS
FT                   FVEQPKA"
FT   misc_feature    717194..717373
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family, score
FT                   60.3, E-value 4.4e-15"
FT   misc_feature    717233..717298
FT                   /note="Predicted helix-turn-helix motif for SAS0637 with
FT                   score 1745.000, SD 5.13 at aa 16-37, sequence
FT                   KTLRKAAEILYISQPAVTQRLK"
FT   misc_feature    717236..717328
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    717443..718039
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain, score 76.1, E-value 7.9e-20"
FT   CDS_pept        718393..719613
FT                   /transl_table=11
FT                   /locus_tag="SAS0638"
FT                   /product="putative sugar efflux transporter"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0684"
FT                   /protein_id="CAG42414.1"
FT                   /translation="MDMFAALLQIKNYKLFVANMFLLGMGIAVTVPYLVLFATKDLGMT
FT                   TNQYGLLLASAAISQFTVNSIIARFSDTHHFNRKIIIILALLMGALGFSIYFFVDTIWL
FT                   FILLYAIFQGLFAPAMPQLYASARESINVSSSKDRAQFANTVLRSMFSLGFLFGPFIGA
FT                   QLIGLKGYAGLFGGTISIILFTLVLQVFFYKDLNIKHPISTQQHVEKIAPNMFKDKTLL
FT                   LPFIAFILLHIGQWMYTMNMPLFVTDYLKENEQHVGYLASLCAGLEVPFMIILGVLSSR
FT                   LQTRTLLIYGAIFGGLFYFSIGVFKNFYMMLAGQVFLAIFLAVLLGIGISYFQDILPDF
FT                   PGYASTLFSNAMVIGQLGGNLLGGAMSHWVGLENVFFVSAASIMLGMILIFFTKNQKIT
FT                   KEDVIST"
FT   misc_feature    718423..719607
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter, score -115.2, E-value 0.0034"
FT   misc_feature    order(718429..718497,718525..718593,718630..718689,
FT                   718699..718767,718825..718893,718903..718971,
FT                   719050..719118,719161..719229,719248..719307,
FT                   719323..719391,719410..719469,719497..719565)
FT                   /note="12 probable transmembrane helices predicted for
FT                   SAS0638 by TMHMM2.0 at aa 13-35, 45-67, 80-99, 103-125,
FT                   145-167, 171-193, 220-242, 257-279, 286-305, 311-333,
FT                   340-359 and 369-391"
FT   CDS_pept        719610..720098
FT                   /transl_table=11
FT                   /locus_tag="SAS0639"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0685"
FT                   /protein_id="CAG42415.1"
FT                   /translation="MTIILWLLIIAAFMLAFVGLIKPIIPSVLVLWVGFLIYQFGFHNQ
FT                   HLSWVFYVSMALLTILILCADFLANKYFVNRFGGSKFGEYAALIGVVIGCFVLPPFGII
FT                   IIPFILVFIVELIQGYSFERAVKVSIGSIVAFLTSSIAQAIIMFIMIVWFFIDALLIN"
FT   misc_feature    order(719613..719672,719682..719735,719748..719816,
FT                   719874..719942,720003..720071)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SAS0639 by TMHMM2.0 at aa 2-21, 25-42, 47-69, 89-111 and
FT                   132-154"
FT   misc_feature    719667..720086
FT                   /note="Pfam match to entry PF04306 DUF456, Protein of
FT                   unknown function (DUF456), score 306.1, E-value 4.5e-89"
FT   CDS_pept        complement(720197..720886)
FT                   /transl_table=11
FT                   /locus_tag="SAS0640"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0728"
FT                   /protein_id="CAG42416.1"
FT                   /translation="MKSTAQLTKENNVKSLRLSNTDREIFENYMTYMRSDFRVNPHDTE
FT                   LIINRILKQLLSAEQHGLLALDFFNHDPKAHAIKELKAMPNETFKNIFKYIYQHIVLLI
FT                   GIVSFLKGFLGFFMEKNGSNLYFVSFPFSVVVGFFIVFLFIWFSFKTIQLQCFNNSNWI
FT                   WIFTYLAIILLIVGFFYVFFIPQSLLAFGPYIQVSNWVFIIFSFIVMPIGLRIERNISK
FT                   KHSHTFL"
FT   misc_feature    complement(order(720239..720307,720335..720403,
FT                   720440..720508,720536..720604))
FT                   /note="4 probable transmembrane helices predicted for
FT                   SAS0640 by TMHMM2.0 at aa 95-117, 127-149, 162-184 and
FT                   194-216"
FT   CDS_pept        721013..721456
FT                   /transl_table=11
FT                   /locus_tag="SAS0641"
FT                   /product="putative acetyltransferase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0729"
FT                   /protein_id="CAG42417.1"
FT                   /translation="MRTLNKDEHNYIKQIANIHETLLSQVESNYKCTKLSIALRYEMIC
FT                   SRLEHTNDKIYIYENEGQLIAFIWGHFSNEKSMVNIELLYVEPQFRKLGIATQLKIALE
FT                   KWAKTMNAKRISNTIHKNNLPMISLNKDLGYQVSHVKMYKDID"
FT   misc_feature    721178..721420
FT                   /note="Pfam match to entry PF00583 Acetyltransf,
