(data stored in ACNUC1104 zone)

EMBL: BX571966

ID   BX571966; SV 1; circular; genomic DNA; STD; PRO; 3173005 BP.
XX
AC   BX571966;
XX
PR   Project:PRJNA178;
XX
DT   16-SEP-2004 (Rel. 81, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 9)
XX
DE   Burkholderia pseudomallei strain K96243, chromosome 2, complete sequence.
XX
KW   .
XX
OS   Burkholderia pseudomallei K96243
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Burkholderia; pseudomallei group.
XX
RN   [1]
RP   1-3173005
RX   DOI; 10.1073/pnas.0403302101.
RX   PUBMED; 15377794.
RA   Holden M.T.G., Titball R.W., Peacock S.J., Cerdeno-Tarraga A.M., Atkins T.,
RA   Crossman L.C., Pitt T., Churcher C., Mungall K., Bentley S.D., Sebaihia M.,
RA   Thomson N.R., Bason N., Beacham I.R., Brooks K., Brown K.A., Brown N.F.,
RA   Challis G.L., Cherevach I., Chillingworth T., Cronin A., Crosset B.,
RA   Davis P., DeShazer D., Feltwell T., Fraser A., Hance Z., Hauser H.,
RA   Holroyd S., Jagels K., Keith K.E., Maddison M., Moule S., Price C.,
RA   Quail M.A., Rabbinowitsch E., Rutherford K., Sanders M., Simmonds M.,
RA   Songsivilai S., Stevens K., Tumapa S., Vesaratchavest M., Whitehead S.,
RA   Yeats C., Barrell B.G., Oyston P.C.F., Parkhill J.;
RT   "Genomic plasticity of the causative agent of melioidosis, Burkholderia
RT   pseudomallei";
RL   Proc. Natl. Acad. Sci. U.S.A. 101(39):14240-14245(2004).
XX
RN   [2]
RP   1-3173005
RA   Holden M.T.G.;
RT   ;
RL   Submitted (01-SEP-2004) to the INSDC.
RL   Submitted on behalf of the Pathogen Sequencing Unit, Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA, E-mail:
RL   mh3@sanger.ac.uk
XX
DR   MD5; 57a2f2c2e11ca0dd8cd74493d667d4d6.
DR   BioSample; SAMEA1705938.
DR   EnsemblGenomes-Gn; BPSS0069.
DR   EnsemblGenomes-Gn; BPSS0072.
DR   EnsemblGenomes-Gn; BPSS0072A.
DR   EnsemblGenomes-Gn; BPSS0084.
DR   EnsemblGenomes-Gn; BPSS0106.
DR   EnsemblGenomes-Gn; BPSS0189.
DR   EnsemblGenomes-Gn; BPSS0233.
DR   EnsemblGenomes-Gn; BPSS0233a.
DR   EnsemblGenomes-Gn; BPSS0285A.
DR   EnsemblGenomes-Gn; BPSS0392.
DR   EnsemblGenomes-Gn; BPSS0393.
DR   EnsemblGenomes-Gn; BPSS0402A.
DR   EnsemblGenomes-Gn; BPSS0402B.
DR   EnsemblGenomes-Gn; BPSS0430.
DR   EnsemblGenomes-Gn; BPSS0445.
DR   EnsemblGenomes-Gn; BPSS0488A.
DR   EnsemblGenomes-Gn; BPSS0490.
DR   EnsemblGenomes-Gn; BPSS0633A.
DR   EnsemblGenomes-Gn; BPSS0637.
DR   EnsemblGenomes-Gn; BPSS0653.
DR   EnsemblGenomes-Gn; BPSS0657.
DR   EnsemblGenomes-Gn; BPSS0660.
DR   EnsemblGenomes-Gn; BPSS0661.
DR   EnsemblGenomes-Gn; BPSS0664a.
DR   EnsemblGenomes-Gn; BPSS0667.
DR   EnsemblGenomes-Gn; BPSS0678.
DR   EnsemblGenomes-Gn; BPSS0721a.
DR   EnsemblGenomes-Gn; BPSS0728.
DR   EnsemblGenomes-Gn; BPSS0744.
DR   EnsemblGenomes-Gn; BPSS0773.
DR   EnsemblGenomes-Gn; BPSS0774.
DR   EnsemblGenomes-Gn; BPSS0858.
DR   EnsemblGenomes-Gn; BPSS0863.
DR   EnsemblGenomes-Gn; BPSS0919A.
DR   EnsemblGenomes-Gn; BPSS0991.
DR   EnsemblGenomes-Gn; BPSS1185.
DR   EnsemblGenomes-Gn; BPSS1188.
DR   EnsemblGenomes-Gn; BPSS1207.
DR   EnsemblGenomes-Gn; BPSS1208.
DR   EnsemblGenomes-Gn; BPSS1254.
DR   EnsemblGenomes-Gn; BPSS1277a.
DR   EnsemblGenomes-Gn; BPSS1384a.
DR   EnsemblGenomes-Gn; BPSS1385A.
DR   EnsemblGenomes-Gn; BPSS1449a.
DR   EnsemblGenomes-Gn; BPSS1450.
DR   EnsemblGenomes-Gn; BPSS1478b.
DR   EnsemblGenomes-Gn; BPSS1515.
DR   EnsemblGenomes-Gn; BPSS1641.
DR   EnsemblGenomes-Gn; BPSS1728A.
DR   EnsemblGenomes-Gn; BPSS1774A.
DR   EnsemblGenomes-Gn; BPSS1775.
DR   EnsemblGenomes-Gn; BPSS1776.
DR   EnsemblGenomes-Gn; BPSS2002.
DR   EnsemblGenomes-Gn; BPSS2004.
DR   EnsemblGenomes-Gn; BPSS2008.
DR   EnsemblGenomes-Gn; BPSS2050.
DR   EnsemblGenomes-Gn; BPSS2061A.
DR   EnsemblGenomes-Gn; BPSS2074a.
DR   EnsemblGenomes-Gn; BPSS2076.
DR   EnsemblGenomes-Gn; BPSS2088.
DR   EnsemblGenomes-Gn; BPSS2092.
DR   EnsemblGenomes-Gn; BPSS2112.
DR   EnsemblGenomes-Gn; BPSS2147.
DR   EnsemblGenomes-Gn; BPSS2313.
DR   EnsemblGenomes-Gn; EBG00000313787.
DR   EnsemblGenomes-Gn; EBG00000313788.
DR   EnsemblGenomes-Gn; EBG00000313789.
DR   EnsemblGenomes-Gn; EBG00000313790.
DR   EnsemblGenomes-Gn; EBG00000313791.
DR   EnsemblGenomes-Gn; EBG00000313792.
DR   EnsemblGenomes-Gn; EBG00000313793.
DR   EnsemblGenomes-Gn; EBG00000313794.
DR   EnsemblGenomes-Gn; EBG00000313795.
DR   EnsemblGenomes-Gn; EBG00000313796.
DR   EnsemblGenomes-Gn; EBG00000313797.
DR   EnsemblGenomes-Gn; EBG00001002491.
DR   EnsemblGenomes-Gn; EBG00001002492.
DR   EnsemblGenomes-Gn; EBG00001002494.
DR   EnsemblGenomes-Gn; EBG00001002495.
DR   EnsemblGenomes-Gn; EBG00001002496.
DR   EnsemblGenomes-Gn; EBG00001002497.
DR   EnsemblGenomes-Gn; EBG00001002498.
DR   EnsemblGenomes-Gn; EBG00001002500.
DR   EnsemblGenomes-Gn; EBG00001002501.
DR   EnsemblGenomes-Gn; EBG00001002504.
DR   EnsemblGenomes-Gn; EBG00001002507.
DR   EnsemblGenomes-Gn; EBG00001002509.
DR   EnsemblGenomes-Gn; EBG00001002511.
DR   EnsemblGenomes-Gn; EBG00001002513.
DR   EnsemblGenomes-Gn; EBG00001002516.
DR   EnsemblGenomes-Gn; EBG00001482347.
DR   EnsemblGenomes-Tr; BPSS0069.
DR   EnsemblGenomes-Tr; BPSS0072.
DR   EnsemblGenomes-Tr; BPSS0072A.
DR   EnsemblGenomes-Tr; BPSS0084.
DR   EnsemblGenomes-Tr; BPSS0106.
DR   EnsemblGenomes-Tr; BPSS0189.
DR   EnsemblGenomes-Tr; BPSS0233.
DR   EnsemblGenomes-Tr; BPSS0233a.
DR   EnsemblGenomes-Tr; BPSS0285A.
DR   EnsemblGenomes-Tr; BPSS0392.
DR   EnsemblGenomes-Tr; BPSS0393.
DR   EnsemblGenomes-Tr; BPSS0402A.
DR   EnsemblGenomes-Tr; BPSS0402B.
DR   EnsemblGenomes-Tr; BPSS0430.
DR   EnsemblGenomes-Tr; BPSS0445.
DR   EnsemblGenomes-Tr; BPSS0488A.
DR   EnsemblGenomes-Tr; BPSS0490.
DR   EnsemblGenomes-Tr; BPSS0633A.
DR   EnsemblGenomes-Tr; BPSS0637.
DR   EnsemblGenomes-Tr; BPSS0652A.
DR   EnsemblGenomes-Tr; BPSS0653.
DR   EnsemblGenomes-Tr; BPSS0657.
DR   EnsemblGenomes-Tr; BPSS0660.
DR   EnsemblGenomes-Tr; BPSS0661.
DR   EnsemblGenomes-Tr; BPSS0664a.
DR   EnsemblGenomes-Tr; BPSS0667.
DR   EnsemblGenomes-Tr; BPSS0678.
DR   EnsemblGenomes-Tr; BPSS0721a.
DR   EnsemblGenomes-Tr; BPSS0728.
DR   EnsemblGenomes-Tr; BPSS0744.
DR   EnsemblGenomes-Tr; BPSS0773.
DR   EnsemblGenomes-Tr; BPSS0774.
DR   EnsemblGenomes-Tr; BPSS0858.
DR   EnsemblGenomes-Tr; BPSS0863.
DR   EnsemblGenomes-Tr; BPSS0919A.
DR   EnsemblGenomes-Tr; BPSS0991.
DR   EnsemblGenomes-Tr; BPSS1185.
DR   EnsemblGenomes-Tr; BPSS1188.
DR   EnsemblGenomes-Tr; BPSS1207.
DR   EnsemblGenomes-Tr; BPSS1208.
DR   EnsemblGenomes-Tr; BPSS1254.
DR   EnsemblGenomes-Tr; BPSS1277a.
DR   EnsemblGenomes-Tr; BPSS1384a.
DR   EnsemblGenomes-Tr; BPSS1385A.
DR   EnsemblGenomes-Tr; BPSS1449a.
DR   EnsemblGenomes-Tr; BPSS1450.
DR   EnsemblGenomes-Tr; BPSS1478b.
DR   EnsemblGenomes-Tr; BPSS1515.
DR   EnsemblGenomes-Tr; BPSS1641.
DR   EnsemblGenomes-Tr; BPSS1728A.
DR   EnsemblGenomes-Tr; BPSS1774A.
DR   EnsemblGenomes-Tr; BPSS1775.
DR   EnsemblGenomes-Tr; BPSS1776.
DR   EnsemblGenomes-Tr; BPSS2002.
DR   EnsemblGenomes-Tr; BPSS2004.
DR   EnsemblGenomes-Tr; BPSS2008.
DR   EnsemblGenomes-Tr; BPSS2050.
DR   EnsemblGenomes-Tr; BPSS2061A.
DR   EnsemblGenomes-Tr; BPSS2074a.
DR   EnsemblGenomes-Tr; BPSS2076.
DR   EnsemblGenomes-Tr; BPSS2088.
DR   EnsemblGenomes-Tr; BPSS2092.
DR   EnsemblGenomes-Tr; BPSS2112.
DR   EnsemblGenomes-Tr; BPSS2147.
DR   EnsemblGenomes-Tr; BPSS2313.
DR   EnsemblGenomes-Tr; EBG00000313787-1.
DR   EnsemblGenomes-Tr; EBG00000313788-1.
DR   EnsemblGenomes-Tr; EBG00000313789-1.
DR   EnsemblGenomes-Tr; EBG00000313790-1.
DR   EnsemblGenomes-Tr; EBG00000313791-1.
DR   EnsemblGenomes-Tr; EBG00000313792-1.
DR   EnsemblGenomes-Tr; EBG00000313793-1.
DR   EnsemblGenomes-Tr; EBG00000313794-1.
DR   EnsemblGenomes-Tr; EBG00000313795-1.
DR   EnsemblGenomes-Tr; EBG00000313796-1.
DR   EnsemblGenomes-Tr; EBG00000313797-1.
DR   EnsemblGenomes-Tr; EBT00001529885.
DR   EnsemblGenomes-Tr; EBT00001529886.
DR   EnsemblGenomes-Tr; EBT00001529887.
DR   EnsemblGenomes-Tr; EBT00001529888.
DR   EnsemblGenomes-Tr; EBT00001529889.
DR   EnsemblGenomes-Tr; EBT00001529890.
DR   EnsemblGenomes-Tr; EBT00001529891.
DR   EnsemblGenomes-Tr; EBT00001529892.
DR   EnsemblGenomes-Tr; EBT00001529893.
DR   EnsemblGenomes-Tr; EBT00001529894.
DR   EnsemblGenomes-Tr; EBT00001529895.
DR   EnsemblGenomes-Tr; EBT00001529896.
DR   EnsemblGenomes-Tr; EBT00001529897.
DR   EnsemblGenomes-Tr; EBT00001529898.
DR   EnsemblGenomes-Tr; EBT00001529899.
DR   EuropePMC; PMC1847439; 17362501.
DR   EuropePMC; PMC2386483; 18439288.
DR   EuropePMC; PMC2612433; 18931103.
DR   EuropePMC; PMC2632904; 19056824.
DR   EuropePMC; PMC3196475; 22028940.
DR   EuropePMC; PMC3356290; 22624061.
DR   EuropePMC; PMC3548686; 23217012.
DR   EuropePMC; PMC3579680; 23409683.
DR   EuropePMC; PMC3984277; 24728008.
DR   EuropePMC; PMC4057154; 24927285.
DR   EuropePMC; PMC4217092; 26038496.
DR   EuropePMC; PMC5025242; 27632353.
DR   EuropePMC; PMC521101; 15377794.
DR   EuropePMC; PMC5300093; 28112723.
DR   EuropePMC; PMC6395871; 30834386.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00624; P9.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; BX571966.
DR   SILVA-SSU; BX571966.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3173005
FT                   /organism="Burkholderia pseudomallei K96243"
FT                   /chromosome="2"
FT                   /strain="K96243"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:272560"
FT   CDS_pept        1..1188
FT                   /transl_table=11
FT                   /locus_tag="BPSS0001"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37444"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PE4"
FT                   /protein_id="CAH37444.1"
FT                   /translation="MTLDEIRQSIREELDALRVSGARRQDLSLHACKRLFFDLGIRPST
FT                   ANVRELTQTGSASDIPKDIDHFWERIRSASKVRLEGAALPKPLEEKAGALLGALYEEAL
FT                   KQARESLDGERQQASSEVAAAEQKYRDALIRQEALEAAVARSDARAEQLQSRLTDVEVQ
FT                   LASASTQGLAHQDSLQGLIRRMENENALLNQRLEAEQSQNAALRERIDALHAELRENTE
FT                   HYAQQIKDAIAEAERRVKPMLVELDSLRSMASTYQQGLRDVNRKEFDFLQQLSAAKARA
FT                   DRLDAQLREQGDELTAALNEVQILRASQGMTPEIAALIRRLANAGNLDAAAFDTIGTSL
FT                   DQHVTLPARCPKCGDGEPELSHDAHGYELLCPECEHASGTQPSRFAAAACFTRTT"
FT   CDS_pept        complement(1282..2325)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0002"
FT                   /product="putative integrase"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   integrase/recombinase protein rsp1102 or rs02608
FT                   SWALL:Q8XQW6 (EMBL:AL646082) (323 aa) fasta scores: E():
FT                   4.8e-34, 37.89% id in 314 aa, and to parts of Rhizobium
FT                   loti integrase/recombinase mll6042 and mll5956 SWALL:Q981F2
FT                   (EMBL:AP003008) (332 aa) fasta scores: E(): 3e-06, 29.65%
FT                   id in 172 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37445"
FT                   /db_xref="GOA:Q63PE3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PE3"
FT                   /protein_id="CAH37445.1"
FT                   /translation="MSLPILTSPPSPPDIPSDLFDRDTSDWLNHPDTAFDAWLAAQEFR
FT                   RSSADVYRAQWGAFLGWLAKRQKNLATVDTETIALFVGELPIKKTQRVRYLRLIERVLD
FT                   HVRKNEFGSTNPARFIAQDGEATWRAARDNEPTSFLAPAERAALLAYLFSPLPAAGAAL
FT                   WKERRDRALIAVFLGGGLKTGEARALTISCVKLGSTMLTIPAAQPEFTRETHLASFAIA
FT                   LFDAWLAERQRCGIPGELVFPASQSGRPMHKATMLRAVDAIVDAADIAQSRTARASPQT
FT                   LRNTFAAELFENGVEPEKVGQWLGFAQPISSNRLHRAWKNWRESLASALPNAESLTDEI
FT                   STEPSQA"
FT   misc_feature    complement(1354..1899)
FT                   /note="Pfam match to entry PF00589 Phage_integrase, Phage
FT                   integrase family , score -12.1, E-value 0.0013"
FT   CDS_pept        complement(2471..2917)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0003"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37446"
FT                   /db_xref="InterPro:IPR018894"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PE2"
FT                   /protein_id="CAH37446.1"
FT                   /translation="MRKILYIRTVYAKQEPAMTEQDLAALSFKAAAHDMETIVRHIAER
FT                   YIRQGVPLTWRLLHAVEAEALADLGFASRHDPMVRCLFDRPAELRFPETDDLVDFGQSN
FT                   ALPAVFSFAVAAYERAADARADTAAVPARSARASRMGRLASRRS"
FT   CDS_pept        complement(2946..3554)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0004"
FT                   /product="putative DNA-binding protein"
FT                   /note="Similar to Ralstonia solanacearum putative
FT                   transcription regulator protein rsp0962 or rs02293
FT                   SWALL:Q8XR97 (EMBL:AL646082) (182 aa) fasta scores: E():
FT                   3.2e-31, 53.33% id in 180 aa, and to Streptomyces
FT                   coelicolor putative transcriptional regulatory protein
FT                   sco1312 or scbac36f5.23C SWALL:Q93IV8 (EMBL:AL592292) (201
FT                   aa) fasta scores: E(): 2.2e-11, 30.11% id in 176 aa. Note:
FT                   This CDS is longer in its N-terminal region than most of
FT                   its database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37447"
FT                   /db_xref="GOA:Q63PE1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PE1"
FT                   /protein_id="CAH37447.1"
FT                   /translation="MASSSGARRTTAPASPATGATPPRVGEQIQRLRNERKLTLDDLSR
FT                   AAGVSKSMLSEIERDKANPTIAVAWRLTNALGISLDELFAQPKAPETIRVDGPHDIPTL
FT                   AGHDAQYQLRVWGPIELAGKFEWYELTLPAHGALVSNPHEPGTREHLTVLNGAVEIEAA
FT                   GTARRLKAGDTARYAADGPHAIRNAGKSEAKALLIVIHR"
FT   misc_feature    complement(2982..3005)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(3306..3470)
FT                   /note="Pfam match to entry PF01381 HTH_3, Helix-turn-helix
FT                   , score 66.0, E-value 5.3e-17"
FT   misc_feature    complement(3378..3443)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1501.000, SD 4.30 at aa 38-59, sequence
FT                   LTLDDLSRAAGVSKSMLSEIER"
FT   CDS_pept        3722..4921
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="BPSS0005"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /EC_number="2.3.1.29"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 2-amino-3-ketobutyrate coenzyme A ligase Kbl or
FT                   b3617 or z5044 or ecs4495 SWALL:KBL_ECOLI (SWALL:P07912)
FT                   (398 aa) fasta scores: E(): 9.6e-104, 69.67% id in 399 aa,
FT                   and to Salmonella typhimurium 2-amino-3-ketobutyrate
FT                   coenzyme A ligase Kbl or stm3709 SWALL:KBL_SALTY
FT                   (SWALL:P37419) (398 aa) fasta scores: E(): 5.5e-104, 69.92%
FT                   id in 399 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37448"
FT                   /db_xref="GOA:Q63PE0"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PE0"
FT                   /protein_id="CAH37448.1"
FT                   /translation="MRDAYLAHLRGTLEQIRADGFYKTEREIASPQAADIRLAGGTHVL
FT                   NFCANNYLGLADDSRLIAAAQAALEQDGFGMASVRFICGTQTVHKQLEAALSAFLKTDD
FT                   CILYSSCFDANGGLFETLLDENDAIISDELNHASIIDGIRLSKARRFRYKNNDLADLEA
FT                   KLREADAAGARFKLIATDGVFSMDGIIANLKGVCDLADRYGALVMVDDSHAVGFIGEHG
FT                   RGTPEYCGVEGRVDIVTGTLGKALGGASGGYVAARREIVELLRQRSRPYLFSNTLTPSI
FT                   AAASLKVLELLASDEGARLRERVRANGAHFREKMSAAGFALVPGEHPIIPVMLGDAQVA
FT                   SKMADALLAEGVYVIGFSFPVVPRGRARIRTQMSAAHTREQIDRAVDAFVRVGKTLGVI
FT                   "
FT   misc_feature    3941..4891
FT                   /note="Pfam match to entry PF00155 aminotran_1_2,
FT                   Aminotransferase class I and II , score 202.1, E-value
FT                   5.7e-58"
FT   misc_feature    4442..4471
FT                   /note="PS00599 Aminotransferases class-II
FT                   pyridoxal-phosphate attachment site."
FT   misc_feature    4883..4906
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        4934..5965
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="BPSS0006"
FT                   /product="threonine 3-dehydrogenase"
FT                   /EC_number="1.1.1.103"
FT                   /note="Similar to Escherichia coli threonine
FT                   3-dehydrogenase Tdh or b3616 SWALL:TDH_ECOLI (SWALL:P07913)
FT                   (341 aa) fasta scores: E(): 5.1e-106, 77.05% id in 340 aa,
FT                   and to Salmonella typhimurium threonine 3-dehydrogenase
FT                   stm3708 SWALL:Q8ZL52 (EMBL:AE008872) (341 aa) fasta scores:
FT                   E(): 2.2e-106, 77.64% id in 340 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37449"
FT                   /db_xref="GOA:Q63PD9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63PD9"
FT                   /protein_id="CAH37449.1"
FT                   /translation="MKALAKLERGPGLTLTRVKKPEVGHNDVLIKIRRTAICGTDIHIW
FT                   KWDDWAQKTIPVPMHVGHEYVGEIVEMGQEVRGFSIGDRVSGEGHITCGFCRNCRAGRR
FT                   HLCRNTVGVGVNREGAFAEYLAIPAFNAFKIPPEISDDLAAIFDPFGNATHTALSFNLV
FT                   GEDVLITGAGPIGVMAVAIAKHVGARNVVITDINDYRLELARKMGATRAVNVSRESLRD
FT                   VMADLHMTEGFDVGLEMSGVPSAFTSLLESMNHGGKVALLGIPPAQTAIDWNQVIFKGL
FT                   EIKGIYGREMFETWYKMVAMLQSGLDLSPIITHRFAVDDYEKGFAAMLSGESGKVILDW
FT                   ADA"
FT   misc_feature    4952..5953
FT                   /note="Pfam match to entry PF00107 adh_zinc, Zinc-binding
FT                   dehydrogenase , score 336.5, E-value 2e-98"
FT   misc_feature    5117..5161
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT   CDS_pept        complement(6300..6953)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Caulobacter crescentus hypothetical
FT                   protein cc3392 SWALL:Q9A314 (EMBL:AE005999) (213 aa) fasta
FT                   scores: E(): 9.6e-20, 36.76% id in 204 aa, and to Xylella
FT                   fastidiosa hypothetical protein xf1840 SWALL:Q9PCE1
FT                   (EMBL:AE004005) (237 aa) fasta scores: E(): 3e-19, 33.99%
FT                   id in 203 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37450"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PD8"
FT                   /protein_id="CAH37450.1"
FT                   /translation="MKPVRWAGRFACAIALAGVAASCTPLRVVTHSVSTAEAAVPAGRY
FT                   TLDPHHWSIVFDVDHFKYSRFTMRFDRANAQLDWRPGGGLADSGVSASIDAASVDTRVP
FT                   LLDKLVAGADALDAARNPQIRFDSTRFARTSATQGTLTGNLTIRGATHPVTLAVTFNGY
FT                   GRNPLTKQDTLGFSASGTFSRAQFGVTSWYPAVGDDVRVRIEAEFVKEGEAPAQ"
FT   CDS_pept        7043..7660
FT                   /transl_table=11
FT                   /locus_tag="BPSS0008"
FT                   /product="putative TetR-family regulatory protein"
FT                   /note="Similar to Anabaena sp. transcriptional regulator
FT                   all7523 SWALL:Q8ZSI7 (EMBL:AP003602) (190 aa) fasta scores:
FT                   E(): 1.8e-19, 35.26% id in 190 aa, and to Pseudomonas
FT                   aeruginosa probable transcriptional regulator pa3034
FT                   SWALL:Q9HZH4 (EMBL:AE004728) (185 aa) fasta scores: E():
FT                   5.7e-19, 41.53% id in 183 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37451"
FT                   /db_xref="GOA:Q63PD7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PD7"
FT                   /protein_id="CAH37451.1"
FT                   /translation="MDTKPDLAPAAGARERLLDAAETLIYAGGIHATGVDAIVKRSGAA
FT                   RKSFYAHFESKEALVAAALERRDARWMAWFVEATKKRGKTPRARLVGMFDVLREWFEQA
FT                   DFHGCAFLNAAGEIERADDPIRVVVREHKARLLAFVREQLDAHAAQAGADRRFVARLAR
FT                   QWLVLIDGAIGVALVSGDASAARDARAAAELLLDATLPNRSS"
FT   misc_feature    7091..7231
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family , score 58.8, E-value
FT                   7.6e-15"
FT   misc_feature    7274..7297
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        7761..8240
FT                   /transl_table=11
FT                   /locus_tag="BPSS0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Agrobacterium tumefaciens hypothetical
FT                   protein atu5387 or agr_pat_559 SWALL:Q8UJT8 (EMBL:AE008960)
FT                   (154 aa) fasta scores: E(): 9.4e-52, 76.31% id in 152 aa,
FT                   and to Pseudomonas aeruginosa hypothetical protein pa5395
FT                   SWALL:Q9HTG9 (EMBL:AE004952) (156 aa) fasta scores: E():
FT                   6.3e-51, 74.19% id in 155 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37452"
FT                   /db_xref="InterPro:IPR009783"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PD6"
FT                   /protein_id="CAH37452.1"
FT                   /translation="MSDSTEIRPPVPPFTRETAIQKVRAAEDGWNTRDPERVSLAYTPQ
FT                   SKWRNRAEFATGRAEIVALLRRKWTREIDYRLIKELWAFTGNRIAVRFAYEWRDDAGNW
FT                   FRSYGNENWEFDENGLMAHRHACINDMPIREADRLFHWPLGRRPDDHPGLSDLGL"
FT   CDS_pept        complement(8455..9471)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0010"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37453"
FT                   /db_xref="GOA:Q63PD5"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PD5"
FT                   /protein_id="CAH37453.1"
FT                   /translation="MTESAPVFPHYSIEVDFPDLEAHRTGNAGVDYVHRFDSGVPGPRV
FT                   MINALTHGNEVCGAIVVDALLKRGLRPRRGVLTVSFANVTAYERFDPARPDAARFVDQD
FT                   FNRVWAPAVLDDLSQHSVELDRARAIRPFVDEADWLLDLHSMHERSAPLIVAGPLAKGT
FT                   ALALRIGAPATVIRDEGHPEGKRMRDYGGFGDPASAKNALLVECGQHWEARAVAVARDS
FT                   TARFLMASGIVDERDLPADWFLPLATTMRIVQVTQPVVATSGDFRFADAYTGLEHFAEA
FT                   GAVIGWSDGKPVTTPYPDCVLVMPSLRQLHPGVTVVRLGRVEREVAQRAARGTRDEC"
FT   CDS_pept        complement(9774..10859)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0011"
FT                   /product="putative tartrate dehydrogenase"
FT                   /EC_number="1.1.1.93"
FT                   /note="Similar to Escherichia coli probable tartrate
FT                   dehydrogenase YeaU or b1800 SWALL:TTUC_ECOLI (SWALL:P76251)
FT                   (361 aa) fasta scores: E(): 2.2e-106, 70.95% id in 358 aa,
FT                   and to Ralstonia solanacearum probable tartrate
FT                   dehydrogenase oxidoreductase protein TtuC or rsp1612 or
FT                   rs02169 SWALL:Q8XPM6 (EMBL:AL646086) (361 aa) fasta scores:
FT                   E(): 5.3e-113, 75% id in 360 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37454"
FT                   /db_xref="GOA:Q63PD4"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PD4"
FT                   /protein_id="CAH37454.1"
FT                   /translation="MSEKVYRIAVIPGDGIGVEVMPEGLRALDAVSRRFGLRFAYEPIE
FT                   WASCDYYAKHGQMMPDDWKTQLSGMDALLFGAVGWPETVPDHISLWGSLIKFRREFDQY
FT                   VNLRPARLFDGVPCPLAGRKAGDIDFMIVRENTEGEYSAVGGTMFEGTEREFVVQQAVF
FT                   TRHGTERVLKFAFELAQRRAKRLTVATKSNGIAISMPWWDARAAEMAARYPDVAWDKQH
FT                   IDILCARFVMQPDRFDVVVASNLFGDILSDLGPACTGTIGIAPSANLNPERNFPSLFEP
FT                   VHGSAPDIAGKHIANPIAMIWSAAMMVDFLGAGTGPAREAHDAIVAAIEHVLKHGPRTR
FT                   DMGGRASTREVGDAIVAHLLG"
FT   misc_feature    complement(9795..10841)
FT                   /note="Pfam match to entry PF00180 isodh,
FT                   Isocitrate/isopropylmalate dehydrogenase , score 337.8,
FT                   E-value 7.8e-99"
FT   misc_feature    complement(10071..10130)
FT                   /note="PS00470 Isocitrate and isopropylmalate
FT                   dehydrogenases signature."
FT   CDS_pept        11028..11945
FT                   /transl_table=11
FT                   /locus_tag="BPSS0012"
FT                   /product="putative LysR-family regulatory protein"
FT                   /note="Similar to Escherichia coli hypothetical
FT                   transcriptional regulator YeaT or b1799 SWALL:YEAT_ECOLI
FT                   (SWALL:P76250) (307 aa) fasta scores: E(): 3.4e-70, 60.13%
FT                   id in 296 aa, and to Yersinia pestis putativellysr-family
FT                   transcriptional regulatory protein ypo2497 SWALL:Q8ZDQ9
FT                   (EMBL:AJ414152) (313 aa) fasta scores: E(): 3.7e-67, 56.31%
FT                   id in 309 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37455"
FT                   /db_xref="GOA:Q63PD3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PD3"
FT                   /protein_id="CAH37455.1"
FT                   /translation="MNNSPNLDDLRVFSVVVRLASFSAAAEQLAVSPAYVSKRVALLEK
FT                   QLGTRLLHRSTRRVAVTEAGERVYAWTEKILDDVDHLVEDVSTTRSVPRGTLRISSSFG
FT                   FGRHVLAPALLGFNERYPQLNVRLDLFDRLVDVAGEGFDLDIRIGDEIADHLIAKRLAT
FT                   NYRVLCASPGYLARYGTPRQLADLGAHQCLAIKERDHPFGVWRLTVRGETSTVKVGGAL
FT                   STNHGEVAVQWALAGRGIVLRSIWEAGPLLASGELRRVLPEASQPANVWAVYPARLAAS
FT                   AKVRVCVDFLVDAFAHLNERANGG"
FT   misc_feature    11028..11105
FT                   /note="Signal peptide predicted for BPSS0012 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.835) with cleavage site
FT                   probability 0.740 between residues 26 and 27"
FT   misc_feature    11046..11225
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family , score
FT                   78.7, E-value 7.7e-21"
FT   misc_feature    11085..11150
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1138.000, SD 3.06 at aa 20-41, sequence
FT                   ASFSAAAEQLAVSPAYVSKRVA"
FT   misc_feature    11295..11915
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain , score 156.7, E-value 2.5e-44"
FT   CDS_pept        12536..13213
FT                   /transl_table=11
FT                   /locus_tag="BPSS0013"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Methanosarcina acetivorans hypothetical
FT                   protein ma2467 SWALL:Q8TN26 (EMBL:AE010940) (237 aa) fasta
FT                   scores: E(): 2.4e-28, 35.37% id in 229 aa, and to Rhizobium
FT                   loti hypothetical protein mll0909 SWALL:Q98LR8
FT                   (EMBL:AP002996) (244 aa) fasta scores: E(): 9.6e-21, 31.6%
FT                   id in 212 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37456"
FT                   /db_xref="GOA:Q63PD2"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PD2"
FT                   /protein_id="CAH37456.1"
FT                   /translation="MNSLTKRALGAQVRFVAMLAVLIFASAGSLRYWQGWIYWFVFSGA
FT                   TTWLARHFLKHDPALVERRMRVGVRAERELSQKIILGVVSVASAGLIVAMGAEWRVLRM
FT                   PFDWRPVALGNALVIAGFAICFAALRANRFASSIVEVKRDQPVISSGPYRFVRHPMYSG
FT                   AMVIFFGSPIAAQSTWAWPFAAVLAVGVVARLVDEERYLSAHLDGYRAYCERVHWRLVP
FT                   HVW"
FT   misc_feature    order(12572..12625,12638..12697,12758..12826,12869..12937,
FT                   12998..13057,13070..13123)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPSS0013 by TMHMM2.0 at aa 13-30, 35-54, 75-97, 112-134,
FT                   155-174 and 179-196"
FT   CDS_pept        13448..14071
FT                   /transl_table=11
FT                   /locus_tag="BPSS0014"
FT                   /product="putative glutathione S-transferase like protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   hypothetical GST-like protein YliJ or b0838 or c0923
FT                   SWALL:YLIJ_ECOLI (SWALL:P75805) (208 aa) fasta scores: E():
FT                   8.4e-22, 38.38% id in 198 aa, and to Xanthomonas axonopodis
FT                   glutathione S-transferase xac4352 SWALL:AAM39182
FT                   (EMBL:AE012089) (206 aa) fasta scores: E(): 4.8e-42, 57.07%
FT                   id in 198 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37457"
FT                   /db_xref="GOA:Q63PD1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PD1"
FT                   /protein_id="CAH37457.1"
FT                   /translation="MLKLLGKAPSINVRKVLWTCAELKLAYEREDWGAGFRSTQTPEFL
FT                   ALNPNGLVPVLVDGDFVLWESNAIIRYLANRYGGAHLYPVEPHARARVDQWLDWQTTAL
FT                   NRAWSYAFLALVRDAPDHGDTARIRASCESWARHMAILDAQLGTTGAFVTGADYTLADV
FT                   ALGLSINRWLRTPFDKPDFPAVSAYFDRLAARPGFAEHVDNGLP"
FT   misc_feature    13451..13672
FT                   /note="Pfam match to entry PF02798 GST_N, Glutathione
FT                   S-transferase, N-terminal domain , score 66.8, E-value
FT                   3e-17"
FT   misc_feature    13697..14035
FT                   /note="Pfam match to entry PF00043 GST_C, Glutathione
FT                   S-transferase, C-terminal domain , score 26.9, E-value
FT                   3e-05"
FT   CDS_pept        complement(14506..14970)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0015"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37458"
FT                   /db_xref="GOA:Q63PD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PD0"
FT                   /protein_id="CAH37458.1"
FT                   /translation="MPIFVVLFALAALIWGAIHMFEAIAARFGDAVAIGAATVAAVAIA
FT                   AAIARSVRRRRDIAPNAREDGWTHVLQRAWGDLRISATKGLLWLSQDGADGRYTLTDLS
FT                   GCRAETLDGRWYLVVAVRDDRRAEWKLPMDDKRDALRWARVLTLAKRQRL"
FT   misc_feature    complement(order(14812..14880,14908..14967))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPSS0015 by TMHMM2.0 at aa 2-21 and 31-53"
FT   CDS_pept        complement(15050..16222)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0016"
FT                   /product="putative phospholipase"
FT                   /note="Similar to Ralstonia solanacearum putative
FT                   transmembrane protein rsp1060 or rs02397 SWALL:Q8XR08
FT                   (EMBL:AL646082) (377 aa) fasta scores: E(): 2.7e-87, 62.29%
FT                   id in 366 aa, and to Rhizobium loti hypothetical protein
FT                   mlr2398 SWALL:Q98IH7 (EMBL:AP002999) (390 aa) fasta scores:
FT                   E(): 3.1e-65, 49.2% id in 378 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37459"
FT                   /db_xref="GOA:Q63PC9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021095"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PC9"
FT                   /protein_id="CAH37459.1"
FT                   /translation="MPHALEHARTPFHDLPYETIALVLQGGGALGAYQAGVFEGLHEAG
FT                   IPLNWIAGISIGALNTALIAGNPPERRVERLREFWNTICQPAFFPALPAMFEAALFNSH
FT                   EYVRTFFTASQAASAVMQGQRGFFVPRFPPPLPGSTHPPEKVSYYDTSALRATLVKLCD
FT                   FDRINSGETRVSVGAVNVGTGNFIYFDNTKTTLRPEHFMASGALPPAFPPVEIDGEFYW
FT                   DGGIVSNTPLMEVLHASPRRDTLAFQVDLWSARGPLPESMNEVTERTKDVQYSSRTRFV
FT                   TDTLQREQRFRNVLRRVLDQVPESIRESDPWCQQAETLSCSKRYNVQHLIYQQKAYEQH
FT                   YKDYQFGASTMRDHWSAGLADIRKTLAVKNGLALPDNDAGFVTHDIHRMR"
FT   misc_feature    complement(15515..16159)
FT                   /note="Pfam match to entry PF01734 Patatin, Patatin-like
FT                   phospholipase , score 86.3, E-value 4.2e-23"
FT   CDS_pept        complement(16285..17070)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0017"
FT                   /product="putative D-beta-hydroxybutyrate dehydrogenase"
FT                   /note="Similar to Rhizobium meliloti D-beta-hydroxybutyrate
FT                   dehydrogenase BdhA or rb1136 or smb21010 SWALL:BDHA_RHIME
FT                   (SWALL:O86034) (258 aa) fasta scores: E(): 2.1e-28, 40.84%
FT                   id in 262 aa, and to Ralstonia solanacearum probable
FT                   dehydrogenase/reductase oxidoreductase protein rsp1059 or
FT                   rs02396 SWALL:Q8XR09 (EMBL:AL646082) (261 aa) fasta scores:
FT                   E(): 7.1e-76, 83.14% id in 261 aa. Note: Also similar to
FT                   BPSS0354 (268 aa) fasta scores: E(): 1.6e-83, 99.615%
FT                   identity in 260 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37460"
FT                   /db_xref="GOA:Q63PC8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PC8"
FT                   /protein_id="CAH37460.1"
FT                   /translation="MSNLNGKTAIVTGAASGIGKEIALELARAGAAVAIADLNQDGANA
FT                   VAELIEQAGGRAIGVAMDVTNEDAVNAGIDKVAQTFGSVDILVSNAGIQIVNPIENYAF
FT                   ADWKKMQAIHVDGAFLTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGL
FT                   LGLARVLAKEGAKHNVRSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGQTV
FT                   DGVFTTVEDVAKTVLFLSAFPSAALTGQSFVVSHGWFMQ"
FT   misc_feature    complement(16297..17058)
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase , score 237.9, E-value 9.2e-69"
FT   misc_feature    complement(16558..16644)
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   CDS_pept        complement(17117..17857)
FT                   /transl_table=11
FT                   /gene="adc"
FT                   /locus_tag="BPSS0018"
FT                   /product="acetoacetate decarboxylase"
FT                   /EC_number="4.1.1.4"
FT                   /note="Similar to Clostridium acetobutylicum acetoacetate
FT                   decarboxylase Adc or cap0165 SWALL:ADC_CLOAB (SWALL:P23670)
FT                   (244 aa) fasta scores: E(): 9.2e-53, 56.78% id in 236 aa,
FT                   and to Ralstonia solanacearum probable acetoacetate
FT                   decarboxylase rsp1058 or rs02395 SWALL:Q8XR10
FT                   (EMBL:AL646082) (247 aa) fasta scores: E(): 1.9e-79, 79.35%
FT                   id in 247 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37461"
FT                   /db_xref="GOA:Q63PC7"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="InterPro:IPR023653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63PC7"
FT                   /protein_id="CAH37461.1"
FT                   /translation="MKPSQVRSKAFAMPLTSPAFPMGPYRFVNREFLIITYRTDMDRLR
FT                   EIVPEPLEVKEPLVHYEFIRMPDSTGFGDYTESGQVIPVEYKGQPGGYTLAMYLNDHPP
FT                   IAGGRELWGFPKKLAQPTLQTHIDTLLGTLDYGPVRVATGTMGYKHQELDLEEQAKRLA
FT                   GANFLLKIIPHVDGSARVCELVRYYLQDIEMKGAWTGPASLQLAPHALAPVADLPVLEI
FT                   VEARHLLADLTLGLGEVVYDYLAQ"
FT   CDS_pept        18316..18912
FT                   /transl_table=11
FT                   /locus_tag="BPSS0019"
FT                   /product="putative transport-related membrane protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YbjG or b0841 SWALL:YBJG_ECOLI (SWALL:P75806) (198 aa)
FT                   fasta scores: E(): 2.2e-18, 35.71% id in 196 aa, and to
FT                   Ralstonia solanacearum putative transport transmembrane
FT                   protein rsc3142 or rs00461 SWALL:Q8XUP4 (EMBL:AL646073)
FT                   (199 aa) fasta scores: E(): 2.3e-20, 38.29% id in 188 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37462"
FT                   /db_xref="GOA:Q63PC6"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR033879"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PC6"
FT                   /protein_id="CAH37462.1"
FT                   /translation="MQNFNLAVFSALNAGSTPPLGAVRFGVFAADWLVYAVPALLLLTW
FT                   VMGAHPTRRQAIEAGVGACVALALAQVIGHFWYSPRPFVLGIGTQLIPHAPDGSFPSDH
FT                   TTFVCSVAAGLLIARATRTAGAALAVIAAVIGWGRVYVGVHWPLDIVGGALVGTAGALA
FT                   AHLYGRPVTALLDRVGESVHAVAFTRLHERPIRID"
FT   misc_feature    order(18331..18399,18409..18462,18481..18549,18607..18666,
FT                   18685..18738,18751..18819)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPSS0019 by TMHMM2.0 at aa 19-41, 45-62, 69-91, 111-130,
FT                   137-154 and 159-181"
FT   misc_feature    18403..18834
FT                   /note="Pfam match to entry PF01569 PAP2, PAP2 superfamily ,
FT                   score 93.1, E-value 3.6e-25"
FT   CDS_pept        complement(18935..19228)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0020"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37463"
FT                   /db_xref="GOA:Q63PC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PC5"
FT                   /protein_id="CAH37463.1"
FT                   /translation="MSNENETARLRASPPGYASMTRHHTHAGIPRTLKIVGYCGLAAIA
FT                   LALFVAMCAILKDSALDREAARQLQNGNVELHGGADVEPGSTNNAAQARTPG"
FT   misc_feature    complement(19061..19129)
FT                   /note="1 probable transmembrane helix predicted for
FT                   BPSS0020 by TMHMM2.0 at aa 34-56"
FT   CDS_pept        complement(19937..20764)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0021"
FT                   /product="putative iron transport/utilisation related
FT                   protein"
FT                   /note="Similar to Stigmatella aurantiaca iron utilization
FT                   protein MxcB SWALL:Q9F641 (EMBL:AF299336) (270 aa) fasta
FT                   scores: E(): 1.4e-50, 50.18% id in 271 aa, and to Vibrio
FT                   cholerae vibriobactin utilization protein ViuB or vc2210
FT                   SWALL:VIUB_VIBCH (SWALL:Q56646) (271 aa) fasta scores: E():
FT                   5.4e-20, 33.85% id in 257 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37464"
FT                   /db_xref="GOA:Q63PC4"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PC4"
FT                   /protein_id="CAH37464.1"
FT                   /translation="MTQPTTERAVVRVRHTLKFRLLQVKRVVDVTPHLKRVTLAGDELD
FT                   DFESASFDDHVKVFFPPPGEDAPARPEFGPNGIVFPQDRPRPVARDFTPRRYDRAAREL
FT                   DLDFVLHHPGPASQWAAQARVGQTLGIGGPRGSFVIPKDFDWHLLIGDDTALPAVARRL
FT                   EELPAGTRVAVVLEVADPSAQIAFETDANLYVVWRHRGDAASGERGASRLVDALRELPL
FT                   PAGEGYVWAAGEAAAMRGVREHLCRERGVAKSRIRASAYWKHGAIAVHESLED"
FT   CDS_pept        complement(20804..21508)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0022"
FT                   /product="PadR-like family regulatory protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein rsp0258 or rs03708 SWALL:Q8XT57 (EMBL:AL646077)
FT                   (218 aa) fasta scores: E(): 1.8e-24, 46.39% id in 222 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37465"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PC3"
FT                   /protein_id="CAH37465.1"
FT                   /translation="MRHAHRFSRRECGMSDSFGHSPFEMFRQMFGGHRRGGGRHGFGPF
FT                   GGFGGGPGGFGGFGDDAMPRGRQFSADDLQLLLLALLAEQPSHGYELIKALDTRSSGFY
FT                   APSPGMVYPALTYLEELGYVTVQAEGNRKRYALADAGRAHLDAQRERVEMLFAKLAHLG
FT                   RKMEFMRRAFAGEAPAAPEDDTRGWLPEFVEARMALKQALFRRSGANADEQRRIAAILR
FT                   RAVADIEGRAQG"
FT   misc_feature    complement(21047..21277)
FT                   /note="Pfam match to entry PF03551 PadR, Transcriptional
FT                   regulator PadR-like family , score 89.5, E-value 4.3e-24"
FT   CDS_pept        21911..23317
FT                   /transl_table=11
FT                   /locus_tag="BPSS0023"
FT                   /product="putative cytochrome monooxygenase related
FT                   protein"
FT                   /note="Similar to Polyangium cellulosum
FT                   cytochrome-P450-monooxygenase SpiL SWALL:CAD43453
FT                   (EMBL:AJ505006) (456 aa) fasta scores: E(): 1.1e-16, 25.6%
FT                   id in 457 aa, and to Mycobacterium tuberculosis putative
FT                   cytochrome P450 137 Cyp137 or rv3685c or mt3787 or
FT                   mtv025.033C SWALL:C137_MYCTU (SWALL:O69653) (476 aa) fasta
FT                   scores: E(): 1.8e-16, 25.27% id in 451 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37466"
FT                   /db_xref="GOA:Q63PC2"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PC2"
FT                   /protein_id="CAH37466.1"
FT                   /translation="MNGLPLSLPRVDSTDSLFADPLAFLARARAQCGDVFVLREHGPIF
FT                   SRASDCSGVIAVFGEHRLRQVLTETDTFALPMSAAAKMALPKNLVNLNRGLHSMREPEH
FT                   GRHKRLLTGTANRALFDAHRSGMQTDLSRFCEMLNGDGRISVVSRMRELTAKLASRLFL
FT                   GPQCEEDAELTFLLSAYFTLRREASSPNAHDPLQYRDALIGAGRQLDRALRARIRRYRK
FT                   APAGECAGLLQRLATAGQPGSPALSEDEIVGHANVMFVSSTEPVAISLAWLLLVLSQLP
FT                   DLRRALRAESAARASSPASPYDAPLLERVINETLRLLTPNALMVRATTQAVSLQGVALP
FT                   ARCEIVVCPFLVHREANAFARPHAFLPSRWETARPSPYEYFPFGAGGHFCAGRNLALSL
FT                   IGEVLSTLLSRFDFVLDIEQFIDWRIHIMLMPKGDPTLTAHPVDERRDTPSPKWRGPVA
FT                   ELFHFAPGLS"
FT   misc_feature    22019..23224
FT                   /note="Pfam match to entry PF00067 p450, Cytochrome P450 ,
FT                   score 36.8, E-value 8.6e-11"
FT   misc_feature    23057..23086
FT                   /note="PS00086 Cytochrome P450 cysteine heme-iron ligand
FT                   signature."