FT                   Acetyltransferase (GNAT) family, score 59.4, E-value
FT                   8.4e-15"
FT   CDS_pept        721523..721918
FT                   /transl_table=11
FT                   /locus_tag="SAS0642"
FT                   /product="putative lipoprotein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0730"
FT                   /protein_id="CAG42418.1"
FT                   /translation="MKKLIISIMAVMLFLTGCGKSQEKATLEKDIDNLQKENKELKDKK
FT                   EKLQQEKEKLADKQKDLEKEVKDLKPSKEDNKDDKKDEDKNKDKDKDKEASQDKQSKDQ
FT                   TKSSDKDNHKKPTSADKDQKANDKHQS"
FT   misc_feature    721523..721597
FT                   /note="Signal peptide predicted for SAS0642 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.995) with cleavage site
FT                   probability 0.552 between residues 25 and 26"
FT   misc_feature    721544..721576
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        722056..722355
FT                   /transl_table=11
FT                   /locus_tag="SAS0643"
FT                   /product="hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0731"
FT                   /protein_id="CAG42419.1"
FT                   /translation="MHEQDFRILEGQDITLPELGRELENITGHTIADSTGEIKRVIAHL
FT                   PNFESDTDTFVATYRLNHQQDFIDATFTALKSDRARLKEVPVHVELISYISKSK"
FT   CDS_pept        722435..722977
FT                   /transl_table=11
FT                   /locus_tag="SAS0644"
FT                   /product="putative acetyltransferase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0732"
FT                   /protein_id="CAG42420.1"
FT                   /translation="MIYCETERLILRDWHEDDLLPFQKMNANYDVRKYFPSLLSYRRSE
FT                   LDMRTMDAVIKDYGIGLFAVEDKESHQWIGFIGLNYIPETSDYPFKELPLYEIGWRLLP
FT                   EFWGKGLATEGAKATLKLAEEHQIYDVYSFTAEANKASQRVMEKIGMTVYDHFELPNLS
FT                   KYHLLKRQVRYYINLRK"
FT   misc_feature    722627..722890
FT                   /note="Pfam match to entry PF00583 Acetyltransf,
FT                   Acetyltransferase (GNAT) family, score 50.9, E-value 3e-12"
FT   CDS_pept        complement(723073..723639)
FT                   /transl_table=11
FT                   /locus_tag="SAS0645"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0733"
FT                   /protein_id="CAG42421.1"
FT                   /translation="MKRIAVYCGASKGHDPSYVQKAYDLGKYFAEQGYELVFGAGSIGI
FT                   MGAIQDGVLDHGGKAIGVMPKMLDEHEITSQRLTELILVDSMHERKNKMAELADAFVMA
FT                   PGGAGSLEEFFEMYSWAQIGIHEKPIAIYNINGFFNPLQTMIDHMIEEGFIDPKYRALA
FT                   PLCDTKESLIESILNFKPLGTRSYD"
FT   misc_feature    complement(723103..723504)
FT                   /note="Pfam match to entry PF03641 Lysine_decarbox, Lysine
FT                   decarboxylase family, score 237.0, E-value 2.8e-68"
FT   CDS_pept        complement(723641..724099)
FT                   /transl_table=11
FT                   /locus_tag="SAS0646"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0734"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBE9"
FT                   /protein_id="CAG42422.1"
FT                   /translation="MTHIIIDGDACPVVDSIIDLTTETGIFVTIIRSFSHFSNQLYPPH
FT                   VSTLYVDDGPDAVDYKIVQLSTKDDIVVTQDYGLASLLVDKVLIVMHHNGKIYNSKNIQ
FT                   QLLDKRYMNAQIRKQGGRHKGPPPFTKQDQKVFEQSLLKVIHRIKELD"
FT   misc_feature    complement(723659..724099)
FT                   /note="Pfam match to entry PF02639 DUF188, Uncharacterized
FT                   BCR, YaiI/YqxD family COG1671, score 81.3, E-value 2.1e-21"
FT   CDS_pept        complement(724102..724785)
FT                   /transl_table=11
FT                   /locus_tag="SAS0647"
FT                   /product="putative exported protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0735"
FT                   /protein_id="CAG42423.1"
FT                   /translation="MDKKKVIKFMINVLPIVLVPLIVERKRIKQHPDVQKVTDATSKVA
FT                   SKTSAAISNTASDVKEYVGDKKQDFENKRELKKFAREHDPAYIEKKGEKLAKQNRKDAD
FT                   KMNKILQKNIEKRHKEEQKAREKNEIQRIKDMKKSQKYEEKAGLTPNKLDEKTEKKGDK
FT                   LAEKNRKEIAKMNKKLQKNIEKRHKEEQKRQQEADKARIKSFKKYKDYVAKSASQQNKE
FT                   NNTEA"
FT   CDS_pept        complement(724957..725832)
FT                   /transl_table=11
FT                   /locus_tag="SAS0648"
FT                   /product="putative undecaprenol kinase"
FT                   /EC_number="2.7.1.66"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0736"
FT                   /db_xref="GOA:Q6GBE7"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBE7"
FT                   /protein_id="CAG42424.1"
FT                   /translation="MFIIELIKGIILGVVEGLTEFAPVSSTGHMILVDDMWLKSSEFLG
FT                   SQSAFTFKIVIQLGSVFAAAWVFRERFLEILHIGKHKHVEGDNNQQRRSKPRRLNLLHV
FT                   LVGMVPAGILGLLFDDFIEEHLFSVPTVMIGLFVGAIYMIIADKYSAKVKNPQTVDQIN
FT                   YFQAFVIGISQAVAMWPGFSRSGSTISTGVLMKLNHKAASDFTFIMAVPIMLAASGLSL
FT                   LKHYQDIQITDIPFYILGFLAAFTVGLIAIKTFLHLINKIKLIPFAIYRIVLVIFIAIL
FT                   YFGFGIGKGI"
FT   misc_feature    complement(order(724972..725031,725059..725127,
FT                   725164..725232,725290..725349,725398..725451,
FT                   725479..725538,725629..725697,725740..725808))
FT                   /note="8 probable transmembrane helices predicted for
FT                   SAS0648 by TMHMM2.0 at aa 9-31, 46-68, 99-118, 128-145,
FT                   162-181, 201-223, 236-258 and 268-287"
FT   misc_feature    complement(724999..725811)
FT                   /note="Pfam match to entry PF02673 BacA, Bacitracin
FT                   resistance protein BacA, score 460.8, E-value 1.2e-135"
FT   CDS_pept        726051..727682
FT                   /transl_table=11
FT                   /locus_tag="SAS0649"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0737"
FT                   /protein_id="CAG42425.1"
FT                   /translation="MKKLTIILFQYKIFPVLMFLVSTGLGILVITQNILIADFLAKIIR
FT                   HQFQGLWIVLFILLGVLLLRATVQFLNQWLGDTLAFKVKHMLRQRVIYKNNGHPIGEQM
FT                   TILTENIDGLAPFYKSYLPQVFKSMMVPLIIIIAMFFIHFNTALIMLITAPFIPLFYII
FT                   FGLKTRDESKDQMTYLNQFSQRFLNIAKGLVTLKLFNRTEQTEKHIYDDSTQFRTLTMR
FT                   ILRSAFLSGLMLEFISMLGIGLVALEATLSLVVFHNIDFKTAAIAIILAPEFYNAIKDL
FT                   GQAFHTGKQSEGASDVVFEFLEQPNNNNEFLLKYEENQKPFIQLTDISFRYDNSDRLVL
FT                   NDLNLEIYNGDQIALVGPSGAGKSTLTHLIAGVYQPTIGTISTNQRDLNIGILSQQPYI
FT                   FSASIKENITMFKDIENNTIEEVLDEVGLLDKVQSFTKGINTIIGEGGEMLSGGQMRRI
FT                   ELCRLLVMKPDLVIFDEPATGLDIQTEHMIQNVLFQHFKDTTMIVIAHRDNTIRHLQRR
FT                   LYIENGRLIADDRNISVNITENGDDL"
FT   misc_feature    726051..726161
FT                   /note="Signal peptide predicted for SAS0649 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.961) with cleavage site
FT                   probability 0.594 between residues 37 and 38"
FT   misc_feature    726060..726884
FT                   /note="Pfam match to entry PF00664 ABC_membrane, ABC
FT                   transporter transmembrane region, score 36.8, E-value
FT                   5.3e-08"
FT   misc_feature    order(726087..726155,726198..726266,726423..726476,
FT                   726489..726548,726729..726797)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SAS0649 by TMHMM2.0 at aa 13-35, 50-72, 125-142, 147-166
FT                   and 227-249"
FT   misc_feature    727098..727619
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 155.8, E-value 7.9e-44"
FT   misc_feature    727119..727142
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    727398..727442
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        727679..729352
FT                   /transl_table=11
FT                   /locus_tag="SAS0650"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0738"
FT                   /protein_id="CAG42426.1"
FT                   /translation="MKTRLKFQVDKDLLLAIVVGVCGSLVALAMFFLSGYMVTQSALGA
FT                   PLYALMILVVTVKLFGFLRAITRYVERLISHKATFTMLRDIRVQFFGKLVNVIPNVYRK
FT                   LSSSDLISRMISRVEALQNIYLRVYYPPVVIGLTALVTVIVLAFISIGHALLIMVSMLF
FT                   TLLVVPWLSSKKARTLKKHAANEQARFLNHFYDYKAGMDELRRFNQINHYRDNLMAKLN
FT                   HFDKLQLKEQRFLTIYDFILNIIAMLSIFGSLVLGLIQINAGQLNIIYMTSIVLMVLTL
FT                   FEQAVPMTNVAYYKADTDQALHDINEVISVPSTNGKNRLNDKYDATNIYEVKDASFKYW
FT                   NQQTYVLSDINFNVNRGEKIAIVGPSGSGKSTLLQIMAGLYQLDSGSIRFENMDMFEID
FT                   DKDKFESLNVLLQSQQLFDGTIRQNLFTDEKDEAVQAIFKQLDLEHLALERQIDLDGHT
FT                   LSGGEIQRLAIARMLLKDTASTWILDEPTTALDKQNSLKVMDLIEAHAETLIVATHDLT
FT                   LLSRFETIIVMINGKIVEKGNYQQLLANQGALWNMIQYNA"
FT   misc_feature    727679..727810
FT                   /note="Signal peptide predicted for SAS0650 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.906 between residues 44 and 45"
FT   misc_feature    order(727715..727783,727811..727879,728045..728113,
FT                   728123..728191,728396..728464)
FT                   /note="5 probable transmembrane helices predicted for