FT   CDS_pept        23467..23667
FT                   /transl_table=11
FT                   /locus_tag="BPSS0024"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37467"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PC1"
FT                   /protein_id="CAH37467.1"
FT                   /translation="MATKPKKTKGVSVSIEGKLPKMTLDMPVDAKKIKAIQKCLENGKL
FT                   TITMSKVDLAGGRMGEGYLYD"
FT   CDS_pept        23841..24692
FT                   /transl_table=11
FT                   /locus_tag="BPSS0025"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to Pseudomonas aeruginosa
FT                   hypothetical protein pa3283 SWALL:Q9HYW0 (EMBL:AE004750)
FT                   (284 aa) fasta scores: E(): 4.9e-12, 33.33% id in 258 aa,
FT                   and to Rhizobium meliloti hypothetical protein rb0508 or
FT                   smb20529 SWALL:Q92W37 (EMBL:AL603643) (309 aa) fasta
FT                   scores: E(): 5.6e-08, 24.68% id in 239 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37468"
FT                   /db_xref="InterPro:IPR007801"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PC0"
FT                   /protein_id="CAH37468.1"
FT                   /translation="MKAFDRDAGAPRIGLAYGPGMAEFAARHAHLVDYIEVPFELLRFS
FT                   PTIAELQQTIPFVLHCASLSVAGFVPPDDSTVDAIERTAVRTGTPWIGEHLAYISADPI
FT                   GEALGGTHEPTSLSYTLCPQLSDETVRRVADNLAVLAPRFPVPLIVENSPQYFSIPGST
FT                   MGMTDFIRAIADRCDVGLLLDLSHFLITAYNTGADVHREFARLPLERVVEVHLSGMSIQ
FT                   SGAAWDDHSLPASPILFELLERLLAVARPRALTFEYNWSPYFPLSVLTSHIERARALMG
FT                   LA"
FT   CDS_pept        24689..25522
FT                   /transl_table=11
FT                   /locus_tag="BPSS0026"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37469"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PB9"
FT                   /protein_id="CAH37469.1"
FT                   /translation="MNARTIHALIAASTKDPQLIERWRRHPDLLRGAGIAPGDLDWRAL
FT                   EHFVGLSLKVRHNGLRGDFPLSFRLLSVVGLEIEVFAAYASDCAESGHVFAATPQERAR
FT                   DLIAFLDRWLDPAQRNHVLLWDILRHEHALACLRQAGDAPLADARPAARHRARATAGGI
FT                   PTLNGSVVQHVMRCNPDDLAAALHQKEPPLDAVPAVDTYCCYWRSAETGEIRLLRVDTL
FT                   GYFAIEAIDGRRSAADICHRLLGNRRLLPQFLSSLDQLAGIGIVRFARPLGCAAA"
FT   CDS_pept        25519..27462
FT                   /transl_table=11
FT                   /locus_tag="BPSS0027"
FT                   /product="hypothetical protein"
FT                   /note="N-terminus is similar to the N-terminal region of
FT                   Pyrococcus horikoshii hypothetical methyltransferase ph0819
FT                   SWALL:Y819_PYRHO (SWALL:O58549) (459 aa) fasta scores: E():
FT                   3.2e-28, 30.07% id in 399 aa, and to the full length
FT                   Methanopyrus kandleri predicted Fe-S oxidoreductase mk0992
FT                   SWALL:Q8TWP0 (EMBL:AE010388) (483 aa) fasta scores: E():
FT                   2.5e-25, 26.53% id in 505 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37470"
FT                   /db_xref="GOA:Q63PB8"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PB8"
FT                   /protein_id="CAH37470.1"
FT                   /translation="MKLLLVDNLVMPEEGSLAYLDVHPHLGLLALAAVAEADGHRVRIY
FT                   DPKRLIRDGTLAYDATLYERASRAILAERPDAVGFTALGCSFLFALNVAALLKRREPDL
FT                   PVLLGGPHATMLHRQILERFPQFDIIVRYEADEILPAVLDCLEQRTFDVIPGLSWRATG
FT                   HGAPLRFTDGKPKVEELDRLPIASYDHYPVDDLGLSMLRIEAGRGCPFACTFCSTAGFF
FT                   QRSFRLKSAERLVHELDILHRRYRVSDFKLDHDMFTVNRHKVMAFCEAVAGRGYRWRAS
FT                   ARIDCVDEALLRKMADAGCVNLYFGVETGSERMQTICRKRLDLRLVEPILAAADSFGIE
FT                   TTASFITGYPQECGQDQDDTLDMIGRCARRPSCLTQLHMLAPEPGTPLFDEHGAQIAYD
FT                   GYGGPYNTRLLGPGDEREVLDHPDIFQTYYYYPAALPRARHIFAVEAVDVLRRAGPIIL
FT                   AYALREFGGRLSRLISAWRRFADETSPGALPDAAGLEAFVAARFGRGHHLHSLFRYALR
FT                   LSAARAPADVVAEGPYEPDRPCMLAENVGLLEDIHNCEALVDRLRRSNDGAPALGDADV
FT                   GGLGAYIVRADGEAVTGYWVESGIAAILDLFRAPRSCRAAAQWLAHVTRNDGVDASIFE
FT                   PLLRRGILVPAR"
FT   CDS_pept        27476..28465
FT                   /transl_table=11
FT                   /locus_tag="BPSS0028"
FT                   /product="hypothetical protein"
FT                   /note="Low similarity to Streptomyces lincolnensis LmbW
FT                   protein SWALL:Q54376 (EMBL:X79146) (318 aa) fasta scores:
FT                   E(): 7.2e-08, 25.91% id in 328 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PB7"
FT                   /protein_id="CAH37471.1"
FT                   /translation="MARRKLERWSALDLAEGLQLAHAVAALQTLGVVDAMAEPTTAQTL
FT                   SAACDLDPELLRGVLEYAASRTNLIRKTGDRFAASEHYTAQARFLLNLYAGAYADNASR
FT                   LATLLRRPALAGTTVDLVAHARAFEASEAGSGALAAIISQLHLNHVLDLGCGAGTLLHA
FT                   LAADDREFVGWGLDRNPSMCKAARMRARQAGIAARVKVFQGDGRHPGASIPPRVLARVR
FT                   NVVASQFVNEMFRGGTSRAQAWLRRMRRLLPDRLLVIADYYGRLGHGFQTPHRETLLHD
FT                   YAQLISGQGVPPPNADAWLAMYRATGCRPLHVIEDRAATTRFVHLVAL"
FT   CDS_pept        complement(28637..29257)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0029"
FT                   /product="putative transport-related membrane protein"
FT                   /note="Similar to Brucella melitensis transporter, LysE
FT                   family bmei1274 SWALL:Q8YG87 (EMBL:AE009566) (204 aa) fasta
FT                   scores: E(): 1.5e-30, 49.74% id in 197 aa, and to Ralstonia
FT                   solanacearum probable transmembrane protein rsc0385 or
FT                   rs03353 SWALL:Q8Y2F1 (EMBL:AL646059) (212 aa) fasta scores:
FT                   E(): 7.8e-28, 47.71% id in 197 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37472"
FT                   /db_xref="GOA:Q63PB6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PB6"
FT                   /protein_id="CAH37472.1"
FT                   /translation="MNWIAFSHGAMLCASLIVTIGAQNAFILRQGIMRSHVGKIVLLCT
FT                   LSDMLLIGAGVGGASVLVERYPAFVHAVLYVGLAYLAWFGLSALRRAFKPGHETLDATG
FT                   AVAAPPAQRAWPIVLMTLAFTWLNPHVYLDTFLLIGTAGAREPEGARSAFAIGAMAVSA
FT                   VWFVALGYGARLLAPWFKRALAWRVLDGAIGGMVLFLAAVQLR"
FT   misc_feature    complement(order(28643..28711,28730..28798,28826..28894,
FT                   28991..29059,29072..29140,29177..29245))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPSS0029 by TMHMM2.0 at aa 5-27, 40-62, 67-89, 122-144,
FT                   154-176 and 183-205"
FT   misc_feature    complement(28718..29059)
FT                   /note="Pfam match to entry PF01810 LysE, LysE type
FT                   translocator , score 84.9, E-value 1.1e-22"
FT   CDS_pept        29365..30258
FT                   /transl_table=11
FT                   /locus_tag="BPSS0030"
FT                   /product="putative chromosome initiation inhibitor"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 chromosome initiation
FT                   inhibitor IciA or b2916 or c3497 or z4253 or ecs3786
FT                   SWALL:ICIA_ECOLI (SWALL:P24194) (297 aa) fasta scores: E():
FT                   3.5e-27, 37.59% id in 274 aa, and to Agrobacterium
FT                   tumefaciens transcriptional regulator, LysR family atu0928
FT                   or agr_c_1691 SWALL:Q8UGV7 (EMBL:AE009057) (319 aa) fasta
FT                   scores: E(): 9.2e-54, 49.48% id in 293 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37473"
FT                   /db_xref="GOA:Q63PB5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PB5"
FT                   /protein_id="CAH37473.1"
FT                   /translation="MLDYALLDALAEVIRHGSFERAAKALNVSPSAVSQRVKLLEERVG
FT                   SVLVKRGQPCVATTSGALLCRHTERVRMLEAELSGHMPAFAGAQAGAWPTLRVAVNDDS
FT                   VATWFVDAVGPFCAQSGTLLDLVIDDQDYTAERIRDGSVQGAVTALAEPIQGCRSTRLG
FT                   RMRYHAVCSPAFHARYFGNGVNRDALRRAPCVMFNPKDSLQARFIRRVTRVDLDPPQHW
FT                   IPHVAGYLRACEAGLGWGMCPERMVERQIAEGGLIDLSDGRSIDIELYWQSWRLSIGWL
FT                   DEFSAALKASAAQYLD"
FT   misc_feature    29374..29550
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family , score
FT                   66.2, E-value 4.5e-17"
FT   misc_feature    29413..29478
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2067.000, SD 6.23 at aa 17-38, sequence
FT                   GSFERAAKALNVSPSAVSQRVK"
FT   misc_feature    29416..29508
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    29506..29541
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT   misc_feature    29620..30243
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain , score 53.1, E-value 4e-13"
FT   CDS_pept        complement(30314..31069)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0031"
FT                   /product="putative anaerobic growth regulatory protein"
FT                   /note="Similar to Neisseria meningitidis putative anaerobic
FT                   transcriptional regulatory protein nma2107 or nmb0380
FT                   SWALL:Q9JQQ8 (EMBL:AL162758) (244 aa) fasta scores: E():
FT                   3.8e-40, 45.1% id in 235 aa, and to Escherichia coli,
FT                   Escherichia coli O6, and Escherichia coli O157:H7 fumarate
FT                   and nitrate reduction regulatory protein Fnr or NirR or
FT                   b1334 or c1807 or z2433 or ecs1915 SWALL:FNR_ECOLI
FT                   (SWALL:P03019) (250 aa) fasta scores: E(): 1.9e-35, 42.47%
FT                   id in 226 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37474"
FT                   /db_xref="GOA:Q63PB4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PB4"
FT                   /protein_id="CAH37474.1"
FT                   /translation="MLTPVARPAAAAAPVHASSTWAPRQAAHCSTCAMRHLCMPQGLAP
FT                   EALARLESVICTARPVRRGETLFREGDTFDNLYAVRSGSLKTIATRHDGREQVTGLHLA
FT                   GEALGLDGICDDAHPRTAVALEDSSVCVIPYSALKTLCSEAGTMQLRMHKLMSEQIVRE
FT                   TSQTMVLGSLNAEERVAAFLLDVSSRYMKRGYSPNEFNLRMTREDIGSYLGMTLETVSR
FT                   TLSKFHKRGLIEMQGRMVRIVDFDGLHRL"
FT   misc_feature    complement(30371..30466)
FT                   /note="Pfam match to entry PF00325 crp, Bacterial
FT                   regulatory proteins, crp family , score 56.8, E-value
FT                   3e-14"
FT   misc_feature    complement(30389..30460)
FT                   /note="PS00042 Bacterial regulatory proteins, crp family
FT                   signature."
FT   misc_feature    complement(30395..30460)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1625.000, SD 4.72 at aa 204-225, sequence
FT                   MTREDIGSYLGMTLETVSRTLS"
FT   misc_feature    complement(30629..30907)
FT                   /note="Pfam match to entry PF00027 cNMP_binding, Cyclic
FT                   nucleotide-binding domain , score 72.4, E-value 6.2e-19"
FT   CDS_pept        complement(31219..31686)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0032"
FT                   /product="universal stress-related protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein rsc0179 or rs00610 SWALL:Q8Y302 (EMBL:AL646057)
FT                   (151 aa) fasta scores: E(): 6.2e-16, 40.69% id in 145 aa,
FT                   and to Methanosarcina acetivorans universal stress protein
FT                   ma3284 SWALL:Q8TKW0 (EMBL:AE011032) (152 aa) fasta scores:
FT                   E(): 7.3e-11, 37.16% id in 148 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37475"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PB3"
FT                   /protein_id="CAH37475.1"
FT                   /translation="MYQRILVAVDGSETARHAFDAALDIARTSGAELQPFYVVENAAIY
FT                   YNVPGYDPSILRTQLLQQGNELAKEFAEKMQAAGVKGALKIGEATSLADVPSLIVEGAK
FT                   AFGADLLVLGTHGRRGFKRLVLGSVAEQCVRHSALPVLLIPAAAHPEDRES"
FT   misc_feature    complement(31252..31686)
FT                   /note="Pfam match to entry PF00582 Usp, Universal stress
FT                   protein family , score 78.3, E-value 1.1e-20"
FT   CDS_pept        32074..32340
FT                   /transl_table=11
FT                   /locus_tag="BPSS0033"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37476"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PB2"
FT                   /protein_id="CAH37476.1"
FT                   /translation="MADSFNRRRRRHMSYVALEVLTEDANRYSLPELIGVGGVSPDVPH
FT                   ICEMLLADAQWPTIQAYLDRQELPYKFARPSTGRRVGRNNPCW"
FT   CDS_pept        33115..34695
FT                   /transl_table=11
FT                   /locus_tag="BPSS0034"
FT                   /product="putative fatty aldehyde dehydrogenase"
FT                   /note="Similar to Xanthomonas campestris ketoglutarate
FT                   semialdehyde dehydrogenase xcc3244 SWALL:AAM42514
FT                   (EMBL:AE012441) (526 aa) fasta scores: E(): 4e-114, 62.14%
FT                   id in 523 aa, and to Vibrio harveyi fatty aldehyde
FT                   dehydrogenase AldH SWALL:DHAF_VIBHA (SWALL:Q56694) (510 aa)
FT                   fasta scores: E(): 6.1e-82, 48.58% id in 494 aa. Note: Also
FT                   similar to BPSS0329 (531 aa) fasta scores: E(): 7.2e-91,
FT                   60.803% identity in 523 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37477"
FT                   /db_xref="GOA:Q63PB1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PB1"
FT                   /protein_id="CAH37477.1"
FT                   /translation="MQITGEMLIGAAAVRGSEGTMRAYAPAQGVELEPTFGAGGAADVD
FT                   RACRLANAAFDPFRQAPLETRARFLEAIAERIVGLGDPLIERAHAESALPVARLEGERA
FT                   RTVGQLRLFAAIVRDGRWLSATLDSAQPERKPLPRADLRLQKIPVGPVAVFGASNFPLA
FT                   FSVAGGDTASAFAAGCPVVAKAHPAHLGTSELVGRAIRQAVADCGLHEGVFSLVVGAGN
FT                   AIGEALVAHPAIRAVGFTGSRAGGLALMGVAARRREPIPVFAEMSSINPFFVLPGALRA
FT                   RGAQIAQGFVESLTLGVGQFCTNPGLVVALEGPDLKAFVDAAAQALSQKGAQTMLTSGI
FT                   ASSYESAVAARRAAAGVSEVARGARSDARNAALPALFTTTHTQFVQNPQLEAEIFGPTS
FT                   LVVACRDIDEMIALAEHVEGQLSATLHLEDDDVDLARKLLPTLERRAGRIVANGYPTGV
FT                   EVAYAMVHGGPFPATSDPRSTSVGALAIERFLRPVCYQDLPAALLPEALADANPLGLWR
FT                   LRDGQLGKA"
FT   misc_feature    33181..34605
FT                   /note="Pfam match to entry PF00171 aldedh, Aldehyde
FT                   dehydrogenase family , score -92.4, E-value 1.1e-11"
FT   CDS_pept        34692..35642
FT                   /transl_table=11
FT                   /locus_tag="BPSS0035"
FT                   /product="putative gluconolactonase"
FT                   /note="Similar to Zymomonas mobilis gluconolactonase
FT                   precursor Gnl SWALL:GNL_ZYMMO (SWALL:Q01578) (320 aa) fasta
FT                   scores: E(): 1.4e-14, 33.45% id in 278 aa, and to Ralstonia
FT                   solanacearum putative gluconolactonase precursor rsp0824 or
FT                   rs05371 SWALL:Q8XRK7 (EMBL:AL646081) (353 aa) fasta scores:
FT                   E(): 2.8e-69, 59.2% id in 326 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37478"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PB0"
FT                   /protein_id="CAH37478.1"
FT                   /translation="MSAMSEIGSRRYPDPAVRVLDPRFGALRLPSASVECLFQGARWSE
FT                   GPVWFGDGRYLLWSDIPNNRMLRWDEQSGTVGVFRQPSNNANGNTRDRAGRLVTCEHLT
FT                   RRVTRTEYDGSITVLAERFAGKRFNSPNDVIVKSDGSIWFSDPDFGIQSFYEGEKQASE
FT                   MPERVYRIDPQTGAVDIVVDGVLGPNGLAFSPDEAMLYVVESKGRPRTIRAYDVAADGR
FT                   TLRNERVLIDAAQGTPDGFRIDVNGNLWCGWGMGTDELDGVRVFTPEGDAIGHIALPER
FT                   CANVCFGGRHRNRLFMAASHGLYSLYVNTQGVPGG"
FT   misc_feature    34791..35639
FT                   /note="Pfam match to entry PF03758 SMP-30, Senescence
FT                   marker protein-30 (SMP-30) , score -6.2, E-value 2.2e-11"
FT   CDS_pept        complement(36388..36804)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0036"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37479"
FT                   /db_xref="InterPro:IPR021551"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PA9"
FT                   /protein_id="CAH37479.1"
FT                   /translation="MTAMNPFERKTSAAGGRARPRSIELYNDATHDSTVDTDGKNREAA
FT                   RIASGGPISPDQMTTSNASLVNAMPETPDGFAGFDSRPGGNRPQFALRAGYAVVDKGFD
FT                   AAALRDAQMADAFSPPYRPPRRPGRIVELAPVAR"
FT   CDS_pept        37059..37307
FT                   /transl_table=11
FT                   /locus_tag="BPSS0037"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37480"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PA8"
FT                   /protein_id="CAH37480.1"
FT                   /translation="MGGLMHSTTTAFTHRGYLLNCAPARASDGSFQPYVVISRSSDGEL
FT                   VANRFFPSDLHFNDEDSAIAHARDWAVRWIDASSLTI"
FT   CDS_pept        37431..38354
FT                   /transl_table=11
FT                   /locus_tag="BPSS0038"
FT                   /product="putative serine acetyltransferase"
FT                   /note="Similar to the plasmid borne Synechococcus sp.
FT                   serine acetyltransferase, plasmid SrpH SWALL:SRPH_SYNP7
FT                   (SWALL:Q59967) (319 aa) fasta scores: E(): 1.3e-62, 59.19%
FT                   id in 299 aa, and to Pseudomonas putida serine
FT                   O-acetyltransferase, putative pp0228 SWALL:AAN65860
FT                   (EMBL:AE016774) (174 aa) fasta scores: E(): 9.3e-46, 74.26%
FT                   id in 171 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37481"
FT                   /db_xref="GOA:Q63PA7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PA7"
FT                   /protein_id="CAH37481.1"
FT                   /translation="MSKSARNWGLEQIVAELRESREKLHRTRHPRGIRELPSRDAVCTI
FT                   VSGLRASMFPTHYGAPDLTDETVDYYVGHTLESTLRLLAEQIRRALRFLPEHAQTPLAV
FT                   LEERAFEIAREFGTQLPRIRALLVSDIQAAYTGDPAAQHITEILLCYPGVLAMMHHRLA
FT                   HALYRLGVPLLARFINEIAHSATGIDIHPGAQIGPSFFIDHGTGVVIGETAIIGERVRV
FT                   YQAVTLGAKSFPADGDGMLVKGNARHPIVEDDVVIYAGATILGRVTIGKGSVIGGNVWL
FT                   THSVPPGSSVAQGKIRESDKDQAEKD"
FT   misc_feature    37998..38024
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats) , score 2.1, E-value
FT                   9.2"
FT   misc_feature    38049..38102
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats) , score 14.0,
FT                   E-value 0.24"
FT   misc_feature    38172..38225
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats) , score 9.0, E-value
FT                   3.4"
FT   misc_feature    38226..38279
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats) , score 10.2,
FT                   E-value 2.4"
FT   CDS_pept        complement(38606..39409)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0039"
FT                   /product="putative dehydrogenase"
FT                   /note="Similar to Synechocystis sp. 3-oxoacyl-[acyl-carrier
FT                   protein] reductase 1 slr0886 SWALL:FAG1_SYNY3
FT                   (SWALL:P73574) (247 aa) fasta scores: E(): 2.5e-17, 37.55%
FT                   id in 245 aa, and to Ralstonia solanacearum putative
FT                   oxidoreductase protein rsc0156 or rs01026 SWALL:Q8Y325
FT                   (EMBL:AL646057) (267 aa) fasta scores: E(): 5.9e-28, 41.66%
FT                   id in 264 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37482"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PA6"
FT                   /protein_id="CAH37482.1"
FT                   /translation="MQSSAKPATLPVVLVTGAARRAGRAFALRFAARGYRVAVHYDRSA
FT                   DAAQAVVREIESSGGEAVALQADLAHADAITQLVDAVYTRFGRLDVLVNNASVFWQDHL
FT                   PSFDLAAFDNAWAINCRAPILLTRAYYERAKAALAQGVVINVVDQKIKENFHRDHFSYT
FT                   VAKAALGNLTQMLALSASPVLRVNAVFPGLMLPSDDQTPADFEHASRASTPLARIAGPN
FT                   DVADAILLLTGPAYNGADFVVDAGQNLIRVDQDVLYKHRSPDGKQ"
FT   misc_feature    complement(38669..39385)
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase , score 77.6, E-value 1.7e-20"
FT   CDS_pept        complement(39410..39964)
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /gene_synonym="mtrA"
FT                   /locus_tag="BPSS0040"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="Similar to Bacillus subtilis GTP cyclohydrolase I
FT                   FolE or MtrA SWALL:GCH1_BACSU (SWALL:P19465) (190 aa) fasta
FT                   scores: E(): 1.6e-29, 47.64% id in 170 aa, and to
FT                   Xanthomonas campestris GTP cyclohydrolase I xcc4166
FT                   SWALL:GCH1_XANCP (SWALL:Q8P3B0) (200 aa) fasta scores: E():
FT                   5.6e-45, 65.69% id in 172 aa. Note: This CDS has a possible
FT                   alternative start codon 156 residues upstream"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37483"
FT                   /db_xref="GOA:Q63PA5"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PA5"
FT                   /protein_id="CAH37483.1"
FT                   /translation="MLLRWAGDDPQREGLVDTPARVVRAYEEFFAGYALEPRDILARTF
FT                   SEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKLARLVDAFAKRL
FT                   QIQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGIHKPGVEMVTSRMLGTFRTDP
FT                   ATRREFLSIVANPSSVNLTNT"
FT   misc_feature    complement(39461..39808)
FT                   /note="Pfam match to entry PF01227 GTP_cyclohydroI, GTP
FT                   cyclohydrolase I , score 166.5, E-value 2.9e-47"
FT   misc_feature    complement(39758..39808)
FT                   /note="PS00859 GTP cyclohydrolase I signature 1."
FT   CDS_pept        complement(40276..41202)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0041"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="Similar to the plasmid borne Pseudomonas putida
FT                   transcriptional activator protein NahR SWALL:NAHR_PSEPU
FT                   (SWALL:P10183) (300 aa) fasta scores: E(): 4.8e-43, 42.28%
FT                   id in 298 aa, and to Rhizobium tropici nodulation protein
FT                   D1 NodD1 SWALL:NOD1_RHITR (SWALL:Q02876) (308 aa) fasta
FT                   scores: E(): 1.3e-26, 35.01% id in 297 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37484"
FT                   /db_xref="GOA:Q63PA4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PA4"
FT                   /protein_id="CAH37484.1"
FT                   /translation="MMPDLDLNLIPYLVALNEARNVSRAGELLGVSQPRVSAALGRLRE
FT                   HFGDPLFVRTSRGMEPTPRALALIPAARDALASIERGLGAPHEFDPAKSARTFSIALSD
FT                   VGEIVFLPRLLQAFAQHAPHANLRSASLSHAEVAHALEDGGVDLAVGYFPDLGGTNFFQ
FT                   QRLFTHRFICLLRRGHPLAERPLTLERFLACGHAVVRAEGRSQEVLEQYLTKRRLTRRA
FT                   VLETPHFMSLPFILSRTDLIATVPHAIGYAYAAEHASITLVEPPLPLPRFDLKQHWHRK
FT                   FHNDPSITWLRGVVAQLFNDALDEWPK"
FT   misc_feature    complement(40303..40932)
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain , score 86.4, E-value 3.9e-23"
FT   misc_feature    complement(41005..41184)
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family , score
FT                   75.1, E-value 9.5e-20"
FT   misc_feature    complement(41080..41145)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1352.000, SD 3.79 at aa 20-41, sequence
FT                   RNVSRAGELLGVSQPRVSAALG"
FT   CDS_pept        41316..42539
FT                   /transl_table=11
FT                   /gene="pobA"
FT                   /locus_tag="BPSS0042"
FT                   /product="p-hydroxybenzoate hydroxylase"
FT                   /EC_number="1.14.13.2"
FT                   /note="Similar to Pseudomonas aeruginosa p-hydroxybenzoate
FT                   hydroxylase PobA or pa0247 SWALL:PHHY_PSEAE (SWALL:P20586)
FT                   (394 aa) fasta scores: E(): 1.7e-84, 55.21% id in 393 aa,
FT                   and to Ralstonia solanacearum probable 4-hydroxybenzoate
FT                   3-monooxygenase oxidoreductase protein rsc2242 or rs01317
FT                   SWALL:Q8XX74 (EMBL:AL646069) (410 aa) fasta scores: E():
FT                   2e-111, 69% id in 400 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37485"
FT                   /db_xref="GOA:Q63PA3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PA3"
FT                   /protein_id="CAH37485.1"
FT                   /translation="MRTQVAIIGAGPSGLLLSHLLRLQGVDSVVLETRSREYCENRIRA
FT                   GVLEQGTVDTLNDAGLGARMRREGLVHCGIELLFDGRRHRIDFGELTPGRAITVYSQHE
FT                   VVRDLIEAALEHGQPIHFDVRDVALHDVATERPSVTFMHADGRPDRIDCDYVAGCDGFH
FT                   GVARQAIPAERRRTFERVYPYAWLGILADAAPSLDELVYAHHARGFALFSMRSPTVTRL
FT                   YLQCRPDENLAEWPDARIWEELGTRFENDGGWTPTPGRITQKSVTPMRSFVSETMQHGR
FT                   LFLAGDAAHIVPPTGAKGMNLAVADVRALSRALVARYRHGRGDLLDAYSSTCLERIWRA
FT                   EHFSYSMTNMLHPCADDSPFVNRLKLAELRYVTRSRAAAQSLAENYVGLPFDETAGDAP
FT                   SFGEAAAA"
FT   misc_feature    41328..41732
FT                   /note="Pfam match to entry PF01494 FAD_binding_3, FAD
FT                   binding domain , score 117.0, E-value 2.3e-32"
FT   misc_feature    41769..42350
FT                   /note="Pfam match to entry PF01360 Monooxygenase,
FT                   Monooxygenase , score 158.2, E-value 9e-45"
FT   CDS_pept        42747..43460
FT                   /transl_table=11
FT                   /gene="pcaI"
FT                   /locus_tag="BPSS0043"
FT                   /product="3-oxoadipate CoA-transferase subunit A"
FT                   /EC_number="2.8.3.6"
FT                   /note="Similar to Pseudomonas putida 3-oxoadipate
FT                   CoA-transferase subunit A PcaI SWALL:PCAI_PSEPU
FT                   (SWALL:Q01103) (231 aa) fasta scores: E(): 3.5e-63, 75.33%
FT                   id in 223 aa, and to Ralstonia solanacearum probable
FT                   3-oxoadipate coa-transferase subunit A protein rsc2254 or
FT                   rs01305 SWALL:Q8XX62 (EMBL:AL646069) (229 aa) fasta scores:
FT                   E(): 2.6e-67, 80.34% id in 229 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37486"
FT                   /db_xref="GOA:Q63PA2"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PA2"
FT                   /protein_id="CAH37486.1"
FT                   /translation="MVNKIFDSLQSAVADVHDGATIMIGGFGTAGMPAELIDALIAQGA
FT                   RDLTIVNNNAGNGETGLAALLKARRVRKIICSFPRQADSQVFDALYRAGEIELELVPQG
FT                   NLAERIRAAGAGIGGFFSPTGYGTKLAEGKETRVIDGKHYVFETPIHADFALVKAYRGD
FT                   RWGNLVYRKTARNFGPVMAMAAKTSIVQVSQVVPLGALNPEHIVTPGIFVQRIVEVPQA
FT                   AHAAELAAERAASAA"
FT   misc_feature    42759..43415
FT                   /note="Pfam match to entry PF01144 CoA_trans, Coenzyme A
FT                   transferase , score 366.6, E-value 1.7e-107"
FT   misc_feature    42798..42845
FT                   /note="PS01273 CoA transferases signature 1."
FT   CDS_pept        43479..44135
FT                   /transl_table=11
FT                   /gene="pcaJ"
FT                   /locus_tag="BPSS0044"
FT                   /product="3-oxoadipate CoA-transferase subunit B"
FT                   /EC_number="2.8.3.6"
FT                   /note="Similar to Pseudomonas putida 3-oxoadipate
FT                   CoA-transferase subunit B PcaJ SWALL:PCAJ_PSEPU
FT                   (SWALL:Q01104) (212 aa) fasta scores: E(): 9.6e-62, 76.55%
FT                   id in 209 aa, and to Ralstonia solanacearum probable
FT                   3-oxoadipate coa-transferase subunit B protein rsc2253 or
FT                   rs01306 SWALL:Q8XX63 (EMBL:AL646069) (220 aa) fasta scores:
FT                   E(): 2.7e-62, 77.98% id in 209 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37487"
FT                   /db_xref="GOA:Q63PA1"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PA1"
FT                   /protein_id="CAH37487.1"
FT                   /translation="MKRLTRDDMAKRVAQDIPEGAYVNLGIGVPTLVANHLDPSREIFL
FT                   HSENGLLGMGPAPAPGAEDDELINAGKQHVTLLTGGAYFHHADSFAMMRGGHLDYCVLG
FT                   AFQVSAHGDLANWHTGAPDAIPAVGGAMDLAIGAKHVFVMMEHLTKQGESKIVAECSYP
FT                   VTGVRCVDRIYTDLAVLDVISDGLAVREICAGLSFDELQQLTGVPLIDATQKAAA"
FT   misc_feature    43491..44093
FT                   /note="Pfam match to entry PF01144 CoA_trans, Coenzyme A
FT                   transferase , score 222.5, E-value 4e-64"
FT   misc_feature    43611..43637
FT                   /note="PS01274 CoA transferases signature 2."
FT   CDS_pept        44232..45629
FT                   /transl_table=11
FT                   /gene="pcaB"
FT                   /locus_tag="BPSS0045"
FT                   /product="3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /EC_number="5.5.1.2"
FT                   /note="Similar to Bradyrhizobium japonicum
FT                   3-carboxy-cis,cis-muconate cycloisomerase PcaB
FT                   SWALL:PCAB_BRAJA (SWALL:O31385) (451 aa) fasta scores: E():
FT                   4.4e-79, 55.95% id in 420 aa, and to Pseudomonas putida
FT                   3-carboxy-cis,cis-muconate cycloisomerase PcaB
FT                   SWALL:PCAB_PSEPU (SWALL:P32427) (407 aa) fasta scores: E():
FT                   2.5e-63, 53.82% id in 366 aa. Note: This CDS is longer in
FT                   its N-terminal region than most of its database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37488"
FT                   /db_xref="GOA:Q63PA0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR012789"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q63PA0"
FT                   /protein_id="CAH37488.1"
FT                   /translation="MDNKRNSSFSIDPMLEDSARLTALVCGSEPLNRIWSPHATLQRML
FT                   DVEAALARALAANGVIPANAVRPIEAACAASELDAQALMRDAALGGNIAIPLVRQLTAR
FT                   VKVRDAEAAKYVHWGATSQDIIDTAAVLQLRDTLDWLDPLLRDTCTALATLAAAHRTTP
FT                   MIGRTWLQQALPITLGLKFAQWLDALLRHRERIVALRERALALQFGGAAGTLASLRDAA
FT                   PAVARSLADDLRLALPAVPWHTQRDRIAETAACFGMLIGTLGKIARDISLSMQTEIGEL
FT                   AEPAAAGKGGSSTMPHKRNPVGCAAVLTAAVRAPGLVSTVLAGMVQEHERALGGWQAEW
FT                   DALPELARLAGGALAQVAQIVEGLNVDVARLADNLDATRGLVLGEAVMLALGDRIGRLD
FT                   AHHLVERASKQAVRSGRPLYDVLAADPDVAAHLTPQALRQLLDPAHYVGEAHAYVDAVL
FT                   ALHASRH"
FT   misc_feature    44301..45524
FT                   /note="Pfam match to entry PF00206 lyase_1, Lyase , score
FT                   182.0, E-value 6.1e-52"
FT   misc_feature    45102..45131
FT                   /note="PS00163 Fumarate lyases signature."
FT   CDS_pept        45642..46427
FT                   /transl_table=11
FT                   /locus_tag="BPSS0046"
FT                   /product="putative lactone hydrolase"
FT                   /note="Similar to Alcaligenes eutrophus 3-oxoadipate
FT                   enol-lactone hydrolase CatD1 SWALL:Q9EV40 (EMBL:AF042281)
FT                   (260 aa) fasta scores: E(): 3.8e-44, 47.69% id in 260 aa,
FT                   and to Ralstonia solanacearum probable b-ketoadipate
FT                   enol-lactone hydrolase transmembrane protein rsc2250 or
FT                   rs01309 SWALL:Q8XX66 (EMBL:AL646069) (270 aa) fasta scores:
FT                   E(): 5.3e-44, 45% id in 260 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37489"
FT                   /db_xref="GOA:Q63P99"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P99"
FT                   /protein_id="CAH37489.1"
FT                   /translation="MPFASVDGVRLHYRIDRAARADAPWLVFSNSLGADLSMWAPQIGP
FT                   MTAHFNLLRYDTRGHGHSDAPAGSYTIEQLAGDVIGLLDHVGVARAHFCGISMGGLTGA
FT                   ALAARHAKRVDRVVLSNTSAKIGSPEIWAPRARKARAEGMAALADAVLPRWFTAAFFER
FT                   EPRLIDVIRDTFNHTDKDGYAANCDALNAADLRDEAKGIAVPTLVVTGAHDLSTPPEQG
FT                   RALAASIAGAKHVEFDCAHISNIECADGFNRTLIDFLTA"
FT   misc_feature    45789..46418
FT                   /note="Pfam match to entry PF00561 abhydrolase, alpha/beta
FT                   hydrolase fold , score 104.6, E-value 1.3e-28"
FT   CDS_pept        46443..46829
FT                   /transl_table=11
FT                   /gene="pcaC"
FT                   /locus_tag="BPSS0047"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /EC_number="4.1.1.44"
FT                   /note="Similar to Acinetobacter calcoaceticus
FT                   4-carboxymuconolactone decarboxylase PcaC SWALL:DC4C_ACICA
FT                   (SWALL:P20370) (134 aa) fasta scores: E(): 8.8e-29, 57.02%
FT                   id in 121 aa, and to Ralstonia solanacearum putative
FT                   4-carboxymuconolactone decarboxylase protein rsc2249 or
FT                   rs01310 SWALL:Q8XX67 (EMBL:AL646069) (131 aa) fasta scores:
FT                   E(): 9e-38, 76.98% id in 126 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37490"
FT                   /db_xref="GOA:Q63P98"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR012788"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P98"
FT                   /protein_id="CAH37490.1"
FT                   /translation="MNDDQRYEAGMNVRRAVLGDAHVDRSLANRTDLTDEFQNLITRYA
FT                   WGEIWTRDGLPRHTRSLLTIAMMVALNRGEELALHLRAAKNNGVTRDEIKEVLLQTAIY
FT                   CGVPAANSAFHLAQRIFGEEDSAS"
FT   misc_feature    46509..46799
FT                   /note="Pfam match to entry PF02627 CMD,
FT                   Carboxymuconolactone decarboxylase , score 130.4, E-value
FT                   2.2e-36"
FT   CDS_pept        47008..48363
FT                   /transl_table=11
FT                   /gene="pcaK"
FT                   /locus_tag="BPSS0048"
FT                   /product="4-hydroxybenzoate transporter"
FT                   /note="Similar to Pseudomonas putida 4-hydroxybenzoate
FT                   transporter PcaK SWALL:PCAK_PSEPU (SWALL:Q51955) (448 aa)
FT                   fasta scores: E(): 1.3e-87, 52.08% id in 432 aa, and to
FT                   Acinetobacter calcoaceticus 4-hydroxybenzoate transporter
FT                   PcaK SWALL:PCAK_ACICA (SWALL:Q43975) (457 aa) fasta scores:
FT                   E(): 8.2e-79, 49.32% id in 442 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37491"
FT                   /db_xref="GOA:Q63P97"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR004746"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P97"
FT                   /protein_id="CAH37491.1"
FT                   /translation="MTDLARQLDVQQFIDERRFSPYQWLILILCFLIVAADGFDTAAIG
FT                   FVAPALAQQWHVTKAALGPVMSAALVGLALGALAAGPLADRIGRKRVLVGSVVLFGLFS
FT                   IGCAFTQSVTELAVLRLLTGLGLGAAMPNATTLMAEYAPHAKRSFLVNTMFCGFTLGSS
FT                   AGGLVAAALIPEHGWRSVFIVGGIAPLALGALLIALPESIRFMVLRGAPHERIAAVLRR
FT                   IAPDAAFDGVRFVLHDDRGEQRRSGAAVVLSPRYRAGTAMLWLTYFMGLLVYYLMTSWL
FT                   PTLIRDTGFTVRDAALVTALFPLGGGIGAIACGWLMDRIEPHRVIAFTYALTALFVWMI
FT                   GLQAGHLALLATVVFVAGVCMNGAQSSLPALAAAFYPTSGRATGVAWMLGVGRFGGILG
FT                   AFSGGLLLQAQLGFGTIFSMLAVPALIAAGALMVKRSAASRETQPDAPTRAA"
FT   misc_feature    order(47080..47148,47191..47259,47278..47346,47356..47424,
FT                   47458..47526,47536..47604,47794..47862,47890..47958,
FT                   47977..48045,48055..48123,48160..48228,48238..48306)
FT                   /note="12 probable transmembrane helices predicted for
FT                   BPSS0048 by TMHMM2.0 at aa 25-47, 62-84, 91-113, 117-139,
FT                   151-173, 177-199, 263-285, 295-317, 324-346, 350-372,
FT                   385-407 and 411-433"
FT   misc_feature    47080..48333
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter , score 51.8, E-value 1e-12"
FT   misc_feature    47245..47295
FT                   /note="PS00216 Sugar transport proteins signature 1."
FT   misc_feature    47371..47448
FT                   /note="PS00217 Sugar transport proteins signature 2."
FT   CDS_pept        complement(48431..48679)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0049"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37492"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P96"
FT                   /protein_id="CAH37492.1"
FT                   /translation="MKPLLKAGDRIEGLHWVAEYRHRARLIRVLRERVEVGTYGAPSAL
FT                   FGDEEEMGASTPADHRGREAALRAYLRHFAKVHDAEE"
FT   CDS_pept        complement(48780..49397)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0050"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein pa2306 SWALL:Q9I1G9 (EMBL:AE004657) (205 aa) fasta
FT                   scores: E(): 1.3e-40, 53.26% id in 199 aa, and to Rhizobium
FT                   meliloti hypothetical transmembrane protein r02108 or
FT                   smc01425 SWALL:Q92NS0 (EMBL:AL591789) (197 aa) fasta
FT                   scores: E(): 5.7e-38, 52.76% id in 199 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37493"
FT                   /db_xref="GOA:Q63P95"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P95"
FT                   /protein_id="CAH37493.1"
FT                   /translation="MNYLTLSALPAGMLFALVTSITPGPNNTMLLASGVNFGFRRTLPH
FT                   MFGISAGVAILMLSVGFGLGEAFKRIPILYTLLETASVVYLLYLAWRIGTSGEVRAHNG
FT                   KSRPMTFVEAIAFQWVNPKAWMMVLTAATTIQLSADYGRNAVWMALVFVFVGLPCISVW
FT                   AAFGQGLRGFLSNPRWLRVFNLTMATLLVLSLYPMFAKVSGH"
FT   misc_feature    complement(order(48801..48860,48897..48965,49119..49187,
FT                   49206..49274,49332..49391))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BPSS0050 by TMHMM2.0 at aa 59-78, 98-120, 127-149, 201-223
FT                   and 236-255"
FT   CDS_pept        complement(49592..50848)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0051"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Rhizobium meliloti putative transport
FT                   transmembrane protein r00752 or smc00807 SWALL:Q92RU2
FT                   (EMBL:AL591784) (400 aa) fasta scores: E(): 5.7e-69, 56.18%
FT                   id in 388 aa, and to Thermoplasma acidophilum sugar
FT                   transporter related protein ta1377 SWALL:Q9HIG2
FT                   (EMBL:AL445067) (381 aa) fasta scores: E(): 3.9e-20, 29.24%
FT                   id in 383 aa. Note: This CDS is longer in its N-terminal
FT                   region than most of its database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37494"
FT                   /db_xref="GOA:Q63P94"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P94"
FT                   /protein_id="CAH37494.1"
FT                   /translation="MHASSGRFSASLAGRIPPAGADKTAALVLASRGMRGFCDGFIAVL
FT                   LPAYLLALGFSQLDVGLVSTVTLLGSALATIAVGMLAGRVAHRRMLMLAATLMAATGIG
FT                   FASLSTLWALIAVAFVGTLNPSAGDVSLFLPLEQSRLAEAAAGDARTALFARYSLIGAL
FT                   SAAAGSLAAGLPLWLAAHTSIPLPGAMRGMFVVYAGAGVAVWLLYRHLPLPEAHAPAAP
FT                   PPLGPSRRIVTRLAMLFSVDAFAGGLVVNSLLSLWLMQRFGLSVAAAGRFFFCAGLLSA
FT                   GSQLAATPLSRRIGLLNTMVFTHIPSSVCLIGAAFAPSLPLTLALLLLRSALSQMDVPT
FT                   RTAFVMAVVTPAERPAAAGLTSVPRSLAAAIAPALAGGLLGLGWLGAPLVACGALKIGY
FT                   DLTLLASFRHVEPDGGPGR"
FT   misc_feature    complement(order(49676..49744,49862..49930,49991..50050,
FT                   50078..50146,50225..50284,50312..50380,50492..50560,
FT                   50603..50671,50684..50752))
FT                   /note="9 probable transmembrane helices predicted for
FT                   BPSS0051 by TMHMM2.0 at aa 33-55, 60-82, 97-119, 157-179,
FT                   189-208, 235-257, 267-286, 307-329 and 369-391"
FT   CDS_pept        complement(50835..51263)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to the Ralstonia solanacearum hypothetical
FT                   protein rsp0556 or rs03923 SWALL:Q8XSC2 (EMBL:AL646079)
FT                   (182 aa) fasta scores: E(): 2.2e-39, 72.66% id in 139 aa,
FT                   and to the C-terminal region of Bradyrhizobium japonicum
FT                   superoxide dismutase SodM-like protein SWALL:Q9RH60
FT                   (EMBL:AF065159) (276 aa) fasta scores: E(): 3.9e-31, 54.9%
FT                   id in 153 aa. CDS is truncated at the C-terminus in
FT                   comparison to both proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37495"
FT                   /db_xref="InterPro:IPR018634"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P93"
FT                   /protein_id="CAH37495.1"
FT                   /translation="MKWITRERPKIDRIACPWLIARFVDKAAEFLYVPDADVLRIAKET
FT                   GAIPFDVPDVELGHHGELCSFDAFLEKYALHDPALLKLAAIVRGADTGRYDLAPEASGL
FT                   HAISVGLSGNFRDDLEQLRHGMVMYDALYAWCRRDARL"
FT   CDS_pept        complement(51665..52855)
FT                   /transl_table=11
FT                   /gene="chrA"
FT                   /locus_tag="BPSS0053"
FT                   /product="chromate resistance transport protein"
FT                   /note="Highly similar to the plasmid borne Alcaligenes
FT                   eutrophus chromate transport protein ChrA SWALL:CHRA_ALCEU
FT                   (SWALL:P17551) (401 aa) fasta scores: E(): 5.6e-109, 75.19%
FT                   id in 387 aa, and to Ralstonia solanacearum probable
FT                   chromate transport transmembrane protein rsp0555 or rs03924
FT                   SWALL:Q8XSC3 (EMBL:AL646079) (401 aa) fasta scores: E():
FT                   4.1e-110, 74.74% id in 396 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37496"
FT                   /db_xref="GOA:Q63P92"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P92"
FT                   /protein_id="CAH37496.1"
FT                   /translation="MTTTVTPHAPAYSMSQLIRYMLRLGTFGFGGPVALAGYMRRDLVE
FT                   RRGWISEADYKEGLTLAQLAPGPMAAQLAIYLGYVHYRILGATLAGFAFVLPSFLMVVA
FT                   LGFAYAHFGGLPWMQAVFYGVGAAVVGIIAMSAYKLTTKTVGKDKLLGAIFVTLAAVTF
FT                   VTESEIAWLFIAAGLIGWLWRAPPKWLGSSGANALAAAHLPATGGFVSGLMRGVDVSVL
FT                   AQIGLFFAKAGAFVFGSGLAIVPFLYGGVVTEHHWLNDKQFVDAVAVAMITPGPVVITV
FT                   GFIGYLVAGFPGALVAALGTFLPCYLFTVVPAPYVKKYGHLPSVKAFVDGITAAAVGAI
FT                   TGSVLVIAKRSIVDAPTAAVALVTIVLLWRFKKLQEPVIVAAAAVVGLLAYPWLHR"
FT   misc_feature    complement(51671..52198)
FT                   /note="Pfam match to entry PF02417 Chromate_transp,
FT                   Chromate transporter , score 55.6, E-value 7e-14"
FT   misc_feature    complement(order(51671..51724,51812..51865,51908..51976,
FT                   51989..52057,52115..52183,52217..52285,52313..52408,
FT                   52445..52513,52526..52594,52613..52681,52739..52798))
FT                   /note="11 probable transmembrane helices predicted for
FT                   BPSS0053 by TMHMM2.0 at aa 20-39, 59-81, 88-110, 115-137,
FT                   150-181, 191-213, 225-247, 267-289, 294-316, 331-348 and
FT                   378-395"
FT   misc_feature    complement(52292..52822)
FT                   /note="Pfam match to entry PF02417 Chromate_transp,
FT                   Chromate transporter , score 271.3, E-value 8.2e-79"
FT   CDS_pept        complement(52852..53847)
FT                   /transl_table=11
FT                   /gene="chrB"
FT                   /locus_tag="BPSS0054"
FT                   /product="chromate resistance exported protein"
FT                   /note="Similar to Alcaligenes eutrophus protein ChrB
FT                   SWALL:CHRB_ALCEU (SWALL:P17552) (324 aa) fasta scores: E():
FT                   1.2e-64, 54.66% id in 311 aa, and to Ralstonia solanacearum
FT                   probable chromate resistance signal peptide protein rsp0554
FT                   or rs03925 SWALL:Q8XSC4 (EMBL:AL646079) (323 aa) fasta
FT                   scores: E(): 9.1e-67, 56.01% id in 316 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37497"
FT                   /db_xref="InterPro:IPR018634"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P91"
FT                   /protein_id="CAH37497.1"
FT                   /translation="MSNIRYMKIASTWSLLVLTLPTENATARMRFWRALKAKGCAVLRD
FT                   GVYLLPHTEAREGMLRELADAIAESGGAAHLLRVPSLDASQEAEFRALFDREEDYAGFV
FT                   RDLAQARKTLASQSAAELARLLRRLRKDFEAIRAIDYFPDDAATRAELAWQDFVSLVDT
FT                   VLSPGEPHAAERAIRRLAIDDYQGRTWATRQRMWVDRVASAWLIRRFIDTRARFIWLAS
FT                   PSECPDGALGFDYDGAAFTHVGERVTFEVLLASFGLDQDPALLRLGTIVHALDVGGPGA
FT                   PETVGFEAVMAGARRRAENDERLLEQMSDVLDSLYAYFATNETDKTGSRS"
FT   misc_feature    complement(53776..53847)
FT                   /note="Signal peptide predicted for BPSS0054 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.935) with cleavage site
FT                   probability 0.761 between residues 24 and 25"
FT   CDS_pept        54765..55313
FT                   /transl_table=11
FT                   /locus_tag="BPSS0055"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium loti hypothetical protein
FT                   mll8139 SWALL:Q983W7 (EMBL:AP003013) (174 aa) fasta scores:
FT                   E(): 1.9e-19, 46.28% id in 175 aa, and to Pseudomonas
FT                   aeruginosa hypothetical protein pa2134 SWALL:Q9I1Y1
FT                   (EMBL:AE004641) (190 aa) fasta scores: E(): 8.6e-09, 34.52%
FT                   id in 168 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37498"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P90"
FT                   /protein_id="CAH37498.1"
FT                   /translation="MTPMHTLSFAALLSALPLAAHAQDAQLTDPQIAAIVVTANQVDID
FT                   AGKLAQGRTHTKQVKDFANLMVTDHTSVNEAAVALATKLSLKPEDNATSGALKRGGDDN
FT                   IAMLKTLRGHEFDKAYIGHEVAYHQQVLDAMDKALIPAAKNGELKALLVKVRPAFAAHL
FT                   EHARDLQSKLGGDRDRKAD"
FT   misc_feature    54765..54830
FT                   /note="Signal peptide predicted for BPSS0055 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 22 and 23"
FT   CDS_pept        55366..55668
FT                   /transl_table=11
FT                   /locus_tag="BPSS0056"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium loti hypothetical protein
FT                   mlr4661 SWALL:Q98DK6 (EMBL:AP003004) (100 aa) fasta scores:
FT                   E(): 5.8e-07, 37.89% id in 95 aa, and to Methanosarcina
FT                   mazei copper-binding protein mm2343 SWALL:AAM32039
FT                   (EMBL:AE013477) (103 aa) fasta scores: E(): 7e-07, 35.41%
FT                   id in 96 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37499"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR035668"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P89"
FT                   /protein_id="CAH37499.1"
FT                   /translation="MAAAVAAVGPAAAGATHTVAIEGMRFNPDSLTVERGDKIVWVNKD
FT                   LVAHTATATAAHAFDSHEIAPNASWAYVARSPGRFAYVCALHPTMKANLIVKSKR"
FT   misc_feature    55396..55428
FT                   /note="PS00626 Regulator of chromosome condensation (RCC1)
FT                   signature 2."
FT   CDS_pept        55704..56372
FT                   /transl_table=11
FT                   /locus_tag="BPSS0057"
FT                   /product="putative RNA polymerase sigma factor"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 RNA polymerase sigma-E factor
FT                   RpoE or SigE or b2573 or c3097 or z3855 or ecs3439
FT                   SWALL:RPOE_ECOLI (SWALL:P34086) (191 aa) fasta scores: E():
FT                   1.5e-14, 33.14% id in 178 aa and to Rhizobium meliloti
FT                   putative RNA polymerase sigma factor protein Rpo or rb1504
FT                   or smb20592 SWALL:Q92TK7 (EMBL:AL603647) (227 aa) fasta
FT                   scores: E(): 9e-31, 42.72% id in 220 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37500"
FT                   /db_xref="GOA:Q63P88"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P88"
FT                   /protein_id="CAH37500.1"
FT                   /translation="MQPSRVDDRALAARVAGGDHAAFEQLMRRYNRRLYRLARATLRDD
FT                   AQAEDVLQEAYLAAFRTIGRFRGDASLSTWLSRLVLNACFTRQRRGARRDNIAPMVNTS
FT                   SIAGFERTTMDADLTSSPDHALMRTELRALLERKLDALPEAFRLVFVLRCVEELSVEET
FT                   AQCLGIPEATVRSRHFRAKRLLRESLAREIDSAGRDVFSFAGERCDRIVRGVLARLISP
FT                   "
FT   misc_feature    56175..56240
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1151.000, SD 3.11 at aa 171-192, sequence
FT                   LSVEETAQCLGIPEATVRSRHF"
FT   CDS_pept        56852..62767
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="BPSS0058"
FT                   /product="putative excinuclease ABC subunit A"
FT                   /note="N-terminal region similar to Micrococcus luteus
FT                   excinuclease ABC subunit A uvrA SWALL:UVRA_MICLU
FT                   (SWALL:P13567) (992 aa) fasta scores: E(): 2.4e-33, 41.63%
FT                   id in 1052 aa, and C-terminal region similar to
FT                   Mycobacterium tuberculosis excinuclease ABC subunit A
FT                   rv1638 or mt1675 or mtcy06h11.02 SWALL:UVRA_MYCTU
FT                   (SWALL:P94972) (972 aa) fasta scores: E(): 2.8e-31, 41.73%
FT                   id in 1016 aa. Note: This CDS seems to have duplicated
FT                   itself forming a whole CDS which N-terminal region is
FT                   highly similar to its C-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37501"
FT                   /db_xref="GOA:Q63P87"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P87"
FT                   /protein_id="CAH37501.1"
FT                   /translation="MSSSNLIRIRGARQHNLKHIDLDLRTGEMTVVTGPSGSGKSSLVF
FT                   DTLYAEGQRRYVETFSAYARQFLDRMDRPQVERVDGVPPAIAIDQTNPVRSSRSTVGTM
FT                   TELNDHLKLLYARAAELFDRRTARLVRHDTPETIYADLFARTQAHDPRIAITFAVELPE
FT                   NASDEEVEQWLSASGYTRVQARRDVASPTGPRKVLDVVADRFRLHQIDKARAIEAIEAS
FT                   LKRGGGRVSIYVLAQAPEGADGGAAQSQVWRYSTGLHDPDSDLRYADPQAALFSFNSAY
FT                   GACETCRGFGRVIGVDLGLVIPDARKTLRGGAVKPMQTPAWKECQDDLMRYAAKANIRR
FT                   DTPWAELTPAEQDWVINGSPDWNGKWQSQWYGVKRFFGYLESKAYKMHIRVLLSKYRSY
FT                   TPCAVCGGARLKTEALLWRLGTKANADAVLASADRFMPRGVDWTRAQLEALPGLTVHDL
FT                   MLLPIERIRRFFDDISLPSALLDDALKLLLAEVRTRLKYLCDVGLGYLTLDRQSRTLSG
FT                   GEVQRINLTTALGTSLTKTLFVLDEPSIGLHPRDLNRIVEAMRRLRDAGNTLVVVEHDP
FT                   SVMLAADRLIDMGPGPGERGGTIVYDGTPGAIRSARTLTGEYLGGRKHVAHASNWARRP
FT                   VDARTPRIVLEGASEHNLRDVTVEIPLQRLVCVTGVSGSGKSTLLQDVLYPAMARHFGK
FT                   ATESPGAYRRLAGAEQVGDVVFVDQSPIGKTTRSNPASYVGAFDEIRKLFAKAPLALQR
FT                   GYSAGTFSFNSGDGRCPSCGGSGFEHIEMQFLSDVYLRCPDCDGSRYRAEILEVRIERG
FT                   GRALSVADVLDLTVSEAAACFAADADVLRVLQPIVDVGLEYVKLGQPVPTLSGGEAQRL
FT                   KLAGFLAESAKARDGRRVVTEEARVARARLFMFDEPTTGLHFDDIAKLMQAFGKLLASG
FT                   HSLIVIEHNLDVIRAADWLIDLGPEGGDGGGLVLCAGTPDDVKACAGSHTGAALLQYER
FT                   AMNVGADADASGDAGVPLQAALNAARARRAIEGENVVRIVNAREHNLKALDVDIPHGKF
FT                   NVVTGVSGSGKSTLAFDILFHEGQRRYLESLNAYARSIVQPAGRPEVDAVYGIPPTVAI
FT                   EQRLSRGGRKSTVATTSEVWHFLRLLYVKLGLQHCIHDGTPVTSQTVESIAAQLLRDHR
FT                   GEHVGLLAPLVVNRKGVYTDLAKWAKARGNTHLRVDGEFVTVDPWPKLDRFREHTIELP
FT                   VADLVVSPDNEAELRQRLDETLELGKGVMHLLAPLDGLRHAMDNRLCTAGVGAIKVLSV
FT                   KRACPVCGTSYPELDPRMFSYNSKHGWCTTCVGTGLALTREQRAAYDDTVLAEDGRGRE
FT                   QTLPSDEQEPEGVGDEPCPDCGGTRLNPSARAVTFGRHSIVDVAQWTVTDTRRWIEGLQ
FT                   LAGRDAQIARDIVGEIGSRLAFLEEVGLGYLSLDRAAPSLSGGEAQRIRLAAQLGSNLQ
FT                   GVCYVLDEPTIGLHPRDNQILLSALRKLGDKGNTLVVVEHDEDTIRRADHIIDIGPGAG
FT                   KRGGTLVAQGGVADLSAQSASVTGRLLAQPMTHPLQPRRSVNPPGKRNGHAVPQAWLTV
FT                   HRARLHNLRDVTVGIPLARLVAVTGVSGSGKSTLARDVLMTNLLDAVGRSVLSSPAARR
FT                   ARKAAQQDAPRAAKSRASVLARSAPRPVLNVTHAWQGCESISGWEHIDRVLEVDQTPIG
FT                   KTPRSCPATYIGVWDAIRRLFADTLEARARGYTASRFSFNTGEGRCPACEGQGVRTIGM
FT                   SFLPDVKVPCDVCHGQRFNPETLAVTWRGRNIGDVLTMEIDEAVEFFAPLSNIAHPLQL
FT                   MKDVGLGYLTLGQPSPTLSGGEAQRIKLVTELSKVRDDVTRRGQKAPHTLYVLDEPTVG
FT                   LHMADVAKLIRVLHRLVDAGHSVVVIEHDLDVIAEADWIVDLGPEGGAGGGTIVAAAPP
FT                   EGLVEVSASHTGRALGAVLARTGADRDEPLRSGTARAG"
FT   misc_feature    56930..58624
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter , score 36.2, E-value 6.4e-09"
FT   misc_feature    56951..56974
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    58838..59710
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter , score 62.7, E-value 5.2e-16"
FT   misc_feature    58859..58882
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    59438..59482
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    59987..61405
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter , score 29.7, E-value 2e-08"
FT   misc_feature    60008..60031
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    61175..61219
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    61640..62602
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter , score 63.5, E-value 2.9e-16"
FT   misc_feature    61661..61684
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    62147..62164
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    62348..62392
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        complement(63800..64060)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Enterobacter aerogenes KluA SWALL:Q93KC6
FT                   (EMBL:U67194) (89 aa) fasta scores: E(): 6.5e-12, 53.84% id
FT                   in 78 aa, and to Pseudomonas sp. hypothetical 10.2 kDa
FT                   protein orf2 SWALL:Q937D1 (EMBL:U66917) (93 aa) fasta
FT                   scores: E(): 6.7e-12, 53.84% id in 78 aa, and to Rhizobium
FT                   meliloti hypothetical protein rb0121 or smb20121
FT                   SWALL:Q92X41 (EMBL:AL603642) (91 aa) fasta scores: E():
FT                   6.5e-10, 43.67% id in 87 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37502"
FT                   /db_xref="GOA:Q63P86"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P86"
FT                   /protein_id="CAH37502.1"
FT                   /translation="MRTTRTLSISLPYEMADYIRAKVSTGEFATESEVIRDALRTLIAR
FT                   DRVVEAWLRDAVNSGEFALDPDAQWAADKDEAKPARPRRRP"
FT   CDS_pept        64719..64991
FT                   /transl_table=11
FT                   /locus_tag="BPSS0060"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37503"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P85"
FT                   /protein_id="CAH37503.1"
FT                   /translation="MSEEVGRWRHALRRFSMNTILEDLKTRLEAGRMPIGARGVAMERV
FT                   EVTAAQTTDILAARHGDGNAEEEYFQRNDDARQWRWRAPDYYEIV"
FT   CDS_pept        complement(65274..65573)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0060B"
FT                   /product="putative H-NS-like DNA-binding protein"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   typhi DNA-binding protein H-NS Hns SWALL:HNS_SALTY
FT                   (SWALL:P17428) (136 aa) fasta scores: E(): 3, 29.31% id in
FT                   116 aa, and to Ralstonia solanacearum putative HNS-like
FT                   transcription regulator protein rs00711 SWALL:Q8XSY2
FT                   (EMBL:AL646078) (96 aa) fasta scores: E(): 1.5e-14, 58.16%
FT                   id in 98 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0060B"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37504"
FT                   /db_xref="GOA:Q63P84"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P84"
FT                   /protein_id="CAH37504.1"
FT                   /translation="MSTYLELKAKADEILRQAEEARRSELETVLKEVRTRVAEYGLTPE
FT                   QVFGARRGRRGQQVHASPTVPKYRDPKTGATWSGRGREPGWIKGKKRERFLIQQ"
FT   CDS_pept        66124..67476
FT                   /transl_table=11
FT                   /gene="kgtP"
FT                   /gene_synonym="witA"
FT                   /locus_tag="BPSS0061"
FT                   /product="alpha-ketoglutarate permease"
FT                   /note="Similar to Escherichia coli alpha-ketoglutarate
FT                   permease KgtP or WitA or b2587 SWALL:KGTP_ECOLI
FT                   (SWALL:P17448) (432 aa) fasta scores: E(): 4.5e-84, 51.63%
FT                   id in 428 aa, and to Ralstonia solanacearum putative
FT                   alpha-ketoglutarate permease transmembrane protein rsp0007
FT                   or rs01979 SWALL:Q8XTU7 (EMBL:AL646076) (447 aa) fasta
FT                   scores: E(): 5.9e-131, 77.87% id in 443 aa. CDS is extended
FT                   at the N-terminus in comparison to orthologues"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37505"
FT                   /db_xref="GOA:Q63P83"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P83"
FT                   /protein_id="CAH37505.1"
FT                   /translation="MEPTFTETGARASEPHATTLAGRAASSGDKLQRLKSIFSASAGNL
FT                   IEWYDWYVYSAFALYFAHSFFPAGNQTAQLLNTAAVFAVGFLARPVGGWLMGIYADRYG
FT                   RRPALLVSVVLMCVGSLIIALCPGYDVIGTAAPVLLVVARLLQGLSVGGEYGTSATYLS
FT                   EVATARDRGFYSSFQYVTLVAGQLVALALLIVLQQFVLTTQQLESWGWRIPFFIGAACA
FT                   LAAMRLRSSMEETGEFKRTLNARDKRGTLAELSKHPRAVLTVVGLTMGGTIAFYTYSIY
FT                   MQKFLVNTVGMSKHDATLVSAASLALFAILQPVVGSISDRIGRRPVLIAFGVLGTLFTV
FT                   PIMTAISRTHDVWTAFFLNMAALVIVSGYTSINAVVKAELFPAKIRALGVGFPYALTVS
FT                   IFGGTAEYLALWLKQAGHESLFYWYVTAAIFCSLLVYVCMRDTGKHSLIKD"
FT   misc_feature    66226..67470
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter , score 215.4, E-value 5.6e-62"
FT   misc_feature    order(66274..66327,66355..66423,66442..66501,66514..66582,
FT                   66643..66711,66748..66816,66901..66969,67012..67080,
FT                   67099..67167,67180..67248,67285..67353,67381..67440)
FT                   /note="12 probable transmembrane helices predicted for
FT                   BPSS0061 by TMHMM2.0 at aa 66-83, 93-115, 122-141, 146-168,
FT                   189-211, 224-246, 275-297, 312-334, 341-363, 368-390,
FT                   403-425 and 435-454"
FT   misc_feature    66409..66459
FT                   /note="PS00216 Sugar transport proteins signature 1."