FT                   SAS0650 by TMHMM2.0 at aa 13-35, 45-67, 123-145, 149-171
FT                   and 240-262"
FT   misc_feature    727715..728536
FT                   /note="Pfam match to entry PF00664 ABC_membrane, ABC
FT                   transporter transmembrane region, score 6.4, E-value
FT                   0.0008"
FT   misc_feature    728747..729271
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 147.3, E-value 2.9e-41"
FT   misc_feature    728768..728791
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    729053..729097
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        complement(729479..729922)
FT                   /transl_table=11
FT                   /locus_tag="SAS0651"
FT                   /product="MarR family regulatory protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0739"
FT                   /db_xref="GOA:Q6GBE4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBE4"
FT                   /protein_id="CAG42427.1"
FT                   /translation="MSDQHNLKEQLCFSLYNAQRQVNRYYSNKVFKKYNLTYPQFLVLT
FT                   ILWDESPVNVKKVVTELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLTDKSET
FT                   IRPELSNASDKVASASSLSQDEVKELNRLLGKVIHAFDETKEK"
FT   misc_feature    complement(729512..729817)
FT                   /note="Pfam match to entry PF01047 MarR, MarR family, score
FT                   78.5, E-value 1.5e-20"
FT   CDS_pept        730149..731075
FT                   /transl_table=11
FT                   /locus_tag="SAS0652"
FT                   /product="putative cobalamin synthesis protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0740"
FT                   /protein_id="CAG42428.1"
FT                   /translation="MKNNKDEKIRISIINGFLGSGKTTLLTHYISELLKNDEKIKIIMN
FT                   EFGTFDIDSNSISNEIEVHSLINGCVCCDLKQELVYELKAIALKGDVNHVIIETTGIAH
FT                   PLELLVACQDPQIVNFFEKPIIYGVLDATRFLERHQYTENTVSLMEDQLKLSDMIIINK
FT                   IDLITDDRLERIDKQLGMICASIPTYKTTYGKVSLEELDLTVKDREISSHHHHHHGIKS
FT                   MTYTFTGPIDRQLFYQFIMKLPESVLRLKGYVSFRDQPNAIYEFQYAYGLPDYGIIGMQ
FT                   LPLTIVIIGETLDTNHIRNQLDMLQFT"
FT   misc_feature    730170..731066
FT                   /note="Pfam match to entry PF02492 cobW, Cobalamin
FT                   synthesis protein/P47K, score 411.8, E-value 6.8e-121"
FT   misc_feature    730194..730217
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        731178..732086
FT                   /transl_table=11
FT                   /locus_tag="SAS0653"
FT                   /product="aldo/keto reductase family protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0741"
FT                   /protein_id="CAG42429.1"
FT                   /translation="MEQIMINHYVHFSRLVQGFWRANEWKMTAKELNYFINELVERGIT
FT                   TMDHADIYGDYQCESLFGNALDLSPELRNKIQIVTKCGIILPSKQFDFTNGHRYDLSSK
FT                   HIVKSVEQSLINLNVDYLDSLLIHRSSSLMDPEQVADALTKLVKQGKLKSFGVSNFNHS
FT                   QYQLLNQYIMKERLHISINQLELSPYHVDSLQDGTMDSMYQNHVQIMAWSPFAGGKIFD
FT                   KEDIKAQRIMKVVQSIADKYGVSDTAVMIAWLVKIPHRIMPILGTSQLKRIDQAIEGLQ
FT                   LNLDDQSWFDIYTAIIGQDIP"
FT   misc_feature    731193..732074
FT                   /note="Pfam match to entry PF00248 aldo_ket_red, Aldo/keto
FT                   reductase family, score 125.3, E-value 1.2e-34"
FT   CDS_pept        732121..732408
FT                   /transl_table=11
FT                   /locus_tag="SAS0654"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0742"
FT                   /protein_id="CAG42430.1"
FT                   /translation="MTNEDKRFEQLRFERKFIVIPYLIYAVIVLLLNIFYSDLKITMTL
FT                   FGLFFAYNVVILFIAFIKHYKRTLLLSLILTVLSGAAFFGIIYVYGINHF"
FT   misc_feature    order(732169..732228,732241..732306,732325..732393)
FT                   /note="3 probable transmembrane helices predicted for
FT                   SAS0654 by TMHMM2.0 at aa 17-36, 41-62 and 69-91"
FT   CDS_pept        732691..734244
FT                   /transl_table=11
FT                   /locus_tag="SAS0655"
FT                   /product="putative sodium:sulfate symporter protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0743"
FT                   /protein_id="CAG42431.1"
FT                   /translation="MSEEKHVVEHEQQKKEKTKKQYKPFWIVMSFIILIVVLLLPAPSS
FT                   LPIMAKAVLAILAFAVIMWVTEAVSYPVSATLIIGLMILLLGFSPVQNLGEKLGNPKSG
FT                   SAILAGSDLLGTNHALSLAFSGYATSAVALVAAALFLAAAMQETNLHKRLALLVLSIVG
FT                   NKTRNIVIGAIIVSIVLAFFVPSATARAGAVVPILLGMIAAFKVSKDSKLASLLIITSV
FT                   QAVSIWNIGIKTAAAQNIVAINFINHQLGFDVSWGEWFLYAAPWSIVMSVALYFIMIKV
FT                   MPPEINTIEGGKDLIKEELHKLGPVSPREWRLIVISMLLLLFWSTEKVLHPIDSASITI
FT                   IALGVMLMPKIGVMTWKHVENKIPWGTIIVFGVGISLGNVLLKTGAAQWLSDQTFGVLG
FT                   LKHLPIIATIALITLFNILIHLGFASATSLSSALIPVFISLTSTLHLGDQSIGFVLIQQ
FT                   FVISFGFLLPVSAPQNMLAYGTGTFTVKDFLKAGIPLTIVGYILVIVFSMTYWKWLGLL
FT                   "
FT   misc_feature    732691..732846
FT                   /note="Signal peptide predicted for SAS0655 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.896) with cleavage site
FT                   probability 0.618 between residues 52 and 53"
FT   misc_feature    732745..734241
FT                   /note="Pfam match to entry PF00939 Na_sulph_symp,
FT                   Sodium:sulfate symporter transmembrane region, score 374.9,
FT                   E-value 8.7e-110"
FT   misc_feature    order(732763..732816,732826..732885,732898..732966,
FT                   733054..733122,733195..733263,733459..733527,
FT                   733675..733734,733777..733836,733873..733941,
FT                   733951..734019,734038..734106,734164..734232)
FT                   /note="12 probable transmembrane helices predicted for
FT                   SAS0655 by TMHMM2.0 at aa 25-42, 46-65, 70-92, 122-144,
FT                   169-191, 257-279, 329-348, 363-382, 395-417, 421-443,
FT                   450-472 and 492-514"
FT   CDS_pept        734330..735703
FT                   /transl_table=11
FT                   /locus_tag="SAS0656"
FT                   /product="putative DNA photolyase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0744"
FT                   /protein_id="CAG42432.1"
FT                   /translation="MAIAVLLNRMFRMEHNPLFEYIYQQKEDIDACYFIIPEEDMSSAS
FT                   DLKAQFYRGTLQRFYQSLHAEKLTPYVMSYDDIISFCKENNISEVVTAGDIMSYHLEEY
FT                   DILHQRSLFNEARIAVTLIRGNHYFKASKTMNQQGEPYKVFTSFYKKWRPYLRHRDVYH
FT                   YDLKSFEDFVIASPDDLVFDDIAFGSSQIIEQNKWQHFLDQDIQNYESGRDYLPEVLTS
FT                   QLSVALAYGLLDIIEIFNDLLARYDEDEANYEAFIRELIFREFYYVLMTQYPETSYQAF
FT                   KPKYRQIKWSQNEADFNAWCEGQTGFPIIDAAIMELTQTGFMHNRMRMVVSQFLTKDLF
FT                   IDWTWGEKFFRKHLIDYDAASNIHGWQWSASTGTDAVPYFRMFNPIRQSERFDAKALYI
FT                   KTYLPIFNQIDAKYLHDTQRNESNLFEQGIELGSHYPRQMVDHQEKRTQVLATFKALD"
FT   misc_feature    734885..735700
FT                   /note="Pfam match to entry PF03441 FAD_binding_7, FAD
FT                   binding domain of DNA photolyase, score 284.8, E-value
FT                   1.2e-82"
FT   CDS_pept        complement(735858..736142)
FT                   /transl_table=11
FT                   /locus_tag="SAS0657"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0745"
FT                   /protein_id="CAG42433.1"
FT                   /translation="MTINIIVLIVSIIVFQLIIGHIWHDIGLSYLRSILLMMLPFGLGV
FT                   FIQQVSYYERQYPKWQVPQNIKVRLKYIYLATFLEYVVLYLTLFTDILR"
FT   misc_feature    complement(order(735873..735941,736002..736061,
FT                   736071..736130))
FT                   /note="3 probable transmembrane helices predicted for
FT                   SAS0657 by TMHMM2.0 at aa 5-24, 28-47 and 68-90"
FT   CDS_pept        complement(736139..736759)
FT                   /transl_table=11
FT                   /locus_tag="SAS0658"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0746"
FT                   /protein_id="CAG42434.1"
FT                   /translation="MMQSRYIARIYFLILFIVSLFETKIFQFMTLNLFLAYIPFELSLL
FT                   LRLFKPNKKYEWPLFIIYSFIFVLLLPNTFYMVTDLIHLNQFQFNFYAGLNLSEWKYFT
FT                   YLLLGVFLAVYVMILIYFEILTLTSHRWLNRLIVVVLMFLNGFGIYIGRFLRLHSVYFF
FT                   NEPLHVLNHILESLTLKTAMFVCFMVVMQAAILLFGKGVRLNK"
FT   misc_feature    complement(order(736163..736231,736298..736366,
FT                   736385..736453,736523..736591,736610..736663,
FT                   736673..736741))
FT                   /note="6 probable transmembrane helices predicted for
FT                   SAS0658 by TMHMM2.0 at aa 7-29, 33-50, 57-79, 103-125,
FT                   132-154 and 177-199"
FT   CDS_pept        complement(736942..737364)
FT                   /transl_table=11
FT                   /locus_tag="SAS0659"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0747"
FT                   /protein_id="CAG42435.1"
FT                   /translation="MKLQKSNHTILLVLEKGEDIVECITTFADDQDLTFTSVSGIGACD
FT                   DVVLKFFNLTTKQYEEKHITEPLELTSLLGNISRLDNGHFAHLHATFGTQSYETFSGHL
FT                   AKAIVSATAEIILTVTDLDIQRSFKDAVGLNLLDPQ"