FT   misc_feature    66559..66636
FT                   /note="PS00217 Sugar transport proteins signature 2."
FT   misc_feature    67066..67119
FT                   /note="PS00216 Sugar transport proteins signature 1."
FT   CDS_pept        67529..69460
FT                   /transl_table=11
FT                   /locus_tag="BPSS0062"
FT                   /product="putative C4-dicarboxylate transport sensor
FT                   kinase"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   C4-dicarboxylate transport sensor kinase transcription
FT                   regulator protein dctb1 or rsp0008 or rs01980 SWALL:Q8XTU6
FT                   (EMBL:AL646076) (634 aa) fasta scores: E(): 4.7e-73, 54.57%
FT                   id in 634 aa, and to Rhizobium leguminosarum
FT                   C4-dicarboxylate transport sensor protein DctB
FT                   SWALL:DCTB_RHILE (SWALL:P10047) (622 aa) fasta scores: E():
FT                   2.3e-24, 31.02% id in 635 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37506"
FT                   /db_xref="GOA:Q63P82"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P82"
FT                   /protein_id="CAH37506.1"
FT                   /translation="MRLRGIRRLHRPAAVLAVIACCVATAWLGYSVALRYYFRAHMNEV
FT                   AQRSSLYALTLESQLARYESIPRIAALEPVLSRLLNDPGERALRDEANAYLNAVQKNAE
FT                   LSAAYVMNARGETLAASNSNEPGSFIGSNYAFRPYFADAMKRGFGRFYGVGNTTGQAGY
FT                   FLAVPIRNPGQPARAPIGVVAIKASLDRYEAALTKSGDVVLLVDRDGVAFLSSVASWRY
FT                   RTLTPIPAATLRKLAATRQYGDAALEPLSDTPPAPAGAGRSSTQADSAPTPELLHLSLS
FT                   GGRPAWYHVVYRAAGPLGWRVAVLVDSTDDERRALFASGGVAAATALVFALIMVAWLRH
FT                   SREKERQRARTALLAAQRDLERRIAERTAELTAANAALEEKVDALDAARRILRDTRDTA
FT                   IQAGKLAALGQMAAGITHELNQPLAAIMTLSSNAVRMAALGRSADLTRNLELVNDLAGR
FT                   MGKIVAHMKGFARHESVSREAVSISEALQQALTLIEAHRKAAKVSVRVEPVPGQGIVLA
FT                   SSIRIEQLLVNLLTNAIDASAAGMDNRQVVVTTDVAGDIVRISVADSGKGIPADVMPQL
FT                   FEPFFTTKQTGKGLGLGLAISQAIVDEFGGRLHARNGSGVEPELGGAVFIVELHRVSRK
FT                   FSSHDERR"
FT   misc_feature    order(67562..67630,68474..68542)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPSS0062 by TMHMM2.0 at aa 12-34 and 316-338"
FT   misc_feature    68747..68953
FT                   /note="Pfam match to entry PF00512 HisKA, His Kinase A
FT                   (phosphoacceptor) domain , score 33.1, E-value 4.2e-07"
FT   misc_feature    69077..69424
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase , score
FT                   121.1, E-value 1.4e-33"
FT   CDS_pept        69444..70790
FT                   /transl_table=11
FT                   /gene="dctD"
FT                   /locus_tag="BPSS0063"
FT                   /product="C4-dicarboxylate transport transcriptional
FT                   response regulator"
FT                   /note="Similar to Rhizobium meliloti C4-dicarboxylate
FT                   transport transcriptional regulatory protein DctD or rb1525
FT                   or smb20613 SWALL:DCTD_RHIME (SWALL:P13632) (460 aa) fasta
FT                   scores: E(): 7.2e-75, 51.82% id in 438 aa, and to
FT                   Escherichia coli, and Escherichia coli O157:H7 nitrogen
FT                   regulation protein Nr GlnG or NtrC or GlnT or b3868 or
FT                   z5404 or ecs4790 SWALL:NTRC_ECOLI (SWALL:P06713) (469 aa)
FT                   fasta scores: E(): 9.6e-53, 41.1% id in 472 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37507"
FT                   /db_xref="GOA:Q63P81"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P81"
FT                   /protein_id="CAH37507.1"
FT                   /translation="MMNADNAYGREAVYVIEDDAAVRLGCSQALALEGIGVREFEDAES
FT                   ALAALKRDPPAAIVSDVRLPGMGGLALLDSMKAHPRDADIPVILMTGHGDVAMAVGAMR
FT                   CGAYDFIEKPFHSDRLVDTVRRALEHRKLVIENRSLRAQLSGERPLLGSAPAMQRVHAL
FT                   IDAIGPTSADVLIIGETGTGKEVLARALHAASRRTGPFVALNCAALPEAVFESEIFGHE
FT                   PGAFTGAQQRRIGKFEYASGGTLFLDELESMPLSLQAKLLRALQERSIERLGSNVSVAV
FT                   DVRVIAAVKQDLKQLAADGLFRSDLYFRLNVASIELPPLRRRTDDIPELFSHFLRAAAV
FT                   RFEKPEPVWTQEDMMRWQLYDWPGNVRELKNTAERFCLGLEDGLPRSPAGFDSLASRMV
FT                   SAERAYIEEALRNAGGQVAKAAELLGLPRKTLYDKITRHGIDMTAFRCT"
FT   misc_feature    69474..69839
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain , score 122.4, E-value 5.4e-34"
FT   misc_feature    69705..69734
FT                   /note="PS00758 ArgE / dapE / ACY1 / CPG2 / yscS family
FT                   signature 1."
FT   misc_feature    69891..70553
FT                   /note="Pfam match to entry PF00158 Sigma54_activat,
FT                   Sigma-54 interaction domain , score 413.7, E-value
FT                   1.1e-121"
FT   misc_feature    69963..70004
FT                   /note="PS00675 Sigma-54 interaction domain ATP-binding
FT                   region A signature."
FT   misc_feature    70146..70193
FT                   /note="PS00676 Sigma-54 interaction domain ATP-binding
FT                   region B signature."
FT   misc_feature    70527..70556
FT                   /note="PS00688 Sigma-54 interaction domain C-terminal part
FT                   signature."
FT   misc_feature    70635..70757
FT                   /note="Pfam match to entry PF02954 HTH_8, Bacterial
FT                   regulatory protein, Fis family , score 48.8, E-value
FT                   7.6e-12"
FT   misc_feature    70686..70751
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1000.000, SD 2.59 at aa 415-436, sequence
FT                   GQVAKAAELLGLPRKTLYDKIT"
FT   CDS_pept        complement(72252..72812)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0064"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches. Possible
FT                   alternative translational start sites"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37508"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P80"
FT                   /protein_id="CAH37508.1"
FT                   /translation="MSRVVFRVSCFVQGAENAERRHATPGRGACIPARDRPESHYNPTF
FT                   VPMTAPRTMLLLRHSILAALAATACASAHAQTADDTPVAAPACAIAIVTGVGGAATNLR
FT                   EYLAARERDRYRYLADHPLDCRVSEDGRASGCTGLAYLRRERVSVYDDGDDTVQNVVAR
FT                   VDLDHGTYPAIIAVQKRDVRCEQ"
FT   misc_feature    complement(order(72504..72572,72582..72650))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPSS0064 by TMHMM2.0 at aa 83-105 and 109-131"
FT   CDS_pept        73093..75045
FT                   /transl_table=11
FT                   /locus_tag="BPSS0065"
FT                   /product="putative exported protein"
FT                   /note="Weak similarity to the C-terminal region of Anabaena
FT                   sp. hypothetical protein all2038 SWALL:Q8YVE0
FT                   (EMBL:AP003588) (743 aa) fasta scores: E(): 3.5e-14, 30.93%
FT                   id in 682 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37509"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P79"
FT                   /protein_id="CAH37509.1"
FT                   /translation="MVETRRIHVVLLAAAITAITAIAAIAPAGHAQNATDWLANTYGTL
FT                   AAHVGNTARSMWVAPEGVIYTASMWDEYEGGVAIYQNGKSVGSIGSHAEFQGGAITGNA
FT                   ASVFVALQYDKSHGSGAVGRYNRVTKARELSIQVSASTDQPRVDVVTGLATVGSLLYAS
FT                   DFYGNRVRLFTTDGVWQRDIGVAGPGALAVDRAGNVWVARKRAGEIVEFSAAGALLNTL
FT                   RMPGGSQPSALYFDAPSGQLMVGDEGPDMNIKRYAVTGAPALVGTFGIQGGYLDTTTGI
FT                   KGQVGARRFTRVAGIGKDAAGNLYVLNNPWGGSWDLGRNGATDIHAYDSAGNLQWTLQS
FT                   LNFEGIAAADPATDGALFYGGTHIYAGSAGGTFVANTVDPFSYPSDPRIDMNDTQRDEH
FT                   FGQLVAVGANRILVASGQNPPIFYFFHFNKANGYVAIPDASLPGAAFNTAQRVTSGFCI
FT                   DSEGGVWAGLEKTGAIYHYPLAGFDASGKPTWGAGVPTRIPASIQPLTRIVYLAESDTM
FT                   ILAQGIVGSADWTSIGTRIEVYHGWRAGNTAAPDPVITLANAGAKSIDAAGNHLFVGYW
FT                   FGGGGPARPNVDAFNLATGKLDATLVNTSRATVDASSAVDSMYGVRAYQRSTGEYVVTK
FT                   NNVKGNSITVYRWKP"
FT   misc_feature    73093..73185
FT                   /note="Signal peptide predicted for BPSS0065 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.834 between residues 31 and 32"
FT   misc_feature    73324..73347
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        75296..75802
FT                   /transl_table=11
FT                   /locus_tag="BPSS0066"
FT                   /product="AraC family regulatory protein"
FT                   /note="Similar to the C-terminal region of Pseudomonas
FT                   aeruginosa ornithine utilization regulator OruR or pa0831
FT                   SWALL:ORUR_PSEAE (SWALL:P72171) (339 aa) fasta scores: E():
FT                   2.1e-10, 35.13% id in 148 aa, and to Mycobacterium
FT                   tuberculosis hypothetical transcriptional regulator rv1395
FT                   or mt1440 or mtcy21b4.12 SWALL:YD95_MYCTU (SWALL:P71663)
FT                   (344 aa) fasta scores: E(): 4.4e-10, 36.55% id in 145 aa.
FT                   Possible gene remnant"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37510"
FT                   /db_xref="GOA:Q63P78"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P78"
FT                   /protein_id="CAH37510.1"
FT                   /translation="MPRQAFSIRVRLRGRLPKARFRAPDNRLRLPASSLPRRLALANNE
FT                   AHAQALGQLDREMARLNLDGPALADRVRAELTLTESGYPSLARLASKLFLSERTLKRRL
FT                   QAHGTPYRNMLEAARYRDACRLLTRTDRCVADVSTRLGYVNPSAFTRAFRRWAGIAPSR
FT                   YRDDR"
FT   misc_feature    75509..75643
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family , score
FT                   4.5, E-value 0.87"
FT   misc_feature    75545..75610
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1342.000, SD 3.76 at aa 100-121, sequence
FT                   PSLARLASKLFLSERTLKRRLQ"
FT   misc_feature    75662..75793
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family , score
FT                   34.7, E-value 1.4e-07"
FT   CDS_pept        76174..78369
FT                   /transl_table=11
FT                   /locus_tag="BPSS0067"
FT                   /product="putative phospholipase C precursor"
FT                   /note="Similar to Pseudomonas aeruginosa non-hemolytic
FT                   phospholipase C precursor PlcN or pa3319 SWALL:PHLN_PSEAE
FT                   (SWALL:P15713) (692 aa) fasta scores: E(): 6e-54, 53.29% id
FT                   in 728 aa, and to Burkholderia pseudomallei non-hemolytic
FT                   phospholipase C precursor PlcN SWALL:PHLN_BURPS
FT                   (SWALL:Q9RGS8) (700 aa) fasta scores: E(): 4e-39, 45.43% id
FT                   in 744 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37511"
FT                   /db_xref="GOA:Q63P77"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR008475"
FT                   /db_xref="InterPro:IPR017767"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P77"
FT                   /protein_id="CAH37511.1"
FT                   /translation="MNARRRFLQGTATTGIAAATLAAFPLSIRRALAIPANNRTGTIRD
FT                   VEHIVILMQENRSFDNYFGTLRGVRGFGDRFGIPLPNALTVWQQRNATGALVLPYHLDG
FT                   SKGNAQRVSGTPHSWDDGQNAWDGGRMYQWPRYKNTASMGYFRESELPFQFALANAFTI
FT                   CDAYHCSMHAGTNSNRMFMWTGTNGPTGAGVASVVNEWDDIGPSTFGYEWKTYPERLQE
FT                   AGVSWKVYQNMPDNFTDNALAGFRQYRRANEASGKPVSNSDKVVSPAYDPASDDVRNPL
FT                   YKGIANTMPDGGFLGAFKEDIRAGKLPQVSWVVAPAAYSEHPGPSSPVQGAWYIQEVLD
FT                   ALTATPDVWSKTVLLVNFDENDGYFDHVPSPSAPSLNPDGSPAGKTTLPEADIAFERFT
FT                   HPKPPGTKSQPQPDARVYGPGVRVPMYVISPWSRGGWVNSQVFDHTSTLRFIEARFGVR
FT                   EPNISAFRRSVCGDLTSAFNFVRPNNEPLPTLAGRKTRAQADALRAAQQQMPQIVPPAN
FT                   GLLPRQETGTRPSRALPYELHVNAVARTLDGTLRLVFANTGQAAAVFHVYDKLNLGRLP
FT                   RRYMVEAGKQLDDVWAAMTDNGGKYDLWVLGPNGLHRHFTGDMNRLRAGGAPVPEVRVE
FT                   YDRQHGNVQLLLRNEGARECVFTVRAKAYRDDGPWTFKVKGGAERKHHWKLDGSGNWYD
FT                   FVVTCDADTGYSRRFAGRVETGEHSVSDPAMGFGDRF"
FT   misc_feature    76174..76272
FT                   /note="Signal peptide predicted for BPSS0067 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.992) with cleavage site
FT                   probability 0.782 between residues 33 and 34"
FT   CDS_pept        78867..79601
FT                   /transl_table=11
FT                   /locus_tag="BPSS0068"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37512"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P76"
FT                   /protein_id="CAH37512.1"
FT                   /translation="MPARKAGDRSSRDSAAFQHFVKYRYRVYAIGYNWLQSNEKSARDV
FT                   IEGMDFDDKKTDKKMRLMGIKEIIAENDSGKAIILIHSMGGLVACMAIAMHSAADLMHG
FT                   VFHNVLPATGAPIAAKRFRTGGGSEGGLNGFINGALLGSNADEFVVMAANAPGALELLP
FT                   MPDYHNGEPWWIFARLNGEPVMKLPQQGDVYNEFYINPKWYGLVPEQANSLLDPAGIVK
FT                   KRLESQPIKITEPHRNRGGWLV"
FT   CDS_pept        complement(join(79598..79903,81358..81459,81461..81880,
FT                   81884..81967))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPSS0069"
FT                   /product="transposase (pseudogene)"
FT                   /note="Pseudogene. Similar to Bacteriophage phiE125 TnpB
FT                   SWALL:Q8W6R2 (EMBL:AF447491) (284 aa) fasta scores: E():
FT                   4.2e-95, 85.21% id in 284 aa, and to Xanthomonas axonopodis
FT                   transposase xac2432 SWALL:Q8PJU8 (EMBL:AE011880) (301 aa)
FT                   fasta scores: E(): 4.2e-77, 68.12% id in 298 aa. CDS
FT                   contains nonsense and frameshift mutations is distrupted by
FT                   the integration of an IS element"
FT                   /db_xref="PSEUDO:CAH37513.1"
FT   misc_feature    complement(79649..79897)
FT                   /note="Pfam match to entry PF00665 rve, Integrase core
FT                   domain , score 36.6, E-value 1.5e-10"
FT   CDS_pept        80077..81324
FT                   /transl_table=11
FT                   /locus_tag="BPSS0070"
FT                   /product="putative transposase"
FT                   /note="Similar to Escherichia coli transposase InsI for
FT                   insertion sequence element IB30B/C/D (InsI1 or b0256) and
FT                   (InsI2 or b1404) and (InsI3 or b4284) SWALL:INSI_ECOLI
FT                   (SWALL:P37246) (383 aa) fasta scores: E(): 8.3e-21, 39.17%
FT                   id in 388 aa, and to Alcaligenes eutrophus transposase for
FT                   insertion sequence element IS1086 SWALL:TRA8_ALCEU
FT                   (SWALL:P37248) (339 aa) fasta scores: E(): 3.8e-19, 42.2%
FT                   id in 372 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37514"
FT                   /db_xref="GOA:Q63P75"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P75"
FT                   /protein_id="CAH37514.1"
FT                   /translation="METEAAALACNVSQPLGPRWLREAGGVAPIDLAPHSGRYLPFSER
FT                   EEIALLWAQDCSVREISRRLQRSPSTISRELRRNAATRGGTLVYRATVAQWKAEGAAER
FT                   PNASKLAENDQLRTYVQDRLAGTVTDYRGEPIPGPNVPWKGRRQGRHADRRWATCWSPE
FT                   QISRRIQIDYPDDQSMRISHEAIYQALYIQGRGALRRELTACLRSGRALRVPRARTQQR
FT                   GKHFVTPEVTISECPAEIADRAVPGHWEGNLITGLNRSAIGTLVERTTRFTMLLHLPPM
FT                   EGHGVGVRVKNGPALAGHGAEAVRNAIATKIALLPEHLRRSLTWDQGAEMAQHVQLRID
FT                   TALEIYFCDPQSPWQRGTNENTNGLLRQYFPKGTDMSRYTERELDAVANILNCRSRKTL
FT                   GWKTPAEAFHELLSAT"
FT   misc_feature    80077..80142
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1216.000, SD 3.33 at aa 1-22, sequence
FT                   METEAAALACNVSQPLGPRWLR"
FT   misc_feature    80077..80586
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1119.000, SD 3.00 at aa 1-170, sequence
FT                   METEAAALACNVSQPLGPRWLREAGGVAPIDLAPHSGRYLPFSEREEIALLWAQDCS
FT                   VREISRRLQRSPSTISRELRRNAATRGGTLVYRATVAQWKAEGAAERPNASKLAEND
FT                   QLRTYVQDRLAGTVTDYRGEPIPGPNVPWKGRRQGRHADRRWATCWSPEQISRRIQ"
FT   misc_feature    80142..80242
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1216.000, SD 3.33 at aa 56-22, sequence
FT                   REAGGVAPIDLAPHSGRYLPFSEREEIALLWAQDC"
FT   misc_feature    80242..80307
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1216.000, SD 3.33 at aa 56-77, sequence
FT                   CSVREISRRLQRSPSTISRELR"
FT   misc_feature    80521..80586
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1119.000, SD 3.00 at aa 149-170, sequence
FT                   GRHADRRWATCWSPEQISRRIQ"
FT   misc_feature    80797..81303
FT                   /note="Pfam match to entry PF00665 rve, Integrase core
FT                   domain , score 72.5, E-value 5.7e-19"
FT   misc_feature    81142..81192
FT                   /note="PS01043 Transposases, IS30 family, signature."
FT   misc_feature    complement(81455..81592)
FT                   /note="Pfam match to entry PF00665 rve, Integrase core
FT                   domain , score 18.5, E-value 2.5e-05"
FT   CDS_pept        complement(join(81964..82059,82059..82289))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPSS0072"
FT                   /product="IS element hypothetical protein (pseudogene)"
FT                   /note="Pseudogene. Similar to Burkholderia cepacia
FT                   insertion element IS401 hypothetical 12.4 kDa protein
FT                   SWALL:YISX_BURCE (SWALL:Q51647) (107 aa) fasta scores: E():
FT                   2.6e-25, 72.22% id in 108 aa, and to Bacteriophage phiE125
FT                   TnpA SWALL:Q8W6R1 (EMBL:AF447491) (92 aa) fasta scores:
FT                   E(): 8.6e-25, 84.78% id in 92 aa. CDS contains frameshift
FT                   mutation after codon 77"
FT                   /db_xref="PSEUDO:CAH37515.1"
FT   CDS_pept        82774..82938
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPSS0072A"
FT                   /product="conserved hypothetical protein (fragment)"
FT                   /note="Partial CDS. Similar to the C-terminal region of
FT                   Ralstonia solanacearum hypothetical protein rsc3358 or
FT                   rs02633 SWALL:Q8XU36 (EMBL:AL646074) (179 aa) fasta scores:
FT                   E(): 0.00013, 46.51% id in 43 aa, and of Neurospora crassa
FT                   histone H3 methyltransferase Dim-5 SWALL:Q8X225
FT                   (EMBL:AF419248) (318 aa) fasta scores: E(): 0.49, 37.5% id
FT                   in 48 aa"
FT   CDS_pept        complement(82938..83957)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0073"
FT                   /product="putative regulatory protein"
FT                   /note="Similar to Pseudomonas aeruginosa ornithine
FT                   utilization regulator OruR or pa0831 SWALL:ORUR_PSEAE
FT                   (SWALL:P72171) (339 aa) fasta scores: E(): 4.4e-20, 27.92%
FT                   id in 333 aa and to Pseudomonas aeruginosa probable
FT                   transcriptional regulator pa2704 SWALL:Q9I0D8
FT                   (EMBL:AE004698) (339 aa) fasta scores: E(): 3.1e-28, 32.39%
FT                   id in 321 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37517"
FT                   /db_xref="GOA:Q63P74"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P74"
FT                   /protein_id="CAH37517.1"
FT                   /translation="MKPVAMAVTRTAAQRPAPLHTIFITLEVMKRIGLSRETLLEGTGI
FT                   SPSDVERPNAMVTHAQEMVLFANALKATGNSAIGLHIGNEIPVTAYGLRAHAMLVSPTL
FT                   GDAMRLAFEHPLLGISYFRMKLLIDGEVARIIVGGYTYRHDLLVINTDMCFTAVRRQMI
FT                   DLIGRSPHFTRIGFAYPKPSHADSYSEYFSCPAIFDSEINFLEFDASILMTKLPLAHPI
FT                   EYEVARKACEKREFELAHWMPTDLVGQLLCMMYENPISQDVFEFADRLGMSLRSLQRKL
FT                   KDMGTSFSALQDLVRQDIASKYLTEKHYTAKEIAARLGYKNASAFSRAMRRWSKISVD"
FT   CDS_pept        84049..84411
FT                   /transl_table=11
FT                   /locus_tag="BPSS0074"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37518"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P73"
FT                   /protein_id="CAH37518.1"
FT                   /translation="MLIEAVGTRAWVCHQCDPIDSIVSQPFHGALKQLTSNTHTVKDRF
FT                   NKQSRNERSIGNDRETYSGHLVVAFADPSAALANLFDQKAAVEQMNLVWVDSILGYREA
FT                   DVVKCTDVTLSHRTVF"
FT   CDS_pept        84913..85833
FT                   /transl_table=11
FT                   /locus_tag="BPSS0075"
FT                   /product="putative ABC transport system, membrane protein"
FT                   /note="Similar to Escherichia coli spermidine/putrescine
FT                   transport system permease protein PotB or b1125
FT                   SWALL:POTB_ECOLI (SWALL:P23860) (275 aa) fasta scores: E():
FT                   7.8e-29, 34.69% id in 245 aa, and to Pseudomonas aeruginosa
FT                   probable permease of ABC transporter pa0325 SWALL:Q9I6G6
FT                   (EMBL:AE004470) (309 aa) fasta scores: E(): 3.4e-49, 49.08%
FT                   id in 273 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37519"
FT                   /db_xref="GOA:Q63P72"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P72"
FT                   /protein_id="CAH37519.1"
FT                   /translation="MAVFRVTALNLRGSWRVIFDPLLLAMTLGVVLPLAVLAVASINAP
FT                   LEFGGVAWGEFTLRAYQRVIFDRDWDGSLVLQQGYISIFIRSMMMAISATILCLLLGFP
FT                   TALFISTRTSKWKAALLVLVTIPFWTCVVVQMTGWIIALADNGLVAQTLGFLGLLHGPL
FT                   SLLYTDIATLIGLVYAFTPFMILPIFAALDDFDWQLVEAAYDLGAHQMAVLWHVIVPVC
FT                   WPGVMAGVGLVFVPALGAYAIPGLLGGNHAFMVGNLIDFQFAGGRDWPLGAAMSFVLLA
FT                   FVLLAMLALRLKSIFLHPESDDEFA"
FT   misc_feature    order(84973..85041,85174..85242,85267..85335,85420..85488,
FT                   85549..85617,85720..85788)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPSS0075 by TMHMM2.0 at aa 21-43, 88-110, 119-141, 170-192,
FT                   213-235 and 270-292"
FT   misc_feature    85483..85701
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component , score 40.4, E-value 2.7e-09"
FT   misc_feature    85486..85572
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        85817..86671
FT                   /transl_table=11
FT                   /locus_tag="BPSS0076"
FT                   /product="putative ABC transport system, membrane protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 spermidine/putrescine
FT                   transport system permease protein PotC or b1124 or c1399 or
FT                   z1763 or ecs1500 SWALL:POTC_ECOLI (SWALL:P23859) (264 aa)
FT                   fasta scores: E(): 8.6e-29, 33.84% id in 260 aa, and to
FT                   Pseudomonas aeruginosa probable permease of ABC transporter
FT                   pa0324 SWALL:Q9I6G7 (EMBL:AE004470) (262 aa) fasta scores:
FT                   E(): 2.9e-42, 47.52% id in 263 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37520"
FT                   /db_xref="GOA:Q63P71"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P71"
FT                   /protein_id="CAH37520.1"
FT                   /translation="MMNSHELRRFPLTAGIATTVLLFLYLPLLVIGWMSFNDGPSALMW
FT                   KGWSTRGYIEAWADPTLIRAIQNSLALALGSMVLSTGLATSAAVAAWSRTERRAVDLRT
FT                   FVIGLPLAIPEVVLAIATMMLFSMLGLDVGFVAVLFAHVVFCVPLAYLPINARLKTIDR
FT                   TLLEAAADLSAPPWAAFRQITLPLALPGIVAGALLSFVASMNDYVTSYFLAGAGMSTLP
FT                   MYIFSSLKIGISPKISAVSIAVVALSSIQLLAVWALGARRSRRSIGARIEPYHSNVQTM
FT                   RAV"
FT   misc_feature    order(85850..85918,86024..86092,86129..86197,86213..86281,
FT                   86438..86497,86525..86593)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPSS0076 by TMHMM2.0 at aa 12-34, 70-92, 105-127, 133-155,
FT                   208-227 and 237-259"
FT   misc_feature    86285..86506
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component , score 53.3, E-value 3.6e-13"
FT   CDS_pept        86668..87699
FT                   /transl_table=11
FT                   /locus_tag="BPSS0077"
FT                   /product="putative ABC transport system, exported
FT                   substrate-binding protein"
FT                   /note="Similar to Escherichia coli
FT                   spermidine/putrescine-binding periplasmic protein precursor
FT                   PotD or b1123 SWALL:POTD_ECOLI (SWALL:P23861) (348 aa)
FT                   fasta scores: E(): 2.3e-25, 26.23% id in 343 aa, and to
FT                   Pseudomonas aeruginosa probable binding protein component
FT                   of ABC transporter pa0323 SWALL:Q9I6G8 (EMBL:AE004470) (347
FT                   aa) fasta scores: E(): 9.7e-69, 48.19% id in 332 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37521"
FT                   /db_xref="GOA:Q63P70"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P70"
FT                   /protein_id="CAH37521.1"
FT                   /translation="MKKAIGAMLLAAVGTATAAELHVGSWPVIMPVALLKKFQAETGIE
FT                   TTLDTYASDAALTQKLQAGGGGYDVVIAGDYYVPVLVRSGLLLKLDKNRLSNMANIKPE
FT                   YRHPSFDSDRDYAVPFTVVLTGFAYDSARVPGGKLDDSWKSFFEPPEALRGQIGDLDVE
FT                   EELYMAASWYLGQDECTENPADAKRVLDVLQKQKPFVKTYSNDGTVDRLASRQIAVQHV
FT                   WNGAAVRAQERLPSIKFVYPKEGVRLFMDSLLVPAKARNIDSAYKFLNWMMQPENIALV
FT                   TNAVRYNNEIIGSERYVDAALLDNPAVKTPEQYKARLRPYKLCSLAAIQLRNKVWLKLK
FT                   GNR"
FT   misc_feature    86668..86721
FT                   /note="Signal peptide predicted for BPSS0077 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.996 between residues 18 and 19"
FT   misc_feature    86731..87624
FT                   /note="Pfam match to entry PF01547 SBP_bac_1, Bacterial
FT                   extracellular solute-binding protein , score 36.7, E-value
FT                   3.6e-08"
FT   CDS_pept        88287..88592
FT                   /transl_table=11
FT                   /locus_tag="BPSS0077A"
FT                   /product="putative HNS-like regulatory protein"
FT                   /note="Similar to Ralstonia solanacearum putative HNS-like
FT                   transcription regulator protein rsp0335 or rs00711
FT                   SWALL:Q8XSY2 (EMBL:AL646078) (96 aa) fasta scores: E():
FT                   1.5e-10, 43.29% id in 97 aa, and to Bordetella pertussis
FT                   Bph3 SWALL:O07507 (EMBL:U82566) (123 aa) fasta scores: E():
FT                   0.00073, 32.72% id in 110 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0077A"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37522"
FT                   /db_xref="GOA:Q63P69"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P69"
FT                   /protein_id="CAH37522.1"
FT                   /translation="MATYEELKAQLDALNKEAEAAKAREISTALSQIRETVLRYEIRPD
FT                   QIFPQWTRLRSPDKRRGPLPPKYRNPMTGETWCGRGRAPKWMSGSPREAFLIDRPA"
FT   CDS_pept        88921..91692
FT                   /transl_table=11
FT                   /locus_tag="BPSS0078"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum putative
FT                   VGR-related protein rsp0518 or rs06151 SWALL:Q8XSF8
FT                   (EMBL:AL646079) (908 aa) fasta scores: E(): 1.1e-90, 41.55%
FT                   id in 900 aa, and to Escherichia coli VgrE protein
FT                   SWALL:O52660 (EMBL:AF044499) (702 aa) fasta scores: E():
FT                   0.00017, 25% id in 532 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37523"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P68"
FT                   /protein_id="CAH37523.1"
FT                   /translation="MNDTLRNFASGAVDWNKRPVALHFGAAQAALGHLLALQHASVQEG
FT                   LMTGIHGRLTCVSTRRDLPPGVLLGIPVSIRLITDRGQPHTVNAIISDVQIGQSDGELC
FT                   VYQLTVCDALSLMDKRTNSRVFRKRSVIDVLATLFNEWQQRSPALARAFEFDLSGLRAD
FT                   RYPPRELTRQVNESDAHFVRRLLRREGITVFAKAGPAKGERPLQGDAPVHTLVCCDDPM
FT                   SLPQAPAGTVRLHPRDGGAAQRDTVTLFALRRQLAPGKAGRPSWDYKKARIDESSVASS
FT                   LDQGEAGNDLAKLLTDIAIDIAHAGDSWRDHERLTRARMLAHEFEAERHDGVSSVRDLA
FT                   VGTWITLTGDPQWDRQRADKRQFVITSIDHDIWNNLPKGLNERVHALFAASRNLAYAPR
FT                   ALPSALANDADTRYENTFACVRRGVPLAPAYDPQADLPPAHLLTGTIVGAEGEEVFCDE
FT                   DGRVRVRVHGLDPADHAHAQGAGTNGNAGDSAPIRVASSLAGAHFGASFLPRVGMEVLL
FT                   GCLGGDPDRLVIIGVLGNGAHPPATFSHAGGLPGNRYLSGIKTKEIRGQRYNQLRLDDT
FT                   PNQISAQLASEHAHSQLNLGYLTQPRENGHGNDRGEGVELRTDAAAALRAAQGMLLTTY
FT                   ARTQASGGQLDRDELIRLLGECAELFKALGDYAGQHGGQAADTAGQHAVAAAFKRWAPG
FT                   TDGADAPSDGAARALMAFGAQAGSVNVTPKTHVTYAGENIDQVAQQHLQLMSGQRLNAT
FT                   AGQGMQLFARGAGVQAVAGEGPMLLQAQAGTLTANAQKGVKITTNEHEVFVSAPKIRLV
FT                   AEDGSYLELGGGITLGTNGDIKLLSASHQWGGPSTAQAAKSGFGNQPTDQRFKLHYPGE
FT                   DGDLQAAANKRFRITLDDGRVIEGKTDASGLTDLVKDDAMRIAKIDYLKPKL"
FT   misc_feature    91588..91611
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        91706..93946
FT                   /transl_table=11
FT                   /locus_tag="BPSS0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein pa0260 SWALL:Q9I6M9 (EMBL:AE004464) (716 aa) fasta
FT                   scores: E(): 1.5e-24, 31.81% id in 770 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37524"
FT                   /db_xref="InterPro:IPR021692"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P67"
FT                   /protein_id="CAH37524.1"
FT                   /translation="MNGINDQCFTAARGAGVTMSNRPGDRPVPIPRDLPGVVIFIHGVN
FT                   DPGAAYATVERGLCQGLNERLSRSDLRPGEYGRRYAAASAAKAEGDSVRYAEVLGDPDM
FT                   YLYQRAETGGTHSMFLPFYWGYRASDNEIAKISHPGEVKSRVADSDGNLMTRGQYQDIH
FT                   GNRLDAHFGKGGGFFANATNNIPQMYSPGFEPDKLERTVMQNALAGNTIFAGKSPERRY
FT                   FVLAAARLANLIKTIRTIQPSALALEHGMDPQHETITVMGHSQGTIITLLAQAMLKQQG
FT                   QRCVDCIIMVDTPYSLQFTQDGSQQTGHAKLKTLVDIVNAVTSEPHTIPELAELMIDSA
FT                   HSCGRAGQNWSKTQGKRPDKGGKHWITFDERDNRGKVYLYFCPEDTVVGLDKVRGIGTF
FT                   GVPDEVPADGAAASRGKTMPAMTVLEPKRFFQRMWTRLERDQDGRGKRSKVAVGTPPAR
FT                   VPVRDPFQRLTPGPDTDGTMLGTLVESGKNMALQASFKRNDIRFINGEQLKPAYEPDLY
FT                   GGEVRKGGQVPGHADVAGLMRPDDVTKNVALGNQYAKFKWKDVATTDDPGAGIEPHKQA
FT                   FNRGRPVDEQSHNWRIVPSRSLGSMLSAAATGGRYQTYVIQREETPDEVRKRMRTDADQ
FT                   LEANNYHSGVLLSSENHRWVTAMDVAIGQAVTLDDPDWRQLLLLMADWKMTSRAFKQMK
FT                   ECKAFNRLDKHTRDFLDACSTYYRTGQFPAEKFVMLTLPPLVTSELKAESKT"
FT   misc_feature    92477..92506
FT                   /note="PS00120 Lipases, serine active site."
FT   misc_feature    92933..92956
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        94259..95614
FT                   /transl_table=11
FT                   /locus_tag="BPSS0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to parts of Pseudomonas aeruginosa
FT                   hypothetical protein pa0259 SWALL:Q9I6N0 (EMBL:AE004464)
FT                   (480 aa) fasta scores: E(): 2.3e-15, 27.19% id in 478 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37525"
FT                   /db_xref="InterPro:IPR021531"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P66"
FT                   /protein_id="CAH37525.1"
FT                   /translation="MLAQSGGKFVLEVRGLGLVAGKETNEEIWKAVEAKADNHSTYMSQ
FT                   NPADYPANEDERMTEVELSTRISFKYGARHSVEYWPVPVFIWEPPKAQRADRPGAELSG
FT                   LRQEASLGVTLLLWQEDANTDDGTSIVEKLFAFFDAHPDVPEAVIVTFDGAATRKLNQT
FT                   PGYVDTFKQSNIPSMPDSMVSMLVSRSDRVDRLIRPYAVEQTEDVNKNTTDYDVTRLWN
FT                   YFWKINHDSGPDGFSAHYDAQERKAGVDTPMSPGFVTSAWWQTKLPAFWKTISNKGPGE
FT                   FKPMPYIPVRWTTWQVKQFDNAPLLGYLHRPIDVKLADAHGKPLKTAQQVQALKAGWQQ
FT                   AVDTLPTGETPKRIFYDTTGDRAWVAPINQALAQSGPSAPSLDDVKEGYDIGRRIGNTG
FT                   ISSPLVQIGLGLIASYHEGGASATIHRRPNGTATIVMVSPPTHKQPDVNPFR"
FT   CDS_pept        95624..95887
FT                   /transl_table=11
FT                   /locus_tag="BPSS0080a"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein RSC3217 or RS02434 SWALL:Q8XUH1 (EMBL:AL646074) (90
FT                   aa) fasta scores: E(): 3e-20, 62.79% id in 86 aa, and to
FT                   the N-terminal region of Burkholderia thailandensis
FT                   bacteriophage protein GP29 SWALL:Q8VP97 (EMBL:AY063741)
FT                   (186 aa) fasta scores: E(): 5e-07, 42.35% id in 85 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0080a"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37526"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P65"
FT                   /protein_id="CAH37526.1"
FT                   /translation="MRGVIRIGDSTSHGGRVETGREGSTVMGRAVACVGDRCTCPMNGH
FT                   EHCVIVEGDEDVRIEGRAVAFDGHRTSCGATLVSSIPTSGRV"
FT   CDS_pept        complement(96302..96721)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 hypothetical protein YjbQ or b4056 or z5655 or
FT                   ecs5038 SWALL:YJBQ_ECOLI (SWALL:P32698) (138 aa) fasta
FT                   scores: E(): 1.2e-18, 42.85% id in 133 aa, and to Rhizobium
FT                   meliloti hypothetical protein r02310 or smc01559
FT                   SWALL:Q92NA3 (EMBL:AL591790) (140 aa) fasta scores: E():
FT                   6.2e-28, 56.42% id in 140 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37527"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P64"
FT                   /protein_id="CAH37527.1"
FT                   /translation="MQQSIQHITVEARGRGLVEFTPQVRAFVEVQSVSTGLLTVFCRHT
FT                   SASLLIQENADPSVQRDIERYFAALAPEDDARYEHDTEGADDMPAHLRTALTQVQLSIP
FT                   VEHGRMVLGTWQGIYLFEHRRAPHRRDVVLHLIGE"
FT   misc_feature    complement(96311..96673)
FT                   /note="Pfam match to entry PF01894 UPF0047, Uncharacterised
FT                   protein family UPF0047 , score 198.4, E-value 7.2e-57"
FT   CDS_pept        complement(96741..97067)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0082"
FT                   /product="putative thioredoxin"
FT                   /note="Similar to Xanthomonas axonopodis thioredoxin TrxA
FT                   or xac0109 SWALL:AAM35001 (EMBL:AE011634) (109 aa) fasta
FT                   scores: E(): 2.1e-17, 50% id in 96 aa, and to Pseudomonas
FT                   aeruginosa probable thioredoxin pa2694 SWALL:Q9I0E8
FT                   (EMBL:AE004697) (108 aa) fasta scores: E(): 1.1e-22, 60.78%
FT                   id in 102 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37528"
FT                   /db_xref="GOA:Q63P63"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P63"
FT                   /protein_id="CAH37528.1"
FT                   /translation="MHSSQAYTADAPTRAEVDALAGATVIEFGANWCGICAGAQPAIRD
FT                   AFSVHADVRHLKIEDGPGRPLGRSFGIKLWPTLVFLRDGTEVARVVRPTHAEQIETIGF
FT                   AALV"
FT   CDS_pept        97539..98231
FT                   /transl_table=11
FT                   /locus_tag="BPSS0083"
FT                   /product="putative exported protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37529"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P62"
FT                   /protein_id="CAH37529.1"
FT                   /translation="MNSQHARFIRPVLGTLCIVSLAALSGCRGDACFGFDGCFDDGGVQ
FT                   TVTLSGTAATGPALASATVNVDCARGSVATLSDGGGHYSVTFDAALPCAITVTSGGTSL
FT                   HSLAYAGGTFNTTPQTELLLVYLAAQLGTSPVRLIGDLPNSSRLQQALENQTNVQAAQT
FT                   AVVTHLQQRYAVMFAVPGFLTTPFFVGQPGVDSDLGALANAGAIDANGMPDALAVSLLQ
FT                   QAGAAHPL"
FT   misc_feature    97539..97718
FT                   /note="Signal peptide predicted for BPSS0083 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.684) with cleavage site
FT                   probability 0.590 between residues 49 and 50"
FT   CDS_pept        complement(98726..98863)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPSS0084"
FT                   /product="putative porin-related protein (fragment)"
FT                   /note="Gene remnant. Similar to internal region of
FT                   Burkholderia cepacia OpcP1 SWALL:Q45106 (EMBL:D63823) (361
FT                   aa) fasta scores: E(): 1.9e-05, 58.06% id in 31 aa, and
FT                   Ralstonia solanacearum probable porin signal peptide
FT                   protein rsc2108 or rs01496 SWALL:Q8XXK5 (EMBL:AL646068)
FT                   (381 aa) fasta scores: E(): 0.00028, 61.29% id in 31 aa.
FT                   Feature lacks translational stop and start codons"
FT   CDS_pept        complement(98817..99440)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0085"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   transmembrane protein rsc0361 or rs03329 SWALL:Q8Y2H5
FT                   (EMBL:AL646058) (171 aa) fasta scores: E(): 2e-11, 33.96%
FT                   id in 159 aa. Weakly similar to Bordetella parapertussis
FT                   putative membrane protein bpp4203 SWALL:Q7W345
FT                   (EMBL:BX640436) (181 aa) fasta scores: E(): 0.00057, 27.16%
FT                   id in 162 aa. CDS is extended at the C- and N-termini in
FT                   comparison to the R. solanacearum protein. The presence of
FT                   a gene remnant overlapping the C-terminus of the CDS
FT                   (BPSS0084) suggest that this may be a partial gene"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37531"
FT                   /db_xref="GOA:Q63P61"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P61"
FT                   /protein_id="CAH37531.1"
FT                   /translation="MKADARCDTRKHAQRHCTHAFVAHDPRLMTRDVAENRRVWLLKRN
FT                   CALSPRQSLISMGLLAALTLAIAMPFAIAGAWAVFACAIGEIAAMCGCFLRYVRHAVDY
FT                   DCVALTEQRLEVIQCDGAQLRRYDWNPLWVAVDLDAAHARDPTIRIRHGSETVLVGRHV
FT                   TLARRRHVAGELNAALAASAGDFGDTDFAPSVRQRQPEPLAAHR"
FT   misc_feature    complement(order(99147..99215,99225..99284))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPSS0085 by TMHMM2.0 at aa 85-104 and 108-130"
FT   CDS_pept        complement(99533..101128)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0086"
FT                   /product="putative cytochrome C oxidase-related protein"
FT                   /note="Similar to Bradyrhizobium japonicum cytochrome C
FT                   oxidase polypeptide I CtaD or CoxA SWALL:COX1_BRAJA
FT                   (SWALL:P31833) (541 aa) fasta scores: E(): 3.4e-116, 54.49%
FT                   id in 534 aa, and to Rhizobium leguminosarum cytochrome C
FT                   oxidase polypeptide I CtaD or CoxA SWALL:COX1_RHILE
FT                   (SWALL:Q08855) (538 aa) fasta scores: E(): 5.8e-116, 56.18%
FT                   id in 534 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37532"
FT                   /db_xref="GOA:Q63P60"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P60"
FT                   /protein_id="CAH37532.1"
FT                   /translation="MSEISTNMPHVRDAAHHAPTGWRRWLFATNHKDIGTLYLLFSIVN
FT                   LMIGGVMALMIRAELFEPGLQLMRPEFFNQLSTEHGFIMIFGAIMPAFVGLANWMIPLQ
FT                   IGASDMAFARMNNFSFWLLPVSSALLIGSFFVPGGAPAAGWTMYAPLSTQMGPGMDLSI
FT                   FAIHIASASSIMGAINIVVTVVNMRAPGLTLMKMPMFAWTWIITSFLLIAIMPVLAGAV
FT                   TMVLFDRHFGTSFFNASGGGDPVLYQHIFWYFGHPEVYVMILPGFGMISQVIPAFSRKP
FT                   LFGYASMVYATASIGILSFMVWAHHMFVTGMPVAGQLFFMYATMTIAVPTGVKVFNWVA
FT                   TMWRGSLTFETPMLFSIGFIFVFLIGGLTGVTLAMAPLNVALHGTYYIIAHFHYVMVAA
FT                   SLFSIYAGWYFWVPKWTGYFYDERRGRIHFWGSMISFNVTFFPMHFLGLAGMPRRYAGY
FT                   PAQFTDFNQIATIGAFAFGLMQVYFLFWVALPTYLGKTRRCVDAKPWDGAQGLEWTLPS
FT                   PAPYHSFETPPAVK"
FT   misc_feature    complement(order(99662..99730,99788..99856,99893..99961,
FT                   100004..100072,100109..100177,100220..100288,
FT                   100307..100375,100448..100516,100574..100642,
FT                   100700..100768,100826..100885,100961..101029))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BPSS0086 by TMHMM2.0 at aa 54-76, 102-121, 141-163,
FT                   183-205, 225-247, 272-294, 301-323, 338-360, 373-395,
FT                   410-432, 445-467 and 487-509"
FT   misc_feature    complement(99701..101059)
FT                   /note="Pfam match to entry PF00115 COX1, Cytochrome C and
FT                   Quinol oxidase polypeptide I , score 830.6, E-value
FT                   3.5e-247"
FT   misc_feature    complement(100211..100375)
FT                   /note="PS00077 Heme-copper oxidase catalytic subunit,
FT                   copper B binding region signature."