FT   misc_feature    complement(736978..737346)
FT                   /note="Pfam match to entry PF03479 DUF296, Domain of
FT                   unknown function (DUF296), score 142.6, E-value 7.2e-40"
FT   CDS_pept        737573..738739
FT                   /transl_table=11
FT                   /locus_tag="SAS0660"
FT                   /product="fluoroquinolone resistance protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0748"
FT                   /db_xref="GOA:Q6GBD5"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004734"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6GBD5"
FT                   /protein_id="CAG42436.1"
FT                   /translation="MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVA
FT                   AFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMS
FT                   AGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAG
FT                   ALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSLGLSAFE
FT                   TLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVV
FT                   VLILLVFANGYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGN
FT                   FIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM"
FT   misc_feature    737573..737662
FT                   /note="Signal peptide predicted for SAS0660 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.665) with cleavage site
FT                   probability 0.651 between residues 30 and 31"
FT   misc_feature    737582..738718
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter, score -79.9, E-value 0.00026"
FT   misc_feature    order(737591..737659,737690..737758,737777..737845,
FT                   737855..737923,737957..738025,738038..738106,
FT                   738179..738247,738290..738349,738368..738436,
FT                   738446..738514,738551..738619,738629..738697)
FT                   /note="12 probable transmembrane helices predicted for
FT                   SAS0660 by TMHMM2.0 at aa 7-29, 40-62, 69-91, 95-117,
FT                   129-151, 156-178, 203-225, 240-259, 266-288, 292-314,
FT                   327-349 and 353-375"
FT   CDS_pept        739020..739484
FT                   /transl_table=11
FT                   /locus_tag="SAS0661"
FT                   /product="putative exported protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0749"
FT                   /protein_id="CAG42437.1"
FT                   /translation="MGKGMTVKNLFLGFVAVILTVCLIGLLILATNEDALAKVHKTINT
FT                   LNAINVSTEDTYKKKMDILNIHTAKSSEVNENMKKQNHFKHRVNANKSNSFNEQECQVI
FT                   ADRYADKHINDNYGLERISKTNHGYNYVYSNDNSTSKQHVSISNQGIITK"
FT   misc_feature    739020..739130
FT                   /note="Signal peptide predicted for SAS0661 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.427 between residues 37 and 38"
FT   misc_feature    739047..739115
FT                   /note="1 probable transmembrane helix predicted for SAS0661
FT                   by TMHMM2.0 at aa 10-32"
FT   CDS_pept        739657..740139
FT                   /transl_table=11
FT                   /locus_tag="SAS0662"
FT                   /product="conserved hypothetical protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0750"
FT                   /protein_id="CAG42438.1"
FT                   /translation="MAKNKKTNAMRMLDRAKIKYEVHSFEVPEEHLSGQEVAELIQANV
FT                   KTVFKTLVLENTKHEHFVFVIPVSETLDMKKAAALVGEKKLQLMPLDNLKNVTGYIRGG
FT                   CSPVGMKTLFPTVVDKSCENYSHISVSGGLRTMQITIAVEDLITITKGKIGAVIHE"
FT   misc_feature    739699..740127
FT                   /note="Pfam match to entry PF04073 YbaK, YbaK / prolyl-tRNA
FT                   synthetases associated domain, score 205.0, E-value
FT                   1.2e-58"
FT   CDS_pept        740392..741153
FT                   /transl_table=11
FT                   /locus_tag="SAS0663"
FT                   /product="DeoR ramily regulatory protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0751"
FT                   /protein_id="CAG42439.1"
FT                   /translation="MIITEKRHELILEELSHKDFLTLQELIDRTGCSASTIRRDLSKLQ
FT                   QLGKLQRVHGGAMLKENRMVEANLTEKLATNLDEKKMIAKIAANQINDNECLFIDAGSS
FT                   TLELIKYIQAKDIIVVTNGLTHVEALLKKGIKTIMLGGQVKENTLATIGSSAMEILRRY
FT                   CFDKAFIGMNGLDIELGLTTPDEQEALVKQTAMSLANQSFVLIDHSKFNKVYFARVPLL
FT                   ESTTIITSEKALNQESLKEYQQKYHFIGGTL"
FT   misc_feature    740410..740514
FT                   /note="PS00894 Bacterial regulatory proteins, deoR family
FT                   signature."