FT   CDS_pept        complement(102280..103737)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0087"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37533"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P59"
FT                   /protein_id="CAH37533.1"
FT                   /translation="MPIRQTHIWIFGFVIACVLAMSGPLTYTFENTFQQTVDIDRKKQG
FT                   TVAEATAFDARSAEQPSAPDADRMHELPRIDAARSPTDHFDELPIHLAAFGGGEPSPSG
FT                   PLPPGPLPDTSFAPFPFQHGFDTAIHAGPPIPAPPESTLARTDAPPRDETPFEPGMPQP
FT                   SETVDTQLSFYADMVAQAIERTAYDSIALAKLDSDTTAPPDMTPERHDALANVNAPMFY
FT                   ADMLTASIHVPPSNDRTLSVPSLLTHQAIGIAWMELFARELPATATQAAPTRHAVSFAA
FT                   TLQAEPFDLAQWSEPDEAHSDGPPLELDGQRTIAPPYPRAGTLPPGTRPTYTDSPPDTG
FT                   IVQAAAMLATGFESAGKHAATLRGQPPGADGCRMGARAIGLGRSGMERLAIEQFVSSAR
FT                   AAYDCARARIHGRASAFANAPASAQPSNHLDANGDPMRIAFLPRLASEPFQEAFSIPGD
FT                   TAGIASAFAVADDQTGHRNRMAAANSD"
FT   misc_feature    complement(103651..103719)
FT                   /note="1 probable transmembrane helix predicted for
FT                   BPSS0087 by TMHMM2.0 at aa 48-70"
FT   CDS_pept        105290..107227
FT                   /transl_table=11
FT                   /locus_tag="BPSS0088"
FT                   /product="putative exported protein"
FT                   /note="No significant database matches to the full length
FT                   CDS. Similar to parts of Xanthomonas axonopodis outer
FT                   membrane protein XadA or xac3546 SWALL:AAM38389
FT                   (EMBL:AE012003) (2190 aa) fasta scores: E(): 1.5e-48,
FT                   41.17% id in 629 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37534"
FT                   /db_xref="GOA:Q63P58"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P58"
FT                   /protein_id="CAH37534.1"
FT                   /translation="MTPRAALVTLLLAAWSAPSVAQALHPGSGAQSVEVGAGSNASGSQ
FT                   STALGNGAQATGSHSTATGQGSHATGSNSTATGQDANASGTSSTATGQGSQATGNNSTA
FT                   TGQDATASGTSSTATGQGSQATGSNSTATGQDATASGESSTATGQGSQATGNNSTATGQ
FT                   DATASGTSSTATGQGSQATGSNSTATGQDATASGESSTAMGQGSQATGNNSTATGQDAT
FT                   ASGESSTAMGQGSQATGSNSTATGQDATASGESSTAAGQGSQATGSNSTATGQDAIASG
FT                   ESSTATGQGSQATGSNSTATGQDATASGESSTATGQGSQATGNNSTATGQDATASGTSS
FT                   TATGQGSQATGSNSTATGQDATASGESSTAMGQGSQATGSNSTATGQDANASGESSTAT
FT                   GQGAQATGDNSTATGQDAAASGESSTATGQGSQAAGSNSTANGAGAAATGHQSTALGAG
FT                   AQAAGSQGVASGWNANASGTQGVAIGGNASAQGNQSIALGANASATGDHSIALGAGSQA
FT                   TGSNSVALGQGSIADRDNSVSVGSDGGERNVTNVANGWHDTDAVNFRQLREVARYAYSG
FT                   IAAATALAMIPDVDAGKTFSIGVGTGGYLGYQAVAVGASARLGQNLKVRVGAGISAAST
FT                   TWGAGASYSW"
FT   misc_feature    105290..105352
FT                   /note="Signal peptide predicted for BPSS0088 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.962 between residues 21 and 22"
FT   misc_feature    105539..105568
FT                   /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core
FT                   protein repeat , score 0.1, E-value 1.7e+02"
FT   misc_feature    105623..105652
FT                   /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core
FT                   protein repeat , score 0.1, E-value 1.7e+02"
FT   misc_feature    105707..105736
FT                   /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core
FT                   protein repeat , score 2.6, E-value 56"
FT   misc_feature    105791..105820
FT                   /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core
FT                   protein repeat , score 0.1, E-value 1.7e+02"
FT   misc_feature    105875..105904
FT                   /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core
FT                   protein repeat , score 1.9, E-value 76"
FT   misc_feature    105959..105988
FT                   /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core
FT                   protein repeat , score 1.9, E-value 76"
FT   misc_feature    106043..106072
FT                   /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core
FT                   protein repeat , score 1.3, E-value 1e+02"
FT   misc_feature    106127..106156
FT                   /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core
FT                   protein repeat , score 2.6, E-value 56"
FT   misc_feature    106211..106240
FT                   /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core
FT                   protein repeat , score 2.6, E-value 56"
FT   misc_feature    106295..106324
FT                   /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core
FT                   protein repeat , score 0.1, E-value 1.7e+02"
FT   misc_feature    106379..106408
FT                   /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core
FT                   protein repeat , score 1.9, E-value 76"
FT   misc_feature    106463..106492
FT                   /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core
FT                   protein repeat , score 2.6, E-value 56"
FT   misc_feature    106547..106576
FT                   /note="Pfam match to entry PF02339 SGXXSG, Aggrecan core
FT                   protein repeat , score 2.6, E-value 56"
FT   CDS_pept        complement(107294..108781)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0089"
FT                   /product="putative exported protein"
FT                   /note="Similar to Ralstonia solanacearum putative
FT                   transmembrane protein rsp0161 or rs05517 SWALL:Q8XTF1
FT                   (EMBL:AL646076) (517 aa) fasta scores: E(): 3.2e-115,
FT                   57.32% id in 485 aa, and to Xanthomonas axonopodis
FT                   hypothetical protein xac3119 SWALL:AAM37964 (EMBL:AE011956)
FT                   (504 aa) fasta scores: E(): 2.5e-104, 53.07% id in 471 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37535"
FT                   /db_xref="InterPro:IPR009199"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P57"
FT                   /protein_id="CAH37535.1"
FT                   /translation="MRNKVAGAIALSMLSLAYPRAEAAPIAFPCPIDARRDLTDTLACY
FT                   RQTVENQPLNYTMTGIVQLPGIEQRTYRLVSQSWSPDQLVRPDTWVHEVALYIPQDALP
FT                   RRALVIANDGTRHPGEGETPRTPNDFLPDTLADIARSTRTAVISVSDVPNQLLSYADDG
FT                   KPKAEDDSVARSWTLFMQSPHTRGAMPLHVPMAASIWRAMSLAERELTSLGIHRFVVSG
FT                   ISKRAWTTWLALIGDQRVDAIAPFAIDLLSTRAALENMYRSYGGNWPLAFYPYYAEGID
FT                   RTLDSPAFGLLMRIEDPLSYLGTRHGSRLAVPKYIVNASGDDFFVPDNSQRYFDKLPGA
FT                   KALRMVPNSSHSDIRRATLDSLVPFVKRIQHGKALPQVDAAPIETNGQTILRLRTSERP
FT                   RQLLLWQATNPLARDFRYACGIRYTSTPIAMNGARPQQLVLVPPTNGWRAYFVEATFDD
FT                   GFVATSQTYILGDGYPSTSPPAVGGSCRTLPGRDTHS"
FT   misc_feature    complement(108713..108781)
FT                   /note="Signal peptide predicted for BPSS0089 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.917 between residues 23 and 24"
FT   CDS_pept        complement(109043..109597)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0090"
FT                   /product="putative exported protein"
FT                   /note="Low similarity to Yersinia pestis putative exported
FT                   protein ypo1208 SWALL:Q8ZGS3 (EMBL:AJ414147) (175 aa) fasta
FT                   scores: E(): 3.4e-08, 27.71% id in 166 aa, and to
FT                   Salmonella typhimurium putative inner membrane protein YfaZ
FT                   or stm2294 SWALL:Q8ZNF6 (EMBL:AE008803) (215 aa) fasta
FT                   scores: E(): 8.4e-07, 29.56% id in 159 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37536"
FT                   /db_xref="InterPro:IPR009998"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P56"
FT                   /protein_id="CAH37536.1"
FT                   /translation="MSRTESSIFAKRSDWPRVFSKLGLVASSIGVFAFMPNARASDYSI
FT                   AIGNGYQSVSRTPTGTGFGFLLDATRSGEDAYSIGSGLSSGVRIGAVSLTVAGKALHVR
FT                   SADDRSGLTTPVGVIAGIPAASRLSLVARAFYTPRAVFNAALGAYTQATAGVRWTYKPI
FT                   NLEAGWRYEALKGRNGTRDPR"
FT   misc_feature    complement(109301..109363)
FT                   /note="PS00107 Protein kinases ATP-binding region
FT                   signature."
FT   misc_feature    complement(109478..109597)
FT                   /note="Signal peptide predicted for BPSS0090 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.995 between residues 40 and 41"
FT   CDS_pept        110182..110727
FT                   /transl_table=11
FT                   /locus_tag="BPSS0091"
FT                   /product="putative fimbrial protein"
FT                   /note="Similar to Escherichia coli f17 fimbrial protein
FT                   precursor f17a-A SWALL:FMF3_ECOLI (SWALL:P11312) (180 aa)
FT                   fasta scores: E(): 1.1e-12, 35% id in 180 aa, and to
FT                   Yersinia pestis frimbrial protein ypo2945 SWALL:Q8ZCN6
FT                   (EMBL:AJ414154) (181 aa) fasta scores: E(): 4.5e-15, 37.83%
FT                   id in 185 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37537"
FT                   /db_xref="GOA:Q63P55"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P55"
FT                   /protein_id="CAH37537.1"
FT                   /translation="MKKKVVSFAVATLFGLVAAQSVYAQSIDQGQVKFTGELTANTCTI
FT                   DAGSKDQIVPLPKVSTSALAAPGDVAGSTAFEIKVSKCAADVKKVAAHFEMENMDPNTR
FT                   TLKNEATGTDAATNVTIQLVNSDGTELPVGSTGSYFDVTGTDDARGATMIYGGQYYALD
FT                   TTTAGKVESHTLFTLAYE"
FT   misc_feature    110194..110253
FT                   /note="1 probable transmembrane helix predicted for
FT                   BPSS0091 by TMHMM2.0 at aa 5-24"
FT   misc_feature    110269..110724
FT                   /note="Pfam match to entry PF00419 Fimbrial, Fimbrial
FT                   protein , score 98.8, E-value 6.7e-27"
FT   CDS_pept        110792..111529
FT                   /transl_table=11
FT                   /locus_tag="BPSS0092"
FT                   /product="putative fimbria-related chaperone"
FT                   /note="Similar to Escherichia coli chaperone protein
FT                   precursor EcpD or b0140 SWALL:ECPD_ECOLI (SWALL:P33128)
FT                   (246 aa) fasta scores: E(): 3.4e-36, 45.04% id in 242 aa,
FT                   and to Bordetella pertussis chaperone protein precursor
FT                   FimB or FhaD SWALL:FIMB_BORPE (SWALL:P33409) (244 aa) fasta
FT                   scores: E(): 4.8e-31, 44.08% id in 245 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37538"
FT                   /db_xref="GOA:Q63P54"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P54"
FT                   /protein_id="CAH37538.1"
FT                   /translation="MRLWKMCVAVAAACCLASTLSQAAIVITGTRVVYPESSREVNVRL
FT                   NNVEQSPVLVQAWIDDGNAGASPDEIKVPFVLMPPVFRVEPKKGQTLRVMYTGDDLPKD
FT                   RESVYWLNVLEIPPKPTVEAEQNLLQLAFRTRIKLFFRPSALEDGNAAQARDQLKWKIV
FT                   RNEKGVSVLRAENRSPYYISISQATAKSGDKSVQFDPGMVPPFGSKEFVSKRDISTLST
FT                   HAEIAYKLLNDYGAEVAGSATAE"
FT   misc_feature    110807..110860
FT                   /note="Signal peptide predicted for BPSS0092 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.975 between residues 18 and 19"
FT   misc_feature    110861..111232
FT                   /note="Pfam match to entry PF00345 pili_assembly,
FT                   Gram-negative pili assembly chaperone, N-terminal domain ,
FT                   score 228.2, E-value 7.9e-66"
FT   misc_feature    111092..111145
FT                   /note="PS00635 Gram-negative pili assembly chaperone
FT                   signature."
FT   misc_feature    111245..111517
FT                   /note="Pfam match to entry PF02753 pili_assembly_C,
FT                   Gram-negative pili assembly chaperone, C-terminal domain ,
FT                   score 37.7, E-value 1.8e-08"
FT   CDS_pept        111753..114386
FT                   /transl_table=11
FT                   /locus_tag="BPSS0093"
FT                   /product="outer membrane usher protein"
FT                   /note="Similar to Escherichia coli outer membrane usher
FT                   protein precursor AfaC SWALL:AFAC_ECOLI (SWALL:P53517) (859
FT                   aa) fasta scores: E(): 8.4e-77, 33.4% id in 877 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37539"
FT                   /db_xref="GOA:Q63P53"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P53"
FT                   /protein_id="CAH37539.1"
FT                   /translation="MGEAPSGAEPGTRGRQALLVASHASPSAPTTVSFNSRLLMGGGID
FT                   LSRFERGNPVVAGIYPVDVTVNGERRGRMDVEFRDVRGGDSAAPCFTRAMLDRLGVEGD
FT                   IVAKRLDAARDATGAASGQTPTLSASACIGLRDALPDATYTLDSADLTLDLTIPQVDMR
FT                   KTARGYVDPSRWDNGVNAGLLQYNLSGYASENKFFGNHASSLFLGLQAGANIGAWRVRQ
FT                   RSNLMWANRSAGMSWRSLETYVQRDITALRSQITLGDSYTTGEIFESFGVRGMQLASDD
FT                   RMLPVSLQSYAPTVRGVADTNARVAVRQRGNVIYEASVPPGPFEFDDLPPTGYGGDLDV
FT                   TITESDGRTKHFTVPFASVRQLLRPGMQRFNFTVGQYRDALSNGKPWVAQLTYQRGMTN
FT                   LLTGYAGLLSSTGYASGLIGVALNTPIGAFAFDVTSARTHLPGQGVRNGFSSHLSYSKM
FT                   VPSTGTHFSMAAYRYSTANYYSLADAVTARYGYNAEERAWRNDYRARTRLQLNVNQRIG
FT                   DRSSAYVSSSLLNYWDGRGRDIQFQAGFSSVFKRVSYTVYAQRSRSSDDRTVTQVGVNL
FT                   SIPLGSGAYTKRNAFSSLTTSLSRASNGDSSIQANLSGSTAHVVPIDYGVNVSRSVTGD
FT                   SNFASLGVYGTYRSPFGTYSGNASVDNRARQASFGANGAVVLHRGGVTLSPPLGSAAAL
FT                   VEAKGARGGKLINGQGATIDRFGYAVIPSLMPYRANTVAIDPSELPDDVELANTSEEVV
FT                   PRNNSIVFVKMETKRGRPVFAATETEDGKPLPMGSELFDVEGKSLGGVGQGGMAFLRGL
FT                   QGAGNVVAKWGAGASEQCTMPYLVPADQAQAKQSRAIVRIRLRCEPRLSADASQTPHGD
FT                   GGTRND"
FT   misc_feature    111846..114263
FT                   /note="Pfam match to entry PF00577 Usher, Fimbrial Usher
FT                   protein , score 976.4, E-value 4.7e-291"
FT   misc_feature    114153..114215
FT                   /note="PS00107 Protein kinases ATP-binding region
FT                   signature."
FT   CDS_pept        114379..114951
FT                   /transl_table=11
FT                   /locus_tag="BPSS0094"
FT                   /product="putative fimbria subunit protein"
FT                   /note="Similar to Xylella fastidiosa fimbrial subunit
FT                   precursor xf0083 SWALL:Q9PH63 (EMBL:AE003862) (184 aa)
FT                   fasta scores: E(): 9.2e-12, 37.5% id in 176 aa, and to
FT                   Escherichia coli F17 fimbrial protein precursor F17a-A
FT                   SWALL:FMF3_ECOLI (SWALL:P11312) (180 aa) fasta scores: E():
FT                   4.4e-10, 38.46% id in 169 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37540"
FT                   /db_xref="GOA:Q63P52"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P52"
FT                   /protein_id="CAH37540.1"
FT                   /translation="MIEMNGLKFRRGAARRWPSIAAAAMFAASAACGAPPSPTVTIKFK
FT                   GSYNPVTCTVVEGNENKTVHLPTISTSSLANAGETAGATGFDISVLCDGYAGNVLAYFE
FT                   NGPTTNENGNLDVEDPSDGQSASGVQVQLLNGDGSPIKVGDISTMKTVSVEASTPTPIP
FT                   FFARYYATGKSGAGKVRTYVTFVIQML"
FT   misc_feature    114379..114477
FT                   /note="Signal peptide predicted for BPSS0094 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.724 between residues 33 and 34"
FT   misc_feature    114442..114474
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    114496..114948
FT                   /note="Pfam match to entry PF00419 Fimbrial, Fimbrial
FT                   protein , score 83.4, E-value 3e-22"
FT   CDS_pept        115016..115672
FT                   /transl_table=11
FT                   /locus_tag="BPSS0095"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Yersinia pestis putative membrane protein
FT                   ypo1468 or ypo0975 or y2703 or y3366 SWALL:Q8XF18
FT                   (EMBL:AJ414148) (228 aa) fasta scores: E(): 8.8e-07, 27.67%
FT                   id in 206 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37541"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P51"
FT                   /protein_id="CAH37541.1"
FT                   /translation="MLLQDTMLHVALLTQGARISRVHDWRARCIALVRQFEQALQDGGY
FT                   RSGIANELGLAQCVFLDEITMRNLSTEQKEEWLRELLQFRFHSIRDGLSKVRARIDRLC
FT                   RGHSANAALLEMYSLFHEFGLLGDKQGHALADARVSEARPTPGKKAAETAEIWKDGGAA
FT                   NEAAHGRSWRIVGGLLAFAALMTMWLVIDTRLSHEVEQMEVTSGDEAAIHPASGD"
FT   CDS_pept        115675..117351
FT                   /transl_table=11
FT                   /locus_tag="BPSS0096"
FT                   /product="OmpA family membrane protein"
FT                   /note="Similar to Yersinia pestis putative membrane protein
FT                   ypo2953 or y1530 SWALL:Q8ZCM8 (EMBL:AJ414154) (560 aa)
FT                   fasta scores: E(): 8.4e-25, 23.54% id in 565 aa, and to
FT                   Yersinia pestis putative OmpA-family membrane protein
FT                   ypo0974 or y2702 or y3365 SWALL:Q8ZHC6 (EMBL:AJ414145) (578
FT                   aa) fasta scores: E(): 7.2e-19, 28.17% id in 575 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37542"
FT                   /db_xref="GOA:Q63P50"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P50"
FT                   /protein_id="CAH37542.1"
FT                   /translation="MSRQIRFWLVWGAIPFVVLASLCLPLRMQPDWSHVLTIVLIIAAI
FT                   VLAIEIFEHSRETAQDRAAEAEIDDHELAVIIVAGPHASSLFNSSGDDTAFRREAGALW
FT                   LRADSVEQLRDTMMRVKASRGRFPDAAVVPLVSESDDESDMRQAFAKWRTELREALCYP
FT                   DAAYVLPCYLAVYTCLGFKGADGARPKWTGDAIEIGTRQMNAASKVGELLASIRQQLLR
FT                   PSPTGSSAQCALGLGVFDWLDATALLSSMTMLANTPPFMLKGLTLANVGRRPIRPGAWT
FT                   RWLTVRTGLHIRQTKSSMAPLPVPRVAKHAESGIREGWSSARHLVSTRASFVPALVFST
FT                   VSTLGIAVAVSGWMNSRMIQRVSNDIADYRSGADEWIGRKRFAQARLEHDRTAIVQTLL
FT                   DGVPTGFGWGLYRGQELLVKLDTVLDSPRTASIAMQLDTVSLFAAGKATFSPGAAQREL
FT                   QHALRMILANPEQRVLIVGHADSSGSDAANFQLSEARARAIRDWFVDQGVLKTRFIVQG
FT                   AGDTHPIADNDSPSGRAQNRRVEVLLIPDVASDRKASGTGL"
FT   misc_feature    115675..115758
FT                   /note="Signal peptide predicted for BPSS0096 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.802) with cleavage site
FT                   probability 0.294 between residues 28 and 29"
FT   misc_feature    order(115693..115761,115771..115830,116668..116736)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BPSS0096 by TMHMM2.0 at aa 7-29, 33-52 and 332-354"
FT   misc_feature    116995..117285
FT                   /note="Pfam match to entry PF00691 OmpA, OmpA family ,
FT                   score 81.5, E-value 1.1e-21"
FT   CDS_pept        117729..118268
FT                   /transl_table=11
FT                   /locus_tag="BPSS0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo2939 SWALL:Q8ZCN9 (EMBL:AJ414154) (174 aa) fasta scores:
FT                   E(): 2.4e-48, 84.75% id in 164 aa, and to Salmonella typhi
FT                   hypothetical protein sty0297 SWALL:Q8Z970 (EMBL:AL627266)
FT                   (180 aa) fasta scores: E(): 6.7e-48, 76.66% id in 180 aa.
FT                   Note: Also similar to BPSS0173 (194 aa) fasta scores: E():
FT                   2e-48, 81.818% identity in 165 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37543"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="InterPro:IPR033851"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P49"
FT                   /protein_id="CAH37543.1"
FT                   /translation="MAISNSSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLAD
FT                   LSGKPLEPLPAVGDRKFFSIDIDNFDERMKAMKPRVAFSVPNTLSGDGQLMVDITFESM
FT                   DDFSPAAIAKKVDALSQLLDARTQLANLQTYMDGKSGAENLVSKVLKDPALLSALAKAP
FT                   KPVAEQAENRESKEKH"
FT   CDS_pept        118302..119801
FT                   /transl_table=11
FT                   /locus_tag="BPSS0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo2938 SWALL:Q8ZCP0 (EMBL:AJ414154) (500 aa) fasta scores:
FT                   E(): 1.3e-175, 84.6% id in 500 aa, and to Salmonella
FT                   enterica subsp. enterica serovar Typhimurium SciI protein
FT                   SWALL:Q93IS7 (EMBL:AJ320483) (497 aa) fasta scores: E():
FT                   9.3e-171, 83.36% id in 499 aa. Note: Also similar to
FT                   BPSS0172 (500 aa) fasta scores: E(): 1.5e-182, 84.168%
FT                   identity in 499 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37544"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P48"
FT                   /protein_id="CAH37544.1"
FT                   /translation="MAARESQARSADAQLATHSDFNALLSREFKPKTEQAREAVEHAVK
FT                   TLAEQALANSVTLSDDAYKSIEAIIGEIDRKLSEQINLILHHDDFQQLESAWRGLHHLV
FT                   TNTETDEKLKIRFMDVSKDDLRRTMKRYKGVAWDQSPFFKQIYEEEYGQLGGEPYGCLV
FT                   ADYYFDHTPPDVDLLSSIGKVAAAAHAPFITGASPSVLQMDSWQELANPRDLTKIFTQN
FT                   LEYAPWNSLRNSEDARYIGLAMPRFLARLPYGIRTNPVDEFDFEESTDGSDHRKYVWAN
FT                   AAYAMAVNINRSFKHYGWCTLIRGVESGGVVENLPCHTFPTDDGGIDMKCPTEIAISDR
FT                   REAELAKNGFIPLIHRKNTDYAAFIGAQSLQKPAEYYDPDATANANLSARLPYLFACSR
FT                   FAHYLKCIVRDKIGSFKEREDMQQWLNEWIMNYVDADPANSSQETKARRPLAAAEVVVE
FT                   DVEGNPGYYQAKFFLRPHFQLEGLTVSLRLVAKLPSVKEAA"
FT   CDS_pept        120001..120483
FT                   /transl_table=11
FT                   /locus_tag="BPSS0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   enterica subsp. enterica serovar Typhimurium putative
FT                   cytoplasmic protein stm0279 or SciM SWALL:Q93IS3
FT                   (EMBL:AE008707) (161 aa) fasta scores: E(): 8e-39, 63.29%
FT                   id in 158 aa, and to Yersinia pestis hypothetical protein
FT                   ypo2937 SWALL:Q8ZCP1 (EMBL:AJ414154) (161 aa) fasta scores:
FT                   E(): 7.9e-38, 55.69% id in 158 aa. Note: Also similar to
FT                   BPSS0171 (162 aa) fasta scores: E(): 1.8e-43, 66.456%
FT                   identity in 158 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37545"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P47"
FT                   /protein_id="CAH37545.1"
FT                   /translation="MSHDIFLKINGIDGEAEDATHKGEIEVLSWSWNVSQQSNMHLGSG
FT                   GGAGKATIDDLQFEHYIDRASPNLVQYCLLGKHIDEARLVVRKAGGSPLEYIKLTMSDV
FT                   LVTQVSPTGVAQDESRPRELVRLSFSRLKQEYVVQNPQGGSGGAITATFDIKKNAA"
FT   CDS_pept        120671..121153
FT                   /transl_table=11
FT                   /locus_tag="BPSS0100"
FT                   /product="putative exported protein"
FT                   /note="Similar to Salmonella enterica subsp. enterica
FT                   serovar Typhimurium SciN protein precursor SciN
FT                   SWALL:Q93IS2 (EMBL:AJ320483) (163 aa) fasta scores: E():
FT                   5.3e-21, 39.21% id in 153 aa, and to Pseudomonas aeruginosa
FT                   hypothetical protein pa0080 SWALL:Q9I752 (EMBL:AE004447)
FT                   (154 aa) fasta scores: E(): 1.4e-12, 35.24% id in 122 aa.
FT                   Note: Also similar to BPSS0170 (171 aa) fasta scores: E():
FT                   5.8e-24, 45.860% identity in 157 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37546"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P46"
FT                   /protein_id="CAH37546.1"
FT                   /translation="MAAMVCTSLAACASLPARKETADLIVKIKVSEGANPDEHQRPAPV
FT                   MVRLYELKSAGAFENADFFTLQSDSRKVLGDDAIATDEFVMRPGDTRDIHRRADSAGTS
FT                   VGVLVGYRELGKSVWRAVHKLRPAPEDAWYRAFTPRTKIKLNVDVGQQTVTITELE"
FT   misc_feature    120671..120727
FT                   /note="Signal peptide predicted for BPSS0100 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.913) with cleavage site
FT                   probability 0.767 between residues 19 and 20"
FT   misc_feature    120998..121021
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        121159..122508
FT                   /transl_table=11
FT                   /locus_tag="BPSS0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo2934 or y1549 SWALL:Q8ZCP3 (EMBL:AJ414154) (449 aa)
FT                   fasta scores: E(): 3.1e-111, 62.61% id in 444 aa, and to
FT                   Salmonella typhi hypothetical protein sty0304 SWALL:Q8Z966
FT                   (EMBL:AL627266) (447 aa) fasta scores: E(): 2.7e-97, 57.9%
FT                   id in 449 aa. Note: Also similar to BPSS0169 (449 aa) fasta
FT                   scores: E(): 1.1e-108, 62.054% identity in 448 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37547"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P45"
FT                   /protein_id="CAH37547.1"
FT                   /translation="MSWHNKVVWNEGLFLLPQLFQQQERYFEYFAHKRAAVLSPFFWGF
FT                   SRYEIDQESLSFGKLVFKSGAGIFPDGTPFDVPGHTPPPPPLTIAAEHQDQVIYLAVPL
FT                   RLPNTEETAFDEQAGSLARYSAFEIELRDSNAIGQGPKPVQLANMRLRLLPEKELTQSW
FT                   IGIALTRVKTLHADGSVALYDGDHIPPVSQYGANPLLREWATQLHGLAKLRADALATRL
FT                   SGSDGRAGAAAEVADYLLLQVLNRYEPLLEHICRIREMPPVTLYRELSMLAGELSTFVR
FT                   PQTRRPRPTPGYDHAQLYASIRPLVDEVHYLLNQVLIRGAQPIPLTEQPHGIRVATMLP
FT                   SELAGYSSLVLAVGAQMSPDVLQQQFASQTKISHPQRLPELIRSHLPGMTMIPLPVPPR
FT                   QIPFNSSYIYYELSRTGPFWEQIAQQGGLAMHIAGHFPELKLELWGVRHK"
FT   CDS_pept        122505..123806
FT                   /transl_table=11
FT                   /locus_tag="BPSS0102"
FT                   /product="OmpA family membrane protein"
FT                   /note="Similar to Salmonella typhi putative membrane
FT                   protein sty0305 SWALL:Q8Z965 (EMBL:AL627266) (433 aa) fasta
FT                   scores: E(): 1.8e-76, 55.78% id in 380 aa, and to Yersinia
FT                   pestis putative OmpA-family membrane protein ypo0514
FT                   SWALL:Q8ZII3 (EMBL:AJ414143) (536 aa) fasta scores: E():
FT                   3.2e-24, 30.93% id in 375 aa. Note: The N-terminal region
FT                   of this CDS does not present similarities to any of the
FT                   database matches. Also similar to BPSS0168 (422 aa) fasta
FT                   scores: E(): 1.9e-61, 46.283% identity in 417 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37548"
FT                   /db_xref="GOA:Q63P44"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR017733"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P44"
FT                   /protein_id="CAH37548.1"
FT                   /translation="MNSGAFDEAAFDFLVSDEGGANVAADRARSAAKAAGAEPARDRID
FT                   ASVNVQHRLDEVRAAANPLLEAATPLLRMLADMPATLDTSEAVASLRTLLVREVALFQN
FT                   LCEKADLPWKHMAVVRYCLCTALDEAANRTRWGGGGVWASQSLLITYEGEVDGGEKFFL
FT                   LIGRMATDPQEYVDILEILYRVLGLGFEGRYSVVADGRRHLEQIRQRLWTLITGARDAI
FT                   QPELSLRWRGAEPGRLPLLRSVPAWASGALVFLLLFGLFAFYQYRLLTERNALEARILA
FT                   IAKDEPATPPQRLRLSILLKNEIARGLLTVDEDDRRSVVVFRGDAMFRSGESRVLPEIE
FT                   PVLDKVAREVARVGGRVTVTGHSDNQPIRRADIPNNLVLSEKRAAYVAQILVQRGTPAD
FT                   RIRSEGRGDAQPVAENATPAGRSRNRRVEIAVTL"
FT   misc_feature    123237..123296
FT                   /note="1 probable transmembrane helix predicted for
FT                   BPSS0102 by TMHMM2.0 at aa 245-264"
FT   misc_feature    123483..123779
FT                   /note="Pfam match to entry PF00691 OmpA, OmpA family ,
FT                   score 96.9, E-value 2.6e-26"
FT   CDS_pept        123821..127729
FT                   /transl_table=11
FT                   /locus_tag="BPSS0103"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Salmonella enterica subsp. enterica
FT                   serovar Typhimurium SciS protein precursor SWALL:Q93IR7
FT                   (EMBL:AJ320483) (1289 aa) fasta scores: E(): 8.3e-165,
FT                   45.82% id in 1305 aa, and to Yersinia pestis putative
FT                   membrane protein ypo2724 SWALL:Q8ZD68 (EMBL:AJ414153) (1275
FT                   aa) fasta scores: E(): 2.4e-94, 34.01% id in 1317 aa. Note:
FT                   Also similar to BPSS0167 (1359 aa) fasta scores: E():
FT                   3.2e-101, 47.210% identity in 1362 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37549"
FT                   /db_xref="GOA:Q63P43"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P43"
FT                   /protein_id="CAH37549.1"
FT                   /translation="MSYLKRFLRFVFSWQMLACIAVLLVCAAVWFVGPLLAFDELRPLA
FT                   GVVVRVAVIVLLVALLAFWLLRWPLSPIGVAALCLLIWHAGPLFAFGDHRPFGPAWVRV
FT                   LIVAAMLFCYAVYGLYRLWRAVRTNDALLKRILEPSAGKPDAAAQANIRAVSVAVSKAI
FT                   GQLKRLRGGAFGWRRLLESGRYLYELPWYMVVGAPGAGKSAAIARSGLKFPLADQMEAS
FT                   SERARGGTANCEWWFANEAVLIDTAGRYVRHEVPGDEEATVANGAEWKGFLGLLRKHRP
FT                   RAPVNGVVLSVSVEELVGRTPAERTAHAATLRARLGELHQELGIHFPVYVIVTKLDLLP
FT                   GFPEYFQSLTAEGRTQIWGFTLPYDAENRRSAVGALREHCADELKRLEMRIDAGLNNRL
FT                   LEEYENDRRKRLYALPQEFRSLSAALSDMLALVFLDSRYDDAQLQNTLRGVYFTSAEQT
FT                   DQVLAADRETILQRLKRQLGRMLGGDAGAQTRDSGAVSGSRGYFLRDVFQHVIVPEAHL
FT                   VRPNVRWEVRFRLMRWAGHLLAVALLVWLASALTVSFDNNRGYLDAISEKTAALAARVN
FT                   AYNKAPKPAQIGGVLDGARDLPQHGNLDLDAPGASFRYGLYVAPGIVDASDATYRSLLR
FT                   RSLLPQIVRRVEDALSAQIDAKHADEVYRTLTVYLMLDDAARHDAKAVKDWVMRDWERS
FT                   DSAAEMGGRNLMARHLDALFVDARPFEPSGHRNAALVQRARLFLNANPAPRRLYERAMA
FT                   AIEKEAPENFTLARAVGLQGAGIFRLADGSRFQRGMPGLYTYDGYHQVFSARLPEFLAR
FT                   AQSDDAWVMGNAGPAARWGDAIRNTQAVAGRSSLADDIRRQYLTDYGNYWQQYLADIRP
FT                   ASSGEDGAGGTLAFDLATLRALAAPDSPLVRLARAVVRETSLSVVDAREDASLTDAALS
FT                   SLGRRSGAAKEVADGAQKLAARRPEQRLEKELVDNRFAALREVVTGQADTGSGPAMTDV
FT                   PVAAGGRALQLDAILTLINEQYTRLVVADNALSSQSMPPALDIGTTLQMEAEKLPAPLR
FT                   TVLGGIATQAADKVGREVGSLLAMQVDSSVGNACRAAVDGKYPFARSAQEVDIEDFNRL
FT                   FAAGGLFDAFFQKALAPHVDTHSKPWRYKALNPGMPPIRGPSLEPFERAAAIRDVFFRE
FT                   PGAKRMAWRMDAKVASIDPEITELIVDVDGQSQRYVHGPVLPFSVNWPGPRGGAIAEIT
FT                   AKPRIRPDTSTIATTGPWALFRLIERGRLTGTTSASRLMLDFDFDGRHAALELRTNGQM
FT                   NPLTSGLLTHFRCPGSVG"
FT   misc_feature    order(123854..123922,123950..124018,124037..124093,
FT                   124121..124189,125417..125476)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BPSS0103 by TMHMM2.0 at aa 12-34, 44-66, 73-91, 101-123 and
FT                   533-552"
FT   misc_feature    124406..124429
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    126887..126910
FT                   /note="PS00501 Signal peptidases I serine active site."
FT   CDS_pept        127919..128488
FT                   /transl_table=11
FT                   /locus_tag="BPSS0104"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37550"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P42"
FT                   /protein_id="CAH37550.1"
FT                   /translation="MNIRNADTYTFDKLPSRHESSTQALERAIASNCTTLRTRIREYRE
FT                   IVAFRRQPHSKKLARALWTAAWRLPRVDEDWVAALSSRGNLATIAGVLGEWLGTHAMPV
FT                   GRVAAIDPPGGGDEIPEPRAAYCMRCVVEFGQKVVDARAPIDLDLAASHLVDAALSIGA
FT                   NLLIDVLLRRARVRIRHPSSAGGDGA"
FT   CDS_pept        128553..131252
FT                   /transl_table=11
FT                   /locus_tag="BPSS0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar in almost its full length to Yersinia pestis
FT                   hypothetical protein ypo2725 SWALL:Q8ZD67 (EMBL:AJ414153)
FT                   (921 aa) fasta scores: E(): 8e-76, 45.87% id in 896 aa,
FT                   C-terminal region to Shigella flexneri Rhs-family protein
FT                   sf0265 SWALL:AAN41925 (EMBL:AE015061) (737 aa) fasta
FT                   scores: E(): 7.7e-48, 41.75% id in 697 aa, and C-terminal
FT                   region where the highly repetitive fragment is to
FT                   Thermoproteus tenax virus 1 viral protein Tpx
FT                   SWALL:VTP3_TTV1V (SWALL:P19275) (474 aa) fasta scores: E():
FT                   1.6e-32, 59.53% id in 304 aa. Note: Contains a highly
FT                   repetitive region at the C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37551"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P41"
FT                   /protein_id="CAH37551.1"
FT                   /translation="MFLGKWKREDCMPNHFSNGRTNQSRTVVIRSGAMPRLLGQPALEF
FT                   LSLRGEEHLGKLYTYELLLRTPDDFHVPLATSANLDLKAMIGTEMTVCIQLDGIGTGAQ
FT                   GGVGAGAREISGLVVKAGFLRCEGRYNVYRIELRPWLWLATLTSDYKIFQDKSVVEIID
FT                   TVLHDYPYPVEKRLDIDKYSVAGESARNEPRAFQVQYGETDFDFVQRLMEEWGIYWFFE
FT                   HSDNKHRLVLCDHIGGHRKAPSEAYHEIAHHPEGGKIDIEYINYFSTDEALRPGRVVID
FT                   DFDFTRPLASLVTSNHQPRETNWGEGELFEWPGDYTDSKHGDLISRVRMEERRATGSRA
FT                   YGRGNVRGLACGHTFVLSKHKHDGANREYLVIESALMLTEVADETGSGYRYECDNELVV
FT                   QPSNEVFRMPRETPKPTTSGPQSAIVVGPPGHEVWTDEFGRVKIRFLWDRYARNDATDS
FT                   CWVRVSQAWAGVNFGGIYIPRIGQEVIVGFMNGDPDRPLILGSLYNTITPPPWDLPGDA
FT                   TKSGFKSKSITGGRENYNGIRFEDKLGAEEFHMQAEKDMNRLTKNDESHTVGANFSIGV
FT                   GLTHTRAVGAMFSSIVGGAASYAVGGAESTMIGGAYALNVGGAHAVAVGGASSVSVGGA
FT                   YARNVGGAYALTVGGVLSIVCGASSITMTACGSIKLVGKNIRIIGSDEVVVQGAPLQLN
FT                   PGDSDCGGGGGGGGGGGAIPPIPLPSFFLDITKPILPPPPPPPTEVPPDPTPTPTPTPT
FT                   PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTP
FT                   TPTPTPTPTPMPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT
FT                   PTPTPTPTPTPTPTPTPTPTPTPTSSEI"
FT   misc_feature    130398..130439
FT                   /note="PS00147 Arginase family signature 1."
FT   CDS_pept        join(131327..131593,131597..135061)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPSS0106"
FT                   /product="putative Rhs-like protein (pseudogene)"
FT                   /note="Pseudogene. Similar to Salmonella typhi Rhs-family
FT                   protein sty0321 SWALL:Q8Z953 (EMBL:AL627266) (1354 aa)
FT                   fasta scores: E(): 7e-85, 33.22% id in 1222 aa, and to
FT                   Yersinia pestis Rhs-like protein y0266 SWALL:AAM83860
FT                   (EMBL:AE013626) (963 aa) fasta scores: E(): 3.5e-63, 28.91%
FT                   id in 875 aa. CDS contains a nonsense mutation (ochre)
FT                   after codon 91"
FT                   /db_xref="PSEUDO:CAH37552.1"
FT   misc_feature    134030..134053
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(134954..136312)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo2951 or y1532 SWALL:Q8ZCN0 (EMBL:AJ414154) (445 aa)
FT                   fasta scores: E(): 4e-50, 36.11% id in 407 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37553"
FT                   /db_xref="InterPro:IPR021067"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P40"
FT                   /protein_id="CAH37553.1"
FT                   /translation="MNHSIFVQIASYRDPQLIPTLVDLIDRASRPEALRIVVCRQHALE
FT                   DTIGAFFAHGFSRWRADTTGEFAVHTLAFRGASIEMIDVPYQQSRGACWARNLIQQRYG
FT                   NERYTLQLDSHHRFIDGWDQQMVGMLESLRTFSAKPLITAYLPGFTPGCERRALSHTPL
FT                   AMTFFRFSPEGVVLFRARDIADWQAMAHPIPARFYSAHFAFADGHFAQTVRHDPHFFFH
FT                   GEEISLAVRAFTHGYDLYHPHRAIAWHEYTRRGRPKIWDDHTVEAKANGVVSRHWGELD
FT                   QRSHERNRALLGIDGASCTGIDFASYGLGTERTLAEYERYVGLSFAHRGVQPALIDGAP
FT                   PEPAARVRQSDDEWKSTLKRANEVRVWVHQNRFSEVLAPLHSCHMTVHDAGQTVLHAAT
FT                   VDADEFRRHHSGEWFGYSLDFLSELDQRPVDYVVELCDEAGRRLAEIECSLDA"
FT   CDS_pept        complement(136345..137373)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0109"
FT                   /product="putative exported protein"
FT                   /note="Similar to Yersinia pestis putative fimbrial protein
FT                   ypo2950 or y1533 SWALL:Q8ZCN1 (EMBL:AJ414154) (343 aa)
FT                   fasta scores: E(): 0.00019, 23.52% id in 357 aa, and
FT                   C-terminal region to Salmonella typhimurium fimbrial-like
FT                   protein precursor FimF or stm0548 SWALL:FIMF_SALTY
FT                   (SWALL:P37926) (172 aa) fasta scores: E(): 0.41, 27.38% id
FT                   in 168 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37554"
FT                   /db_xref="GOA:Q63P39"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P39"
FT                   /protein_id="CAH37554.1"
FT                   /translation="MKKKFSRFLAALVLLAATVDALAAGCNMLTAENIAWLTEQGKIAR
FT                   AHSSFPISFSSGMVDVDPNLEIGGLIAEAKSIPSEELHFIWCSAPSGNVHFALNSSPLP
FT                   SELGNSIYETGVPGVGFRITQVRQSGSIGAIPRDTPWIEEKPGQDSSLNFGAGTVFRIE
FT                   LIKTSEALPSESTISLGNLSRVYGDDNKTVVDFNAGSVKLRVLPICHVDQQEKNVDFGQ
FT                   FGPKDVSFDSGPTKDVKFDVQCSGPTPPVSITATLAATPDSHDQSLIANAGDAMNLAIR
FT                   LRDASTQQVLRPNDPTSEIKVEPGGAMEHGFALEATVLRVGTAPPTAGTIDATSIITLT
FT                   IL"
FT   misc_feature    complement(137305..137373)
FT                   /note="Signal peptide predicted for BPSS0109 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.812 between residues 23 and 24"
FT   CDS_pept        complement(137428..138498)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   enterica subsp. enterica serovar Typhimurium putative
FT                   cytoplasmic protein stm0266 or SciA SWALL:Q93IT5
FT                   (EMBL:AE008707) (351 aa) fasta scores: E(): 9.6e-42, 43.42%
FT                   id in 350 aa, and to Yersinia pestis hypothetical protein
FT                   ypo2949 SWALL:Q8ZCN2 (EMBL:AJ414154) (393 aa) fasta scores:
FT                   E(): 1.1e-31, 38.03% id in 376 aa. Note: Also similar to
FT                   BPSS0180 (382 aa) fasta scores: E(): 3.7e-28, 44.101%
FT                   identity in 356 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37555"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P38"
FT                   /protein_id="CAH37555.1"
FT                   /translation="MNATPSAAALRYADLLEPVSPDAPCGPDLEYDPAFVMLQSAIAPR
FT                   KDAQYGEFVEAPQPANWAEAERDCLALLLRTKDIRLVVILMRCRIRQSGAEGLRDGLTL
FT                   LNELLARYGEALHPVPFFEGERDPVVYANAIATLADPDATLADIREIPLPKASGLQLQL
FT                   RDIEKALAVTRVKDALAPESASRLLKEWWNRRDKTIAALAQAQRIVADLIASTRESLGD
FT                   DAPDLSGIAKLLHPFAQAQLESPYSANAAQPQGDAKPATGDAAHARAADTSAQAGDTDT
FT                   QAPAAMPIAPAQPPMDRWGALAAIQATRLWFEQNEPSSPVIVLLRQSERMVGKRFSEIA
FT                   NAIPAELLAQWDAIDV"
FT   CDS_pept        complement(138517..139566)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo2948 SWALL:Q8ZCN3 (EMBL:AJ414154) (341 aa) fasta scores:
FT                   E(): 5.7e-72, 52.1% id in 332 aa, and to Salmonella
FT                   enterica subsp. enterica serovar Typhimurium SciB protein
FT                   SWALL:Q93IT4 (EMBL:AJ320483) (291 aa) fasta scores: E():
FT                   9.5e-68, 57.54% id in 285 aa. Note: Also similar to
FT                   BPSS0179 (363 aa) fasta scores: E(): 2.8e-68, 55.224%
FT                   identity in 335 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37556"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P37"
FT                   /protein_id="CAH37556.1"
FT                   /translation="MTAHPPAARPIDAHSPLHPDALRAWFDPQAPWRAGFLSLLRAIAA
FT                   RDTRVPLPGTACLPKEEAFRIGQRPSMAFAPREIASLDVQRGRLDIQLFGLGLWGPQGP
FT                   LPLHMTELAYNRAESYQDHAIAHFSNLFHHRALALFYRAWASSQATVSLDRAEHETFSF
FT                   YIGSLMGTDPEEAARTHPPTHARYAACAHLVREARNPDGVAATLSHYFGVPIAVDEYVF
FT                   HWIRIAPPERCLLGARAASTVMGEGALLGDMVADCQHKFRLVIGPLDLDQYLRLTPHGN
FT                   DLPTLVDWVRAFVGHEYDWEIKLLVKPRAAPPARADTTHRLGYSTWLGESRDDRPVVGM
FT                   VFEPEKYCS"
FT   CDS_pept        complement(139563..141443)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo2947 or y1537 SWALL:Q8ZCN4 (EMBL:AJ414154) (626 aa)
FT                   fasta scores: E(): 3.3e-177, 64.05% id in 626 aa, and to
FT                   Salmonella enterica subsp. enterica serovar Typhimurium
FT                   SciC protein SWALL:Q93IT3 (EMBL:AJ320483) (627 aa) fasta
FT                   scores: E(): 8.1e-163, 60.92% id in 627 aa. Note: Also
FT                   similar to BPSS0178 (630 aa) fasta scores: E(): 1.5e-156,
FT                   63.796% identity in 627 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37557"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P36"
FT                   /protein_id="CAH37557.1"
FT                   /translation="MDPQFLDHYNRELTYMRELSAEFAAQHPKIARRLGMQGIEVADPY
FT                   VERLIEAFCFMSARTQLKLEAEFPRFTQRLLEVAYPNYVAPTPSMAVARLRPSLREGDF
FT                   SKGFKVPRHSMLRSSIPPGEQTACEFRTGQDITLWPIEIAGATLTAVPPDLPDLQRSLL
FT                   PHTKLRGALRLRVRTVGEIRFSQITGLDRLSLYIGGDERIASHLFELIHASSVASVVRA
FT                   PGAARGEGAVVAKNAVDFEGLSPDQSLLPLVWNTFHGHNLLHEYFTCRQRFYFFALTQL
FT                   NAGLSRIDGKEAEIVLLLDRLPDELVTHVEAARFLLFCAPIVNLFPKRTDRVEINRAQT
FT                   AFHLIPDRTRPLDYEVFSVSRVFGQKAETSTEVTFNPLYQTLHSDIGNYGRYFSILREP
FT                   RTTSTNARKYGTRTPYVGTEVYVSLVDQAEAPYADDIRYLSVDAWVTNRDLPRLIPRNG
FT                   VNDLTMQDSVPIEGVSLVHPPSAPREPYATGETAWRLIRQLSFNYMPLAELDHRDGGQA
FT                   LRNMLRLFVGTSEREQATQIDSLVGARTEPVVRRLPGHGLLVYGRGVRCELTVDESGFS
FT                   GLSPYLFGLVLEQYLTRHVSINVFTETELRSMQRGLVTRWKPRMGGRGAV"
FT   CDS_pept        complement(141445..141963)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   enterica subsp. enterica serovar Typhimurium putative
FT                   cytoplasmic protein stm0269 or SciD SWALL:Q93IT2
FT                   (EMBL:AE008707) (164 aa) fasta scores: E(): 1.2e-21, 43.79%
FT                   id in 153 aa, and to Yersinia pestis hypothetical protein
FT                   ypo2728 or y1561 SWALL:Q8ZD64 (EMBL:AJ414153) (159 aa)
FT                   fasta scores: E(): 3.1e-20, 40.12% id in 157 aa. Note: Also
FT                   similar to BPSS0177 (194 aa) fasta scores: E(): 1.6e-24,
FT                   45.912% identity in 159 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37558"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P35"
FT                   /protein_id="CAH37558.1"
FT                   /translation="MRHPEGRHRAAYLPSLLDRLQDDAPHALSESPDAYAPSADEMRRI
FT                   VQRDLSLLLNTSNLDDEVDARRYPLVSASVVNYGVPPLAGSYLHDRNRETIERLVRTAI
FT                   AHFEPRLIADSLAIRPLAAQPGASYNKLTFEISALVQWSPYPLELRIQSTFDLELNRVT
FT                   LEKTTLNGN"
FT   CDS_pept        complement(141950..142804)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Salmonella enterica subsp. enterica
FT                   serovar Typhimurium SciE protein SWALL:Q93IT1
FT                   (EMBL:AJ320483) (279 aa) fasta scores: E(): 5.9e-38, 39.85%
FT                   id in 276 aa, and to Yersinia pestis hypothetical protein
FT                   ypo2727 or y1560 SWALL:Q8ZD65 (EMBL:AJ414153) (268 aa)
FT                   fasta scores: E(): 8.6e-36, 39.36% id in 254 aa. Note: Also
FT                   similar to BPSS0176 (322 aa) fasta scores: E(): 4.8e-29,
FT                   39.590% identity in 293 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37559"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P34"
FT                   /protein_id="CAH37559.1"
FT                   /translation="MTNRSESPQPSDPRDAMLRDALRAQSFEEIKARTAEAVRKRPSDT
FT                   RERWLLFQLLCIDGAWERALKQLQTWAGLEPQGEARAQLHRGLIRCEMFRADVFAGKRT
FT                   PGFIDAQPAWVDTLLQANAKLGAGDVAAADTLREAAFHCAPVTRGESAEMGSFAWLTDS
FT                   DTRLGPIFEIAVAGGYRWIPFEQLKSITFTPAGTLTDLVWRPVTALMLDATVLRGYAPT
FT                   RYSGSENGATAIRLASETTWRDIGTTNVVALGQRTWTTDQGDWGMLQIGGCRFTGESDD
FT                   AAS"
FT   CDS_pept        complement(142788..143843)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0115"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37560"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P33"
FT                   /protein_id="CAH37560.1"
FT                   /translation="MSKNGSPLKSDRSRHASAHHEAPDVPTPLVSLARYEGRDASPPRQ
FT                   HAIGAAGCVYFVQANRFEAWDARIGIPNDGIIFAAEPDGSLRMENHCARADCRVNGEAV
FT                   APGACRHLERGDVIAVAAAELTIQDGASAREPSAPRQPPVDLIALGNALPRSEPAHFAD
FT                   LAELANLPAAAHPHGRASAGAAAPLVILDEEALSDAAPPAFDSTNHDPLAHLLTEYRRA
FT                   LIHQERSYAHALKSIERPQIAVPLPDDPFLDAPGRYRRGSLLGDLLGSRQNIDYVLDEM
FT                   NPFRAEALFADEARHDVLLLLAPRRRKKAHFPQTALLARHEHHLMSVDSHFPTLGAETD
FT                   IQQEEPNDESI"
FT   CDS_pept        144273..146918
FT                   /transl_table=11
FT                   /locus_tag="BPSS0116"
FT                   /product="putative chaperone-related protein"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   enterica subsp. enterica serovar Typhimurium putative
FT                   ATPase with chaperone activity, homolog of Yersinia ClpB
FT                   stm0272 or SciG SWALL:Q93IS9 (EMBL:AE008707) (879 aa) fasta
FT                   scores: E(): 4.1e-196, 63.58% id in 865 aa, and to Yersinia
FT                   pestis putative Clp ATPase ClpB or ypo0506 or y3669
FT                   SWALL:Q8ZIJ2 (EMBL:AJ414143) (867 aa) fasta scores: E():
FT                   1.9e-121, 44.6% id in 843 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37561"
FT                   /db_xref="GOA:Q63P32"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P32"
FT                   /protein_id="CAH37561.1"
FT                   /translation="MTVSRQALFGKLGYSLFRSIESATAFCKLRGNPYVELVHWLHQML
FT                   QAADGDMQRIARHCDIDLGELERDMVRALGELPAGASSISDFSHHIETAIERAWVLATL
FT                   DFGDRRIRGAWLLAALLKTPELRRVLLSISSAFGRIRVDELDAMLPAWIDGSPEANETP
FT                   YDDSDFGAAIPGEASSAMQQKGGGSPLEQFCLDLTARARAGQIDPVVGRELEIRTMIDV
FT                   LLRRRQNNPLLTGEAGVGKTAVVEGLARAIAAGDVPPKLADARLLSLDVGALLAGASMK
FT                   GEFEARLKGVLEAAAKATLPVILFVDEIHTLIGAGGQAGTGDAANLLKPALARGTLRTI
FT                   GATTWAEYKRHIEKDPALTRRFQVLQVPEPDEAAAIDMVRGLTRTFSRHHGVVVLDEAI
FT                   RAAVKLSHRYIPSRQLPDKAISLLDTACARVALSQHAPPRELQDVRRRLEAARVRLELL
FT                   DGEQRIGLGDEAALAQSRAEIAALEVEEQSIDACWRQQIEAAQTLLSAREAAGDAAASA
FT                   IDALRELEHALSNLQGDHAFVFPEVNEAIVAEIMSDWTGIPVGRMVTDEVSAVRALPDT
FT                   LAARVIGQRDALHQIGDRVQTARAGLTDPKKPLGVFLLAGPSGVGKTETALALAEALYG
FT                   GEQNLITINMSEYQEAHTVSGLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAH
FT                   PDVHEMFFQVFDKGYMEDGDGRYIDFRNTTILLTSNAGSDLVSGLCMDEACAPDADGLC
FT                   AALASELLKTFPAAFLGRVTLVPYRPLAQETLSRIVRLHLDRVVTRMAENQGVALRYSD
FT                   NVVDYVVNRCLVQETGARLLIGFIEQHVLPLLAKLWLDSLASKHVLTRVDLDVADPAAA
FT                   PTEAFALRAS"
FT   misc_feature    144585..144626
FT                   /note="PS00213 Lipocalin signature."
FT   misc_feature    144960..145544
FT                   /note="Pfam match to entry PF00004 AAA, ATPase family
FT                   associated with various cellular activities (AAA) , score
FT                   27.8, E-value 5.1e-07"
FT   misc_feature    144975..144998
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    145239..145277
FT                   /note="PS00870 Chaperonins clpA/B signature 1."
FT   misc_feature    146118..146141
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(147309..150353)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0117"
FT                   /product="putative histidine kinase/response regulator
FT                   fusion protein"
FT                   /note="Similar to Ralstonia solanacearum probable capsular
FT                   synthesis regulatory RcsC or rsp1622 or rs02179
FT                   SWALL:Q8XPL6 (EMBL:AL646086) (1098 aa) fasta scores: E():
FT                   1.2e-48, 27.88% id in 1126 aa, and C-terminal region to
FT                   Escherichia coli sensor protein EvgS precursor or b2370
FT                   SWALL:EVGS_ECOLI (SWALL:P30855) (1197 aa) fasta scores:
FT                   E(): 2.1e-40, 32.07% id in 555 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37562"
FT                   /db_xref="GOA:Q63P31"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P31"
FT                   /protein_id="CAH37562.1"
FT                   /translation="MPGKLKELLIQPFKLNHRKALFDPRRMLAHQRLLTYGGAIGISAF
FT                   ILFCLLLMIRMEAMDYVSNARSEFLIQQSKLTIKLQIRRTALMRAVMHAEGLWNRRIEP
FT                   STELLSQFDAHQGYAVLHTPQGAPAALAVGIPAPGRSASAFAPYLALLETQLLMGDGQS
FT                   PLPDDRVEGYSFSPDGTYLSLLWSREDQAPEAFIESHSASGLIGDAMRGIRYLRDASTI
FT                   VPLRADRRTVWLPPHPDPLTGKPMIRIVQPAIDATGKLFAIYVRSLPLDMFYSNLNDAP
FT                   AGSTLTIVDRKGNVILGSSNQHGGDGGATASALGIRSLGDGFGGLVERYQDGMFVTSDQ
FT                   LPGTDWVLVHAYSWKTIAAALALRFSLVTGLVAGIIVMLWLFAIQFDRKGLIPNYRRAQ
FT                   RLLESEVLNRTILRTAPVGLGLLSAQDGSVLLQNNAMLELSARTSDEPLPIRLWEAYRH
FT                   AVGRSSDEDGALLQHDLAIEREGANPVYLQANVVAARYRGANVLLCTLLDISLRKESEL
FT                   KLKEARIAADQANKAKSTFLATMSHEIRTPLNAIIGNLELLRRSPLSEQQSERLHVVES
FT                   CSNALLHIINDILDLSKVESGQMTLENIPFDIHALLQETVDAYAPLAESKGLALLSSIG
FT                   EGVARHYAGDPTRIRQVLSNLIGNAIKFTERGHISIDVHRAKAARDGSAIEIWVNDTGI
FT                   GIRPDRIATLFDVYTQADASIHRRFGGSGLGLPLCQRLVTIMGGSIEIDSLPDFGTTVT
FT                   VALPLREARHATALSNGPAARRRNATALARPTLHVLVAEDHPANRALLRDQLEALDHRV
FT                   DVVENGREALRAFGEHQYDIVLTDLGMPELDGYGFARFANKMRAGTPIVAMTAHATDED
FT                   YQRSKKVGIAEIVLKPLSLTTLEKVLQRHAMRAPAEEIVTAAGPGPAHAEPRMRALPPA
FT                   VAAALRTATLQSIDKIAQALAARNFETIRQELHSIKGGFALTGNRLLIARCAATEELAE
FT                   AEDLDTLRAAWRKLEASLLEALERL"
FT   misc_feature    complement(147639..147998)
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain , score 110.1, E-value 2.8e-30"
FT   misc_feature    complement(148077..148424)
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase , score
FT                   130.5, E-value 2e-36"
FT   misc_feature    complement(148563..148760)
FT                   /note="Pfam match to entry PF00512 HisKA, His Kinase A
FT                   (phosphoacceptor) domain , score 98.4, E-value 9.2e-27"
FT   misc_feature    complement(order(149205..149273,150192..150260))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPSS0117 by TMHMM2.0 at aa 32-54 and 361-383"
FT   CDS_pept        151025..151285
FT                   /transl_table=11
FT                   /locus_tag="BPSS0118"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37563"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P30"
FT                   /protein_id="CAH37563.1"
FT                   /translation="MAFVYSIARPEPASFEHSSYGILAVTYDCGALQVRQGISAFGVAG
FT                   VQQYARCNDLFPFHPCFATRGRREEYEVVEKHQELPPLILG"
FT   CDS_pept        complement(151956..152618)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0119"
FT                   /product="putative two-component system response regulator"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 capsular synthesis regulator
FT                   component B RcsB or b2217 or c2760 or z3476 or ecs3106
FT                   SWALL:RCSB_ECOLI (SWALL:P14374) (216 aa) fasta scores: E():
FT                   9.3e-24, 41.34% id in 208 aa, and to Pseudomonas aeruginosa
FT                   probable response regulator pa4080 SWALL:Q9HWU8
FT                   (EMBL:AE004824) (214 aa) fasta scores: E(): 6.8e-35, 47.84%
FT                   id in 209 aa. Note: Also similar to BPSS0124 (243 aa) fasta
FT                   scores: E(): 3.7e-33, 45.283% identity in 212 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37564"
FT                   /db_xref="GOA:Q63P29"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P29"
FT                   /protein_id="CAH37564.1"
FT                   /translation="MTVFSIKVVIADDHPAVLTGLLHALAPVSSIEVVSACKNSTELLT
FT                   ALNEYPCDVVISDYNMPDDNFGDGISLFSYIQRRYPSTRLIALTMISNPAIIHNLISHG
FT                   ISTVLSKSDEIGHIIAAIHASYAKGSYLSPTMETIVNSGHGKSSDGEVQLSPREIEVVR
FT                   LFTSGLSVNEIANRLKRSKQTISSQKANAMRKLGVNSDIDLLKYALKAKLVEDTNSY"
FT   misc_feature    complement(151971..152168)
FT                   /note="Pfam match to entry PF00196 GerE, Bacterial
FT                   regulatory proteins, luxR family , score 77.6, E-value
FT                   1.7e-20"
FT   misc_feature    complement(152034..152117)
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT   misc_feature    complement(152049..152114)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1137.000, SD 3.06 at aa 169-190, sequence
FT                   LSVNEIANRLKRSKQTISSQKA"
FT   misc_feature    complement(152229..152603)
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain , score 82.7, E-value 4.9e-22"
FT   CDS_pept        complement(153167..155551)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0120"
FT                   /product="putative fimbrial usher protein"
FT                   /note="Similar to Yersinia pestis putative outer membrane
FT                   fimbrial usher protein ypo0302 or y0562 SWALL:Q8ZJ27
FT                   (EMBL:AJ414142) (792 aa) fasta scores: E(): 1.4e-120,
FT                   42.67% id in 764 aa, and to Escherichia coli outer membrane
FT                   usher protein precursor FanD SWALL:FAND_ECOLI
FT                   (SWALL:P12050) (783 aa) fasta scores: E(): 5.4e-22, 22.91%
FT                   id in 768 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37565"
FT                   /db_xref="GOA:Q63P28"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P28"
FT                   /protein_id="CAH37565.1"
FT                   /translation="MYARRLVLSFSLLLGIAWGSNDALAVSSPSPSAAVEFDTQTLIAR
FT                   GYSADIAKFFSGDSRFLPGKQEVTIALNANQTYTTNVQFDDDGDPCFDAALLDTLRLRK
FT                   PSDLAGCADPEQMWPEFHMKLHPGQFRIDMTVPEEAFDPRRRGNGLHSGGEAVLLNYDV
FT                   FAQRFDTRFGSSHYLQARLEPGFNIGNWFFRNRGALTHSGKGFSYQLQDTYLARTVDAW
FT                   GAITQIGQFTSTGENLGGLPMLGFQISSDRLQNSGQLTVPIQGIAESNATVEVRQRGRV
FT                   VYRTIVPPGPFMLSDIGSVAQNADLQIEITEQDGRKRRFEMPVGMGYADAKQPTTWQAA
FT                   IGRYQDAGNSDRTRAPAIFATGEISFSPLDNLRVSTAALAASGYLHASVQGTLSAKSGA
FT                   WLASGVRYSRMAGAGQGYQFELQGSSRIGGNVFASASWLSRSIRYTTPDVALGSLGDAT
FT                   GTGQTKHSANASINWAHPRWGSFTYGLSYNSFVGAPNSVSHTLSIGRKIGRANVSLAAQ
FT                   ISPKSGSSVYANVSIPLGGGSLSARTTRSQRGDLTFGTSYGNRLGRDGSYSIGASGSKS
FT                   GQTANASVSMRTGFAQFGAGVAQSTSNSRSTYLSASGGIAYANGLFGTASSRIGETFAI
FT                   VSVPNQKGLRISAPGGTSITNPFGTAVISSLTPYTKAQLRLDTQSLPMNVRLDTTTVDI
FT                   GLRRGSVLTRTIHAAETRQLMLTIRDSTGATAPVGTTVLDEQGQFLGTIIGDGNFILND
FT                   DDIGRPIRLSGVNRSECRVTYEAPARFDPNQPYEEAEGTCG"
FT   misc_feature    complement(153221..155449)
FT                   /note="Pfam match to entry PF00577 Usher, Fimbrial Usher
FT                   protein , score 159.6, E-value 3.5e-45"
FT   misc_feature    complement(154661..154693)
FT                   /note="PS01151 Fimbrial biogenesis outer membrane usher
FT                   protein signature."
FT   misc_feature    complement(155450..155551)
FT                   /note="Signal peptide predicted for BPSS0120 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.520 between residues 34 and 35"
FT   CDS_pept        complement(155912..156622)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0121"
FT                   /product="putative fimbrial chaperone"
FT                   /note="Similar to Yersinia pestis putative fimbrial
FT                   chaperone ypo0303 or y0563 SWALL:Q8ZJ26 (EMBL:AJ414142)
FT                   (247 aa) fasta scores: E(): 3.3e-35, 46.26% id in 201 aa,
FT                   and to Escherichia coli hypothetical fimbrial chaperone
FT                   precursor YhcA or b3215 SWALL:YHCA_ECOLI (SWALL:P28722)
FT                   (224 aa) fasta scores: E(): 5.9e-18, 30.49% id in 223 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37566"
FT                   /db_xref="GOA:Q63P27"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P27"
FT                   /protein_id="CAH37566.1"
FT                   /translation="MNSLMLSHILFRSSRIKTFLASLFAACSLQSHAATFTLENPTIIF
FT                   NETDQRVAFNVKNDGESPMLLISKLEDLGEDKLSQRFLIAPPIARIDPGQSQQINFSLK
FT                   KGAKLEHEYMLKASFEGVSQTGRGSLVMPVRQEIGFLVQAGAIPVSKTPWDNLKLSVKD
FT                   KQLTLSNPSAHVIRLAPSVKLLPTNKMVALAHAYLMPGESRTVEIDDATDKIEIVPLSR
FT                   YGLVLPAVTMPVQH"
FT   misc_feature    complement(156326..156520)
FT                   /note="Pfam match to entry PF00345 pili_assembly,
FT                   Gram-negative pili assembly chaperone, N-terminal domain ,
FT                   score 34.5, E-value 5.6e-10"
FT   misc_feature    complement(156524..156622)
FT                   /note="Signal peptide predicted for BPSS0121 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 33 and 34"
FT   CDS_pept        complement(157098..157745)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0122"
FT                   /product="putative exported protein"
FT                   /note="Similar to Yersinia pestis putative exported protein
FT                   ypo0301 or y0561 SWALL:Q8ZJ28 (EMBL:AJ414142) (212 aa)
FT                   fasta scores: E(): 3.1e-26, 41.09% id in 219 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37567"
FT                   /db_xref="InterPro:IPR010546"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P26"
FT                   /protein_id="CAH37567.1"
FT                   /translation="MKPKITFYAISIIIAQLWSANIQADTPNLDLMVKGTIDVPSCTVS
FT                   VANNGIYDYGKILPTIITSGTGHTDLGKMTKAWSVNCDANTFMTFKVTDNRSESASVSS
FT                   HDSRTLNTFGLGMVNKTGKLGYYTIKMTNPTVDGEATKLFNTLQTSDTDIYVRHSDIIQ
FT                   GWGSPNSLAIGRDFTADLTVNAYLAGTSIMAGPLTESIDLDGSTTLSFAFGL"
FT   misc_feature    complement(157674..157745)
FT                   /note="Signal peptide predicted for BPSS0122 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.989) with cleavage site
FT                   probability 0.973 between residues 24 and 25"
FT   CDS_pept        complement(157968..158624)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0123"
FT                   /product="putative exported protein"
FT                   /note="Similar to Yersinia pestis putative exported protein
FT                   ypo0301 or y0561 SWALL:Q8ZJ28 (EMBL:AJ414142) (212 aa)
FT                   fasta scores: E(): 6.2e-34, 48.13% id in 214 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37568"
FT                   /db_xref="InterPro:IPR010546"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P25"
FT                   /protein_id="CAH37568.1"
FT                   /translation="MKLKTSLLALSIAMLGTTAAHAAAPTQDLIVKGSIDVPACTVVAA
FT                   DNGVYDYGKISPTLIKSGTATTPLAKMEKAWTVNCDAETYMSFKVTDNRSDSASSGDNT
FT                   AFGLGKVNETGKLGYYSVTMQDAQVDGKKARVYATPSTSLGGTGVVATYQKLNKLPSYT
FT                   HGWANESSATQLAGKNFTANMVVEAVLAGTETMGGALKDAVDLDGSATLTFAFGL"
FT   misc_feature    complement(158559..158624)
FT                   /note="Signal peptide predicted for BPSS0123 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 36 and 37"
FT   CDS_pept        159632..160324
FT                   /transl_table=11
FT                   /locus_tag="BPSS0124"
FT                   /product="putative response regulator"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 capsular synthesis regulator
FT                   component B RcsB or b2217 or c2760 or z3476 or ecs3106
FT                   SWALL:RCSB_ECOLI (SWALL:P14374) (216 aa) fasta scores: E():
FT                   1.5e-21, 35.61% id in 205 aa, and to Pseudomonas aeruginosa
FT                   probable response regulator pa4080 SWALL:Q9HWU8
FT                   (EMBL:AE004824) (214 aa) fasta scores: E(): 9.9e-31, 47.61%
FT                   id in 210 aa. Note: Also similar to BPSS0119 (221 aa) fasta
FT                   scores: E(): 6.9e-29, 45.283% identity in 212 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37569"
FT                   /db_xref="GOA:Q63P24"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P24"
FT                   /protein_id="CAH37569.1"
FT                   /translation="MKIDLIVADDHPALIAGIEHALSKSSAISVAGTASNSTELVDLLA
FT                   RERCDILITDYAMPGGSHGDGLGLLSFLRRHYPDLKIIVFTAIDNPALIASMARLGVRA
FT                   VVNKMDHIDNLIASIQAVYAGATYIPAGVDAFVSSRPAGDEHTPEIERQLSARELEIVR
FT                   LYVSGLSVNEIAAYLHRSKQAVSTQKMNAMRKLGIERDAGLFRYAYETGLMAAGVPSAS
FT                   PVSAQAVH"
FT   misc_feature    159638..160012
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain , score 82.4, E-value 6.2e-22"
FT   misc_feature    160082..160279
FT                   /note="Pfam match to entry PF00196 GerE, Bacterial
FT                   regulatory proteins, luxR family , score 59.4, E-value
FT                   5.2e-15"
FT   CDS_pept        complement(160633..160926)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0125"
FT                   /product="putative regulatory protein"
FT                   /note="Similar to Ralstonia solanacearum putative HNS-like
FT                   transcription regulator protein rsp0029 or rs02004
FT                   SWALL:Q8XTS5 (EMBL:AL646076) (95 aa) fasta scores: E():
FT                   4e-06, 34.4% id in 93 aa, and low similarity to Rhodobacter
FT                   capsulatus trans-acting regulatory protein HvrA
FT                   SWALL:HVRA_RHOCA (SWALL:P42505) (102 aa) fasta scores: E():
FT                   0.84, 31.64% id in 79 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37570"
FT                   /db_xref="GOA:Q63P23"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P23"
FT                   /protein_id="CAH37570.1"
FT                   /translation="MNSYQEYKQHVKTLQATLDRERKAISAKVLQEIRECIAEFGFTPQ
FT                   EVFSSKKKREPKYYDPVSGSTWTGLGREPEWIRGKDRKAFELSSHQRDDHCR"
FT   CDS_pept        161417..162742
FT                   /transl_table=11
FT                   /locus_tag="BPSS0126"
FT                   /product="putative transport system, membrane protein"
FT                   /note="Similar to Agrobacterium vitis putative tartrate
FT                   transporter TtuB SWALL:TUB3_AGRVI (SWALL:P70786) (449 aa)
FT                   fasta scores: E(): 1.5e-62, 42.23% id in 412 aa, and to
FT                   Xanthomonas campestris MFS transporter xcc4227
FT                   SWALL:AAM43443 (EMBL:AE012550) (461 aa) fasta scores: E():
FT                   1.2e-100, 61.88% id in 446 aa. Note: This CDS is shorter in
FT                   its N-terminal region than most of its database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37571"
FT                   /db_xref="GOA:Q63P22"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P22"
FT                   /protein_id="CAH37571.1"
FT                   /translation="MTPPSSVAARPASDPLNDGYRKVTFRLIPLIFVCYLFNYLDRVNV
FT                   GFAKLQMLSDLNMSETVYGLGAGIFFIGYVLAGVPSNLVLRRVGARAWIAIIMVVWGAL
FT                   SSALLCVKTPASFYTLRFFTGIAEAGFFPGMVLYLTQWFSAEHRGRAIALFMSAIPISG
FT                   VIGGPLSGWMLDHFSAGQGGLAGWQWLFLLQGAPTIVLGVAVFALLEDRIDDARWLSAD
FT                   EKAALARAVATTAADAAIASAGRPNTLRDILLNGAVWKFGIVYFSIQMGVYAINFWLPS
FT                   IIRSLGVGGSGAIGWLSAIPYLFASVAMIAVGKSADARQERRWHLSVPMAVGVAGLLMA
FT                   AQSGNAIVPAMIGLVLATAGALTALAMFWPLPTLVLTGSAAAGGVALINSLGQIAGFVS
FT                   PYIVGWIKDATQRTDLALYILSSTMVVGIVLVMRTHARGAGR"
FT   misc_feature    161435..162733
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter , score -90.8, E-value 0.00012"
FT   misc_feature    order(161483..161536,161603..161671,161690..161749,
FT                   161765..161833,161870..161938,161975..162043,
FT                   162197..162265,162293..162352,162386..162439,
FT                   162452..162520,162533..162601,162659..162712)
FT                   /note="12 probable transmembrane helices predicted for
FT                   BPSS0126 by TMHMM2.0 at aa 23-40, 63-85, 92-111, 117-139,
FT                   152-174, 187-209, 261-283, 293-312, 324-341, 346-368,
FT                   373-395 and 415-432"
FT   misc_feature    162272..162358
FT                   /note="PS00107 Protein kinases ATP-binding region
FT                   signature."
FT   misc_feature    162338..162361
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        162816..163982
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /gene_synonym="glxB5"
FT                   /locus_tag="BPSS0127"
FT                   /product="glycerate kinase 1"
FT                   /EC_number="2.7.1.31"
FT                   /note="Similar to Escherichia coli glycerate kinase 1 GlxK
FT                   or GlxB5 or b0514 SWALL:GRK1_ECOLI (SWALL:P77364) (381 aa)
FT                   fasta scores: E(): 2.6e-63, 55.05% id in 376 aa, and to
FT                   Xanthomonas axonopodis glycerate kinase xac4360
FT                   SWALL:AAM39190 (EMBL:AE012090) (389 aa) fasta scores: E():
FT                   1.6e-77, 64.3% id in 381 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37572"
FT                   /db_xref="GOA:Q63P21"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P21"
FT                   /protein_id="CAH37572.1"
FT                   /translation="MKIVIAPDSFKESLTAVETARQIEAGFREVFADADYRCLPIADGG
FT                   EGTVDALVAAAGGERRGASVADPLGRPTRAAFGILPDGTAVIEMAEASGLHLVAPDARD
FT                   PRVTSSRGTGELIRAALDAGARRFIVGLGGSATNDGGAGMLQALGVHLSDADGRPLGPG
FT                   GAALARLARIDAAGLDGRLAECAFEVACDVDNPLVGPNGASAVFGPQKGATPEMVADLD
FT                   RHLAHFAAIVARDVGPDVAQLPGGGAAGGLGAAMSAFLGATLRPGVEIVTDALRLRDAI
FT                   RGASLVVTGEGRIDGQTLRGKAPIGVARIAAECGVPVVAIGGAVTHQAGALYAHGFDAV
FT                   FASVGRACTIDEALRDAAANVRFAARNVAAAIRVGLKLGRHAPSRRLA"
FT   misc_feature    162816..163946
FT                   /note="Pfam match to entry PF02595 DUF168, Uncharacterized
FT                   BCR, COG1929 , score 650.6, E-value 5.3e-193"
FT   CDS_pept        164175..165629
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="BPSS0128"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="Similar to Bacillus stearothermophilus pyruvate
FT                   kinase Pyk SWALL:KPYK_BACST (SWALL:Q02499) (587 aa) fasta
FT                   scores: E(): 1.7e-60, 41.27% id in 470 aa, and to
FT                   Pseudomonas aeruginosa pyruvate kinase I PykF or pa1498
FT                   SWALL:Q9I3L4 (EMBL:AE004578) (477 aa) fasta scores: E():
FT                   1.5e-83, 55.57% id in 466 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37573"
FT                   /db_xref="GOA:Q63P20"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P20"
FT                   /protein_id="CAH37573.1"
FT                   /translation="MRNESHTARERRRSTKIVATLGPSSSTETAIEALARAGADVFRLN
FT                   FSHGTHADHALRHAAVRAIEARIGHPIGVLLDLQGPKLRVGQFASGRAQIAKGRPFVFD
FT                   RDPAPGDARRVSLPHPEIFDAARPGHLLLVDDGKLRFRVDAVSSARIETTALLDGIVSD
FT                   RKGVSVPDATLAIPALSAKDRDDLEFGLSLGVDWVALSFVQTAQDVRDARALIGARAAI
FT                   VAKIEKPQAVANIAEIVDAADAVMVARGDLGVEMSLEDVPSVQKQIIRLARAAGKPVIV
FT                   ATQMLESMTLAPTPTRAEASDVAAAVYDGADAVMLSAESASGQYPVEAVDFMRKIISTT
FT                   EADPIQPQLMKAIVTAHAPNATDAIGAAIEVVSDTLRLGVAVTYTASGATAIRLSRLRP
FT                   STAILSLTPRAEIARRLTLAWGVRSRVAAEATGIENIVEIAIEAAHAEGFATDECPIVV
FT                   AAGVPFGHPGSTNLMRIVWPTEMTRQ"
FT   misc_feature    164199..165224
FT                   /note="Pfam match to entry PF00224 PK, Pyruvate kinase,
FT                   barrel domain , score 472.9, E-value 1.6e-139"
FT   misc_feature    164832..164870
FT                   /note="PS00110 Pyruvate kinase active site signature."
FT   misc_feature    165258..165605
FT                   /note="Pfam match to entry PF02887 PK_C, Pyruvate kinase,
FT                   alpha/beta domain , score 40.1, E-value 3.4e-09"
FT   CDS_pept        165876..167096
FT                   /transl_table=11
FT                   /locus_tag="BPSS0129"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Escherichia coli carbohydrate diacid
FT                   regulator CdaR or SdaR SWALL:CDAR_ECOLI (SWALL:P37047) (385
FT                   aa) fasta scores: E(): 8.2e-49, 40.63% id in 379 aa, and to
FT                   Xanthomonas campestris sugar diacide regulator xcc4225
FT                   SWALL:Q8P353 (EMBL:AE012550) (392 aa) fasta scores: E():
FT                   2.2e-47, 40.56% id in 392 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37574"
FT                   /db_xref="GOA:Q63P19"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P19"
FT                   /protein_id="CAH37574.1"
FT                   /translation="MMIDARLATEIVVRTVEVMPFDVNVMDAHGVILASSDAARVGEIH
FT                   AGAQLALARARAVEIDDAMAANLSGARPGINLPLSVRGKVCGVIGVTGEPDAVRGFGEL
FT                   LRVTAELILEREQLTVELRRNARHREEFVLQLLRRTAAAAELEAWADRLGIDMRLAHAA
FT                   IVCRLSGVDTEPEAGVGQIEAMQSQLAQEWPQLLSAKTSYRELVMFDAVDARAGRDGVL
FT                   ATHAGKRLAALEDTLRKVATQPFSLALGIALDGIDGFERSYQCALATLRVGAARTPQRA
FT                   AYSYYDFVLPVLLSALSQGWQARQLRLPLTRLLARERRSGALLDTLKAWYAHDGHPSAT
FT                   AQALGIHRNTLDYRLQQIRDATGLDLGAIDDRLWLYIALQTMAGSDDGDDDGLDGDAGL
FT                   GDERPAS"
FT   misc_feature    166869..166949
FT                   /note="Pfam match to entry PF02954 HTH_8, Bacterial
FT                   regulatory protein, Fis family , score 26.5, E-value
FT                   8.2e-07"
FT   misc_feature    166878..166943
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1256.000, SD 3.46 at aa 368-389, sequence
FT                   GHPSATAQALGIHRNTLDYRLQ"
FT   CDS_pept        168157..170964
FT                   /transl_table=11
FT                   /locus_tag="BPSS0130"
FT                   /product="putative peptide synthase protein"
FT                   /note="Similar in its full length to Ralstonia solanacearum
FT                   putative peptide synthase protein rsp1419 or rs03122
FT                   SWALL:Q8XQ67 (EMBL:AL646084) (937 aa) fasta scores: E(): 0,
FT                   61.11% id in 936 aa, and in its N-terminal region to
FT                   Bacillus subtilis putative polyketide synthase PksJ
FT                   SWALL:PKSJ_BACSU (SWALL:P40806) (557 aa) fasta scores: E():
FT                   8.8e-64, 35.95% id in 534 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37575"
FT                   /db_xref="GOA:Q63P18"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P18"
FT                   /protein_id="CAH37575.1"
FT                   /translation="MTASTLDLPRDCEHALRAASPPNIVDLLLRAARLHPHTGVRFIAA
FT                   ESEHKGAFVTYPELLDEARRILGGLRARGYRSGMKVALLLEHASDFIPAFWACALGGFV
FT                   PCPLVPIRNDPERWAKHLAHVDTLLDHPLLVTTEALNNDLPGGASAVNLNALRASLPDA
FT                   STHVAQPSDPAVFVLTSGSTGNAKAVVLTHGNLLASMAGKNDRQQLAGADVTLNWISFD
FT                   HVAALLEAHLLPLYVGAVQLHVEAAAVLTDPLRFLRLVSRYRVTMTFSPNFLFGQLNAA
FT                   LEAMGDEALAAWRGAVDLSSLRHVVSGGEAIVVATGQRFLDLLAPCGLARDALWPAFGM
FT                   TETCAGSVYSREFPEGDAGREFASLGLPVAGLQMRIADDRNNVLPEGEAGEFQVRGPMI
FT                   FQRYHNNAEATRAAFTSDGWFRTGDLGRIERGRLWLVGRSKDSIIVNGVNYFSHELETT
FT                   LEALDGVKPSFVAAFPTRGAGDESEQLVVTFTPSFPLDDEDALYRLVIAIRNSTILLWG
FT                   FRPALILPLPEDEFPKTSLGKTQRAIMRKRLEAGSYDGYKARVADLANRQMGGYVAPDG
FT                   QTEAAVAAIFARMFQVAPEAISATASFFDLGGTSLDILKLKRHVEQRLGVIDLPIVTIL
FT                   QNPSVRALAARLAPGERVTAGEYDPVVPLQLTGGKTPLFCVHPGVGEVLVFVNLAKYFV
FT                   NERPFYALRARGFNEGETYFSSFDEMVNTYVDAIRKRQPHGPYAVAGYSYGGAVAFEIA
FT                   KVLEAQGERVDFVGSFNLPPHIKYRMDELDEVEGAVNLAFFLSLIDKQQSLTLPPQLRA
FT                   AMPEQDPLAYLIDHAPPGRLVELDLDLPKFRAWAGLAQSLLTLGRSYAPSGSVRAMSIF
FT                   YAIPLRGTKDDWLNKELRRWDEFTRAPNRYIDVAGEHYTLMGPAHVATFQAVLRAELDR
FT                   ALGGK"
FT   misc_feature    168319..169566
FT                   /note="Pfam match to entry PF00501 AMP-binding, AMP-binding
FT                   enzyme , score 288.3, E-value 6.1e-84"
FT   misc_feature    168682..168717
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT   misc_feature    169894..170097
FT                   /note="Pfam match to entry PF00550 pp-binding,
FT                   Phosphopantetheine attachment site , score 40.8, E-value
FT                   2e-09"
FT   misc_feature    170167..170937
FT                   /note="Pfam match to entry PF00975 Thioesterase,
FT                   Thioesterase domain , score 82.5, E-value 5.6e-22"
FT   CDS_pept        170998..171984
FT                   /transl_table=11
FT                   /locus_tag="BPSS0131"
FT                   /product="putative dehydratase"
FT                   /note="Similar to Rhizobium meliloti putative epimerase
FT                   dehydratase, red superfamily, possibly UDP-glucose
FT                   4-epimerase protein rb0631 or smb21052 SWALL:Q92VR8
FT                   (EMBL:AL603644) (321 aa) fasta scores: E(): 1.5e-08, 26.68%
FT                   id in 311 aa, and to Streptomyces avermitilis dtdp-glucose
FT                   4,6-dehydratase AveBII SWALL:Q9S0P5 (EMBL:AB032523) (355
FT                   aa) fasta scores: E(): 1.1e-07, 25.76% id in 260 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37576"
FT                   /db_xref="GOA:Q63P17"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P17"
FT                   /protein_id="CAH37576.1"
FT                   /translation="MLMTVARNDGRGDARQRERAKRKVLITGATGQVARPVAEALAAQD
FT                   EVWAIGRFGDAGVEHALRAKGVKTWRWDMERDTLDSLPDDFTHVLHAAVRRGEDGDFDR
FT                   AIEINTVATGRLMTHCRHAESFIYVSSGSLYARQALDHPYAETDPLNGVAHWLPAYPIV
FT                   KISCEGVVRALSATLGLPTVIARLNVAYGPYGHGGVPVLLYRQLLAGKPVPVPREGQNW
FT                   ASLIHTDDLVRQVPLLWEVASSPALVLNWGGDDAVGIRDCLQYVADLTGVDARFERSDV
FT                   TRETYAFDNTKRRALIGDCTVHWKDGVRRTIETHFPGAVKTQPAAQR"
FT   CDS_pept        172008..172403
FT                   /transl_table=11
FT                   /locus_tag="BPSS0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium loti hypothetical protein
FT                   mlr5282 SWALL:Q98C61 (EMBL:AP003006) (148 aa) fasta scores:
FT                   E(): 6.3e-06, 29.45% id in 129 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37577"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="PDB:3EBT"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P16"
FT                   /protein_id="CAH37577.1"
FT                   /translation="MSNNMQTVRESYEAFHRRDLPGVLAALAPDVRWTHPDGMSPYGLG
FT                   GTKHGHDEVIAFIRHVPTHIAEMRLAPDEFIESGERIVVLGTRRVTAVNGRSATLKFVH
FT                   VWRFENGRAVTFEDHFDTAEMIRLITA"
FT   CDS_pept        172666..173691
FT                   /transl_table=11
FT                   /locus_tag="BPSS0133"
FT                   /product="putative methyltransferase"
FT                   /note="Similar to Actinomadura hibisca ORF6 SWALL:O32456
FT                   (EMBL:D87924) (341 aa) fasta scores: E(): 3e-36, 36.73% id
FT                   in 343 aa, and to Streptomyces lipmanii
FT                   O-demethylpuromycin-O-methyltransferase DmpM
FT                   SWALL:DMPM_STRLP (SWALL:P42712) (376 aa) fasta scores: E():
FT                   7.8e-32, 35.65% id in 331 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37578"
FT                   /db_xref="GOA:Q63P15"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P15"
FT                   /protein_id="CAH37578.1"
FT                   /translation="MTEVDAGQTPHAAILQMVTGKWHAQALYVAAELGIADLLAQRERT
FT                   ADELAAETQTHPEALYRVLRALGSLGVFVEEDGRRFRNSPLGDTLRRDAPGSMRGFVRF
FT                   AGMDAGWRAWGQLMYSVRTGRSAFEHVVGGPGFAYIDSHPEIAAIVNDAMTSMSELEAP
FT                   AVARAYDFSQARTIVDVGGGHGFLLATLLRANPHANGVLFELPHACEGARQLFAKHRLT
FT                   ERVKVIAGDASQSIDAHGDVFVMKHVICDWDDEQATRIMTNCAEAMRPGGKLLLVEAVL
FT                   TPPGEPHFAKLHDLEMLIMSSGGHGRTADGYGRLYAAAGLTMTAVRPTQGMNSVIEGVK
FT                   P"
FT   misc_feature    172891..173616
FT                   /note="Pfam match to entry PF00891 Methyltransf_2,
FT                   O-methyltransferase , score 203.3, E-value 2.4e-58"
FT   CDS_pept        complement(173732..174673)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0134"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 glycine cleavage system
FT                   transcriptional activator GcvA or b2808 or c3378 or z4125
FT                   or ecs3668 SWALL:GCVA_ECOLI (SWALL:P32064) (305 aa) fasta
FT                   scores: E(): 1e-25, 34.23% id in 295 aa, and to Pseudomonas
FT                   putida transcriptional regulator, putative pp1393
FT                   SWALL:AAN67016 (EMBL:AE016779) (291 aa) fasta scores: E():
FT                   7.9e-30, 38.88% id in 288 aa. Note: This CDS is longer in
FT                   its N-terminal region than most of its database matches,
FT                   lacks an appropriate translational start codon. Possible
FT                   pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37579"
FT                   /db_xref="GOA:Q63P14"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P14"
FT                   /protein_id="CAH37579.1"
FT                   /translation="MSEQSKNSQAGHAPLAYPLAALTRALPTLAALQSFVAAAQLGSLS
FT                   KAAAHLCRTQGAVSRQIQQLEAHYRCALFVRQPTGLTLTADGDALFAVAADVLARLVRH
FT                   ARERDEAAAAVTVRVPSTFAIRWLLPRLPAIRRALGATQLCLSTSANDTPDFSEPDIDA
FT                   IVARGDGRWPGVEAIPLFAETLAPMCGPALAASLKSVDDLAHVTLLHPGRGRAEWRCWL
FT                   DAVGAAHIDATRGPVFDTLELTLSAAAEGHGVAIGDPRMAGDRLRAGTLTMPLRETAAN
FT                   GLSYYLVYPAQRATQPKIRALADVLVKLARAR"
FT   misc_feature    complement(173741..174352)
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain , score 106.9, E-value 2.6e-29"
FT   misc_feature    complement(174410..174589)
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family , score
FT                   79.2, E-value 5.6e-21"
FT   misc_feature    complement(174455..174547)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(174485..174550)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1665.000, SD 4.86 at aa 42-63, sequence
FT                   GSLSKAAAHLCRTQGAVSRQIQ"
FT   CDS_pept        174740..175159
FT                   /transl_table=11
FT                   /locus_tag="BPSS0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein rsp1479 or rs03064 SWALL:Q8XQ07 (EMBL:AL646085)
FT                   (150 aa) fasta scores: E(): 2e-17, 45.86% id in 133 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37580"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P13"
FT                   /protein_id="CAH37580.1"
FT                   /translation="MIGGLKIVDSSSNALYTRQIHAYVKALERGDVEAICALFTPDAQI
FT                   VSPFLGRMQPAPFFAKVAAASGESAIAPTDVCVSASGARRAMGYLVYDWGLKDGSSVRF
FT                   ECVDVFEFDANGLIERMVIVYDTHPIRDVVGDKYA"
FT   CDS_pept        complement(175204..176592)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0136"
FT                   /product="putative membrane protein"
FT                   /note="Similar in its full length to Ralstonia solanacearum
FT                   probable transmembrane protein rsc3143 or rs00460
FT                   SWALL:Q8XUP3 (EMBL:AL646073) (459 aa) fasta scores: E():
FT                   1e-97, 58.48% id in 448 aa, and to Bradyrhizobium japonicum
FT                   two-component hybrid sensor and regulator blr5677
FT                   SWALL:BAC50942 (EMBL:AP005955) (941 aa) fasta scores: E():
FT                   1.7e-17, 32.38% id in 315 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37581"
FT                   /db_xref="GOA:Q63P12"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033424"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P12"
FT                   /protein_id="CAH37581.1"
FT                   /translation="MDGFLIQRPSRLQTLGAGTFALLTLGALVATAPHADLRLPPIEPF
FT                   LPMCALTVFSTSLIAAFLLGAQFIVMRRPILGTLAGAYAFAAITVALQLLAFPGVFAPT
FT                   GLLGARHESAAWLWTFWHGGFPLFVVLAMLTRYRLAKRLSNTRHVGRWLATLAGVPIAV
FT                   AIALGLVALRADLPAPFGPSLDNALLAADPVAIVIWTINLGAIAAALFVGRMRTMLDIW
FT                   LVVVLLAGFTDTSLNLLSTARFTAGWYVARLFSMIAPGILVCVLVWEVTVLYRRLFDAH
FT                   ASLMRTASHDALTMVYNRSYFNEQFERAFHYARRHNTPLALVMVDVDHFKQYNDTFGHL
FT                   QGDTCLAAVAAALSGVAGRANDFVARYGGEEFAVVLPGADERGAATIAERARQAVERLR
FT                   IAADTAPGYVTVSAGYAASSGNPFETPGALIAAADAALYRAKMLGRNVSAAPHHDMQDT
FT                   AMRD"
FT   misc_feature    complement(175252..175743)
FT                   /note="Pfam match to entry PF00990 GGDEF, GGDEF domain ,
FT                   score 223.3, E-value 2.3e-64"
FT   misc_feature    complement(order(175759..175827,175870..175938,
FT                   175957..176025,176083..176151,176188..176247,
FT                   176290..176358,176395..176463,176491..176559))
FT                   /note="8 probable transmembrane helices predicted for
FT                   BPSS0136 by TMHMM2.0 at aa 12-34, 44-66, 79-101, 116-135,
FT                   148-170, 190-212, 219-241 and 256-278"
FT   CDS_pept        177878..178165
FT                   /transl_table=11
FT                   /locus_tag="BPSS0137"
FT                   /product="putative exported protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37582"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P11"
FT                   /protein_id="CAH37582.1"
FT                   /translation="MKMKTNRLMAPLLVTCLMLATVAHAQTPPPLQDVNPNRHMNIAVA
FT                   QASIRQAYDAISAAQAANHDRLGGHGDRAKRLLDEASVELKAAALTANGE"
FT   misc_feature    177878..177952
FT                   /note="Signal peptide predicted for BPSS0137 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 46 and 47"
FT   CDS_pept        178341..178646
FT                   /transl_table=11
FT                   /locus_tag="BPSS0138"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches. Possible
FT                   alternative translational start site"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37583"
FT                   /db_xref="GOA:Q63P10"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P10"
FT                   /protein_id="CAH37583.1"
FT                   /translation="MADVRPARGEARARMRRPGSRARRVARRCRCVAAVAHAGQPMVER
FT                   RVDTGGGSHGQSQSRRGWRQDMKKILVAMLALGVLIGVVAIVSICVAWTLADRLCY"
FT   misc_feature    178548..178616
FT                   /note="1 probable transmembrane helix predicted for
FT                   BPSS0138 by TMHMM2.0 at aa 29-51"
FT   CDS_pept        179358..180737
FT                   /transl_table=11
FT                   /locus_tag="BPSS0139"
FT                   /product="putative pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein rsp1380 or rs02078 SWALL:Q8XQA6 (EMBL:AL646084)
FT                   (459 aa) fasta scores: E(): 1.4e-148, 84.9% id in 457 aa,
FT                   and to Streptomyces lividans mercuric reductase MerA
FT                   SWALL:MERA_STRLI (SWALL:P30341) (474 aa) fasta scores: E():
FT                   3.7e-43, 35.85% id in 449 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37584"
FT                   /db_xref="GOA:Q63P09"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P09"
FT                   /protein_id="CAH37584.1"
FT                   /translation="MTRRFDAIIIGTGQSGPPLAARLSAAGMKVAVVERGRFGGTCVNT
FT                   GCIPTKTLIASAYAAHLARRADEYGVTLGGPVAVDMKKVKARKDQVAARSNRGVEQWVR
FT                   GLENGAVYHGHARFESARTVRVDEALLEAERIFIDVGGRALIPPIPGLDQVPYFTNSTM
FT                   MDVDFLPEHLIVLGGSYVGLEFGQMYRRFGARVTIVEKGPRLIAREDEDVSHAVREILE
FT                   GEGIDVRLDADCLSVRRDGGGIAVGLDCAAGAREVRGSHLLLAVGRVPNTDDLGLEHAG
FT                   VETDARGYIRVDEQLRTNVAGIWAMGDCNGRGAFTHTSYNDYEIVAANLLDGDPRKVSD
FT                   RIPAYAMFIDPPLARVGLTQAEAARSGRRLLVGTRPMTRVGRAVEKGESLGFMKVIVDA
FT                   DSHAILGASILGVTGDEVVHSLLDAMYAKAPYTTISRAMHIHPTVSELVPTLLQDLHPP
FT                   A"
FT   misc_feature    179373..180311
FT                   /note="Pfam match to entry PF00070 pyr_redox, Pyridine
FT                   nucleotide-disulphide oxidoreductase , score 232.8, E-value
FT                   3.1e-67"
FT   misc_feature    179472..179504
FT                   /note="PS00076 Pyridine nucleotide-disulphide
FT                   oxidoreductases class-I active site."
FT   misc_feature    180384..180713
FT                   /note="Pfam match to entry PF02852 pyr_redox_dim, Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain ,
FT                   score 91.8, E-value 8.9e-25"
FT   CDS_pept        complement(180870..181817)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0140"
FT                   /product="putative sugar ABC transport system, lipoprotein"
FT                   /note="Similar to Escherichia coli O157:H7 putative
FT                   periplasmic ribose-binding protein of ABC transport system
FT                   z5689 or ecs5071 SWALL:Q8X5Q6 (EMBL:AE005642) (313 aa)
FT                   fasta scores: E(): 3.9e-54, 54.27% id in 304 aa, and to
FT                   Bacillus subtilis D-ribose-binding protein precursor RbsB
FT                   SWALL:RBSB_BACSU (SWALL:P36949) (305 aa) fasta scores: E():
FT                   1.6e-17, 31.31% id in 281 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37585"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P08"
FT                   /protein_id="CAH37585.1"
FT                   /translation="MLEIKHKLVQTAAACALAFAACAAHAADKPLKSIGITVGSLGNPY
FT                   FVTVVKGAQAQAKEINPSAKVTAVSADYDLNKQFTQIDNFISAHVDMILLNAADPKAIE
FT                   PAVRKAQAAGIAVIAVDVAASGADATVQTNNVKAGELACDYLAKKLNGKGNVIIENGPQ
FT                   VSAVVDRVNGCKAVLAKNPGLRLLSSDQDGKGSREGGMNAMQGYLTRFPKVDGLFAIND
FT                   PQAIGSDLAAKQLRRTGIVITSVDGAPDIETALTSDTQVQASSSQDPFAMAKKAVSVGY
FT                   GIMNGHKPANAMILLEPTLITRENVKRYKGWSAH"
FT   misc_feature    complement(180891..181727)
FT                   /note="Pfam match to entry PF00532 Peripla_BP_like,
FT                   Periplasmic binding proteins and sugar binding domain of
FT                   the LacI family , score -4.6, E-value 3e-05"
FT   misc_feature    complement(181740..181817)
FT                   /note="Signal peptide predicted for BPSS0140 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 26 and 27"
FT   misc_feature    complement(181752..181784)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(181894..182928)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0141"
FT                   /product="putative sugar ABC transport system, membrane
FT                   protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 ribose transport system
FT                   permease protein RbsC or b3750 or c4678 or z5251 or ecs4692
FT                   SWALL:RBSC_ECOLI (SWALL:P04984) (321 aa) fasta scores: E():
FT                   6e-36, 45.48% id in 310 aa, and to Yersinia pestis sugar
FT                   transport system permease protein ypo3963 or y3866
FT                   SWALL:Q8ZA55 (EMBL:AJ414160) (330 aa) fasta scores: E():
FT                   2.3e-62, 60.67% id in 328 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37586"
FT                   /db_xref="GOA:Q63P07"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P07"
FT                   /protein_id="CAH37586.1"
FT                   /translation="MNQQIKQSETAAAPPGAAQPRAPRRAADHRARMQALMRTAGMLPV
FT                   LVLLCVGFGFMTDGFFTLQNLSIVTQQASINIVLAAGMTFVILTGGIDLSVGSVLAAAA
FT                   VASLLASNLPGWGWLGIPAALAVGLAFGVVNGGLISFLRLPPFIVTLGALTAVRGIARL
FT                   MGNDTTIFNPQLPFAFIGNGSILGVPWLVVIALAVVAVSWFILRRTVLGMRIYAVGGNP
FT                   EAARLSGINVRGIELFVYASSGLLAGLGALMSAARLYAANGLQLGQSYELDAIAAVILG
FT                   GTSFVGGVGSIVGTLVGALIIAVLSNGLVLLGVSDIWQYIIKGLVIIGAVALDRYRQHG
FT                   SART"
FT   misc_feature    complement(181912..182763)
FT                   /note="Pfam match to entry PF02653 BPD_transp_2,
FT                   Branched-chain amino acid transport system / permease
FT                   component , score -20.3, E-value 9.1e-06"
FT   misc_feature    complement(order(181933..182001,182014..182109,
FT                   182152..182220,182311..182379,182437..182490,
FT                   182503..182571,182581..182649,182662..182730,
FT                   182758..182826))
FT                   /note="9 probable transmembrane helices predicted for
FT                   BPSS0141 by TMHMM2.0 at aa 35-57, 67-89, 94-116, 120-142,
FT                   147-164, 184-206, 237-259, 274-305 and 310-332"
FT   CDS_pept        complement(182971..184524)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0142"
FT                   /product="putative sugar ABC transport system, ATP-binding
FT                   protein"
FT                   /note="Similar to Escherichia coli ribose transport
FT                   ATP-binding protein RbsA or b3749 SWALL:RBSA_ECOLI
FT                   (SWALL:P04983) (501 aa) fasta scores: E(): 1.2e-71, 45.4%
FT                   id in 500 aa, and to Yersinia pestis sugar transport
FT                   ATP-binding protein ypo3964 or y3865 SWALL:Q8ZA54
FT                   (EMBL:AJ414160) (507 aa) fasta scores: E(): 1.2e-90, 59.28%
FT                   id in 501 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37587"
FT                   /db_xref="GOA:Q63P06"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63P06"
FT                   /protein_id="CAH37587.1"
FT                   /translation="MQRSDPPRPLLEMRGISKTFPAVRALAGVSLTVHPGEVHSLMGEN
FT                   GAGKSTLMKILSGAYQADPGGEILIDGRPISIDGPLAARDAGVAVIYQELCLAPNLSVA
FT                   ENIHVGRELRRGNGRRGTIDRAAMARGCQDVLERLGADFGPNTLVGTLSIAEQQLVEIA
FT                   RAVHTRARILVMDEPTTPLSSRETDNLFRLIRQLRAEGLAIIYISHRMAEIYELSDRVS
FT                   VLRDGAYVGTLERDALSAERLVGMMVGRDISGFYKKAHAPYDPGNLLLSVRDIADGARV
FT                   RGCSLDLHAGEVLGIAGLVGAGRTELARLIFGAEPRVRGEVTLAGKAFAAHSPREAIDA
FT                   GLVYLTEDRKRQGLFLDMSVRENINISVCGRDARLGALDLARGAQRARDAIAALSIRVP
FT                   HANVNVGALSGGNQQKVLLSRLLETKPRVLILDEPTRGVDIGAKSEIYRIINELARAGV
FT                   GVIVISSELPEIIGVADRVLVMREGRIAGELGGRTDAPITQEAIIALATGSRTEASAAH
FT                   "
FT   misc_feature    complement(183076..183654)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter , score 109.1, E-value 5.6e-30"
FT   misc_feature    complement(183259..183303)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(183844..184419)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter , score 189.9, E-value 2.7e-54"
FT   misc_feature    complement(184375..184398)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(184511..185761)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0143"
FT                   /product="putative ROK family transcriptional regulator"
FT                   /note="Similar to Rhizobium meliloti putative transcription
FT                   regulator protein r00475 or smc02172 SWALL:Q92SC9
FT                   (EMBL:AL591783) (409 aa) fasta scores: E(): 1.3e-34, 33.42%
FT                   id in 386 aa, and to Agrobacterium tumefaciens
FT                   transcriptional regulator, ROK family atu4655 or agr_l_455
FT                   SWALL:Q8U701 (EMBL:AE009394) (429 aa) fasta scores: E():
FT                   2.9e-28, 31.93% id in 404 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37588"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P05"
FT                   /protein_id="CAH37588.1"
FT                   /translation="MRSPHLGQGSNSANVRRYNERLLLKTLRRAGSASKADLARLANLT
FT                   GTAVGSIIASLAEAKLIEFAGRRAEGQRGQPASLIRLDPRGAFGIGVRLDRMRIETALV
FT                   NFAGDVIGRRSHDTLLPQPTAVLEIVREDVAAMQQLLCAHERARLTGVGVAQPYNLGSW
FT                   LREIDLPADAFGAWAEVDFARELDRAIELPVFSENDGNAAAIAELFYGCGRQRDDFVYL
FT                   FLGPAIGGGIAVDGDCLRGVTGNAGDFAMMPVPPSRLPSVPKPSGAWDLLITRASLNGL
FT                   ARHLRHRGETLESRADLEACIARGGQAVDEWIDDCVDALAPALRAVLAVLESPVVVLDA
FT                   DTDAGLIDTLIARLHTALAALAPEARGTPVLVRGTFGPDAGAIGAATLPMFFNFSPRAG
FT                   ILRGAGVDSQEARYAAF"
FT   misc_feature    complement(184928..185491)
FT                   /note="Pfam match to entry PF00480 ROK, ROK family , score
FT                   23.7, E-value 2.8e-08"
FT   misc_feature    complement(185600..185665)
FT                   /note="Predicted helix-turn-helix motif with score 998.000,
FT                   SD 2.59 at aa 33-54, sequence ASKADLARLANLTGTAVGSIIA"
FT   CDS_pept        complement(186668..189283)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0144"
FT                   /product="putative amylase"
FT                   /note="N-terminal region similar to Clostridium sp.
FT                   glucoamylase precursor Cga SWALL:AMYG_CLOSP (SWALL:P29761)
FT                   (702 aa) fasta scores: E(): 8.9e-20, 37.14% id in 743 aa,
FT                   and C-terminal end to Streptomyces violaceus alpha-amylase
FT                   precursor Aml SWALL:AMY_STRVL (SWALL:P22998) (569 aa) fasta
FT                   scores: E(): 7.5e-13, 37.8% id in 164 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37589"
FT                   /db_xref="GOA:Q63P04"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015220"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P04"
FT                   /protein_id="CAH37589.1"
FT                   /translation="MLVGSLAALAGAAALPANTSAAAEAFGSPGAAPVRGPAAKSFLGT
FT                   AVNGASRVYFTGYRGILSEVYYPVLDTPESVDLQFLVGDAGKTFVDEEKQQAYSAAQTD
FT                   TRTMSWQVTTGNSSHNWQIRKIVFADPNHNAIVQRVTFTALNGRKVGDFNLYMLSKPYL
FT                   DNAGANNTAQTVSGSGGTALVANHNSRYSALVASRPWKVVNGVGMTSNGFVGQSDGWTD
FT                   LLGGTADKTMDWTFSSATNGNVAQMGWLDLGDPSATSVSFDVVLGFGGTQDQALGDANT
FT                   VLGSDLAGEQQQYDTGWHNYAAGLSSQNGAADDGYYLAAMTLKTMQDKSNGAMIAGIGT
FT                   PWGETQGDANAGGYHLVWPRDLFKFANALTTAGDTSSATSVVNYLFNTLQQTTDCGTAE
FT                   YNAPGCAQGYSRVGRFPQNAWVNGWPYWQGTQMDEQAMPIILAWRLGPSVFNPLWPKIK
FT                   LTADYIVNTGPWTYQERWEENAGYSPSTIAAEIAGLVTAADIATQNGDTASAARYLAAA
FT                   DYWQENVAAWTYTSSGAFGNGSYYIRINPAGRAGTGTDRASFAPTAGPDTPQTLSVKNG
FT                   GGSHDARRVVDGGFFELVRMGVKRATDPTIANTISVYDSVLGQTLNVANAPALSPNAWF
FT                   RYNFDGYGEHNDGGDFDGTGAGRLWPIFTAERGMVEIARQGSGGAGSAYFSTLKQLTTP
FT                   EGFVPEQVWSNSTTLPDGWAVTTPAGYTPGQPTKSMAPLNWAMGEYISLLASIQAGRIV
FT                   DVPSVVCARYNNCAAPPQSGQVPVAVNVNASTQLGQQMYVTGNVAALGNWNTDLGIPVD
FT                   PASYPVWRNTVNLPAAQAIQYKYYRKNADGSVTWENRSGNRQLQTPASGTLALNDQVSW
FT                   "
FT   misc_feature    complement(186683..186964)
FT                   /note="Pfam match to entry PF00686 CBM_20, Starch binding
FT                   domain , score 118.9, E-value 6.2e-33"
FT   misc_feature    complement(188459..188506)
FT                   /note="PS00453 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 1."
FT   misc_feature    complement(189218..189283)
FT                   /note="Signal peptide predicted for BPSS0144 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.422 between residues 22 and 23"
FT   CDS_pept        complement(190115..191512)
FT                   /transl_table=11
FT                   /gene="dbpA"
FT                   /locus_tag="BPSS0145"
FT                   /product="ATP-independent RNA helicase"
FT                   /note="Similar to Escherichia coli ATP-independent RNA
FT                   helicase DbpA or b1343 SWALL:DBPA_ECOLI (SWALL:P21693) (457
FT                   aa) fasta scores: E(): 3.1e-84, 55.02% id in 458 aa, and to
FT                   Pseudomonas aeruginosa RNA helicase pa0455 SWALL:Q9I663
FT                   (EMBL:AE004483) (458 aa) fasta scores: E(): 2.4e-109,
FT                   64.62% id in 458 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37590"
FT                   /db_xref="GOA:Q63P03"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P03"
FT                   /protein_id="CAH37590.1"
FT                   /translation="MTYPPTATPFSALALTPATLANLAQLGYTDMTPIQAASLPIALAG
FT                   HDLIAQAKTGSGKTAAFSLALLARLDARRFDVQALVLCPTRELADQVAQEIRRLARAEE
FT                   NVKVLTLCGGTPMRPQTQSLEHGAHIIVGTPGRIMDHLDRGHLTLDALNTLVLDEADRM
FT                   LDMGFFDDIAKVARQCPPTRQTLLFSATYPDGIAKLSQQFLRHPKRVKLEERHDDSKIR
FT                   QRFYEVTEDERLHAVGLLLNHYRPVSTIAFCNTKQQCRDLLDVLHAQGFHALALHGELE
FT                   QRERDQVLIRFANRSCSVLVATDVAARGLDIAQLEAVINVDVTPDPEVYVHRIGRTGRA
FT                   DQDGWALSLASMNEMGRVGGIEQALAREVEWHPLAELKAGGDAPLLPPMETLQILGGRK
FT                   DKIRPGDVLGALTGDAGFSGAQIGKINVTEFSTYVAVERGIARDALRKLNAGKIKGKRV
FT                   KVRLMDE"
FT   misc_feature    complement(190121..190378)
FT                   /note="Pfam match to entry PF03880 DbpA, DbpA RNA binding
FT                   domain , score 108.4, E-value 9e-30"
FT   misc_feature    complement(190490..190705)
FT                   /note="Pfam match to entry PF00271 helicase_C, Helicase
FT                   conserved C-terminal domain , score 108.5, E-value 8.5e-30"
FT   misc_feature    complement(190841..191452)
FT                   /note="Pfam match to entry PF00270 DEAD, DEAD/DEAH box
FT                   helicase , score 265.3, E-value 5.4e-77"
FT   misc_feature    complement(191021..191047)
FT                   /note="PS00039 DEAD-box subfamily ATP-dependent helicases
FT                   signature."