FT   misc_feature    740410..741081
FT                   /note="Pfam match to entry PF00455 deoR, Bacterial
FT                   regulatory proteins, deoR family, score 229.6, E-value
FT                   4.7e-66"
FT   misc_feature    740452..740517
FT                   /note="Predicted helix-turn-helix motif for SAS0663 with
FT                   score 1665.000, SD 4.86 at aa 21-42, sequence
FT                   LTLQELIDRTGCSASTIRRDLS"
FT   CDS_pept        741150..742070
FT                   /transl_table=11
FT                   /locus_tag="SAS0664"
FT                   /product="putative phosphofructokinase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0752"
FT                   /protein_id="CAG42440.1"
FT                   /translation="MIYTVTFNPSIDYVIFTNDFKIDGLNRATATYKFAGGKGINVSRV
FT                   LKTLDVESTALGFAGGFPGKFIIDTLNNSAIQSNFIEVDEDTRINVKLKTGQETEINAP
FT                   GPHITSTQFEQLLQQIKNTTSEDIVIVAGSVPSSIPSDAYAQIAQITAQTGAKLVVDAE
FT                   KELAESVLPYHPLFIKPNKDELEVMFNTTVNSDTDVIKYGRLLVDKGAQSVIVSLGGDG
FT                   AIYIDKEISIKAVNPQGKVVNTVGSGDSTVAGMVAGIASGLTIEKAFQQAVACGTATAF
FT                   DEDLATRDAIEKIKSQVTISVLDGE"
FT   misc_feature    741168..742028
FT                   /note="Pfam match to entry PF00294 pfkB, pfkB family
FT                   carbohydrate kinase, score 166.9, E-value 3.6e-47"
FT   misc_feature    741876..741917
FT                   /note="PS00584 pfkB family of carbohydrate kinases
FT                   signature 2."
FT   CDS_pept        742076..744034
FT                   /transl_table=11
FT                   /locus_tag="SAS0665"
FT                   /product="PTS transport system, fructose-specific IIABC
FT                   component"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0753"
FT                   /protein_id="CAG42441.1"
FT                   /translation="MRVTELLTKDTIAMDLMANDKNGVIDELVNQLDKAGKLSDVASFK
FT                   EAIHNRESQSTTGIGEGIAIPHAKVAAVKSPAIAFGKSKAGVDYQSLDMQPAHLFFMIA
FT                   APEGGAQTHLDALAKLSGILMDENVREKLLHASSPEEVLAIIDEADDEVTKEEEAEAEA
FT                   QQVATAEQSSKQSNEPYVLAVTACPTGIAHTYMARDALKKQADKMGIKIKVETNGSSGI
FT                   KNHLTEQDIENATGIIVAADVHVETDRFDGKNVVEVPVADGIKRPEELINKALDTSRKP
FT                   FVARDGQRKGNSNDSQEKLSPGKAFYKHLMNGVSNMLPLVISGGILMAIVFLFGVDSFK
FT                   PKSSEYNAFAEQLWNIGSKSAFALIIPILSGFIARSIADKPGFAAGLVGGMLAISGGSG
FT                   FIGGIIAGFLAGYLTQGVKAMTRKLPQALEGLKPTLIYPLLTVTATGLLMIYVFNPPAS
FT                   WLNHLLLDGLNNLSGSNIVLLGLVIGAMMAIDMGGPFNKAAYVFATGALIEGNAAPITA
FT                   AMIGGMIPPLAIATAMLIFRRKFTKEQRGSIIPNYVMGMSFITEGAIPFAAADPLRVIP
FT                   SMMIGSGIGGAIALGLGSRITAPHGGIIVIVGTDGAHLLQTLIALLVGTLVSALIYGLI
FT                   KPKLTETEIEASKSMDE"
FT   misc_feature    742088..742522
FT                   /note="Pfam match to entry PF00359 PTS_EIIA_2,
FT                   Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2, score 99.6, E-value 6.7e-27"
FT   misc_feature    742229..742279
FT                   /note="PS00372 PTS EIIA domains phosphorylation site
FT                   signature 2."