FT   misc_feature    complement(191060..191086)
FT                   /note="PS01070 DNA/RNA non-specific endonucleases active
FT                   site."
FT   misc_feature    complement(191336..191359)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(191677..192306)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0146"
FT                   /product="hypothetical protein"
FT                   /note="Similar to the C-terminal region of Ralstonia
FT                   solanacearum probable porin signal peptide protein rsp0051
FT                   or rs02026 SWALL:Q8XTQ5 (EMBL:AL646076) (382 aa) fasta
FT                   scores: E(): 2.3e-23, 38.64% id in 207 aa, and of
FT                   Acinetobacter lwoffii hypothetical 36.5 kDa protein
FT                   SWALL:Q934S0 (EMBL:U77658) (344 aa) fasta scores: E():
FT                   1e-06, 26.22% id in 225 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37591"
FT                   /db_xref="GOA:Q63P02"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P02"
FT                   /protein_id="CAH37591.1"
FT                   /translation="MAGGFANDRLYGAALQYQRGGLTVGASYPKMNRARSADAAGAVTG
FT                   DNTFDASSQRNVGIGATYAFSKALIGFAYSHVGVYDPTSNAYFTGTTRPAGGHWQSWKF
FT                   DHFEINGRYRVTPAFYAGAAYTYTQARADSTAGAFHPKWRPLSTKLDYDLSKRSSGFAE
FT                   GVYQHAQHAMNARTGTDFDHAYIPGAANIASGPNQYVVRPALLHPF"
FT   CDS_pept        complement(192341..193654)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0147"
FT                   /product="putative transporter protein"
FT                   /note="Similar to Klebsiella pneumoniae citrate-proton
FT                   symporter CitH or Cit SWALL:CIT1_KLEPN (SWALL:P16482) (444
FT                   aa) fasta scores: E(): 4.8e-44, 37.05% id in 421 aa, and to
FT                   the plasmid borne Escherichia coli citrate-proton symporter
FT                   CitA or Cit SWALL:CIT1_ECOLI (SWALL:P07661) (431 aa) fasta
FT                   scores: E(): 3.7e-41, 35.84% id in 399 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37592"
FT                   /db_xref="GOA:Q63P01"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P01"
FT                   /protein_id="CAH37592.1"
FT                   /translation="METSALNFAGAPADARAAAKKRRLIAAAAVGNALEFYDFTVYSFF
FT                   AILIGKLFFPVHSPFGQLMLAVASFGVGFVTRPLGGLVIGVYADRAGRKRAMIATLLIM
FT                   ALGTATIAVAPTYAQIGIAAPLLLVAARLLQGFASGGEVGASTTLLIEQAPQARRGFYA
FT                   SFQFSSQGLAALAGALTGVLLTSTLSAAQLESWGWRVPFVIGTLFAPLGYWLRRTVDEA
FT                   PAAAPAPRGDAAPLPLADVLRHHGKAVFAGLGITIGGTSIHYIIVFYMAIYGVQVLHLP
FT                   SWLSMSAGCIAGAILAVVTPIGGHLSDRYGRNRIVWWTRVALMLAIYPAFVTLNRWPGA
FT                   ASLLSIIAALAGVHAINIGATGAMLGELFPRAVRATGGALVYSVGVAIFGGFAQFFVTW
FT                   LIAATGNANAPAWYAIGCGALTLAALGSMDDKAGKPLD"
FT   misc_feature    complement(192359..193585)
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter , score 80.2, E-value 2.8e-21"
FT   misc_feature    complement(order(192371..192424,192452..192520,
FT                   192557..192625,192653..192709,192743..192811,
FT                   192839..192907,193010..193063,193076..193144,
FT                   193205..193273,193286..193354,193391..193459,
FT                   193517..193585))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BPSS0147 by TMHMM2.0 at aa 46-68, 88-110, 123-145, 150-172,
FT                   193-215, 220-237, 272-294, 304-326, 338-356, 366-388,
FT                   401-423 and 433-450"
FT   misc_feature    complement(193178..193255)
FT                   /note="PS00217 Sugar transport proteins signature 2."
FT   misc_feature    complement(193355..193405)
FT                   /note="PS00216 Sugar transport proteins signature 1."
FT   CDS_pept        complement(193695..194885)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0148"
FT                   /product="subfamily M20D non-peptidase homologue"
FT                   /note="Similar to Campylobacter jejuni hippurate hydrolase
FT                   HipO or cj0985C SWALL:HIPO_CAMJE (SWALL:P45493) (383 aa)
FT                   fasta scores: E(): 2.3e-64, 47.53% id in 385 aa, and to
FT                   Pseudomonas aeruginosa probable hydrolase pa4344
FT                   SWALL:Q9HW57 (EMBL:AE004850) (406 aa) fasta scores: E():
FT                   1.3e-86, 59.17% id in 387 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37593"
FT                   /db_xref="GOA:Q63P00"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q63P00"
FT                   /protein_id="CAH37593.1"
FT                   /translation="MHSAPSEHPVIPGIAAIAPELIDVRRRIHAHPELAFEETLTSDLV
FT                   AGLLAGWGYDVHRGLGKTGLVGVLREGQGARTLGLRADMDALPIAEATGLPYASRRANK
FT                   MHACGHDGHTAMLLCAARHLAATRRFSGTLNLIFQPAEENFGGAKAMMDDGLFERFPCD
FT                   AIFAIHNMPGRAAGDMAFRTGAAMASSDRVTITLRGVGGHGAMPHFARDPMSAAGSIIV
FT                   ALQTIVAREIDAQQSAVITVGSVQAGETFNVIPETVVMKLSVRALNADVRALLAQRIEA
FT                   LAKGQAQSFGIEADVQYDYGYPVLVNHDEPTAFAIDVARRMLGEARVEAQTAPLMGSED
FT                   FAYMLEARPGCYAFIGNGVGSKGGCMVHNPGYDFNDDILAIGASYWVRLAEAWLAA"
FT   misc_feature    complement(193881..194834)
FT                   /note="Pfam match to entry PF01546 Peptidase_M20, Peptidase
FT                   family M20/M25/M40 , score 291.7, E-value 5.8e-85"
FT   CDS_pept        195065..195967
FT                   /transl_table=11
FT                   /locus_tag="BPSS0149"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="Similar to Comamonas testosteroni TsaR SWALL:P94678
FT                   (EMBL:U32622) (298 aa) fasta scores: E(): 2.3e-35, 37.79%
FT                   id in 299 aa, and to Escherichia coli putative
FT                   transcriptional regulator AbgR or b1339 SWALL:ABGR_ECOLI
FT                   (SWALL:P77744) (302 aa) fasta scores: E(): 7e-28, 32.64% id
FT                   in 291 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37594"
FT                   /db_xref="GOA:Q63NZ9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NZ9"
FT                   /protein_id="CAH37594.1"
FT                   /translation="MKYHQLKAFVAVADEGSIRAAARRLNVSPAALTKAVKELELALGV
FT                   SLVVRTARGVQLTRFGQQLQVRASLIVAEMQRARDDIEQAQGATTGAVAAAITPAAAVT
FT                   ILPDAFRAFRRRFPLARVSIVEGFPGVALPKLHDGSLDFAVSVVVPELLAAEFEHAQLY
FT                   ASRHVIVARNAHPLAAATSLADLVDADWLMNPSPESSTQLMFNCFAEHGLPAPTRVVEC
FT                   PSYAIAHSLIQGSDLIASMPEQLLGVEWSRDRIAVLPIREALPAASVQVVTRRDSPLTP
FT                   AAAMLVDCMRDAARRHGLR"
FT   misc_feature    195071..195250
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family , score
FT                   90.5, E-value 2.2e-24"
FT   misc_feature    195110..195175
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1745.000, SD 5.13 at aa 16-37, sequence
FT                   GSIRAAARRLNVSPAALTKAVK"
FT   misc_feature    195113..195205
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    195320..195949
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain , score 123.7, E-value 2.2e-34"
FT   misc_feature    195677..195697
FT                   /note="PS00290 Immunoglobulins and major histocompatibility
FT                   complex proteins signature."
FT   CDS_pept        complement(196307..197116)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0150"
FT                   /product="hypothetical protein"
FT                   /note="Low similarity to Pseudomonas aeruginosa
FT                   hypothetical protein pa5101 SWALL:Q9HU82 (EMBL:AE004923)
FT                   (265 aa) fasta scores: E(): 5.2e-20, 36.07% id in 219 aa,
FT                   and to Rhizobium loti hypothetical protein mll1215
FT                   SWALL:Q98L21 (EMBL:AP002996) (275 aa) fasta scores: E():
FT                   2.2e-08, 34.57% id in 214 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37595"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NZ8"
FT                   /protein_id="CAH37595.1"
FT                   /translation="MYNVTPRHAALWRSLLRDALHAFARAGGPADVTLLGEPSGEPDGE
FT                   LLPLWRRGDLLLSQTCGYPYRMLGVGDAVHLIATPVFDAAGCDGPRYCSMLAVSAGAHA
FT                   RGATTLAACRGLRAACNGDDSHSGMNALRHAIAPHARGGRFFSAVTRTGSHLSALRALD
FT                   AGAADLAAIDCVTLAYVRDALPARLRRVRIIGATAAAPGLPFIASRALAGEHVGALRDA
FT                   LDAAVAIDAERARALRLRGFARLAPDAYAEIERFEREAVALGYPALA"
FT   CDS_pept        197293..198459
FT                   /transl_table=11
FT                   /locus_tag="BPSS0151"
FT                   /product="putative desaturase"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein pa5102 SWALL:Q9HU81 (EMBL:AE004923) (312 aa) fasta
FT                   scores: E(): 1.8e-58, 49.21% id in 317 aa, and to
FT                   Burkholderia cepacia putative omega-3 fatty acid desaturase
FT                   SWALL:Q9ZGQ3 (EMBL:AF076477) (334 aa) fasta scores: E():
FT                   8.2e-05, 28.78% id in 264 aa. Note: CDS is longer in its
FT                   N-terminal region than most of its database matches,
FT                   possible alternative start codon at residue 51"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37596"
FT                   /db_xref="GOA:Q63NZ7"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NZ7"
FT                   /protein_id="CAH37596.1"
FT                   /translation="MRIHWLVGPPRLVTVHAWPCVPRKAQSSSVCLSTFGFHPHRNMAE
FT                   YFDVDHAREIAALGERFAARTEWPTWLLIFVVYGGWLGVLLGVRAGQLPLAAATPLLIA
FT                   LCAWHMSLQHELLHGHPTRSARVNKLLGYPPLAVWYPYTLYRDTHLEHHRDEDLTAPGI
FT                   DPESNYVPLAQWTRLPRWRRALWRARKCFVGRLVVGPPESVAAMGAATLRAWHGGDWRD
FT                   APMWAAHAVSVVALLAWLHGSIGVPWWYYLLAITWPAQSLAMIRSLYEHRAAEHPKARI
FT                   AINEAGLAMRMLYLNNNYHLVHHDLPKLPWYQLPRAYRLRRDAYARKCGGFVIRGGYWE
FT                   LLKRHAWRVTDSPVHPFAGRGASDRASGGGATPGARVAVIEDCVQIGG"
FT   misc_feature    197503..197571
FT                   /note="1 probable transmembrane helix predicted for
FT                   BPSS0151 by TMHMM2.0 at aa 107-129"
FT   misc_feature    197584..198264
FT                   /note="Pfam match to entry PF00487 FA_desaturase, Fatty
FT                   acid desaturase , score 20.6, E-value 3.6e-07"
FT   CDS_pept        198951..199391
FT                   /transl_table=11
FT                   /locus_tag="BPSS0152"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Ralstonia solanacearum putative
FT                   transmembrane protein rsc3150 or rs00450 SWALL:Q8XUN7
FT                   (EMBL:AL646073) (143 aa) fasta scores: E(): 3e-25, 72.26%
FT                   id in 137 aa, and to Pseudomonas aeruginosa hypothetical
FT                   protein pa5183 SWALL:Q9HU06 (EMBL:AE004931) (135 aa) fasta
FT                   scores: E(): 2.7e-13, 47.94% id in 146 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37597"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NZ6"
FT                   /protein_id="CAH37597.1"
FT                   /translation="MSKKLIQIMAVAALSAAASLPAFAGDMNNALGGALGGVAGAAVGG
FT                   AVGGSTGAVIGGAVGGGAGGAVTSNRRERTGAIIGGALGGGAGTAAGNAMGGRGGGLIG
FT                   AAVGGGAGAALGGNISRSNSYNDDYDRGYRRGKHHGKHHHRH"
FT   misc_feature    198951..199022
FT                   /note="Signal peptide predicted for BPSS0152 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 24 and 25"
FT   misc_feature    order(198963..199025,199068..199136,199173..199241,
FT                   199254..199307)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BPSS0152 by TMHMM2.0 at aa 5-25, 40-62, 75-97 and 102-119"
FT   CDS_pept        complement(199973..200872)
FT                   /transl_table=11
FT                   /gene="gltI"
FT                   /locus_tag="BPSS0153"
FT                   /product="glutamate/aspartate periplasmic binding protein
FT                   precursor"
FT                   /note="Similar to Escherichia coli glutamate/aspartate
FT                   periplasmic binding protein precursor GltI or b0655
FT                   SWALL:GLTI_ECOLI (SWALL:P37902) (302 aa) fasta scores: E():
FT                   1.8e-60, 55% id in 300 aa, and to Ralstonia solanacearum
FT                   probable amino-acid-binding periplasmic rsc0481 or rs04394
FT                   SWALL:Q8Y255 (EMBL:AL646059) (313 aa) fasta scores: E():
FT                   1.8e-64, 59.37% id in 288 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37598"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NZ5"
FT                   /protein_id="CAH37598.1"
FT                   /translation="MMKPLRPLLSIAVGCALAAAAHANDAGPTLKKIRDTGVVTLGVRE
FT                   SSVPFSYYDQQQRTIGYSQEIALKIVDEIKKTLNRPNLTVREIPITSQNRIPLVQNGTV
FT                   DLECGSTTHTKERANQVSFSNSIFQYGMRLIVKKSSGVKDFPDLAGKTVATTAGTTEER
FT                   LLRQWNAEKGMAMQIISAKDHADAFLNVKSGRAVAFFMDEPLLYGAKAKEANPGDYVIT
FT                   GNSPVSEAYGCMLRKDDPGFKQLADRVIARMQRSGEAEALYVKWFNRPIPPKGVNLDYP
FT                   LSADMKQLFANPNDKALD"
FT   misc_feature    complement(200066..200758)
FT                   /note="Pfam match to entry PF00497 SBP_bac_3, Bacterial
FT                   extracellular solute-binding proteins, family 3 , score
FT                   202.5, E-value 4.4e-58"
FT   misc_feature    complement(200804..200872)
FT                   /note="Signal peptide predicted for BPSS0153 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.993 between residues 23 and 24"
FT   CDS_pept        complement(201036..202283)
FT                   /transl_table=11
FT                   /gene="dadA"
FT                   /gene_synonym="dadR"
FT                   /locus_tag="BPSS0154"
FT                   /product="putative D-amino acid dehydrogenase small
FT                   subunit"
FT                   /EC_number="1.4.99.1"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 D-amino acid dehydrogenase
FT                   small subunit DadA or DadR or b1189 or c1638 or z1952 or
FT                   ecs1684 SWALL:DADA_ECOLI (SWALL:P29011) (432 aa) fasta
FT                   scores: E(): 5.6e-51, 37.85% id in 420 aa, and to
FT                   Pseudomonas aeruginosa D-amino acid dehydrogenase 2 small
FT                   subunit pa5084 SWALL:DAD2_PSEAE (SWALL:Q9HU99) (416 aa)
FT                   fasta scores: E(): 1e-68, 51.44% id in 414 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37599"
FT                   /db_xref="GOA:Q63NZ4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NZ4"
FT                   /protein_id="CAH37599.1"
FT                   /translation="MRICVLGAGVVGLTSAYCLAREGHDVTVLEARPDAVLDASFANGG
FT                   QLSYSYVAPLADPAVLGKLPAWLARRDSALRFVPRLDVDQWLWCAAFLAACRTARARRT
FT                   AAEMLELGALSRIALHALVERETLDFDYARNGKLVVYRDRREFDRARRAMDHLIAAGAR
FT                   QQALDTAACVALEPALAPASGLLAGGIHTPSEEVGDCRRFGIELARVLRERLRVAIHYE
FT                   TPVDTLRTEGATIVAARTPRGEIAADAFVLSAGNGSAPMLRRLGMRLPIYPLTGYSLTL
FT                   PARHDATPRVSVTDLHRKIVYAPLGARLRIAGMVEIAGLRSSGAARRLALLAQQAQEIF
FT                   PHAGDYAHGETWCGHRPATPDGKPLIGATPFRNLWLNTGHGALGFTLACGSARVLADLI
FT                   AGRPPALDTRAYALHR"
FT   misc_feature    complement(202200..202283)
FT                   /note="Pfam match to entry PF03721 UDPG_MGDP_dh_N,
FT                   UDP-glucose/GDP-mannose dehydrogenase family, NAD binding
FT                   domain , score 31.7, E-value 4.2e-08"
FT   misc_feature    complement(202224..202283)
FT                   /note="Signal peptide predicted for BPSS0154 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.984) with cleavage site
FT                   probability 0.975 between residues 20 and 21"
FT   CDS_pept        complement(202436..203368)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0155"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /note="Similar to Escherichia coli transcriptional
FT                   activator protein LysR or b2839 SWALL:LYSR_ECOLI
FT                   (SWALL:P03030) (311 aa) fasta scores: E(): 1.7e-16, 34.95%
FT                   id in 246 aa, and to Pseudomonas aeruginosa probable
FT                   transcriptional regulator pa5085 SWALL:Q9HU98
FT                   (EMBL:AE004921) (318 aa) fasta scores: E(): 1.7e-30, 41.58%
FT                   id in 291 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37600"
FT                   /db_xref="GOA:Q63NZ3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NZ3"
FT                   /protein_id="CAH37600.1"
FT                   /translation="MRLRHIEVFHAIMRTGSLSKAAQLLCVSQPAVSKVLAHAEQNLGI
FT                   RLFSRAHGRLLPTREAELLFGETQKLQSNLERIRALSRNLALQPEGQLRVGCLPSLGLS
FT                   LIPQAVKAFRDDYPRVALKIQTLHTDALLNALLTRDLDVAVAIDPPARPGITSAELGRT
FT                   AVVSVGPPDDDAPDAPLSLHAFMEGESIGIGTEDPLGDAIGNALEAFGEDRVTMVEAHT
FT                   WYVARALAARGVGRVLLDELTARAPGEPVTIRPIEPALSVGVFALWRDGGLDSHAGATF
FT                   VDALRAPFGEPSGKPPSMRAPGAPKRRAR"
FT   misc_feature    complement(202499..203113)
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain , score 100.5, E-value 2.1e-27"
FT   misc_feature    complement(203183..203362)
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family , score
FT                   77.4, E-value 1.9e-20"
FT   misc_feature    complement(203258..203323)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2048.000, SD 6.16 at aa 16-37, sequence
FT                   GSLSKAAQLLCVSQPAVSKVLA"
FT   CDS_pept        complement(203913..204674)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0156"
FT                   /product="putative dehydrogenase"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   dehydrogenase/reductase oxidoreductase protein rsc1029 or
FT                   rs04221 SWALL:Q8Y0L4 (EMBL:AL646062) (246 aa) fasta scores:
FT                   E(): 6.8e-24, 39.5% id in 243 aa, and to Bacillus cereus
FT                   benzil reductase YueD SWALL:Q8RJ14 (EMBL:AB052927) (249 aa)
FT                   fasta scores: E(): 1.8e-19, 34.04% id in 235 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37601"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NZ2"
FT                   /protein_id="CAH37601.1"
FT                   /translation="MTTSPSPLPAVRAIVTGHTRGLGEALAEQLLRRDIAVLGLSRGRH
FT                   PSLASHAPERLVEAELDLSEPARVQAWLGGDTLGAFVAGASRVLLFNNAGTVEPIGPLD
FT                   TQDTAAIARAVGLNVATPLMLASALAKLAPDALERRIAHISSGAARNAYAGWSVYCATK
FT                   AALDHHARAVALDANRALRICSVAPGVVDTGMQATIRATSDERLPSRERFARLKSSGAL
FT                   STPDDAARQLIDYVLSDDFGSTPTADIRHLG"
FT   misc_feature    complement(203922..204650)
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase , score 42.1, E-value 5e-10"
FT   CDS_pept        205043..205462
FT                   /transl_table=11
FT                   /locus_tag="BPSS0157"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37602"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NZ1"
FT                   /protein_id="CAH37602.1"
FT                   /translation="MAPRRGRIFSSDLRDSRPMEPITQAFAQQFSREWIDAWNAHDLDR
FT                   VLSHYADAFEMSSPMIVQIAGEPSGRLCGKDQVGAYWLKALRMIPALHFEWIATLAGID
FT                   SVAIHYRGANGRLALEVFHFGPGRRVVKAFAHYAE"
FT   CDS_pept        205904..207820
FT                   /transl_table=11
FT                   /locus_tag="BPSS0158"
FT                   /product="putative exported protein"
FT                   /note="Very low similarity to Anabaena sp. hypothetical
FT                   protein all2038 SWALL:Q8YVE0 (EMBL:AP003588) (743 aa) fasta
FT                   scores: E(): 1.3e-16, 30.72% id in 677 aa, and in its
FT                   C-terminal region to Anabaena sp. hypothetical protein
FT                   all3696 SWALL:Q8YQW5 (EMBL:AP003594) (379 aa) fasta scores:
FT                   E(): 2.1e-06, 27.71% id in 368 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37603"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NZ0"
FT                   /protein_id="CAH37603.1"
FT                   /translation="MVRKRIRAVFAAALVGLAAHAAHAQYTTDWIANTYGTIASHVGNN
FT                   ARSMWVSPEGVIYTASFWDENAGGVAIYQNGKTLGSIGTHAEFQGGAITGNATSIFAAM
FT                   QYSTPQGSGTVGRYNRATLQRDLTIPVSVWNAVSRADVITGLATAGTLLYASDYFGNRV
FT                   RVFTTEGVWQRDIGIANPGALALDDAGNLWVAQKNAAKIVEFSPTGALMNTIQMASASR
FT                   PASLYFDASKRQLMIGDQGPDMNVKLYAIAGMPKQVGTFGVQGGYLDTTTGIRGQVGDR
FT                   RFTRVVGIGKDAAGTLYVLNNPWGGGWDLGRNGATDIHAYDALGNALWKLQALNFEAIA
FT                   APDPTTDGALFYSGMNVYSGTAGGTFVANTVDPFTYPSDPRLDMNDYQRGQHFGQLVSV
FT                   GGHKILVASGQNPGNFNFYHFNAASGYIAIPDASLPGKGFNTSLQVTAGFSIDNKGDVW
FT                   AGLNGTNAISHYPLAGIDASGKPSWGAPTSIPTPASVQPTTRILYLSDSDTMILAQGIA
FT                   GSWDWTAMNGRIEVYHGWSAGNVTQPNPVIALTSPNPKSIASAGNYLFVGYVHTVPNID
FT                   VFDLNTGQLVATLTNSNTGMMDVGNDVDSMYGLRAYLRSTGEYVITKDNYNGSSIVVYR
FT                   WRP"
FT   misc_feature    205904..205975
FT                   /note="Signal peptide predicted for BPSS0158 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.995 between residues 59 and 60"
FT   misc_feature    206114..206137
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        208096..210993
FT                   /transl_table=11
FT                   /locus_tag="BPSS0159"
FT                   /product="putative exported protein"
FT                   /note="Similar to Xanthomonas campestris hypothetical
FT                   protein xcc2894 SWALL:Q8P6S1 (EMBL:AE012403) (781 aa) fasta
FT                   scores: E(): 2.6e-40, 34.17% id in 793 aa, and to
FT                   Mycobacterium tuberculosis hypothetical protein rv0584 or
FT                   mt0612 or mtv039.22 SWALL:O86365 (EMBL:AL021942) (877 aa)
FT                   fasta scores: E(): 4.7e-37, 38.47% id in 850 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37604"
FT                   /db_xref="GOA:Q63NY9"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NY9"
FT                   /protein_id="CAH37604.1"
FT                   /translation="MNRFVRLGAAMAVACALAACGGDDGGPAVAASSFAAAGANGATAG
FT                   VADTAQADGAPRTGSLTQYVDPLIGTLASNSPNPVPAGQAGSVVPAAGLPSGMIQWAPD
FT                   TNTTPAPADSKEPGSPAGYYYDLNAIQGFSVTHMSGAGCAGNNGEFPVMPTTDATKLAP
FT                   TFSHANETAKPGYYSVLLDSQIKVELTATLRTGFGRFAYPAGKPALLVIDATRTNTKTS
FT                   TSGAITRVSANAISGSTVGGGFCGNSVPVPVYFYATFDRPFAPASSISRGIAKLAFDSG
FT                   ATVRMKIGISYVSVDNAKANLDAENRTWDFDGVRALADAAWNDRLGAIRVSSSDADALK
FT                   KFYTAFYHALWAPSVFSDVNGQYIGFDKQVHTVAKGQAAQYSSFSGWDVYRSLIQLKAV
FT                   LFPRETSDMIQSLVNDADQCGAIPHWVNDNVEDGVMPGDAGSLMVSSAYAFGAREFDAR
FT                   GALAHMIRMANIPGTACAGVTTNGGRASYLQTGYITSGEWGIASSTLEYTSSDFAISRF
FT                   ALALGDTATQKMLLGRSAYWQNLLNASLNPPLIAARQSNGAWIAETPGSTDNYVEGNAE
FT                   QYTWMVPYDPAGLFTQLGGNQAVVPRLDKFFTVLNAGMSLPNFYMGNEPTFEVPWLYNW
FT                   AGSPSGTQRVVRQIMQTAFSTKPDGLPGNDDLGAVSGWYVWAALGLYPQVPGVAGFAIG
FT                   SPQFDAIDVRLGSGRMLKIRAPGAPASGYVQSVAVNGRAQASPWIALDALDGGAVMHFK
FT                   MGGAPSQWGAGEAPPSFGVPVARDVADSFNNRGISADGATNADGQGADFDGSLFSYSAN
FT                   ALAQAGVRPGAPFTYGGASFVLGGASSLDNAVAVGQTVMLPPGSAGTSVVVLGASNNGP
FT                   SAGVARVSFADGTSAQVTLSFDDWTLNGGSTGATSAIAVTSAYRNAGNGQKDNVKTYIF
FT                   AQKIPVPAGKVVTSVTLPRQVSAGKMHVFGIGVAA"
FT   misc_feature    208096..208236
FT                   /note="Signal peptide predicted for BPSS0159 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.943) with cleavage site
FT                   probability 0.438 between residues 19 and 20"
FT   misc_feature    210556..210585
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT   CDS_pept        211595..212653
FT                   /transl_table=11
FT                   /locus_tag="BPSS0160"
FT                   /product="putative siderophore biosynthesis-related
FT                   protein"
FT                   /note="Similar to Pseudomonas aeruginosa pyoverdine
FT                   biosynthesis protein PvcA or pa2254 SWALL:Q9I1L5
FT                   (EMBL:AE004651) (328 aa) fasta scores: E(): 1.5e-74, 61.16%
FT                   id in 309 aa, and to the N-terminal region of Vibrio
FT                   cholerae PvcA protein vc1949 SWALL:Q9KQP9 (EMBL:AE004270)
FT                   (608 aa) fasta scores: E(): 1.3e-13, 30.45% id in 243 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37605"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="InterPro:IPR017133"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NY8"
FT                   /protein_id="CAH37605.1"
FT                   /translation="MKCDRNDEIALAILGEILGIHRRYPEYTTDSDIRHEIEQIHAVQL
FT                   PRIRAFVDAARPVEFVLPAFPSKSPNPNKVLGRLPDMAEQLSLSFLNDLCERISGFYAP
FT                   GAKLTICSDGRVFGDLIRVDDRDITAYQHALGQLIAALRADRLSTYNLENFEAFAQRAA
FT                   NFDDMRRRLVDEFADPIEAIRHRLMADEEGTLLYRAMTRFMFEDGFTPDYRGSKAALQK
FT                   DSKTRALGVIQRSWAWGALLATRFPDAIRLSIHPQPAASLKIGVHMMPTRDNWLTPWHG
FT                   VAVDLGDQFALMKRRDVELLGGRVVMRGGRPSHYAIERWRVAGDALAPLAGGGARPRAD
FT                   AGGALVISGEAV"
FT   CDS_pept        212650..213564
FT                   /transl_table=11
FT                   /locus_tag="BPSS0161"
FT                   /product="putative siderophore biosynthesis-related
FT                   protein"
FT                   /note="Similar to Pseudomonas aeruginosa pyoverdine
FT                   biosynthesis protein PvcB or pa2255 SWALL:Q9I1L4
FT                   (EMBL:AE004651) (291 aa) fasta scores: E(): 4.4e-76, 61.03%
FT                   id in 290 aa, and to Vibrio cholerae PvcB protein vc1944
FT                   SWALL:Q9KQQ4 (EMBL:AE004270) (287 aa) fasta scores: E():
FT                   1.1e-54, 48.86% id in 264 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37606"
FT                   /db_xref="GOA:Q63NY7"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NY7"
FT                   /protein_id="CAH37606.1"
FT                   /translation="MNDLFLPRAVSLEPLTSDAGAPCSFGVLVKPRRARTHVGELSIEW
FT                   LRALVRSQQLVVLRGFDSFADAPGMTRYCAAFGEIMMWPFGAVLELREQANPVDHVFAS
FT                   SYVPLHWDGMYLETVPEFQVFQCVQAIGDAHGGRTTFSSTTEALRVATPEARALWQRAH
FT                   GRYRRTVELYSNTVEAPIVERHPRREFPILRFCEPPIADDPTFINPSSYTFGGIADSER
FT                   DALLGSLTRALYDPRAHYAHRWRTGDVVLTDNFTLLHGRERFTSRSGRHLRRVHIHGDP
FT                   PLRNPHLSKQPHDAAAADAAASA"
FT   CDS_pept        213569..215074
FT                   /transl_table=11
FT                   /locus_tag="BPSS0162"
FT                   /product="putative siderophore biosynthesis-related
FT                   protein"
FT                   /note="Similar to Pseudomonas aeruginosa pyoverdin
FT                   chromophore biosynthetic protein PvcC or pa2256
FT                   SWALL:PVCC_PSEAE (SWALL:O30372) (500 aa) fasta scores: E():
FT                   2.2e-156, 76.17% id in 491 aa, and to Escherichia coli
FT                   4-hydroxyphenylacetate 3-monooxygenase, oxygenase component
FT                   HpaB SWALL:HPAB_ECOLI (SWALL:Q57160) (520 aa) fasta scores:
FT                   E(): 2.5e-81, 43.84% id in 504 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37607"
FT                   /db_xref="GOA:Q63NY6"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024677"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NY6"
FT                   /protein_id="CAH37607.1"
FT                   /translation="MVQGGTTMTLMTGNDYLDSLRDGRNVYVGGERIADVASHRAFRNA
FT                   ARSIASLYDALHGEHRERLTAPDRHGQITHRFFKPSESPDDLLAAQDAIELWSRMTYGF
FT                   MGRTPDYKAAFMSGLEAGADYYGDFRQNAAGWYKRFAGSGLYLNHAIINPPLDRGKAIH
FT                   DMRDVFVRVVGETDRGIVVSGVKMLATAGALTNATFVAPVASALLEPGKADDFAIVFFA
FT                   RMDNPGLSLMCRPSYEAAATSPFDAPLSSRFDENDSVLIFDRALIPWEDVLVYRDVKRA
FT                   TGFYAASGFANLYNFQSGIRLAVKLELMIGLLSLGTQANGTQSFRGIQAALGELVSLQH
FT                   LLKTITAAMARDPERTPSGVVVPKLQYASALRIQVPQIWKRVRELMETALGGSPLVTVS
FT                   GAADLLDPRVKGLIDAYYRGAALEPQQRIKLFKLIWDATGSEFGSRHSVYETHYSGNFD
FT                   QIRLDSLTWATRSGQLADCEAFARQCMGDYDASGWLRGPWLHG"
FT   misc_feature    213902..215017
FT                   /note="Pfam match to entry PF03241 HpaB,
FT                   4-hydroxyphenylacetate 3-hydroxylase family , score 598.7,
FT                   E-value 2.3e-177"
FT   CDS_pept        215120..216988
FT                   /transl_table=11
FT                   /gene="asnO"
FT                   /locus_tag="BPSS0163"
FT                   /product="asparagine synthetase [glutamine-hydrolyzing]"
FT                   /EC_number="6.3.5.4"
FT                   /note="Similar to Bacillus subtilis asparagine synthetase
FT                   [glutamine-hydrolyzing] 3 AsnO SWALL:ASNO_BACSU
FT                   (SWALL:O05272) (614 aa) fasta scores: E(): 1.6e-68, 42.01%
FT                   id in 626 aa, and to Streptomyces aureofaciens asparagine
FT                   synthase homolog TcsG SWALL:Q9FAR2 (EMBL:AB039379) (609 aa)
FT                   fasta scores: E(): 2.6e-128, 54.76% id in 619 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37608"
FT                   /db_xref="GOA:Q63NY5"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NY5"
FT                   /protein_id="CAH37608.1"
FT                   /translation="MCGITGWIDFARDLRNEAPIVDTMTDTLARRGPDARGVWLDTHAA
FT                   LGHRRLSIIDPERGAQPMLTPERGPRGLPRAVISYAGETYNFRELRAELGALGHRFDTH
FT                   CDTEVVLRAYLEWGAAFVDRLNGMYSIAIWDTARDELLLVRDRLGVKPLFYYPTADGVI
FT                   FGSEPKAILAHPDVRARTSSEGLCDALLFLRTPGQVPFSGMREVKPGHVLRVRRGGLAE
FT                   QRYWALEARPHTDDLPTTIATIRALLDDIVSRQMISDVPLCALLSGGVDSSTIAALAQK
FT                   RRRASGGGALSTFCVDFTGHTRNFRADPIRPTADAPFALEVARHIGSDHHTIELDQAGL
FT                   LDPQVREAVLRAWDLPFNFADLDVSLHRLFAEVRKHATVALSGEAADEIFGGYLWFSDP
FT                   AARRAHTFPWLKLGAHRGLDPRALFHRSFIDALRLGEYEAQLYRAALAEVPRLDGENAE
FT                   DRRTRELHYLTLTRWLPVLLDKKDRMGMASGLEGRVPFCDHRLVEYVFNIPWAMKTFSG
FT                   QEKALLRAAAADLLPESVLNRKKAAYPSIQAPGYDRGLIERLNRAIAAGRAPLEPFIDA
FT                   GALRGLTEKTAAGSLSEFERILLESSSRLNDWLDLYRVELDGVPAG"
FT   misc_feature    215123..215587
FT                   /note="Pfam match to entry PF00310 GATase_2, Glutamine
FT                   amidotransferases class-II , score 52.0, E-value 8.3e-13"
FT   misc_feature    215786..216829
FT                   /note="Pfam match to entry PF00733 Asn_synthase, Asparagine
FT                   synthase , score 109.8, E-value 3.5e-30"
FT   CDS_pept        217017..217988
FT                   /transl_table=11
FT                   /locus_tag="BPSS0164"
FT                   /product="putative quinone oxidoreductase"
FT                   /note="Similar to Mycobacterium tuberculosis quinone
FT                   oxidoreductase rv1454c or mt1501 or mtv007.01C SWALL:O53146
FT                   (EMBL:AL021184) (335 aa) fasta scores: E(): 2.6e-54, 54.1%
FT                   id in 329 aa, and to Pseudomonas aeruginosa quinone
FT                   oxidoreductase Qor or pa0023 SWALL:QOR_PSEAE (SWALL:P43903)
FT                   (325 aa) fasta scores: E(): 3.4e-42, 46.27% id in 322 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37609"
FT                   /db_xref="GOA:Q63NY4"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NY4"
FT                   /protein_id="CAH37609.1"
FT                   /translation="MQAIEIRETGGPDVLEYVTRAAREPGRGELLVELAAAGVNFIDLY
FT                   RREGRYPMPLPGTPGEEGAGRVLAVGPDVTRFKPGDRVAWTTVMGSYATRVVVPEDKAI
FT                   AVPDGIDLRTAAAALVQGMTAHYLVNDSYRAREGDVVLVHAAAGGVGLLLTQWLKRRGV
FT                   RVIGTVSTAGKAALARSNGADDVVLHGAFDDLAAEVRRLTDGRGVHAVYDGIGAATFDA
FT                   SLASLRTRGTLVIFGGASGPVPPVDVMRLLWGGSLTLTRPYLEHFRASVDEFLWRAGAV
FT                   FDGILDGSLKIRIGGAYPLADARRAHADLAARRTTGKLLLVP"
FT   misc_feature    217041..217985
FT                   /note="Pfam match to entry PF00107 adh_zinc, Zinc-binding
FT                   dehydrogenase , score 272.7, E-value 3.1e-79"
FT   misc_feature    217428..217493
FT                   /note="PS01162 Quinone oxidoreductase / zeta-crystallin
FT                   signature."
FT   CDS_pept        218043..218969
FT                   /transl_table=11
FT                   /locus_tag="BPSS0165"
FT                   /product="putative dioxygenase"
FT                   /note="Similar to Salmonella typhi
FT                   3,4-dihydroxyphenylacetate 2,3-dioxygenase sty1137
FT                   SWALL:Q8Z7Q1 (EMBL:AL627269) (283 aa) fasta scores: E():
FT                   6.7e-18, 29.21% id in 291 aa, and to Escherichia coli
FT                   3,4-dihydroxyphenylacetate 2,3-dioxygenase HpcB
FT                   SWALL:HPCB_ECOLI (SWALL:Q05353) (275 aa) fasta scores: E():
FT                   4.2e-16, 28.95% id in 259 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37610"
FT                   /db_xref="GOA:Q63NY3"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR011984"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NY3"
FT                   /protein_id="CAH37610.1"
FT                   /translation="MGKIVGAGLISHAPVVMMPQAVRLRENGGRDFTLATGLARLRRDV
FT                   FDAHDYDTVLVFDSHWLTTTEAVVTAHARRAGRFTSDEMPNAIRQLPYDLAGDPALAHA
FT                   IAEQARRRASWIDAVDDPCLPLHYATLNPWTYLGRPDKRWLSVSVCQTATTEDFLRMGE
FT                   TVAQAIAQLERKVLLVASGGLSHAFWPLAELRGRMAGAASNIVTPAARAADERRIAWLE
FT                   QGRHDRVIDAMPEFLRFAPEANFGHYLMMAGALGARACAARARRFSEYENGIGTGHVHL
FT                   WFSPADGGWARAETHNERRTETDAASA"
FT   misc_feature    218196..218600
FT                   /note="Pfam match to entry PF02900 LigB, Catalytic LigB
FT                   subunit of aromatic ring-opening dioxygenase , score 38.2,
FT                   E-value 3.8e-11"
FT   CDS_pept        complement(219213..220175)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0166"
FT                   /product="LysR family regulatory protein"
FT                   /note="Similar to Pseudomonas aeruginosa transcriptional
FT                   regulator for exotoxin A production PtxR or pa2258
FT                   SWALL:PTXR_PSEAE (SWALL:P72131) (312 aa) fasta scores: E():
FT                   1.3e-42, 42.06% id in 290 aa, and to Salmonella typhi
FT                   possible LysR-family transcriptional regulator sty3037
FT                   SWALL:Q8Z482 (EMBL:AL627276) (310 aa) fasta scores: E():
FT                   4.1e-25, 30.84% id in 308 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37611"
FT                   /db_xref="GOA:Q63NY2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NY2"
FT                   /protein_id="CAH37611.1"
FT                   /translation="MTVLEVGNMSEVGIRNLNHLRVFMAIVEKGSFTAAAECLSMSKSL
FT                   VSEYLSRLEAEIDTQLVMRSTRRIAPTDAGNKLYCASQAFVSGLYDVIGSIRCLRHEST
FT                   GLLRVAAPSGFSTTHLSSIAATFIHQHPQIELEIVCNDDEIDLVGERVDLAFETGWPKK
FT                   KGFRMKMLGAFDQVLVASPEYSRRHAVPRHPDDLPGSHWIGHGGLANLSYSVFGNEGRS
FT                   VRIQTPGRLKVKSVLLAHQMALAGAGISAFPDYLVAEDLREGRLHRLLPTWTMPKGGIY
FT                   AFRTAPRQASVRERLFLAAVQAYLAGLCGEHARAGAVPT"
FT   misc_feature    complement(219258..219878)
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain , score 129.8, E-value 3.3e-36"
FT   misc_feature    complement(219948..220127)
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family , score
FT                   82.7, E-value 4.9e-22"
FT   misc_feature    complement(220023..220088)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1341.000, SD 3.75 at aa 30-51, sequence
FT                   GSFTAAAECLSMSKSLVSEYLS"
FT   CDS_pept        complement(221397..225473)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0167"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Salmonella enterica subsp. enterica
FT                   serovar Typhimurium SciS protein precursor SWALL:Q93IR7
FT                   (EMBL:AJ320483) (1289 aa) fasta scores: E(): 2.4e-141,
FT                   45.3% id in 1351 aa, and to Yersinia pestis putative
FT                   membrane protein ypo2724 SWALL:Q8ZD68 (EMBL:AJ414153) (1275
FT                   aa) fasta scores: E(): 3.4e-48, 29.77% id in 1360 aa. Note:
FT                   The amino acid residues between approx. position 255 and
FT                   position 320 present no similarities to the database
FT                   matches. Also similar to BPSS0103 (1303 aa) fasta scores:
FT                   E(): 5.1e-92, 47.210% identity in 1362 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37612"
FT                   /db_xref="GOA:Q63NY1"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NY1"
FT                   /protein_id="CAH37612.1"
FT                   /translation="MNKFLSFLVSRSFIAFVALLAVALVIWFVGPFVAFGGLTPLAGAG
FT                   MRVLAIALLLAGVLLWLAGRPTSIVFVALLCVLIWHASPLLAFGGATPFAAEAVRAIAI
FT                   ALVLAAFALHLAFRLLQKARTDPDFLKSLLEFGGKQPESPAAGRLVAVNAAIAGAIARL
FT                   KGMRSGARGLRRLLRGKRYLYELPWYVTLGSRACGKTSALLNAGLSFPVAAQMPRAAAG
FT                   LPDHGGSVDWWLTNDAVLIDTAGHYTRHGTSAHAAPLPPAGPAPHAQPFDAAADARRAN
FT                   GQPAGERHAVAMAAAAPSSAAFVDERQAQWRQTVDQAEWLGFLRTLRKHRPREPINGAL
FT                   LAVDVATLTSADDNARHAEAAALRARLADLRAQLGVRFPVYLIVTKTDQLPGFAEYFSA
FT                   LTTEGRAQTWGFTLPYDKETIADEGVHARCADELRALAARLAAGVNTRLQEEHDTQRRR
FT                   RLAALPEEFLVLTRPLGELIDRVFADSRYDDTQHHATLRGVYFTSAAQTGGEAAAETRT
FT                   VARRLAAATGRAPAAAARAAQQETSQSFFLHDLLTKIVIPDARLVQPNLRWEYRSRTLS
FT                   LAAHALALLLFAWVAIGLRVSMGNNDAYLDALARKTAALASRVDQLYKAPKPEAVPDVL
FT                   TQARSLSAYPGLDLSAPGSGWRFGLYTPPGIVAESSRTYDALEDTLLLPRIVTRIEAVL
FT                   SQAIADRDPNAAYDALRVYLMLYDRARFDAAQVEAWVLDDWARTDSAAVFGGRASMIAH
FT                   VEQLFRGERIVQSPLIRNDALIRQARAFLDGSNATERLYERAKAAMNKEAPDEFTLLRA
FT                   VGPQAGTVFTRASGAPLARGVPGLFTFDGYRRVFDKRLAEFVRTAREDDAWVMGRAYLG
FT                   DAQKKTAEIANALAGADDPLTDAIRRQYLIEYAQQWDAFLGDIRTIGGTSLAFDLVVLR
FT                   SFAAPDSPLERLARAAVHETTLAQPEASADRSFLQKASAQLSQQADKALGVRAQERVER
FT                   ELVDNRFAGLREMVTGRADTQTDARPGAPAGKSGLDAVANLLNDYYTALTVSDDALANN
FT                   SMPPANDTAAKLKMAAQTMPAPFRSVLTGLAAQGSREVNRGIGQLLSRQLQATVGDVCR
FT                   LAIEGNYPFAPDSKRDVGIEDFTRVFAQGGVIDDFFAKTLAPFVDTSTRPWRYKTLPGA
FT                   TEPVEGPDLEPFQHAKAIREVFFGAPGQKQMAWKADIRIPELDPTITSLAIDVDGQTAL
FT                   YQHGPVAPFAVSWPGPRGGVHAEITASPRIRPDTSAVSTDGPWALLRLLQKGRVSGTAT
FT                   PGRTRVTLDFDGRKAVLDLASTGSVANPLTSDVLKTFRCPGSMPMFSLADTGAPPGLPP
FT                   GSPAAPTSRVARDGR"
FT   misc_feature    complement(order(223677..223745,225114..225173,
FT                   225201..225269,225288..225356,225369..225437))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BPSS0167 by TMHMM2.0 at aa 13-35, 40-62, 69-91, 101-120 and
FT                   577-599"
FT   misc_feature    complement(224838..224858)
FT                   /note="PS00046 Histone H2A signature."
FT   misc_feature    complement(224874..224897)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(225366..225473)
FT                   /note="Signal peptide predicted for BPSS0167 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.837 between residues 36 and 37"
FT   CDS_pept        complement(225502..226767)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0168"
FT                   /product="OmpA family membrane protein"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   enterica subsp. enterica serovar Typhimurium putative outer
FT                   membrane protein, OmpA family stm0282 or SciP SWALL:Q93IS0
FT                   (EMBL:AE008707) (434 aa) fasta scores: E(): 6.7e-63, 48.33%
FT                   id in 391 aa, and to Pseudomonas aeruginosa hypothetical
FT                   protein pa0078 SWALL:Q9I754 (EMBL:AE004447) (449 aa) fasta
FT                   scores: E(): 1.3e-22, 37.44% id in 414 aa. Note: Also
FT                   similar to BPSS0102 (434 aa) fasta scores: E(): 2.1e-55,
FT                   46.283% identity in 417 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37613"
FT                   /db_xref="GOA:Q63NY0"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR017733"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NY0"
FT                   /protein_id="CAH37613.1"
FT                   /translation="MHHPDISAPAPTFDSVAATFARREPAPAPAGEPPAARLAAIRLAR
FT                   NPLLEAARVLLRALADMPERLDRDDIPQLRLLLEQEVRLFQRLCEQANIRRDHMLGARY
FT                   CLCTALDEAAMQTSWAQSASGNLGTWISEGLATSFHEDRQGGDKVYLLIGRLMNSPHEH
FT                   IDLLEVIYRILSLGFEGRYRYEADGQRKHETVRQRLYNEIASQRGPVSVALSPHWQPGP
FT                   RSRSAPFRDFPAWVTAAVLSLIALGLFGCFKYALSTRSADVQQRIAAIARMAPPAAPAE
FT                   LRLATLLAGEIAAGTLSVEENARRSSVTFRGDAMFAPGAAGVNPAMGPLIRKIAAEIAK
FT                   VPGKVTVRGYTDNQPIKSRQFASNEALSEERATQVMQMLQSAGVPASRLEALGKGGAEP
FT                   IGDNRTPQGRALNRRVEITVAR"
FT   misc_feature    complement(225529..225825)
FT                   /note="Pfam match to entry PF00691 OmpA, OmpA family ,
FT                   score 111.1, E-value 1.4e-30"
FT   misc_feature    complement(226000..226068)
FT                   /note="1 probable transmembrane helix predicted for
FT                   BPSS0168 by TMHMM2.0 at aa 234-256"
FT   CDS_pept        complement(226856..228202)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   enterica subsp. enterica serovar Typhimurium putative
FT                   cytoplasmic protein stm0281 or SciO SWALL:Q93IS1
FT                   (EMBL:AE008707) (447 aa) fasta scores: E(): 4.3e-107,
FT                   59.73% id in 447 aa, and to Yersinia pestis hypothetical
FT                   protein ypo2934 or y1549 SWALL:Q8ZCP3 (EMBL:AJ414154) (449
FT                   aa) fasta scores: E(): 3.6e-97, 55.05% id in 445 aa. Note:
FT                   Also similar to BPSS0101 (453 aa) fasta scores: E():
FT                   4.5e-106, 62.054% identity in 448 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37614"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NX9"
FT                   /protein_id="CAH37614.1"
FT                   /translation="MSWHNKVVWSEGLFMRPQLFQQQERYLEHYAHKRAAPLSPFFFGF
FT                   SHFSLDSEAPALGKIIVKSASGVFADGTPFDAPGSTPPPAPLTIRPEHLDQVIYLAVPI
FT                   RVPNGEETAFDRAAESLARYAVFETDLRDTNSIGQGPKTVQLSNLRLRLLPEKELTDAW
FT                   IGLALTRVKTIRADASIELDDMLIPPVVGYGASDTLASWLAKIHDLTRLRANALAERLT
FT                   GSDGRAGTTAEVSDYLLLQTLNRYEPLLKHLQRVPTTSPAELYALLIGMAGELSTYVRT
FT                   DTRRPLDTHPPYQHVAPHLCLKPVVDDTHRLLNAVLVRSAQRLALADLGHGMLNAVVDP
FT                   VDMQGFTAVVLAVHAQMPPDLLQQQFAAQAKAGPSERLPDLVRSHLSGIALQALPVPPR
FT                   QIPFNAGYVYYELARGGPLWDEVARHGGLALHIAGEFPSLKLELWGIRG"
FT   CDS_pept        complement(228224..228736)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0170"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Salmonella enterica subsp. enterica
FT                   serovar Typhimurium SciN protein precursor SWALL:Q93IS2
FT                   (EMBL:AJ320483) (163 aa) fasta scores: E(): 2.9e-21, 46.25%
FT                   id in 160 aa, and to Pseudomonas aeruginosa hypothetical
FT                   protein pa1666 SWALL:Q9I359 (EMBL:AE004594) (168 aa) fasta
FT                   scores: E(): 6.4e-13, 39.85% id in 138 aa. Note: Also
FT                   similar to BPSS0100 (161 aa) fasta scores: E(): 2.9e-21,
FT                   45.860% identity in 157 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37615"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NX8"
FT                   /protein_id="CAH37615.1"
FT                   /translation="MPRMHPTTPVAAVALALACAACASGAAKQKEPLRLELAVRAAPTV
FT                   NPDDRSRPAPIVVSVYELKTDGAFNAADFFTLQGPDKTVLADDLLARERFQLRPGERRV
FT                   IRRDADPAAGALGVVAAYRDLPNSVWRAAYPLPPARDAAWYRFSSPKLKLTIELDTHAI
FT                   RITEPGK"
FT   misc_feature    complement(228659..228736)
FT                   /note="Signal peptide predicted for BPSS0170 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.290 between residues 26 and 27"
FT   misc_feature    complement(228680..228712)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(228834..229319)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   enterica subsp. enterica serovar Typhimurium putative
FT                   cytoplasmic protein stm0279 or SciM SWALL:Q93IS3
FT                   (EMBL:AE008707) (161 aa) fasta scores: E(): 2.9e-42, 68.12%
FT                   id in 160 aa, and to Yersinia pestis hypothetical protein
FT                   ypo2937 SWALL:Q8ZCP1 (EMBL:AJ414154) (161 aa) fasta scores:
FT                   E(): 8.8e-37, 57.59% id in 158 aa. Note: Also similar to
FT                   BPSS0099 (161 aa) fasta scores: E(): 4.1e-42, 66.456%
FT                   identity in 158 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37616"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NX7"
FT                   /protein_id="CAH37616.1"
FT                   /translation="MAQDIFLKIDGINGESLDDSHKDEIEVLNWNWEIQQESTMHTGSG
FT                   GGAGKASVKDLTFEHAIDRASPNLMKYALTGKHVDQAVLVMRKAGGNPLEYLKLTMSDV
FT                   IITRVRPSGSRDDTERSRETVSLSFAKVKQEYVVQNAQGGSGGAVTTSFDIKGNKEA"
FT   CDS_pept        complement(229436..230935)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo2938 SWALL:Q8ZCP0 (EMBL:AJ414154) (500 aa) fasta scores:
FT                   E(): 9.3e-166, 80.2% id in 500 aa, and to Salmonella
FT                   enterica subsp. enterica serovar Typhimurium SciI protein
FT                   SWALL:Q93IS7 (EMBL:AJ320483) (497 aa) fasta scores: E():
FT                   4.6e-161, 78.49% id in 493 aa. Note: Also similar to
FT                   BPSS0098 (500 aa) fasta scores: E(): 5.9e-182, 84.168%
FT                   identity in 499 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37617"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NX6"
FT                   /protein_id="CAH37617.1"
FT                   /translation="MKKQQAQTAAAGVQPQADSDFAQLLAQEFKPKTEQAREAVEYAVR
FT                   TLAEQALAQSATISDDAYKSIAAIIAQIDHKLSEQINLILHHADFQKLESAWRGLHHLV
FT                   SNTETDERLKIRFMDISKEELRRTMRRYKGQSWDQSPLFKQIYEEEYGQLGGEPYGCLV
FT                   ADYYFDHTPPDVDLLGSISKVAASAHTPFLSGASPSVLQMESWQELANPRDLTKIFTQN
FT                   LEYASWNALRNMDDARYIGLAMPRFLSRLPYGVLTNPVDEFDFEEDTNGADHRRYAWTN
FT                   AAYAMGVNINRSFRLYGWCSLIRGVESGGTVENLPCHTFPTDDGGIDIKCPTEIAISDR
FT                   REAELSKNGFIPLVHRKNTDHATFIGAQSLHKPAEYDDSDATANANLSARLPYLFACSR
FT                   FAHYLKCIVRDKVGAFKEREDMQRWLNEWIMNYVDADPANSSQDTKARRPLAAAEVVVE
FT                   QAQGNPGYYQAKFFLRPHFQLEGLTVSLRLVAKLPSIKEAA"
FT   misc_feature    complement(230048..230098)
FT                   /note="PS00237 G-protein coupled receptors signature."
FT   CDS_pept        complement(230970..231551)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0173"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo2939 SWALL:Q8ZCN9 (EMBL:AJ414154) (174 aa) fasta scores:
FT                   E(): 1.8e-45, 78.31% id in 166 aa, and to Salmonella
FT                   typhimurium, and Salmonella enterica subsp. enterica
FT                   serovar Typhimurium putative cytoplasmic protein stm0273 or
FT                   SciH SWALL:Q93IS8 (EMBL:AE008707) (180 aa) fasta scores:
FT                   E(): 1.2e-44, 77.43% id in 164 aa. Note: This CDS is longer
FT                   in its C-terminal region than most of its database matches
FT                   and also similar to BPSS0097 (180 aa) fasta scores: E():
FT                   4.5e-46, 81.818% identity in 165 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37618"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NX5"
FT                   /protein_id="CAH37618.1"
FT                   /translation="MSASSSSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLAD
FT                   LSGKPVAPLPAVADRRFLDIDIDNFDERMKAIKPRVAFAVDNTLSGDGQLMVDMTFESI
FT                   EDFSPAAIARMVGPLRQLLEARTQLANLQTYMDGKSGAETLVNQLLQDPALLRSLAAAP
FT                   KPQLAGGPDAGNARGAKDAPDTANHDSDAA"
FT   CDS_pept        complement(231587..234526)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0174"
FT                   /product="putative chaperone"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   enterica subsp. enterica serovar Typhimurium putative
FT                   ATPase with chaperone activity stm0272 or sciG SWALL:Q93IS9
FT                   (EMBL:AE008707) (879 aa) fasta scores: E(): 1.4e-75, 58.54%
FT                   id in 948 aa, and to Yersinia enterocolitica Clp
FT                   protease-associated protein ClpB SWALL:Q9F746
FT                   (EMBL:AF285784) (890 aa) fasta scores: E(): 1.7e-69, 55.59%
FT                   id in 939 aa. Note: Also similar to BPSS1502 (1013 aa)
FT                   fasta scores: E(): 1.8e-94, 44.865% identity in 1003 aa
FT                   overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37619"
FT                   /db_xref="GOA:Q63NX4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NX4"
FT                   /protein_id="CAH37619.1"
FT                   /translation="MAISRQALFGKLGATLFRAIESATVFCKLRGNPYVELVHWLQQLL
FT                   QQSDSDLHRIVRHAGIERDALDRDIARALAALPAGAGSISDFSHHVEAAIERAWVLATL
FT                   RFGDRRIRGAWLVAALVDTPELRRVLLSISPAFARIPHDDALDDVLPAWTAGSPEAADA
FT                   PYDHADSAPASPGEPSGATRAAPNGSPLERYCTDLTARARDGDIDPVIGRELEIRTMTD
FT                   VLLRRRQNNPLLTGEAGVGKTAVVEGLALAIANGDVPPKLADVRLMSVDVGALLAGAGM
FT                   KGEFEARLKGVLEAAAKSVAPVILFVDEIHTLIGAGGQAGTGDAANLLKPALARGTIRT
FT                   IGATTWAEYKRHIEKDPALTRRFQVLQVPEPEEPAAVHMVRGVARAFARHHRVTVRDEA
FT                   IRAAVALSHRYIPSRHLPDKAISLLDTACARVALSQHAAPGELQHVRQRLLAARAERDL
FT                   LEQEARIGLDAGQSLAAVRERIEALAAEEAAVDARWKAQADAARALLAAREAALAECHR
FT                   ESCSETRAGSLSESRTESRTESRARSHIDSSAYAHSDVPAEMHVGSHAGSRAATCPDTH
FT                   AEAHAAPASPPPAADTPHAGAAPGLRELERALAAAQGDAPLVFPEVDETIVAQIVADWT
FT                   GIPVGRMMTDEVAAVRALPATLEARVIGQPDALRQIGERVQTARAGLADPKKPLGVFLL
FT                   AGPSGVGKTETALALAEALYGGEQSLITINMSEYQEAHTVSGLKGAPPGYVGYGEGGVL
FT                   TEAVRRRPYSVVLLDEIEKAHRDVHELFFQVFDKGYMEDGDGRYIDFRNTTILLTSNVG
FT                   AELSASLCADASLAPDAAALRDALMPELLKVFPAAFLGRVSVVPYRPLEARALARIVRL
FT                   HLDRVVARMAERHRIALAYDDAVVDYVVGRCLVQETGARLLIGFIEQHVLPRLSALWLD
FT                   AFPSKAALARIDIGVADAAAPAARALVFRPGQASRAGPPNAPLTAVQAG"
FT   misc_feature    complement(232418..232441)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(233324..233836)
FT                   /note="Pfam match to entry PF00004 AAA, ATPase family
FT                   associated with various cellular activities (AAA) , score
FT                   29.8, E-value 3.5e-07"
FT   misc_feature    complement(233519..233557)
FT                   /note="PS00870 Chaperonins clpA/B signature 1."
FT   misc_feature    complement(233798..233821)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(234173..234208)
FT                   /note="PS00213 Lipocalin signature."
FT   CDS_pept        235059..235778
FT                   /transl_table=11
FT                   /locus_tag="BPSS0175"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37620"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NX3"
FT                   /protein_id="CAH37620.1"
FT                   /translation="MRAFKLFRRGPPDIERAETAARRDFEPSCAGVDMEGNAGDETGAC
FT                   LAEAQPPRAPQAGPQGATDGGDAVFGVIGAAFAADTPGERQGGMAAGASAVCGTVAAQD
FT                   LLHTLYEQYCRVLDDPRASLASDDAARLAIERTRDAGPQIDPQRSADGADSIDALLSRA
FT                   RVLDDAFGTFAPGEAPDPADAEPVPEVLRLFAPAEYHAASARRPAGLPPALARREHQTL
FT                   AIDSPLPAPVATSEHGA"
FT   CDS_pept        235775..236740
FT                   /transl_table=11
FT                   /locus_tag="BPSS0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Salmonella enterica subsp. enterica
FT                   serovar Typhimurium SciE protein SWALL:Q93IT1
FT                   (EMBL:AJ320483) (279 aa) fasta scores: E(): 6.8e-24, 38.69%
FT                   id in 292 aa, and to Pseudomonas aeruginosa hypothetical
FT                   protein pa0086 SWALL:Q9I746 (EMBL:AE004447) (281 aa) fasta
FT                   scores: E(): 8.4e-23, 37.5% id in 272 aa. Note: Also
FT                   similar to BPSS0114 (285 aa) fasta scores: E(): 7.9e-24,
FT                   39.590% identity in 293 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37621"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NX2"
FT                   /protein_id="CAH37621.1"
FT                   /translation="MTTPAFPAPPGARTSARPHDTLLDARLAAAQAAVRARPVDAASRW
FT                   ALFQLLCVTGQWERAVGQLQAYARFAAQHAHIAHAYRDLIRAERFRARVMAGQARPGFV
FT                   FDAPPWIDDLLEALRAQAAGARDEADRARSRALDRAPFVAGRGPDAPFDWIADSDSRFG
FT                   PVCEVVTAGHDRWLPFSDLAGWRLARPGVLLALVWAPCVLTLADGSVAHGFMPARYPGS
FT                   ELADGGGAPGASAAAHEADAHESAAREADALRLGSRTAWRDVGRTGVFALGRKTWSTSA
FT                   GDAGLFELHACEFGARARAGAVLGGAAREARGGEAADGCA"
FT   CDS_pept        236781..237308
FT                   /transl_table=11
FT                   /locus_tag="BPSS0177"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   enterica subsp. enterica serovar Typhimurium putative
FT                   cytoplasmic protein stm0269 or SciD SWALL:Q93IT2
FT                   (EMBL:AE008707) (164 aa) fasta scores: E(): 6.7e-24, 48.12%
FT                   id in 160 aa, and to Yersinia pestis hypothetical protein
FT                   ypo2728 or y1561 SWALL:Q8ZD64 (EMBL:AJ414153) (159 aa)
FT                   fasta scores: E(): 3e-21, 38.71% id in 155 aa. Note: Also
FT                   similar to BPSS0113 (173 aa) fasta scores: E(): 3.8e-25,
FT                   45.912% identity in 159 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37622"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NX1"
FT                   /protein_id="CAH37622.1"
FT                   /translation="MRGEGLATPRRANTQLLPTLIDRLRDDAPQRQTEAPGGYALTRMQ
FT                   MRGIVQRDLAFLLNTTSIDEHIDRERHPAAAASTLNFGVPPLAGAFLASCQWAEVERII
FT                   RRVILDFEPRLIAETLVVAPSRAAGAVARPNVLAFEVRGMIRMDPYPIEFMVQSALDLE
FT                   TNQVNITGMRAS"
FT   CDS_pept        237339..239228
FT                   /transl_table=11
FT                   /locus_tag="BPSS0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Salmonella enterica subsp. enterica
FT                   serovar Typhimurium SciC protein SWALL:Q93IT3
FT                   (EMBL:AJ320483) (627 aa) fasta scores: E(): 3.9e-156,
FT                   61.14% id in 628 aa, and to Yersinia pestis hypothetical
FT                   protein ypo2947 or y1537 SWALL:Q8ZCN4 (EMBL:AJ414154) (626
FT                   aa) fasta scores: E(): 2.1e-143, 55.09% id in 628 aa. Note:
FT                   Also similar to BPSS0112 (627 aa) fasta scores: E():
FT                   1.2e-144, 63.796% identity in 627 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37623"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NX0"
FT                   /protein_id="CAH37623.1"
FT                   /translation="MDPQLLDYYNQELIYMRELGAEFARAHPKIARRLGMQAGEVADPY
FT                   VERLIESFCFMAARMQIKLDAEFPRFTGRLLEVLYPNYVAPTPSMAVARLYPSRTEGNL
FT                   AQGFRVARGTAFAARVPAGEKTACRFRSGQDVTLYPLEIADARLTGIPPDIPALDRYVP
FT                   AGAQVRGALRLRLRTTGNMRIADLRGLDRLPLYLAGDAQVASHLFELLHVAGVATLTAA
FT                   PGEFAAPGRPPAAVTVDALAHEGLGADEGLLPLTWAKFHGHNLLHEYFACPERFYFVAL
FT                   TGLEEGLRRIAGSEVEIVVLLEQSPERLADVVDASRFALFCTPVINLFPRHMDRIELSS
FT                   GQTECHLVPARLAPLDYEVFSVEAMYGQVAATSAELEFRPLYQTLNDDESNYGRYFSTR
FT                   RERRLVSDFARRYGTRTPYVGTEMFVSLVDQNEAPYSEDIRYLSVDALVTNRDLPSLVP
FT                   RDGVRDLTAIESAPIDSVGLIRAPSAPKAPYAEREIAWRLIRQLNFNYLPLDELDHRAG
FT                   GQGLRGLLRLFLAGDEADSRRQVESLVGVKTRPVTRKLPGAGPLVFGRGVECALSVDET
FT                   GFSGVSPYLFGLVLEHYLARHVSINVFTQTELNSIQRGRIARWPVRMGARGGA"
FT   CDS_pept        239240..240313
FT                   /transl_table=11
FT                   /locus_tag="BPSS0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Salmonella enterica subsp. enterica
FT                   serovar Typhimurium SciB protein SWALL:Q93IT4
FT                   (EMBL:AJ320483) (291 aa) fasta scores: E(): 1.2e-65, 56.29%
FT                   id in 286 aa, and to Yersinia pestis hypothetical protein
FT                   ypo2948 SWALL:Q8ZCN3 (EMBL:AJ414154) (341 aa) fasta scores:
FT                   E(): 1.2e-57, 47.02% id in 319 aa. Note: This CDS is longer
FT                   in its N-terminal region than most of its database matches
FT                   and it is also similar to BPSS0111 (350 aa) fasta scores:
FT                   E(): 4.6e-66, 55.224% identity in 335 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37624"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NW9"
FT                   /protein_id="CAH37624.1"
FT                   /translation="MTQAAVADTALSPQALARLRAEPWRYGFLALLRRIGADARIDPIG
FT                   KARRPQAEPFRLGQQPSLAFAPREIASVGDANGRLKVRLFGLGMLGPNGPLPIHVTEIA
FT                   RDREESRRDPTLGNFLDIFHHRYLTLLYRAWASAQAVAGLDRPDDERFSFYVASLAGQD
FT                   LDEVGAQPLPAHARLSASPHLVREARNADGLRMTLERYFGVPVTLEENVFHWIAVDPLE
FT                   HSRLGRPGDASTMAAGALLGELVPDRQHKFRLVFGPLDIDAYLRFTPRGEDLPRLVEWV
FT                   RAFVGYEFEWELELRIKPNGAPPAVMGGPHQLGWSGWLGRSPSGEPVTGMRFEPEHYAH
FT                   GFARGTARDTRGMRGER"
FT   CDS_pept        240310..241455
FT                   /transl_table=11
FT                   /locus_tag="BPSS0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Salmonella typhimurium, and Salmonella
FT                   enterica subsp. enterica serovar Typhimurium putative
FT                   cytoplasmic protein stm0266 or SciA SWALL:Q93IT5
FT                   (EMBL:AE008707) (351 aa) fasta scores: E(): 1.7e-34, 45.33%
FT                   id in 364 aa, and to Yersinia pestis hypothetical protein
FT                   ypo2949 SWALL:Q8ZCN2 (EMBL:AJ414154) (393 aa) fasta scores:
FT                   E(): 5.7e-20, 30.53% id in 393 aa. Note: Also similar to
FT                   BPSS0110 (357 aa) fasta scores: E(): 1.3e-23, 44.101%
FT                   identity in 356 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37625"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NW8"
FT                   /protein_id="CAH37625.1"
FT                   /translation="MTPSRKPAGRAAAARTPKPDGWMAPVDAAAPCGADLEYDPEFVVL
FT                   AAKVAPRAEAQYGDFVGSPEPVNWSDVERDCRRLMMRSKDMRLAVLFARSRTRLAGATG
FT                   LAEGIGLLAAWLAAFPDAIHPQADVDADRDAALEIRRNALQALTDADGLLADVREIALT
FT                   RSSATRLQVRDVERAFAQPRPGDALAPESVVRQLDDLHAQQPETLAGFGDALAGLAAID
FT                   AWSGEHLGDYAPDLSALDALLRRIAGANARGDRAEAEPIAPAEADAPPASEAAAAHAHA
FT                   HAHAHAHAHAHAHASPPRRREPAAQALAAAIAGEPAAQPVDRYAARELIRQARQWFEQH
FT                   EPSSPIPILLRRAEHFVGKRYADVVQAIPAELLALWSADET"
FT   CDS_pept        241527..243854
FT                   /transl_table=11
FT                   /locus_tag="BPSS0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo2725 SWALL:Q8ZD67 (EMBL:AJ414153) (921 aa) fasta scores:
FT                   E(): 4.7e-87, 45.51% id in 580 aa, and to Shigella flexneri
FT                   Rhs-family protein sf0265 SWALL:AAN41925 (EMBL:AE015061)
FT                   (737 aa) fasta scores: E(): 2.4e-74, 46.15% id in 546 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37626"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NW7"
FT                   /protein_id="CAH37626.1"
FT                   /translation="MPNFSAARTVTVSGPAVPTTPVGEPALELSAIRGDETLSQIYSYT
FT                   LDCLTPPDPLLAHERAANLDLKAMIGKALTVTVQLEGMGSFVPGMPGMAGAANIGAGAR
FT                   EISGIVTGARFEGQLNRQCRYRLTMRPWIYLADLRSDYRIFQNRSVDEIVDEVLNAYSY
FT                   SYDKRLSGRYPKLGYQVQYGETDFAFIQRLMQEHGIYWFFEHTNQVHRMVLVDHLGAHK
FT                   PVESAAYRTLRYYPPGHKIDAEYIDRFSTEEHIRPGRWATGDFDFEKPNADLGVENALP
FT                   RDTAHNGLERYEWPGDYTAREHGEHLARVRMEQTRARGERASGGGNVRDIVCGTTFALA
FT                   GHPHASANREYLVIGATFEATETGGASGPGAYRIDTSFVAQPATTAFRPPRTVRKPRTR
FT                   GPQTAIVTGPRGQDIWTDQYGRVKLKFHWDRSLVDDQNSSCWVRVSYAWSGNNYGGVNI
FT                   PRVGSEVVVDFEHGDPDRPLVTGQVYNALHMPPWPLPENATQSGFMTRSPAGGGENANM
FT                   LRFEDKAGEEQVKLHAERNYDVSVERDATTAVGRKHLTLVGVDLMPVMSTRSPLERLID
FT                   LLRTGGAASPAASGQPAAASRQPSGQQQQHQQQHQQHQRQRQPYQQLKQQRQMQRAGGW
FT                   QALAANVAKTLQEIVAVLTDPFVTASVSTVQGASTSVVFGDAKGVHVGDTVKITSGDAH
FT                   SEVNGTASSKDVNSVSLKGTSTSLTGVSTSETGTNIVTTGLTVSTTGASVSTTGFSATE
FT                   TLVQVAKKTQECEFIKGIKISM"
FT   CDS_pept        243886..246363
FT                   /transl_table=11
FT                   /locus_tag="BPSS0182"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar in its full length to Yersinia pestis
FT                   hypothetical y3665 SWALL:AAM87213 (EMBL:AE013969) (739 aa)
FT                   fasta scores: E(): 6.7e-20, 24.39% id in 779 aa, C-terminal
FT                   region to Yersinia pestis hypothetical protein ypo0509
FT                   SWALL:Q8ZII9 (EMBL:AJ414143) (540 aa) fasta scores: E():
FT                   3.1e-09, 23.14% id in 566 aa, and N-terminal region to
FT                   Rhizobium loti hypothetical protein mlr2351 SWALL:Q98IL3
FT                   (EMBL:AP002999) (367 aa) fasta scores: E(): 0.00016, 29.11%
FT                   id in 261 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37627"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NW6"
FT                   /protein_id="CAH37627.1"
FT                   /translation="MKIVKPLAISPLTRVYRMHGREYLGVAALLIATLGDEPKLLAESA
FT                   LWRLAGDELRGYPLDMALPKACPEFLVSGYAYGKYASDPHACACEVGVRIAGLEKRLRV
FT                   CGDRQWAGARITAPRPFERLPIDWDLAYGGAGCADNPRGRGAHAREGAPRDLPNVEYAH
FT                   SPMRFAHEQPAPAGFCPVDAAWPARAGLYGALDRQWQEEDCPGFPRTLDPRYFNIAPAD
FT                   QQLPELRAFPDGARYELTHMHPDHATLAGNLPALRARSFVVRRGSDAPEEMPMRLTTAW
FT                   FVPHRERVILIYHGVTPVRAFDASDVQTVLFGAEASGHARPADWYRQVIEWRTRDDRAA
FT                   LYALRDRDLLPEHALAPEAAATPEPTQQSAKQRQLRERLSVFPDAPRAQTPAPDRLAEF
FT                   VEQQQALADEKRAALEAMRRELATSEVFSVGRRRGPPGRIAPADEEPARHAGALAESPD
FT                   IRALERDADERLRGLYQQCAQHQDAPARLHGAAARARRECVASAAAAGQSLQVADLTGA
FT                   DLSGMDLRGARLAGAMLENADLSDADLTGADLSRTVLVRADLTRAKLVDARLTAANLSL
FT                   AHCERTDFSGSDLSDGIFEQVHLRDCRFNGSVLASTRFDACRFDAVDFGRATLRELIFI
FT                   EQSFSGVSFSDATIRKMLLMRCAFADVRFSAASIDGFGIVETQASGQLRFDRASVNKAC
FT                   FVGRCDIGRADFSFATLTEVNFRETQLVEANFGGARIGNCDFTDACLRAADLRGAKAEG
FT                   SPFVRADLTRADLRDTDLIAAYLRGAKLDGADLRRANLFRANLSQILIDADTRWQGAYL
FT                   NRAVRFPLAEART"
FT   misc_feature    245419..245538
FT                   /note="Pfam match to entry PF00805 Pentapeptide,
FT                   Pentapeptide repeats (8 copies) , score 50.2, E-value
FT                   2.9e-12"
FT   misc_feature    245539..245658
FT                   /note="Pfam match to entry PF00805 Pentapeptide,
FT                   Pentapeptide repeats (8 copies) , score 39.8, E-value
FT                   4.1e-09"
FT   misc_feature    245734..245853
FT                   /note="Pfam match to entry PF00805 Pentapeptide,
FT                   Pentapeptide repeats (8 copies) , score 12.1, E-value
FT                   0.023"
FT   misc_feature    246010..246129
FT                   /note="Pfam match to entry PF00805 Pentapeptide,
FT                   Pentapeptide repeats (8 copies) , score 37.0, E-value
FT                   2.8e-08"
FT   misc_feature    246160..246279
FT                   /note="Pfam match to entry PF00805 Pentapeptide,
FT                   Pentapeptide repeats (8 copies) , score 46.2, E-value
FT                   4.9e-11"
FT   CDS_pept        246360..247442
FT                   /transl_table=11
FT                   /locus_tag="BPSS0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to the C-terminal region of Anabaena sp.
FT                   hypothetical protein all3114 SWALL:Q8YSH1 (EMBL:AP003591)
FT                   (576 aa) fasta scores: E(): 3.3e-14, 26.19% id in 313 aa,
FT                   and to the full length of Synechocystis sp. hypothetical
FT                   protein sll1446 SWALL:P74206 (EMBL:D90913) (320 aa) fasta
FT                   scores: E(): 6.2e-10, 24.76% id in 323 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37628"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NW5"
FT                   /protein_id="CAH37628.1"
FT                   /translation="MSTRADRLRDAIRHGRAIRDTAIDAGDFDGHDWSGGVFERVRFIG
FT                   VSMKRVRLDEAVFIDCLFRDVDMRQAGCARCTFDRCRLERVDLSASELRDCMMNGTHAA
FT                   GVYFSGARASGLHCVKSDLGDCGFDDARIESAVFSDTRLARAAFTRAAVRKAVFYRLDL
FT                   TSAVFADAAFDDTVFAEANLAGQRLQGQRMHRCQFVGADLRHADFTGARLAGCNFQRAK
FT                   LTGARLDGVDAPNTVFFEADAPDATCRDAALRGSIWVQADARRIDFTGSELDGAVFQRA
FT                   TCTGARFSRAKLEGADFSYADLTGAVFDEAGFARTAFHGATAPAIAWRDHPGAVACDAE
FT                   LSDAQAWSRQRDEQARREEC"
FT   misc_feature    246525..246644
FT                   /note="Pfam match to entry PF00805 Pentapeptide,
FT                   Pentapeptide repeats (8 copies) , score 17.4, E-value
FT                   0.0065"
FT   misc_feature    246660..246779
FT                   /note="Pfam match to entry PF00805 Pentapeptide,
FT                   Pentapeptide repeats (8 copies) , score 4.9, E-value 0.14"
FT   misc_feature    246780..246899
FT                   /note="Pfam match to entry PF00805 Pentapeptide,
FT                   Pentapeptide repeats (8 copies) , score 15.4, E-value 0.01"
FT   misc_feature    246900..247019
FT                   /note="Pfam match to entry PF00805 Pentapeptide,
FT                   Pentapeptide repeats (8 copies) , score 31.3, E-value
FT                   1.5e-06"
FT   misc_feature    247020..247139
FT                   /note="Pfam match to entry PF00805 Pentapeptide,
FT                   Pentapeptide repeats (8 copies) , score 22.8, E-value
FT                   0.00053"
FT   misc_feature    247170..247289
FT                   /note="Pfam match to entry PF00805 Pentapeptide,
FT                   Pentapeptide repeats (8 copies) , score 42.4, E-value
FT                   6.9e-10"
FT   CDS_pept        247624..248283
FT                   /transl_table=11
FT                   /locus_tag="BPSS0184"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37629"
FT                   /db_xref="InterPro:IPR021927"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NW4"
FT                   /protein_id="CAH37629.1"
FT                   /translation="MSEIEAKPDIRGRSSVPDKAGSVVGALPDGVYVVECGGAKLRCRR
FT                   AFSCLVEPRIGDRVVVCGADSRCVYVIAILARPNADGVQLRVEGDLVLEATRRVCVTSG
FT                   DALRLASREQLSIEAQRLTMSARQAALTSEKTTLTSAAFDGRLGKIRLIGRLLETVMEH
FT                   VAQSCRSSFRTVETVEHLRASHIDHAAAESMRMHAKHTLLTAETLTKIDAAQIHLG"
FT   CDS_pept        248330..248704
FT                   /transl_table=11
FT                   /locus_tag="BPSS0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   ypo0511a or y3662 SWALL:Q8ZII6 (EMBL:AJ414143) (121 aa)
FT                   fasta scores: E(): 2e-08, 40.17% id in 117 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37630"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NW3"
FT                   /protein_id="CAH37630.1"
FT                   /translation="MVNSSAGGMNAATSINLTPPGMPMPYPNNAPRANAMPNVGHIFVG
FT                   GGPVHNLATVIPASNGDSGGSMGGVASQTVSGSSRNAQGASKTLVAGMPITRMTDPTQQ
FT                   NNNNTIGSGSSPSQTIVLNL"
FT   CDS_pept        complement(249406..251322)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0186"
FT                   /product="putative exported protein"
FT                   /note="Similar to Anabaena sp. hypothetical protein all2038
FT                   SWALL:Q8YVE0 (EMBL:AP003588) (743 aa) fasta scores: E():
FT                   2.9e-14, 28.5% id in 684 aa, and in its C-terminal region
FT                   to Anabaena sp. hypothetical protein all3696 SWALL:Q8YQW5
FT                   (EMBL:AP003594) (379 aa) fasta scores: E(): 3.3e-05, 28.8%
FT                   id in 368 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37631"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NW2"
FT                   /protein_id="CAH37631.1"
FT                   /translation="MTKRIHAVLLAALLIAALAPPCQARSSTDWLANTFATDAMHVGNA
FT                   ARSMWVAPEGVIYTASMWDENEGGVALYQNGRSIGSIGAHNEFQGGAITGNAASIFAAL
FT                   QFNRNGGSGMVGRYDRTTRRRDLLIPVSATTTERWADVVTGLATSGSTLYASDFPGNRV
FT                   RIYTVAGVWRRDIDISEPGALAADSAGNVWVAQKRAGAIAEFDSGGRLLNTIRMAAASR
FT                   PSALYFDAATQRLMVGDEGPDMNIKIYDVSRTPALVGTFGVRGGYLDSASGIKGQVGDK
FT                   RFTRVAGLGKDAAGNLYVLNNPWGGTWDLGRDGATDIHAYSPSGTLQWKLQSVNFEGIA
FT                   APDSGTDGAFFYSGTNVYAGTAGGTFVANTVDPIDYPMDPRIDVRDPARGEHFGQLAAI
FT                   GSNRILAAGSQNPDVFHFFHFNAAHGYIAIPDGSIPGAAFGTTARIRAGFCLDSRGGVW
FT                   AGLDKTNAIWHYPLTGFDANGKPAWGPATVTPIPNSIKPLTRIVYLPESDTMILARGRP
FT                   VGTDWTAIGTRIEVYHGWLAGNTAAPDPVIGLSSANPKSITAAGNYLFVGYVHTQPNID
FT                   AFNLSTGALAATLINSSPEQIYVGNDVDSMYGLRSYLRSNGEYVITKDNYNAAGIVVYR
FT                   WTP"
FT   misc_feature    complement(251251..251322)
FT                   /note="Signal peptide predicted for BPSS0186 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.995 between residues 24 and 25"
FT   CDS_pept        complement(251662..252555)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0187"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator pa1223 SWALL:Q9I4B5
FT                   (EMBL:AE004552) (297 aa) fasta scores: E(): 1.2e-82, 71.38%
FT                   id in 297 aa, and to Rhizobium sp. SyrM protein homolog 1
FT                   SyrS1 or Y4pN SWALL:SYR1_RHISN (SWALL:P55619) (338 aa)
FT                   fasta scores: E(): 3e-30, 39.46% id in 299 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37632"
FT                   /db_xref="GOA:Q63NW1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NW1"
FT                   /protein_id="CAH37632.1"
FT                   /translation="MDNLRRLDLNLLITLDALLSEHNVTRAAARLNLSQPSVSIHLAKL
FT                   RDIFGDPLLLPGPRGMRPTARADELREPLRRALETLGRAVSPGAPFDPAASAHTWRVAA
FT                   SDYSESTVVLPALNGLRAAAPGTRLAVVETVPSRIAKQAEQGDIDLAFHITECAPGNLR
FT                   HRALFTERYVLVGRAGHPRLKRRPTLAQFCKLDHVIVSPDGGGFQGGTDHALAKLGLAR
FT                   RVVLSVPHFLFMMSAVANSDLVAMMPSRLVRDSRALQVVEPPVDVPGFRMAMLWHERSH
FT                   RDPAHQWLREHIAASV"
FT   misc_feature    complement(251671..252279)
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain , score 132.2, E-value 6.1e-37"
FT   misc_feature    complement(252352..252531)
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family , score
FT                   70.5, E-value 2.3e-18"
FT   misc_feature    complement(252397..252489)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(252427..252492)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1554.000, SD 4.48 at aa 22-43, sequence
FT                   HNVTRAAARLNLSQPSVSIHLA"
FT   CDS_pept        252651..253427
FT                   /transl_table=11
FT                   /locus_tag="BPSS0188"
FT                   /product="putative dehydrogenase"
FT                   /note="Similar to Pseudomonas aeruginosa probable NAD(P)H
FT                   deydrogenase pa1224 SWALL:Q9I4B4 (EMBL:AE004552) (259 aa)
FT                   fasta scores: E(): 3.3e-82, 72.48% id in 258 aa, and to
FT                   Rhizobium meliloti putative NADPH dehydrogenase quinone
FT                   reductase transmembrane protein r02916 or smc03185
FT                   SWALL:Q92LV5 (EMBL:AL591792) (270 aa) fasta scores: E():
FT                   4.7e-65, 58.52% id in 258 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37633"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NW0"
FT                   /protein_id="CAH37633.1"
FT                   /translation="MNVLLVYAHPEPKSLNGSLKNFALRHLEEAGHAVQVSDLYAMQWK
FT                   AALDADDNTARRPDTRFDPSLDSKHAFENGTQAADIAREQDKLRWADALVLQFPLWWFS
FT                   MPAILKGWVERVYAFGFAYGVGEHSDTHWGDRYGEGSMKGKRAMLIVTTGGWASHYGPR
FT                   GINGPIDDLLYPIHHGILYYPGFDVLPPFLVHRTNRIDETRFATIRDALGQRLDTLWTT
FT                   APIAFRAQNAGDYEIPQLTLRADIAPGRSGFAAHIA"
FT   misc_feature    252651..253313
FT                   /note="Pfam match to entry PF02525 Flavodoxin_2,
FT                   Flavodoxin-like fold , score 308.2, E-value 6.5e-90"
FT   CDS_pept        253453..253893
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPSS0189"
FT                   /product="putative AraC-family transcriptional regulator
FT                   (fragment)"
FT                   /note="Gene remnant. Similar to the C-terminal region of
FT                   Streptomyces coelicolor putative AraC-family
FT                   transcriptional regulator sco0605 or scf55.29 SWALL:Q9RJN9
FT                   (EMBL:AL939106) (311 aa) fasta scores: E(): 3e-22, 54.86%
FT                   id in 144 aa, and of Mycobacterium smegmatis putative
FT                   transcription activator SWALL:Q938B5 (EMBL:AY054120) (332
FT                   aa) fasta scores: E(): 1.2e-19, 47.26% id in 146 aa. CDS
FT                   lacks an appropriate translational start codon"
FT   misc_feature    253582..253719
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family , score
FT                   34.2, E-value 1.9e-07"
FT   misc_feature    253618..253683
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1127.000, SD 3.03 at aa 40-61, sequence
FT                   STRDAIARQSAMSVRTLARRFQ"
FT   misc_feature    253738..253869
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family , score
FT                   16.0, E-value 0.049"
FT   CDS_pept        complement(254427..255722)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0190"
FT                   /product="putative O-acetylhomoserine"
FT                   /note="Similar to Bacillus halodurans O-acetylhomoserine
FT                   sulfhydrylase bh2603 SWALL:Q9K9P2 (EMBL:AP001516) (430 aa)
FT                   fasta scores: E(): 7.2e-95, 60.71% id in 420 aa, and to the
FT                   full length of the eukaryotic Emericella nidulans
FT                   O-acetylhomoserine CysD SWALL:CYSD_EMENI (SWALL:P50125)
FT                   (437 aa) fasta scores: E(): 1.6e-83, 51.16% id in 430 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37635"
FT                   /db_xref="GOA:Q63NV9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NV9"
FT                   /protein_id="CAH37635.1"
FT                   /translation="MTEPASADWRLETLAVHGGYRPDPTTRAAAVPIYQTVAFAFDDTQ
FT                   HGADLFDLKVQGNIYSRIMNPTNDVLEQRVAALEGGIGALALASGQAAVTYSILTIAEA
FT                   GDNIVSSSTLYGGTYNLFAHTLPQYGISTRFADPREPAAFDALIDARTKAIFAESVGNP
FT                   LGNITDIAALAEIAHRHGLPLIVDNTVPTPYLLRPFEHGADIVVHSLTKYLGGHGTSLG
FT                   GAIVDSGKFPWAKHAERFRRLNEPDVSYHGVVYTDAFGAAAYIGRARVVPLRNTGAALS
FT                   PFNAFQILQGIETLALRIERIGENALKIAQHLARHEKVEWVDYSGLPNHRDHALVERYL
FT                   SGRAPGILTFGVKGGRAAGAAFQDALKLFTRLVNIGDAKSLATHPASTTHRQLSPDELA
FT                   KAGVKEETVRLSIGIEHIDDLLADLDQALAKV"
FT   misc_feature    complement(254436..255689)
FT                   /note="Pfam match to entry PF01053 Cys_Met_Meta_PP, Cys/Met
FT                   metabolism PLP-dependent enzyme , score 686.0, E-value
FT                   1.2e-203"
FT   CDS_pept        complement(256006..256398)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0191"
FT                   /product="putative dioxygenase"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein rsc2017 or rs03585 SWALL:Q8XXU6 (EMBL:AL646067)
FT                   (134 aa) fasta scores: E(): 3.9e-05, 33.61% id in 119 aa,
FT                   and to Caulobacter crescentus hypothetical protein cc2962
FT                   SWALL:Q9A481 (EMBL:AE005960) (121 aa) fasta scores: E():
FT                   4.2e-05, 30.64% id in 124 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37636"
FT                   /db_xref="GOA:Q63NV8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NV8"
FT                   /protein_id="CAH37636.1"
FT                   /translation="MSVIGLDHYNLRAPRPLLDTLRDFYIDVVGLRLGARPPFRSHGYW
FT                   LYAGAQAVLHLSQAGPDETRRANVVNTFDHVAFPCDDLPGTLARLQRFGIRYSSADVPL
FT                   TRQHQLFFDDPAGNGVELNFAVRDDG"
FT   misc_feature    complement(256033..256335)
FT                   /note="Pfam match to entry PF00903 Glyoxalase,
FT                   Glyoxalase/Bleomycin resistance protein/Dioxygenase
FT                   superfamily , score 28.0, E-value 7e-08"
FT   CDS_pept        complement(256752..257597)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0192"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37637"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NV7"
FT                   /protein_id="CAH37637.1"
FT                   /translation="MSNAPAPRTLTVPPLPPLTEAESADVTRRALALRAAFAQDVARRL
FT                   NVPDAEQRAYGERLQQTLDANGLGELAREYVVLVDRAPNVQAVFLYFRTTRSNAWQMIG
FT                   ASPVATGLPGQYDHFVTPLGVFEHTPENMDFRAEGTTNDNGIRGYGQRDMRIYDFGWTD
FT                   AERGWGKGGVSQMRFQMHATDPEYLEPLLGIRHSKGCVRIPASLNVFLDQHGILDAEYE
FT                   ARAAGGDPPWVLRAHRQVTPWAGRYLVVIDSQRKTRPAWSPAPGKKAQAKLPKGGDTAD
FT                   "
FT   CDS_pept        complement(258412..259767)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0193"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37638"
FT                   /db_xref="GOA:Q63NV6"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NV6"
FT                   /protein_id="CAH37638.1"
FT                   /translation="MANMTQAAADGELDLSTLALPQAARMPAFSLTMAWWAVCSAVFYI
FT                   VVGATLALDYGARNALIGMVLSVVSYGLVNAAISRYAIRTGLSVALFSRVLFGSAGAAL
FT                   ATLIFFATAIYYAVFEGSVIAVAAHGLMPALDYKWAALIVVCYSVPLVFGSVQHWLDKF
FT                   NGVLLPFYLLGLLAAVALATHRYGYHAAWLDFGPKGGAPAHGWWHCFVYYMGVWVLMMF
FT                   TFDYARFGREADADYHGRWNFGMPFYLVTFVVNGAAGIYLVSTIPGLGALSEVSVVTAL
FT                   LKLMGVWGLLFVWVTQSRINTANYYLATVNMQAFFQKAAGLRAPKYVWALVVGAVVYAL
FT                   MMADIFSKLLQALAWQGVFIVAWVGVALAHILSTRYEELLGGGIECRDTHVPAFNPGGL
FT                   SAWFAGVFAGMMLTTATGFAQSLSAPVTFVVSWAVYRGMLASAKRTWFVRER"
FT   misc_feature    complement(order(258451..258519,258529..258597,
FT                   258646..258714,258730..258789,258883..258951,
FT                   258979..259047,259108..259161,259204..259272,
FT                   259291..259359,259417..259485,259519..259587,
FT                   259615..259683))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BPSS0193 by TMHMM2.0 at aa 29-51, 61-83, 95-117, 137-159,
FT                   166-188, 203-220, 241-263, 273-295, 327-346, 352-374,
FT                   391-413 and 417-439"
FT   CDS_pept        complement(259954..260958)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein pa0496 SWALL:Q9I622 (EMBL:AE004486) (325 aa) fasta
FT                   scores: E(): 4.1e-81, 65.2% id in 319 aa, and similar to
FT                   parts of Pseudomonas fluorescens urea amidolyase homologue
FT                   UahA SWALL:Q9XAV3 (EMBL:AJ243652) (1213 aa) fasta scores:
FT                   E(): 2.4e-34, 42.76% id in 311 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37639"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NV5"
FT                   /protein_id="CAH37639.1"
FT                   /translation="MPTDTLNAIEVVKPGLATSVQDAGRHGYYHVGIPPSGALDQFSLR
FT                   AANLLVGNDEDAAVLECTLLGPQLLFRRDALIAVTGAEMAPRIDGAAQPCNVALRIRAG
FT                   GTLTFDYVKQGARAYLAVAGGIDVPVVLGSRSTYTLGAIGGHEGRRLQKGDALPIGAAK
FT                   RAAREGATLPDALRTPLAREAELRVLPGLYHHRLTDESARTFFEDTWVVAPEADRIGYR
FT                   YRQGRALRFREREQPFGAGADPSNIVDACYPIGSIQVPAGVEPIILHRDAVSGGGYATI
FT                   GTVISADLDLIGQMQPNHQARFVAVTMADALAARRDAQRRLARLRDALWPHGG"
FT   misc_feature    complement(259996..260871)
FT                   /note="Pfam match to entry PF02626 DUF183, Uncharacterized
FT                   ACR, COG1984 , score 287.8, E-value 8.9e-84"
FT   CDS_pept        complement(260948..261823)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein pa0495 SWALL:Q9I623 (EMBL:AE004486) (292 aa) fasta
FT                   scores: E(): 5.2e-84, 69.55% id in 289 aa, and to parts of
FT                   Pseudomonas fluorescens urea amidolyase homologue UahA
FT                   SWALL:Q9XAV3 (EMBL:AJ243652) (1213 aa) fasta scores: E():
FT                   4.9e-13, 26.18% id in 275 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37640"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NV4"
FT                   /protein_id="CAH37640.1"
FT                   /translation="MTIRYTFGGDEFIFVEISESMSLDAFFKGTAITRELRRRNVPGVT
FT                   EICPANASYQVRYDPDVIEPDTLLALLKTIEAEVGEAALNIDTRIVEVPVLYNDPWTHE
FT                   TLMRFRERHQAPESTDLEYAARVNGKRDIDEFIAAHAGSPWFVSMVGFVAGLPFMYQMV
FT                   ERERQLQVPKYLRPRTDTPKLTVGHGGCFGCIYSVRGAGGYQMFGVTPAPIFDPAQRLD
FT                   YLRDFMVFFRPGDIVKFKPIDRAEYDAAVAAVEAGTFTLRVKPVRFALEAFLRDPHAYN
FT                   RSLVEVLDAN"
FT   misc_feature    complement(261161..261817)
FT                   /note="Pfam match to entry PF02682 DUF213, Uncharacterized
FT                   ACR, COG2049 , score -1.6, E-value 3.6e-09"
FT   CDS_pept        complement(261820..263265)
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /gene_synonym="fabG"
FT                   /locus_tag="BPSS0196"
FT                   /product="biotin carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /note="Similar to Pseudomonas aeruginosa biotin carboxylase
FT                   AccC or FabG or pa4848 SWALL:ACCC_PSEAE (SWALL:P37798) (449
FT                   aa) fasta scores: E(): 1.2e-81, 54.31% id in 440 aa, and to
FT                   Bacillus halodurans acetyl-coa carboxylase biotin
FT                   carboxylase subunit bh2787 SWALL:Q9K963 (EMBL:AP001516)
FT                   (452 aa) fasta scores: E(): 3.6e-84, 52.7% id in 444 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37641"
FT                   /db_xref="GOA:Q63NV3"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NV3"
FT                   /protein_id="CAH37641.1"
FT                   /translation="MNDLDSTHASFYRPSRIGTVLVANRGEIAVRVIRAAHELGMRAVA
FT                   AVSDADRDSLAARMADEAVHIGPSHAAKSYLDPAAMLAAARQCGADAIHPGYGFLSENA
FT                   DFAAQVEAAGLIFVGPPARVIATMGDKARARETARRAGVPTVPGSEGVVASLDGAREVA
FT                   ARIGYPVMIKAAAGGGGRGIRVAHDAAQLAAQLPLAQREAQAAFGDGGVYLERFIARAR
FT                   HIEVQILGDGENVIHLFERECSLQRRRQKILEEAPSPSLTPALRDTLCASATRLARQVS
FT                   YRGAGTLEYLFDDARGELYFIEMNTRIQVEHPVTEAVTGVDLVREMLRIADGEPLRFAQ
FT                   GDIALRGAALECRINAEDPLQDFRPNPGRIDALVWPAGPGVRIDSLLYPGYTVPPFYDS
FT                   LLAKLIVHDESRPAALARAARALRELRIDGVKTTAPLHRALLDDADVRAGRYHTNYLEA
FT                   WMRDWLARLDARASAPRGLGEAA"
FT   misc_feature    complement(261895..262215)
FT                   /note="Pfam match to entry PF02785 Biotin_carb_C, Biotin
FT                   carboxylase C-terminal domain , score 204.5, E-value 1e-58"
FT   misc_feature    complement(262234..262878)
FT                   /note="Pfam match to entry PF02786 CPSase_L_D2,
FT                   Carbamoyl-phosphate synthase L chain, ATP binding domain ,
FT                   score 346.4, E-value 2.1e-101"
FT   misc_feature    complement(262342..262365)
FT                   /note="PS00867 Carbamoyl-phosphate synthase subdomain
FT                   signature 2."
FT   misc_feature    complement(262720..262764)
FT                   /note="PS00866 Carbamoyl-phosphate synthase subdomain
FT                   signature 1."