FT   misc_feature    742613..742921
FT                   /note="Pfam match to entry PF02379 PTS_IIB_fruc, PTS
FT                   system, Fructose specific IIB subunit, score 202.2, E-value
FT                   8.4e-58"
FT   misc_feature    743006..743818
FT                   /note="Pfam match to entry PF02378 PTS_EIIC,
FT                   Phosphotransferase system, EIIC, score 141.5, E-value
FT                   1.6e-39"
FT   misc_feature    order(743015..743083,743141..743209,743246..743314,
FT                   743372..743440,743474..743542,743609..743677,
FT                   743714..743782,743825..743893,743912..743980)
FT                   /note="9 probable transmembrane helices predicted for
FT                   SAS0665 by TMHMM2.0 at aa 314-336, 356-378, 391-413,
FT                   433-455, 467-489, 512-534, 547-569, 584-606 and 613-635"
FT   CDS_pept        744342..745523
FT                   /transl_table=11
FT                   /locus_tag="SAS0666"
FT                   /product="putative N-acetylglucosamine-6-phosphate
FT                   deacetylase"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0754"
FT                   /protein_id="CAG42442.1"
FT                   /translation="MSELIIYNGKVYTEDGKIDNGYIHVKDGQIVAIGEGDDKAAIDND
FT                   TTNKIQVIDAKGHHVLPGFIDIHIHGGYGQDAMDGSYDGLKYLSENLLSEGTTSYLATT
FT                   MTQSTDKIDKALTNIAKYEAEQDVHNAAEIVGIHLEGPFISENKVGAQHPQYVVRPFID
FT                   KIKHFQETANRLIKIMTFAPEVEGAKEALETYKDDIIFSIGHTVATYEEAVEAVERGAK
FT                   HVTHLYNAATPFQHREPGVFGAAWLNDALHTEMIVDGTHSHPASVAIAYRMKGNERFYL
FT                   ITDAMRAKGMPEGEYDLGGQKVTVQSQQARLANGALAGSILKMNHGLRNLISFTGDTLD
FT                   HLWRVTSLNQAIALGIDDRKGSIKVNKDADLVILDDDMNVKSTIKQGKVHTFS"
FT   misc_feature    744516..745466
FT                   /note="Pfam match to entry PF01979 Amidohydro_1,
FT                   Amidohydrolase family, score 66.6, E-value 5.4e-17"
FT   CDS_pept        745744..747093
FT                   /transl_table=11
FT                   /locus_tag="SAS0667"
FT                   /product="putative membrane protein"
FT                   /note="Ortholog of S. aureus MRSA252 (BX571856) SAR0755"
FT                   /protein_id="CAG42443.1"
FT                   /translation="METSTIISLIIFILLIALTTVFVGSEFALVKIRATRIEQLADEGN
FT                   KPAKIVKKMIANLDYYLSACQLGITVTSLGLGWLGEPTFEKLLHPIFEAINLPTALTTT
FT                   ISFAVSFIIVTYLHVVLGELAPKSIAIQHTEKLALVYARPLFYFGNIMKPLIWLMNGSA
FT                   RVIIRMFGVNPDAQTDAMSEEEIKIIINNSYNGGEINQTELAYMQNIFSFDERHAKDIM
FT                   VPRTQMITLNEPFNVDELLETIKEHQFTRYPITDDGDKDHIKGFINVKEFLTEYASGKT
FT                   IKIAKYIHELPMISETTRISDALIRMQREHVHMSLIIDEYGGTAGILTMEDILEEIVGE
FT                   IRDEFDDDEVNDIVKIDNKTFQVNGRVLLDDLTEEFGIEFDDSEDIDTIGGWLQSRNTN
FT                   LQKDDYVDTTYDRWVVSEIDNHQIIWVILNYEFNEARPTIGQSDEDEKSE"
FT   misc_feature    745744..745827
FT                   /note="Signal peptide predicted for SAS0667 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.977) with cleavage site
FT                   probability 0.706 between residues 28 and 29"
FT   misc_feature    order(745756..745824,745915..745983,746041..746109,
FT                   746158..746226)
FT                   /note="4 probable transmembrane helices predicted for
FT                   SAS0667 by TMHMM2.0 at aa 5-27, 58-80, 100-122 and 139-161"
FT   misc_feature    745762..746352
FT                   /note="Pfam match to entry PF01595 DUF21, Domain of unknown
FT                   function DUF21, score 312.5, E-value 5.3e-91"
FT   misc_feature    746407..746574
FT                   /note="Pfam match to entry PF00571 CBS, CBS domain, score
FT                   39.8, E-value 6.6e-09"
FT   misc_feature    746596..746757
FT                   /note="Pfam match to entry PF00571 CBS, CBS domain, score
FT                   42.5, E-value 1e-09"
FT   misc_fe