FT   misc_feature    complement(262882..263220)
FT                   /note="Pfam match to entry PF00289 CPSase_L_chain,
FT                   Carbamoyl-phosphate synthase L chain, N-terminal domain ,
FT                   score 153.0, E-value 3.4e-43"
FT   CDS_pept        complement(263271..263537)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0197"
FT                   /product="putative biotin-binding protein"
FT                   /note="Similar to the full length of Pseudomonas aeruginosa
FT                   probable biotin-requiring enzyme pa0493 SWALL:Q9I625
FT                   (EMBL:AE004486) (82 aa) fasta scores: E(): 1e-12, 52% id in
FT                   75 aa, and to the C-terminal region (where the
FT                   biotin-binding domain lies) of Anabaena sp. biotin carboxyl
FT                   carrier protein of acetyl-CoA carboxylase AccB or all5057
FT                   SWALL:BCCP_ANASP (SWALL:Q06881) (181 aa) fasta scores: E():
FT                   2.9e-09, 50.68% id in 73 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37642"
FT                   /db_xref="GOA:Q63NV2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NV2"
FT                   /protein_id="CAH37642.1"
FT                   /translation="MKLEDPHEMAQHEIVSPLPGTFYRRPSPDATPFVDVGSTLAPGAV
FT                   VGIVEVMKQFTEIETAAAGRVVEILVDDGEPVDAGQVLMRTEE"
FT   misc_feature    complement(263280..263504)
FT                   /note="Pfam match to entry PF00364 biotin_lipoyl,
FT                   Biotin-requiring enzyme , score 72.6, E-value 5.5e-19"
FT   CDS_pept        complement(263527..264327)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0198"
FT                   /product="LamB/YcsF family protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein pa0492 SWALL:Q9I626 (EMBL:AE004486) (252 aa) fasta
FT                   scores: E(): 7.9e-69, 72.58% id in 248 aa, and to
FT                   Escherichia coli protein YbgL or b0713 SWALL:YBGL_ECOLI
FT                   (SWALL:P75746) (244 aa) fasta scores: E(): 8.5e-28, 38.55%
FT                   id in 249 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37643"
FT                   /db_xref="GOA:Q63NV1"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63NV1"
FT                   /protein_id="CAH37643.1"
FT                   /translation="MRKHSVDLNSDMGEGFGPWKIGDGVDEEIMPLISSANIATGFHAG
FT                   DPNIIARTVQLAKNAGVGVGAHPGFRDLVGFGRRDIGETPQALVNDIVYQLGALREFAR
FT                   FHGVSVQHVKPHGALYMRAARDEALSRLLVETLQQLDPALRLYCMEASVTYRIARELGQ
FT                   PVVREFYADRDYGRNGSIVFTRRAGRLDPRQVADKVLRACVDGRVATVDGEDIDIDFDS
FT                   ICLHSDTPGALALARATRDALTAHGIRIAAPATAEANGIRIDEA"
FT   misc_feature    complement(263590..264315)
FT                   /note="Pfam match to entry PF03746 LamB_YcsF, LamB/YcsF
FT                   family , score 437.8, E-value 6.2e-129"
FT   CDS_pept        264595..265509
FT                   /transl_table=11
FT                   /locus_tag="BPSS0199"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 hydrogen peroxide-inducible
FT                   genes activator OxyR or MomR or Mor or b3961 or c4922 or
FT                   z5519 or ecs4890 SWALL:OXYR_ECOLI (SWALL:P11721) (305 aa)
FT                   fasta scores: E(): 1.2e-18, 30.5% id in 295 aa, and to
FT                   Pseudomonas aeruginosa probable transcriptional regulator
FT                   pa0491 SWALL:Q9I627 (EMBL:AE004486) (308 aa) fasta scores:
FT                   E(): 1.8e-73, 64.21% id in 299 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37644"
FT                   /db_xref="GOA:Q63NV0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NV0"
FT                   /protein_id="CAH37644.1"
FT                   /translation="MALTLRQLKYFVATAELGQISQAAIQLTISQSAVTSAIRELEDSL
FT                   GTQLFVRTASGVALTNTGRRFLNQAYTILSSVDEAMRIPNLESTLTGTLALAASYTVLG
FT                   YFLPHHLMRLHTQYPRLTIQLHELNRESIEEGLIAGRYDMAVLLTSNVSNPELVLEPVI
FT                   HSARRLWVGAHHPLLRRESVTFADVAPEPFVMLTVDEAAYTALRYWNETPYRPNVILRT
FT                   SSVEAVRSMVANGSGVAILSDMVYRPWSLEGRRIETVLLRDPVPPMSVGLAWRRNAEFS
FT                   PAMHAVREYFRHTFMEPRMGGGA"
FT   misc_feature    264607..264786
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family , score
FT                   87.4, E-value 1.9e-23"
FT   misc_feature    264646..264711
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1374.000, SD 3.87 at aa 18-39, sequence
FT                   GQISQAAIQLTISQSAVTSAIR"
FT   misc_feature    264649..264741
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    264853..265482
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain , score 161.7, E-value 8.2e-46"
FT   CDS_pept        266228..268741
FT                   /transl_table=11
FT                   /locus_tag="BPSS0200"
FT                   /product="putative penicillin amidase"
FT                   /note="Similar to Brucella abortus putative penicillin
FT                   acylase II batn1953.orf25 SWALL:Q8VQK2 (EMBL:AF454951) (761
FT                   aa) fasta scores: E(): 6e-37, 29.86% id in 817 aa, and to
FT                   Arthrobacter viscosus penicillin G acylase precursor Pac or
FT                   Pa SWALL:PAC_ARTVI (SWALL:P31956) (802 aa) fasta scores:
FT                   E(): 1.3e-33, 27.75% id in 544 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37645"
FT                   /db_xref="GOA:Q63NU9"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NU9"
FT                   /protein_id="CAH37645.1"
FT                   /translation="MSIRHATRSVALCSMLALASTLGCTSGAHDAPAAHAPRTAQTAHA
FT                   TAVAAGIAGLREPVRIVRDSVGVSHIYARNTHDLFFAQGYNAARDRLWQLDLWRRQGEG
FT                   KMAEQFGPRFAAQDRAARLFLYRGDLEAEYASYHPEAKQILQAFADGINAYVREAKADP
FT                   AKMPPEFRLTGAEPGEWRPESSLIRIYGITRNVTGEVALARQVAAVGLSKALSLNAFEP
FT                   PVRQTAIPAGVDVGLIDKRILADYLLARNGLPFRAEDFPRSPLGAAQRDALAARLNAAR
FT                   LTLADDSANPLAPRYESNNWVVAGARTASGKPLLANDPHRRIGMPSLRYMVHLHAPGWN
FT                   VIGAGEPALPGVSVGHNDRVAFGLTIFAFGDEEDLYVYDTRPGHPDEYRYRGRWEKMRI
FT                   VEETVAVRGQANRVERLAFTRHGPVLYEDAAHRKAYALRAAYLEFPGTAAYLASLRLDQ
FT                   ARDWPSFVAGMRRHYVPGENMVYADVDGNIGWFGGALAPIRREADWSGALPVPGDGRYE
FT                   WAGLTEGEALPHVLNPAAGYIATANAYDLPDGYRYVDRSAHVWAEPFRQRRLDEVLRGA
FT                   SGLTVADMQRLQYDDRSLPAQAMLGFASQLKADEPGTRDALARLARWSGDMAIDSVPAT
FT                   IYEFWMREVMRRVRDVEVPAAARDAFPKLEVRQVLRYLQQPDGAFGADPVAGRDALLLA
FT                   ALRDGLANARAKLGENVDAWRWGRLHHAQFDHQLAGVLPAFGAFGTERYAVGGNDDTVH
FT                   RGTYRPSDFRQTSGASYRQVIDVADWDRSMIQNTPGQSGDPRSPFHANLLKGWASGEYW
FT                   PMAFSDRAVDALAHDTLILEPAPAQ"
FT   misc_feature    266228..266311
FT                   /note="Signal peptide predicted for BPSS0200 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.980) with cleavage site
FT                   probability 0.707 between residues 33 and 34"
FT   misc_feature    266267..266299
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    266393..268708
FT                   /note="Pfam match to entry PF01804 Penicil_amidase,
FT                   Penicillin amidase , score 495.7, E-value 2.4e-146"
FT   CDS_pept        269128..270066
FT                   /transl_table=11
FT                   /gene="pip"
FT                   /locus_tag="BPSS0201"
FT                   /product="prolyl iminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /note="Similar to Serratia marcescens proline
FT                   iminopeptidase Pip SWALL:PIP_SERMA (SWALL:O32449) (317 aa)
FT                   fasta scores: E(): 4.7e-86, 66.77% id in 310 aa, and to
FT                   Ralstonia solanacearum probable prolyl aminopeptidase
FT                   protein rsp0196 or rs04709 SWALL:Q8XTB7 (EMBL:AL646077)
FT                   (320 aa) fasta scores: E(): 4.9e-88, 68.6% id in 309 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37646"
FT                   /db_xref="GOA:Q63NU8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NU8"
FT                   /protein_id="CAH37646.1"
FT                   /translation="MYPPIEPYAHGFLDTGDGHRVYWELCGNPNGKPAVFLHGGPGSGC
FT                   SADHRRLFDPARYNVLLFDQRGCGRSTPHASLENNTTWHLVDDIERLRAMIGVERWLVF
FT                   GGSWGSALALAYAQTHPARVAELVVRGIFTVRRSELLWYYQEGASWLFPDLWEDFIAPI
FT                   PRAERADLIAAYRRRLTGDDEAAKREAARAWSVWEGRTIALLPNAAHETYFGDAHFALA
FT                   FARIENHYFVHQGFMEDGQLLRDAHRLADIPGVIVQGRYDVATPARTAWELAKAWPRAS
FT                   LEIVPDAGHAYDEPGILRALIAATDRFARER"
FT   misc_feature    269299..270051
FT                   /note="Pfam match to entry PF00561 abhydrolase, alpha/beta
FT                   hydrolase fold , score 89.9, E-value 3.2e-24"
FT   CDS_pept        270241..271134
FT                   /transl_table=11
FT                   /locus_tag="BPSS0202"
FT                   /product="hypothetical protein"
FT                   /note="Very low similarities to parts of Mycobacterium
FT                   tuberculosis hypothetical 37.9 kDa protein rv1523 or mt1574
FT                   or mtcy19g5.05C SWALL:Q50584 (EMBL:Z77826) (347 aa) fasta
FT                   scores: E(): 9.2e-06, 35.03% id in 137 aa, and to
FT                   Pseudomonas aeruginosa hypothetical protein pa2650
FT                   SWALL:Q9I0I8 (EMBL:AE004694) (269 aa) fasta scores: E():
FT                   5.8e-05, 34.07% id in 135 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37647"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NU7"
FT                   /protein_id="CAH37647.1"
FT                   /translation="MAILEASSTKCGDSPGPSARRGIVNAGFVQDRINQAVWRSRGALR
FT                   GYGRASGWTDPGEAAAIAWIAERVRDEPILDVGVGGGRTVPLLKTISADYTAVDYTPEL
FT                   VEICRRNHPGTRVHRMDARDMSAFADESFSLVVFSYNGIDAVDHDGRMAILKEFARVLR
FT                   PGGFTLFSTHNLAGPSYREGPSRLARLPRRSANPFAIALDAARIAYSLPVGAFNYFRNS
FT                   RFNRVFDGYAMRVCAAHKFGILVMYTDFATQQRQLADVGLKLRAAFGGSSGEPVRRDQD
FT                   LGGEAWLHFVASKPCG"
FT   CDS_pept        complement(271227..273239)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0203"
FT                   /product="putative lipoprotein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37648"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NU6"
FT                   /protein_id="CAH37648.1"
FT                   /translation="MNLHRSIVVPLVFSATFLAGCGSSVDGRFTSGMVAMGAVAGSTVA
FT                   AYPIGADGTIGAQPLAVTTSDASGAFSLPALDRWPALIRATHGAYVEEATGAAATLEGD
FT                   GLEAVYASAPSTIVVSPYSSAVVATARAAGGLTQANIAAAIATISAFVGDFDPQQTRPA
FT                   TMAAGAAAPAIEPGHQMALALGAESQSRTDAAADIATSIAAIVAQAAAGDTLDTCHAGA
FT                   GDPRADGTLAAPVSSGCAITRGAARYAANARNTSGVTSLASLSAARTSRASPDQTAAAT
FT                   PDACADRAALLAQNLALFDGRRDDVQANLVVGVTRDNWRTVTTRSTWGPTAAFYGTLAT
FT                   PAACADADTFARELVIAAENYWIDQGINYCHHHIPGWTPPDDSAAAAPRYRNSSAGSTS
FT                   GASSNGMTCTAQRSGTGAQIVPGTAPSAGFSASEIQWNGVDCSDFTSWIYNFVGLTGVR
FT                   LPTAIGSQACAANEGADALPTPGVLLDIDSGNIDAMLPALKPGDLLYITQVDPLASGSD
FT                   AGGYQLAHVVTWTGKRWSDLQAGPDAARYALARLGQPGSRLGGDLAKYLPLADLATQNP
FT                   WMIIDSHYAGPAYRPFVGWYRRSLSNVRRIVGADAARRDPALAPYVIAPIASDARGDTL
FT                   TLASPHANASAQQGWRMIYRQSGGTPSCVRAGIAQ"
FT   misc_feature    complement(273120..273239)
FT                   /note="Signal peptide predicted for BPSS0203 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.993) with cleavage site
FT                   probability 0.407 between residues 40 and 41"
FT   misc_feature    complement(273177..273209)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(274149..275777)
FT                   /transl_table=11
FT                   /gene="tsr"
FT                   /gene_synonym="cheD"
FT                   /locus_tag="BPSS0204"
FT                   /product="methyl-accepting chemotaxis protein I"
FT                   /note="Similar to Escherichia coli methyl-accepting
FT                   chemotaxis protein I Tsr or CheD or b4355 SWALL:MCP1_ECOLI
FT                   (SWALL:P02942) (551 aa) fasta scores: E(): 7.7e-55, 47.52%
FT                   id in 484 aa, and to Ralstonia solanacearum probable
FT                   methyl-accepting chemotaxis transmembrane protein rsc1234
FT                   or rs02741 SWALL:Q8Y011 (EMBL:AL646063) (514 aa) fasta
FT                   scores: E(): 1.4e-100, 65.1% id in 513 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37649"
FT                   /db_xref="GOA:Q63NU5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NU5"
FT                   /protein_id="CAH37649.1"
FT                   /translation="MKLRRKIPLAFATALVLTSASAFYGIHALNRSLDTYGTTVRQNVA
FT                   NERMVSATLVAFKLQVQEWKDTLLRGKDPAKLDKYWRAFQQREQTVDALAAELKAKLPD
FT                   GESRGLIEQFASAHAEMGQGYRKGFEAFRASGFDPSAGDQAVAGVDRAPAVLLEKAARD
FT                   IAADSARVSADAASDAAHATAISIAATFALFALSLAGGVWFGGTVTRPLERALACVRRV
FT                   ATGDLSTPIDARGRDEIAELLAALKDMQASLSHVVRDVRHNADGVATASAQIASGNLDL
FT                   SSRTEEQAASLEETAASMDELTSTVRRNAEHAQHACAVAAGASTKAARGGDVMRQVVDT
FT                   MRGIADSSGKVAEIIAVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRTLAQR
FT                   SATAAREIKTLIEQSTERVGAGSALVDDAGRIIGEIVDSVRQVTGIVSEIAAASNEQSV
FT                   GIEQVNRAVAQMDNVTQQNAALVEEASAAAHALAEQAHALHGAVAVFSLHGERAGERGC
FT                   AHAGQPAVEAAHDSPRTALPVVAPA"
FT   misc_feature    complement(274254..274952)
FT                   /note="Pfam match to entry PF00015 MCPsignal,
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain
FT                   , score 350.5, E-value 1.2e-102"
FT   misc_feature    complement(275013..275222)
FT                   /note="Pfam match to entry PF00672 HAMP, HAMP domain ,
FT                   score 57.7, E-value 1.7e-14"
FT   misc_feature    complement(275691..275759)
FT                   /note="1 probable transmembrane helix predicted for
FT                   BPSS0204 by TMHMM2.0 at aa 28-50"
FT   CDS_pept        complement(276127..278211)
FT                   /transl_table=11
FT                   /gene="prpR"
FT                   /locus_tag="BPSS0205"
FT                   /product="putative sigma interaction-related Fis-family
FT                   transcriptional regulator"
FT                   /note="Similar to Burkholderia sacchari PrpR SWALL:Q8VPT1
FT                   (EMBL:AY033092) (646 aa) fasta scores: E(): 3.9e-121,
FT                   60.78% id in 663 aa, and to Escherichia coli propionate
FT                   catabolism operon regulatory protein PrpR or b0330
FT                   SWALL:PRPR_ECOLI (SWALL:P77743) (528 aa) fasta scores: E():
FT                   3e-41, 36.99% id in 673 aa. CDS is extended at the
FT                   C-terminus in comparison to orthologues"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37650"
FT                   /db_xref="GOA:Q63NU4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR012704"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NU4"
FT                   /protein_id="CAH37650.1"
FT                   /translation="MSTLPETGVRPRVWAVGISRLRALFRDIADEYEERADLRIVARGY
FT                   EEAITALATAGAERPDAIVAAGSNGTYLKARVRVPVVLVNPTGFDVMHALARARRDAGR
FT                   IALVSYGETPPEVRSFAAAYGLDVVFASYQSAQEADTRVLEMRERGIETVVGPGLVTDL
FT                   AANAGMGAVFVYSHASVRAAVNTALEVAHATHAEALRRERLDNLLQHLRDGVVALDREG
FT                   RIEAINERLALALGVSPSAAVGRALDDLTPELRTLRAADGDTLATVRGVRYVVHRGPLA
FT                   SSGGAPGSVLTFQESRAVERLDRTLRSHQHAQQFTARYRLDDIVGTTPAIAYARDLARR
FT                   YAKSDATVLILGESGTGKEMIAQSLHALSARRKYPFVAVNCGAFPESLLESELFGYEEG
FT                   AFTGARRGGKAGLFEAAHRGTLFLDEIGEMPPSLQSRLLRVLQEREVVRVGSTEPVPVD
FT                   IRVVAATHRPLFAAVEAGTFRADLYYRLNILNIGLPPLRERAADIPALAATLLAQAARR
FT                   EPRLAERLRDANDAARALDAANAALARYRWPGNVRELQNVIERIAVELADAGERGDAAV
FT                   SADTLRAIAPEVFALDTLGGFGSFGSAAGGGHGDASGGDIDADADARRPTLVQRRRRAE
FT                   ADEIRAALDACGGDRDRACARLGISKTTLWRKLAASEGKARGNKRGGGHGGDNDEGAGA
FT                   "
FT   misc_feature    complement(276199..276321)
FT                   /note="Pfam match to entry PF02954 HTH_8, Bacterial
FT                   regulatory protein, Fis family , score 42.3, E-value 7e-10"
FT   misc_feature    complement(276205..276270)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1005.000, SD 2.61 at aa 648-669, sequence
FT                   GDRDRACARLGISKTTLWRKLA"
FT   misc_feature    complement(276544..276573)
FT                   /note="PS00688 Sigma-54 interaction domain C-terminal part
FT                   signature."
FT   misc_feature    complement(276547..277242)
FT                   /note="Pfam match to entry PF00158 Sigma54_activat,
FT                   Sigma-54 interaction domain , score 427.0, E-value
FT                   1.1e-125"
FT   misc_feature    complement(277129..277170)
FT                   /note="PS00675 Sigma-54 interaction domain ATP-binding
FT                   region A signature."
FT   misc_feature    complement(277453..277608)
FT                   /note="Pfam match to entry PF00989 PAS, PAS domain , score
FT                   26.8, E-value 5.5e-07"
FT   CDS_pept        278428..279321
FT                   /transl_table=11
FT                   /gene="prpB"
FT                   /locus_tag="BPSS0206"
FT                   /product="probable methylisocitrate lyase"
FT                   /EC_number="4.1.3.30"
FT                   /note="Similar to Escherichia coli probable
FT                   methylisocitrate lyase PrpB or b0331 SWALL:PRPB_ECOLI
FT                   (SWALL:P77541) (295 aa) fasta scores: E(): 2.4e-65, 63.01%
FT                   id in 292 aa, and to Burkholderia sacchari PrpB
FT                   SWALL:Q8VPT0 (EMBL:AY033092) (296 aa) fasta scores: E():
FT                   6.6e-91, 85.27% id in 292 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37651"
FT                   /db_xref="GOA:Q63NU3"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NU3"
FT                   /protein_id="CAH37651.1"
FT                   /translation="MGNPQLISAGAKFRAAVAAEQPLQVVGAITAYAAKMAEAVGFKAV
FT                   YLSGGGVAANSLGIPDLGISTMDDVLVDANRITNATNLPLLVDIDTGWGGAFNIARTIR
FT                   SFIKAGVGAVHLEDQVGQKRCGHRPGKECVPAGEMVDRIKAAVDARTDETFVIMARTDA
FT                   AAAEGIDAAIERAIAYVEAGADMIFPEAMKTLDDYRRFKEAVKVPILANLTEFGSTPLF
FT                   TLDELKGANVDIALYCCGAYRAMNKAALNFYETVRRDGTQKAAVPTMQTRAQLYDYLGY
FT                   YAYEEKLDQLFNQGRN"
FT   misc_feature    278674..278925
FT                   /note="Pfam match to entry PF00463 ICL, Isocitrate lyase
FT                   family , score 26.5, E-value 6.2e-12"
FT   CDS_pept        279370..280542
FT                   /transl_table=11
FT                   /gene="prpC"
FT                   /locus_tag="BPSS0207"
FT                   /product="2-methylcitrate synthase"
FT                   /EC_number="2.3.3.5"
FT                   /note="Similar to Escherichia coli 2-methylcitrate synthase
FT                   PrpC or b0333 SWALL:PRPC_ECOLI (SWALL:P31660) (389 aa)
FT                   fasta scores: E(): 3.5e-119, 78.61% id in 374 aa, and to
FT                   Burkholderia sacchari 2-methylcitrate synthase PrpC
FT                   SWALL:Q8VPS9 (EMBL:AY033092) (388 aa) fasta scores: E():
FT                   1.2e-133, 86.15% id in 390 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37652"
FT                   /db_xref="GOA:Q63NU2"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NU2"
FT                   /protein_id="CAH37652.1"
FT                   /translation="MSETKEAAATGAAGGFKPKKSVALSGVAAGNTALCTVGKTGNDLH
FT                   YRGYDILDIAGSSEFEEIAHLLVHETLPNVTELAAYKAKLRAMRGLPANVKAALEWIPA
FT                   SAHPMDVMRTGVSVLGTVLPEKDDHNLPGARDIADRLMASLGSMLLYWYHYSHNGRRIE
FT                   TETDDDSIGGHFLHLLHGKTPSKSWIDAMHTSLILYAEHEFNASTFTARVIAGTGSDMY
FT                   SSITGAIGALRGPKHGGANEVAYEIQNRYRTPDEAQADIRRRVENKEVVIGFGHPVYTI
FT                   SDPRNKVIKEVARKLSKEAGDLKLFNIAERLESVMWEIKKMFPNLDWFSAVSYHMMGVP
FT                   TAMFTPLFVIARTAGWSAHIIEQRVDNKIIRPSANYTGPEDLKFVPIEKR"
FT   misc_feature    279439..280485
FT                   /note="Pfam match to entry PF00285 citrate_synt, Citrate
FT                   synthase , score 331.7, E-value 5.6e-97"
FT   misc_feature    279466..279489
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    280186..280224
FT                   /note="PS00480 Citrate synthase signature."
FT   CDS_pept        280616..283210
FT                   /transl_table=11
FT                   /gene="acnA"
FT                   /gene_synonym="acn"
FT                   /locus_tag="BPSS0208"
FT                   /product="aconitate hydratase 1"
FT                   /EC_number="4.2.1.3"
FT                   /note="Similar to Escherichia coli aconitate hydratase 1
FT                   AcnA or Acn or b1276 SWALL:ACO1_ECOLI (SWALL:P25516) (890
FT                   aa) fasta scores: E(): 1.7e-82, 45.46% id in 893 aa, and to
FT                   Ralstonia solanacearum probable aconitate hydratase 1
FT                   transmembrane protein rsp0120 or rs03002 SWALL:Q8XTI8
FT                   (EMBL:AL646076) (865 aa) fasta scores: E(): 0, 86.69% id in
FT                   864 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37653"
FT                   /db_xref="GOA:Q63NU1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR012708"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NU1"
FT                   /protein_id="CAH37653.1"
FT                   /translation="MNTANRKPLPGTSLDYFDARAAVDAIRPGAYDALPYTSRVLAENL
FT                   VRRCDPAILADSLTQLVERKRERDFPWFPARVVCHDILGQTALVDLAGLRDAIAERGGD
FT                   PAKVNPVVPVQLIVDHSLAVECGGFDPGAFAKNRAIEDRRNEDRFHFIEWTKKAFENVD
FT                   VIPPGNGIMHQINLEKMSPVIQAQDGVAYPDTCVGTDSHTPHVDALGVIAIGVGGLEAE
FT                   NVMLGRASWMRLPDIVGVELTGKRQPGITATDVVLALTEFLRREKVVGAYLEFRGEGAK
FT                   SLTLGDRATISNMAPEYGATAAMFFIDEQTIDYLRLTGRSDEQVKLVETYAKAAGLWAD
FT                   SLAHAQYERTLTFDLSSVVRNMAGPSNPHKRLPTSDLAARGIAGKWEEKPGEMPDGAVI
FT                   IAAITSCTNTSNPRNVIAAALLARNANARGLARKPWVKSSLAPGSKAVELYLKAANLLP
FT                   ELEKLGFGIVAFACTTCNGMSGALDPKIQREIVDRDLYATAVLSGNRNFDGRIHPYAKQ
FT                   AFLASPPLVVAYAIAGTIRFDIEKDALGHDKDGKPVTLKDIWPTDEEIDAIVASSVKPE
FT                   QFRTVYEPMFARAADAGERAAPLYDWRPRSTYIRRPPYWEGALAGERTLKGMRALAVLG
FT                   DNITTDHLSPSNAILPTSAAGEYLAKMGLPEEDFNSYATHRGDHLTAQRATFANPTLVN
FT                   EMAIVDGEVKKGSLARVEPDGKVMRMWEAIETYMSRKQPLVVIAGADYGQGSSRDWAAK
FT                   GVRLAGVEAIVAEGFERIHRTNLIGMGVLPLEFKPGTNRATLAIDGTETFDVIGERTPR
FT                   ADLTLVIHRSSGERVAVPVTCRLDTAEEVSIYDAGGVLQRFAQDFLESSRAA"
FT   misc_feature    280733..282214
FT                   /note="Pfam match to entry PF00330 aconitase, Aconitase
FT                   family (aconitate hydratase) , score 543.3, E-value
FT                   1.1e-160"
FT   misc_feature    282578..283102
FT                   /note="Pfam match to entry PF00694 Aconitase_C, Aconitase
FT                   C-terminal domain , score 114.6, E-value 1.2e-31"
FT   CDS_pept        283368..284558
FT                   /transl_table=11
FT                   /locus_tag="BPSS0209"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   transmembrane protein rsp0119 or rs03003 SWALL:Q8XTI9
FT                   (EMBL:AL646076) (396 aa) fasta scores: E(): 2.8e-129,
FT                   88.07% id in 394 aa, and to Burkholderia sacchari
FT                   hypothetical 41.4 kDa protein SWALL:Q8VPS6 (EMBL:AY033092)
FT                   (396 aa) fasta scores: E(): 4.9e-128, 86.36% id in 396 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37654"
FT                   /db_xref="GOA:Q63NU0"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="InterPro:IPR012709"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NU0"
FT                   /protein_id="CAH37654.1"
FT                   /translation="MAHVPQIKIPATYLRGGTSKGVFFRLQDLPEAARTPGAARDALLS
FT                   RVIGSPDPYGKQIDGMGGASSSTSKTVIVSKSARPDHDVDYLFGQVSIDKPFVDWSGNC
FT                   GNLSAAVGPFAIAGGLIDPARVPENGVATVRIWQANIGKTIVAHVPITNGAVQETGDFE
FT                   LDGVTFPAAEVQLEFMDPAADEDGAGGAMFPTGNLVDDLDVPGVGTLKATMINAGIPTI
FT                   FVDAAAIGYTGTELQDAINSDAKALAMFETIRAHGALRMGLIASLDEIATRQHTPKVAF
FT                   VAKPADYVASSGKRVAAADVDLLVRALSMGKLHHAMMGTAAVAIGTAAAIPGTLVNLAA
FT                   GGGARHAVRFGHPSGTLRVGAEAKQDGGEWVVTKAIMSRSARVLMEGWVRVPGDAF"
FT   misc_feature    284319..284387
FT                   /note="1 probable transmembrane helix predicted for
FT                   BPSS0209 by TMHMM2.0 at aa 318-340"
FT   CDS_pept        complement(284611..285054)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Deinococcus radiodurans hypothetical
FT                   protein dra0198 SWALL:Q9RYV8 (EMBL:AE001862) (164 aa) fasta
FT                   scores: E(): 7.4e-21, 45.73% id in 129 aa, and to Rhizobium
FT                   loti hypothetical protein mlr6946 SWALL:Q987R7
FT                   (EMBL:AP003010) (171 aa) fasta scores: E(): 1.4e-06, 32.39%
FT                   id in 142 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37655"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NT9"
FT                   /protein_id="CAH37655.1"
FT                   /translation="MTDIVDHARGALRAQPFSMLLGTELVHIGGEEASLRLPIRDELRQ
FT                   QYGFVHGGVISYLADNALTFAGALALGPRVVTGEYKINYLRPAVVGTLIARAKLIYAGR
FT                   NQATCQCHVFVIDGDHERLVAVAQGTINRVGDGREPGAAEEKA"
FT   misc_feature    complement(284653..285024)
FT                   /note="Pfam match to entry PF02584 DUF157, Uncharacterized
FT                   protein PaaI, COG2050 , score 76.1, E-value 4.7e-20"
FT   CDS_pept        286130..286321
FT                   /transl_table=11
FT                   /locus_tag="BPSS0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein rsc1725 or rs02913 SWALL:Q8XYN3 (EMBL:AL646066) (63
FT                   aa) fasta scores: E(): 2.2e-08, 62.26% id in 53 aa, and to
FT                   the C-terminal region of Ralstonia solanacearum
FT                   hypothetical protein rsc1727 or rs02915 SWALL:Q8XYN1
FT                   (EMBL:AL646066) (193 aa) fasta scores: E(): 0.00076, 45.9%
FT                   id in 61 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37656"
FT                   /db_xref="InterPro:IPR014994"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NT8"
FT                   /protein_id="CAH37656.1"
FT                   /translation="MSQAQGHPVTPYGVAIHQAIADGDLAQMKSLRTQAQALLAQQGNL
FT                   ATALELLEVEIAKLERRK"
FT   CDS_pept        286414..287052
FT                   /transl_table=11
FT                   /locus_tag="BPSS0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein rsc1726 or rs02914 SWALL:Q8XYN2 (EMBL:AL646066)
FT                   (208 aa) fasta scores: E(): 6.3e-40, 54.71% id in 212 aa,
FT                   and to Ralstonia solanacearum hypothetical protein rsc1727
FT                   or rs02915 SWALL:Q8XYN1 (EMBL:AL646066) (193 aa) fasta
FT                   scores: E(): 3.2e-13, 39.61% id in 207 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37657"
FT                   /db_xref="InterPro:IPR014992"
FT                   /db_xref="InterPro:IPR014994"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NT7"
FT                   /protein_id="CAH37657.1"
FT                   /translation="MSEDLRVGLFPVRYLVGTGLPGAPQLVLDLMVDTVDHSVVGRAAV
FT                   SQAVSPPLNFHADVWGSYVFRLGPPPRRDGSGAIVQISLQGNQGGPQSNSMITFYGELL
FT                   LKGDGKTGVASYRYYSNGSWHEVENVPVKADPELVPIEPGPVIGQSSMSAIGSAAMYGV
FT                   AIQSAAASGDLAHMRTLSAYARQQLESRDEIAAALSELKAEIAKLESRQ"
FT   CDS_pept        287105..287695
FT                   /transl_table=11
FT                   /locus_tag="BPSS0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein rsc1727 or rs02915 SWALL:Q8XYN1 (EMBL:AL646066)
FT                   (193 aa) fasta scores: E(): 2.1e-33, 51.79% id in 195 aa,
FT                   and to Ralstonia solanacearum hypothetical protein rsc1726
FT                   or rs02914 SWALL:Q8XYN2 (EMBL:AL646066) (208 aa) fasta
FT                   scores: E(): 1.3e-12, 36.94% id in 203 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37658"
FT                   /db_xref="InterPro:IPR014992"
FT                   /db_xref="InterPro:IPR014994"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NT6"
FT                   /protein_id="CAH37658.1"
FT                   /translation="MATTGLFPVQLRVATPNLGAPVLWLNLLVNTVEKTASGFARITQT
FT                   VYPPMHFRARVVGPFHQMRIDPHAPQSVTLTLSGSPTGPVAPQVVILELNALLNEGWQS
FT                   GTANYRYFYESRWHSIEHAIVSKDNSRIPLDPPSEHVMPMYGVGLQEARASGDLSRMKA
FT                   LAQQAEQQLADHDVIAAELQKLEAEIARLEARR"
FT   CDS_pept        287774..289249
FT                   /transl_table=11
FT                   /locus_tag="BPSS0214"
FT                   /product="putative heme/metallo cofactor biosynthesis
FT                   related protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein rsc1728 or rs02916 SWALL:Q8XYN0 (EMBL:AL646066)
FT                   (491 aa) fasta scores: E(): 3.8e-168, 84.45% id in 489 aa,
FT                   and to Pyrobaculum aerophilum metallo cofactor biosynthesis
FT                   protein pae0579 SWALL:Q8ZYW8 (EMBL:AE009774) (384 aa) fasta
FT                   scores: E(): 1.7e-19, 28.45% id in 369 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37659"
FT                   /db_xref="GOA:Q63NT5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023820"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NT5"
FT                   /protein_id="CAH37659.1"
FT                   /translation="MSTTDARPARYLFDSDYQRFVPVHAVWEITLACDLKCLHCGSRAG
FT                   HRRTNELSTAECLEVIDALARLGTREVSLIGGEAYLRKDWTQLIRAIRSHGMYCAIQTG
FT                   GRNLTPKRLAQAVDAGLNGVGVSLDGLAPLHDKVRNVPGAFERALDTLRRARDAGIAVS
FT                   VNTQIGAQTMEDLPALMDTIIELGATHWQIQLTVAMGNAVDNDELLLQPYRLAELMPLL
FT                   AKLYKDGVSRGLLMTVGNNIGYYGPYEHLWRGFGDERVHWSGCAAGQNVIALEADGTVK
FT                   GCPSLATVGFSGGNVRDMSLEDIWRTSEGIHFGRLRSVDDLWGFCRTCYYADVCRGGCT
FT                   WTSHSLLGKPGNNPYCHYRVLELQKQGLRERIAKVQDAGPASFAVGRFDLVTERIADGE
FT                   PVASVVRSGQVIELAWKNRGKRSPEVGRVPPKLKMCRNCDGYVHAGEQTCPHCGGDIDA
FT                   AARAHELDAQRRHALMNDLERLLGLPASTFGGG"
FT   misc_feature    287957..288631
FT                   /note="Pfam match to entry PF01444 MoaA_NifB_PqqE, moaA /
FT                   nifB / pqqE family , score 68.6, E-value 8.3e-18"
FT   CDS_pept        289471..291084
FT                   /transl_table=11
FT                   /gene="tar"
FT                   /gene_synonym="cheM"
FT                   /locus_tag="BPSS0215"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Similar to Salmonella typhimurium methyl-accepting
FT                   chemotaxis protein II Tar or CheM or stm1919
FT                   SWALL:MCP2_SALTY (SWALL:P02941) (553 aa) fasta scores: E():
FT                   9.9e-67, 47.81% id in 525 aa, and to Escherichia coli
FT                   methyl-accepting chemotaxis protein I Tsr or CheD or b4355
FT                   SWALL:MCP1_ECOLI (SWALL:P02942) (551 aa) fasta scores: E():
FT                   4e-63, 44.93% id in 523 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37660"
FT                   /db_xref="GOA:Q63NT4"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NT4"
FT                   /protein_id="CAH37660.1"
FT                   /translation="MFSKIKLASGLLGVLVTFCLFLIAVEGLGFWSLSASRSNVDALSN
FT                   VAIKQTDATTVATQHMLDARTNLSRASTRMVKGDPMPTETLQHVRDQLALADRAFAAFT
FT                   AAPTISAENTERAAALTDRYRKYHAALVDLVQFLESNNMQAFLDQPTQQIQDAYLGELR
FT                   TFSEFSGRTSEHALGMIDTGMHWFETVGAVLLVLMLACIAGIYAVARRAVVAPLAQALV
FT                   HFERIAQGRLDETVAPHGVYEIERLLRGLADMQASVAGTVRVVRNASNAIHLGAAEIAS
FT                   GNADLSARTSSQAASLEQTAASMEELTATVRQNSDSARAASALADDALRTTQNGGAIVD
FT                   DVIDKMHGIARSSGRIAEIIAVIDGIAFQTNILALNAAVEAARAGEEGRGFAVVAGEVR
FT                   ALAQRSAQSAKEIKLLIEESVAQIDGGSELVERAGEAMRSVSASIERVAQTMTEITAAS
FT                   VEQSAGIEQVNQAVTQMEQLTQQNAALVEEVAAAAGSLNEQTEQLQQSVSVFELGDARA
FT                   RRLAGGAALAGARAPQLAGA"
FT   misc_feature    289471..289542
FT                   /note="Signal peptide predicted for BPSS0215 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.770 between residues 24 and 25"
FT   misc_feature    order(289498..289566,290026..290094)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPSS0215 by TMHMM2.0 at aa 10-32 and 186-208"
FT   misc_feature    289603..290001
FT                   /note="Pfam match to entry PF02203 TarH, Tar ligand binding
FT                   domain homologue , score 45.1, E-value 1e-10"
FT   misc_feature    289963..289986
FT                   /note="PS00097 Aspartate and ornithine
FT                   carbamoyltransferases signature."
FT   misc_feature    290041..290250
FT                   /note="Pfam match to entry PF00672 HAMP, HAMP domain ,
FT                   score 37.9, E-value 1.5e-08"
FT   misc_feature    290311..291009
FT                   /note="Pfam match to entry PF00015 MCPsignal,
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain
FT                   , score 343.0, E-value 2.2e-100"
FT   CDS_pept        complement(291447..293084)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0216"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Rhizobium loti transmembrane efflux
FT                   protein mll5686 SWALL:Q98B85 (EMBL:AP003007) (502 aa) fasta
FT                   scores: E(): 3.1e-40, 32.99% id in 491 aa, and to
FT                   Streptomyces glaucescens tetracenomycin C resistance and
FT                   export protein TcmA SWALL:TCMA_STRGA (SWALL:P39886) (538
FT                   aa) fasta scores: E(): 1.7e-37, 31.08% id in 518 aa. Note:
FT                   This CDS is longer in its N-terminal region than most of
FT                   its database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37661"
FT                   /db_xref="GOA:Q63NT3"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NT3"
FT                   /protein_id="CAH37661.1"
FT                   /translation="MHDAPSRPAPIEPPRHACGSPAASAPARARALAPAAEPGAEAPSR
FT                   AWRALATASATCSLIVLDTNVVAVSLPSIARTLHASFADIEWVVSAYMTAFAACLLPAG
FT                   GLADRAGRKRVLLAGLAVFFVASLGCGLAPSAALLNVARAVKGIGAAMLLTSALAVIAN
FT                   RFSEGRERARAWAIWGMCMGVATAIAPLVGGAIAQWIGWRWIFLLNLPVCIALAAAVRA
FT                   TIDESRDPHAKRIDAPGSVLFGAALALGIWALIDAPSHGWTAPGTLARFAASAALGAAF
FT                   VAAERWQRRPMIDLALFRTPRFVGALLAMFGYAACAQVMMTFLPLYLQIGFGMSAIDAG
FT                   LGMLPFALAMIVGPSLGAALSARAPAATVLGCGLALIGIGNFATAALAGASHYGLVALG
FT                   MMITGCGAGILNGDTQKAIMACVPPERTGMASGISTTTRFSAIVTSVGVLGAVLAEQTH
FT                   AALAARVAHAPALLGALDPRFMSSLLAGDLAQAIRSLPPRTGATLAHIAPGGFASGFSL
FT                   ALCASGAFALAAAVAVRLLVGAQPGRAA"
FT   misc_feature    complement(order(291474..291542,291702..291770,
FT                   291849..291908,291921..291980,291999..292067,
FT                   292110..292178,292239..292307,292320..292376,
FT                   292413..292481,292494..292562,292596..292664,
FT                   292677..292745,292764..292832))
FT                   /note="13 probable transmembrane helices predicted for
FT                   BPSS0216 by TMHMM2.0 at aa 85-107, 114-136, 141-163,
FT                   175-197, 202-224, 237-255, 260-282, 303-325, 340-362,
FT                   369-388, 393-412, 439-461 and 515-537"
FT   misc_feature    complement(292728..292778)
FT                   /note="PS00216 Sugar transport proteins signature 1."
FT   CDS_pept        293213..294070
FT                   /transl_table=11
FT                   /locus_tag="BPSS0217"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /note="Similar to Agrobacterium tumefaciens transcriptional
FT                   regulator, LysR family atu4021 or agr_l_1663 SWALL:Q8U8R9
FT                   (EMBL:AE009333) (309 aa) fasta scores: E(): 2.6e-32, 37.2%
FT                   id in 293 aa, and to Yersinia pestis probable LysR-family
FT                   transcriptional regulator ypo1929 SWALL:Q8ZF22
FT                   (EMBL:AJ414150) (292 aa) fasta scores: E(): 1.6e-23, 31.59%
FT                   id in 288 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37662"
FT                   /db_xref="GOA:Q63NT2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NT2"
FT                   /protein_id="CAH37662.1"
FT                   /translation="MRHVRAFLCVARHLHFARAADELDIAPPALTRLVQDAERLLGVRL
FT                   FHRTRRSVALSAAGAAYLGEAQAALAHLARGRERAALAERGEIGRIELGYVSSAAYAGV
FT                   LQRTVGAFRDAHPRIRVDVREVPMSEVAARLDAGTLDAAYVRPPLPLPDGVSTHTVHRD
FT                   VFVVAVHGQSPLAARASIRPAALAGERFVVPEQALGTLEAARRGRFEPIVDARPGALVA
FT                   VLAHVSVSGGVAIVPKALVGCVSLPGVAYRPIEGKPIASEVAVAYRRHEKAPAVRAFVR
FT                   QAAL"
FT   misc_feature    293213..293392
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family , score
FT                   70.3, E-value 2.6e-18"
FT   misc_feature    293231..293251
FT                   /note="PS00290 Immunoglobulins and major histocompatibility
FT                   complex proteins signature."
FT   misc_feature    293252..293317
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1289.000, SD 3.58 at aa 29-50, sequence
FT                   LHFARAADELDIAPPALTRLVQ"
FT   misc_feature    293462..294064
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain , score 100.2, E-value 2.7e-27"
FT   CDS_pept        complement(294153..295256)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0218"
FT                   /product="putative isomerase"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   mannose-6-phosphate isomerase protein ManA or rsc3058 or
FT                   rs00502 SWALL:Q8XUX5 (EMBL:AL646073) (410 aa) fasta scores:
FT                   E(): 1.6e-39, 43.22% id in 391 aa, and to Rhizobium
FT                   meliloti mannose-6-phosphate isomerase Pmi or r02982 or
FT                   smc03111 SWALL:MANA_RHIME (SWALL:P29954) (387 aa) fasta
FT                   scores: E(): 9.4e-06, 28.75% id in 386 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37663"
FT                   /db_xref="GOA:Q63NT1"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NT1"
FT                   /protein_id="CAH37663.1"
FT                   /translation="MSAPVSVSDQAARLRRHFAQIVLPIWRGPGFNPALQLPFEAVAPD
FT                   THAPLPVTRYRAMACARQLFIFSQAGDAQHAHALFAALCRHFRDPRHDGWFYSVDAQGA
FT                   PLDRTKDLYTHAFVVFACAEYFAAFGNRDARELAQRTAALIVDRFAPRPGSALLDSARG
FT                   EDFAAAAGGPLQNPLMHLTEGWLAAGRAFGDTAFDDALLRTAQAVERTFVDPHTGCVAE
FT                   LPIGCADNRFEPGHQFEWFYLVASAGARLAATGLPDALARAYAFAQRHGVDPDTGGVSA
FT                   TTDERGACVDGTQRIWAQTEYLRALATHGGEPDALARQIARFAERFLHPRGWYECKTAQ
FT                   GEVSRADMPSTTPYHLATAYASLPAGT"
FT   CDS_pept        295367..296062
FT                   /transl_table=11
FT                   /locus_tag="BPSS0219"
FT                   /product="MgtC family membrane protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 hypothetical protein YhiD or b3508 or z4920 or
FT                   ecs4388 SWALL:YHID_ECOLI (SWALL:P26606) (215 aa) fasta
FT                   scores: E(): 1.1e-24, 40.55% id in 217 aa, and to Aquifex
FT                   aeolicus Mg(2+) transport ATPase MgtC or aq_447
FT                   SWALL:O66755 (EMBL:AE000690) (225 aa) fasta scores: E():
FT                   6.8e-20, 39.3% id in 201 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37664"
FT                   /db_xref="GOA:Q63NT0"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NT0"
FT                   /protein_id="CAH37664.1"
FT                   /translation="MLNNVELIMRLMLAAALGSVIGIERERLSWAAGLRTHMLVCVGSA
FT                   LIMIVSAFGFADVLGQAHVDLDPSRMAAQVVSGIGFLGAGSILLRGEIVRGLTTAASLW
FT                   SVAAVGLAVGGGLYAAAIAATIIILVILAGIKPLERRYLSVRQRRHLMLLVERGTLTFD
FT                   SLHAALGLDSARVKRFIVQQSEDSADSDEVTIALGRVSDVEYESICARLRQLPGVKGFS
FT                   ERKGGLPDD"
FT   misc_feature    order(295367..295435,295478..295546,295580..295648,
FT                   295691..295759)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BPSS0219 by TMHMM2.0 at aa 13-35, 50-72, 84-106 and
FT                   121-143"
FT   misc_feature    295397..295798
FT                   /note="Pfam match to entry PF02308 MgtC, MgtC family ,
FT                   score 181.9, E-value 6.7e-52"
FT   CDS_pept        296382..297662
FT                   /transl_table=11
FT                   /locus_tag="BPSS0220"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches. Possible
FT                   alternative translational start site"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37665"
FT                   /db_xref="GOA:Q63NS9"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NS9"
FT                   /protein_id="CAH37665.1"
FT                   /translation="MAVDETAHDAARVQARGFGGLDRPRRDAGAGAGADAGAGAGAGAD
FT                   ADASADASADADADARGARAAAHAPEPAGEQADLLSGFGESPAADRQDAQRNADGRVDA
FT                   EAADGERSRAVKADERLNEGVSQGVNAEASAGEHAAAGPAIIRRGASAPDASEPAAAKS
FT                   GVDEATAARPPRARRASARRADGGKQAAERGARRGRAAEGAISKSAGADGGALGGEAAG
FT                   GQAAENRAVPADTVRDSSPAPVARRDAAVRGRPAEARALPAAADRAPVNAAQPHPRSAN
FT                   PSPALLPAAAAQAATSAASADSDAQLRPLADRIRALQSETIDLRRAADAQMRRVNRLLL
FT                   ALAVVLLAAIVAWIVQAVQLSRQRDQFAAMQQRIDRLVAAQATQGATIATLSQRQDEVG
FT                   AQVDRLTSRLSSAAVPAKRAHRTRHMR"
FT   misc_feature    297393..297461
FT                   /note="1 probable transmembrane helix predicted for
FT                   BPSS0220 by TMHMM2.0 at aa 338-360"
FT   CDS_pept        complement(297814..298842)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0221A"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS. Poor database matches. Weakly similar
FT                   to the N-terminal region of Mycobacterium paratuberculosis
FT                   FtsQ ftsQ SWALL:Q73YR0 (EMBL:AE017233) (375 aa) fasta
FT                   scores: E(): 0.00018, 31.51% id in 330 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0221A"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37666"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NS8"
FT                   /protein_id="CAH37666.1"
FT                   /translation="MASERGNGNGNDTTRHGSDHDLTNRNGRQSMRTGQPRAERRSGAA
FT                   PMGFRARRRMHGCDGIFVRGARSPRFGAPPARLRLAIGFDGRTSVSHPPPRQASDRDEP
FT                   ADEVRRLGCAIRRYIGDVDARRWARHRRTRISRAPRDPAIAAAPGVHRGEAAAPSAQRR
FT                   ATVHGRCRTGRRKIARRRPLDGRRVTAGHARAARRNTSVIRRRQRNGRGRASAAPTPPG
FT                   DRPASLAAIMPADRGGYGHRRRLGATRHARAHAGSAIPPRHAPSPRRRLRRRQRSAADQ
FT                   ADLRDVRLAHPLHLGMAGLVRIVGVERQMRRREKIFNLLKQREDEAHLRLLSANVQGFP
FT                   LE"
FT   CDS_pept        299030..299500
FT                   /transl_table=11
FT                   /locus_tag="BPSS0222"
FT                   /product="putative acetyltransferase"
FT                   /note="Similar to Listeria monocytogenes hypothetical
FT                   protein lmo0624 SWALL:Q8Y9A8 (EMBL:AL591976) (147 aa) fasta
FT                   scores: E(): 2.4e-12, 32.43% id in 148 aa, and to Bacillus
FT                   subtilis YycN protein SWALL:O32293 (EMBL:Z99124) (156 aa)
FT                   fasta scores: E(): 1.9e-11, 30.71% id in 153 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37667"
FT                   /db_xref="GOA:Q63NS7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NS7"
FT                   /protein_id="CAH37667.1"
FT                   /translation="MRPMTQTEFREYRERAARGYARDLIESGQSAPDEADARALACIDT
FT                   LLPDGLLTDDQVLLTLSESADGSVLGHLWYGVVAEGPHRSLFIYDLEIEPAFRRQGWAT
FT                   RVLQALEDDARELRVSEIGLSVFNHNAAALALYRELGFAAVTTTFVKSIESP"
FT   misc_feature    299210..299458
FT                   /note="Pfam match to entry PF00583 Acetyltransf,
FT                   Acetyltransferase (GNAT) family , score 64.8, E-value
FT                   1.2e-16"
FT   CDS_pept        complement(299703..300371)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0223"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37668"
FT                   /db_xref="InterPro:IPR025145"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NS6"
FT                   /protein_id="CAH37668.1"
FT                   /translation="MRRRWCVAPAPASHASCRGPHAVCSRTDIRAHPRIKRRSQRPRAT
FT                   NCDTAANATAIDFTHRQHETAADTRRLSSRMIAFLARRAARRTPTPTTASHSPTSRSRG
FT                   AGRHLFAALAVALIGLPHAHAEIRCGWLQNPTPGNWWLDDRTGSWTLGTMGGPETEGMD
FT                   VIPDMAGKQYVETNGSHGYACACLTVVTDKQERRIVKVLKAKQLPLSRCRRDKRLKEPT
FT                   "
FT   CDS_pept        complement(300572..303502)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0224"
FT                   /product="putative cation-transporting ATPase membrane
FT                   protein"
FT                   /note="No significant database matches to the full length
FT                   CDS. N-terminal region is similar to Similar to Homo
FT                   sapiens copper-transporting ATPase 2 ATP7B or WND or PWD or
FT                   WC1 SWALL:AT7B_HUMAN (SWALL:P35670) (1465 aa) fasta scores:
FT                   E(): 3e-07, 27% id in 300 aa. C-terminal region is similar
FT                   to Ralstonia solanacearum probable cation-transporting
FT                   ATPase transmembrane protein rsc3348 or rs02623
FT                   SWALL:Q8XU45 (EMBL:AL646074) (748 aa) fasta scores: E():
FT                   1.1e-121, 59.89% id in 768 aa, and to Synechocystis sp.
FT                   cation-transporting ATPase PacS or sll1920 SWALL:ATCS_SYNY3
FT                   (SWALL:P73241) (745 aa) fasta scores: E(): 2.8e-81, 44.01%
FT                   id in 777 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37669"
FT                   /db_xref="GOA:Q63NS5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NS5"
FT                   /protein_id="CAH37669.1"
FT                   /translation="MQMTKLFAPAAPITTTLLVEGMHCGGCTSRVEQALAQVPGVTGAV
FT                   ADLAAGTATVAAASAIDTARLVAALDAAGYRATVATAPAATGNADARHGRARDEDDDAA
FT                   AAPHTAAVTLTIGGMTCGGCARRVEQALAAVRGVADAKVDLATMSAKASVARDVDSQTL
FT                   VAAVEQAGYRANVVRDARAEAAPKPAACPFEDAARSAAPAAAFAVDESSAASPERVATQ
FT                   SFELDIAGMTCASCVGRVEKALAQVPGVARATVNLATEKATVDADADAHVDTARLIDAV
FT                   KRAGYRASPAIAACAPASRATATADAAAARPASPSADDRKLAEARRERALVIASAVLTT
FT                   PLALPMFAAPFGVDAALPAWLQLALASIVQFGFGARFYRAAWHALKARAGNMDLLVALG
FT                   TSAAYGLSIWLMLRDPGHAAHLYFEASAVIVTLVRFGKWLEARAKRQTTDAIRALNALR
FT                   PDRARIVEHGVERDVPLAQVRVGTVVRVLPGERVPVDGRIEAGVTHVDESLITGESLPV
FT                   PKEPGERVTAGSINGEGALTVATTAIGAETTLARIIRLVESAQAEKAPIQRLVDRVSAV
FT                   FVPAIVAIAFATFAGWLVAGAGVETAILNAVAVLVIACPCALGLATPAAIMAGTGVAAR
FT                   HGVLIKDAQALELAQRARIVAFDKTGTLTQGRPTVTAFDAIGIPRGDALALAAAVQRAS
FT                   AHPLARAVVAAFDADADARRSSLAAAHADTPRAVAGRGVEARVDARLLALGSTRWRDEL
FT                   GIAVPDGVARRAAALEAAGNTVSWLMRADAPREALALVAFGDTVKPNARRAIERLAARG
FT                   IRSALVTGDNRGSATAVAASLGIDEVHAQVLPDDKARVVAQLKATAGDGAVAMVGDGIN
FT                   DAPALAAADVGIAMATGTDVAMHTAGITLMRGDPALVADAVDISRRTYRKIQQNLFWAF
FT                   VYNLVGIPLAALGWLNPMIAGAAMAFSSVSVVTNALLLRRWKGDAR"
FT   misc_feature    complement(order(300599..300658,300668..300727,
FT                   301622..301690,301718..301786,302195..302254,
FT                   302267..302335,302369..302437,302447..302515))
FT                   /note="8 probable transmembrane helices predicted for
FT                   BPSS0224 by TMHMM2.0 at aa 330-352, 356-378, 390-412,
FT                   417-436, 573-595, 605-627, 926-945 and 949-968"
FT   misc_feature    complement(300836..301549)
FT                   /note="Pfam match to entry PF00702 Hydrolase, haloacid
FT                   dehalogenase-like hydrolase , score 110.4, E-value 2.2e-30"
FT   misc_feature    complement(300839..300907)
FT                   /note="PS01229 Hypothetical cof family signature 2."
FT   misc_feature    complement(301511..301531)
FT                   /note="PS00154 E1-E2 ATPases phosphorylation site."
FT   misc_feature    complement(301559..302221)
FT                   /note="Pfam match to entry PF00122 E1-E2_ATPase, E1-E2
FT                   ATPase , score 323.2, E-value 2e-94"
FT   misc_feature    complement(302633..302833)
FT                   /note="Pfam match to entry PF00403 HMA,
FT                   Heavy-metal-associated domain , score 94.5, E-value
FT                   1.4e-25"
FT   misc_feature    complement(302732..302821)
FT                   /note="PS01047 Heavy-metal-associated domain."
FT   misc_feature    complement(302975..303169)
FT                   /note="Pfam match to entry PF00403 HMA,
FT                   Heavy-metal-associated domain , score 74.5, E-value
FT                   1.5e-19"
FT   misc_feature    complement(303068..303157)
FT                   /note="PS01047 Heavy-metal-associated domain."
FT   misc_feature    complement(303266..303460)
FT                   /note="Pfam match to entry PF00403 HMA,
FT                   Heavy-metal-associated domain , score 74.8, E-value
FT                   1.1e-19"
FT   misc_feature    complement(303359..303448)
FT                   /note="PS01047 Heavy-metal-associated domain."
FT   repeat_region   303972..304223
FT                   /note="contains perfect hexamer repeat, ggcaac x42"
FT   CDS_pept        304350..305177
FT                   /transl_table=11
FT                   /locus_tag="BPSS0225"
FT                   /product="putative exported protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37670"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NS4"
FT                   /protein_id="CAH37670.1"
FT                   /translation="MSTNMKRLMTAALGAALAFGALSARAASFDCAHAANAAERAICGT
FT                   PALGELDVRMAAYYEMLQNARPADEGMAYREFRDALRDEQQRWRQRTRDACGARIDCLT
FT                   NAYTARIAALRGVAAERLVLRMTGGSAASAGAADATYAIEGESITLANGESVRPAAPGS
FT                   AMKRVTTLVARSAVATIAGRPVEAVLLSDDPGGSGRFLYVATAQPGGGAPAVLLGDRVK
FT                   PVSVSIERAATGGAVVVVEYLDRPEGAPFAQAPTIKIVRRFALEQGRLVEQRG"
FT   misc_feature    304350..304427
FT                   /note="Signal peptide predicted for BPSS0225 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.628 between residues 26 and 27"
FT   CDS_pept        305951..307372
FT                   /transl_table=11
FT                   /locus_tag="BPSS0226"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   transmembrane protein rsc0254 or rs00689 SWALL:Q8Y2T1
FT                   (EMBL:AL646058) (542 aa) fasta scores: E(): 1.1e-24, 34.67%
FT                   id in 522 aa, and to Listeria monocytogenes hypothetical
FT                   protein lmo0525 SWALL:Q8Y9K2 (EMBL:AL591975) (443 aa) fasta
FT                   scores: E(): 8.1e-18, 28.17% id in 465 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37671"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NS3"
FT                   /protein_id="CAH37671.1"
FT                   /translation="MTTNQRESTVSLRRACASLAALALLAACTSTPEAIQRKTGWMRSE
FT                   VADSYIYAYPLVLMDVAKEAATADGAPVNTLRHAQALPAPGAANPPLASVDMLDSTAWL
FT                   DVADEPVIVALPDGRGRYLDARALDMWTNVLWSTGPSANPRSGASRARTLAFVGAGWEG
FT                   TLPEGVTRVDVPARNVWLDVRIQTSGGRDLAAARKLQRAIRVEPLSVYTGDARGARADA
FT                   GAASAEPASGAAASPVAQVAALDPPAFFSRVARALQDNPPPAADAHAQEILADIGVTAG
FT                   APVQWKGDKLIGAENGAAEARERLTALPPNALSANGWSWLGDSVGNYGQDYALRAYAAS
FT                   TQFGAGTRDDETVAVVKTDSAGRPLNGAHRYVIRFAPNALPPARAFWSLAPYTPDGAVP
FT                   ELGRARRSIGERDRLRRNRDGSLEIVVSAAPPGKGYASNWLPAPRADFELALRLYAPKR
FT                   QAADGTWQPPAVVRK"
FT   misc_feature    305951..306031
FT                   /note="Signal peptide predicted for BPSS0226 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.997) with cleavage site
FT                   probability 0.231 between residues 27 and 28"
FT   misc_feature    306002..306034
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        307527..311486
FT                   /transl_table=11
FT                   /locus_tag="BPSS0227"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Ralstonia solanacearum putative
FT                   transmembrane protein rsc0896 or rs06183 SWALL:Q8Y0Z7
FT                   (EMBL:AL646061) (1261 aa) fasta scores: E(): 8e-67, 44.29%
FT                   id in 1314 aa, and to Pseudomonas aeruginosa hypothetical
FT                   protein pa4735 SWALL:Q9HV64 (EMBL:AE004887) (1088 aa) fasta
FT                   scores: E(): 1.9e-29, 24.82% id in 1305 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37672"
FT                   /db_xref="GOA:Q63NS2"
FT                   /db_xref="InterPro:IPR008023"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NS2"
FT                   /protein_id="CAH37672.1"
FT                   /translation="MAFNKETVQSNLQKLGVAARSRRAKRAGIGALIFLVAFGLLGFFA
FT                   APPLIRHVAEQQLSQQLERPATIARIAFNPYTLRLEADGVRVGERGGQGAFVDIGKLVV
FT                   RASWTSLARFAPIIDEVRLDQPRFRIVRYDAQRFNFTDLVDKFSKPSPQPSAKPARFSV
FT                   SNIQVNDGRIEFDDRLLNARHVVDQWTVGIPFIATLPSKTDIFVEPKLRARLDGSPIAI
FT                   DGKTKPFAQSRESSINLKFDGLDVPRLLSYAPTKLPVDVRSGRLSSNLDVNFAMAGDTP
FT                   SLRVSGTLDLNDAQVTSRANEPLFAAHAVHVAAAQLEPLRNVLHFDDIRIDRPVVSLAR
FT                   DKAGVLNVMKLAGGEKAGAPPAARAAAPTSAGASAAAAGSSVSAVSPGSPAAARPASGA
FT                   ASQPAAAASSAAAAHAAAEKAPPLDLTIKRFAINDGALNLNDASLATPAAISLQHVATT
FT                   LADFTLAGKTPARYTLAADVASGGSLKAEGAFSLAARQADTKLAIDALALPAVQPYLAG
FT                   ASSARVLDGVLSTSVNAKADWSKTPLDAQVSDSELGLKSLKIALPNAKTPAVALPDARV
FT                   KVTKIDLAARTAEIASVDATGLALDVARLQDGRIDLASLAGDGGRAAGAKPAASNASAA
FT                   RGARPAAPAWRYRIDELNVKDAKANFTDRSTPRPVKLAIAPLALNVRQISEDLSKPLPV
FT                   RLTATLNRKGSLELSGNVTAQPLKVGLKLNGNRLDAAAFEPYFGSMLNATVASALLNAK
FT                   GELSVEQAKQSTKASYRGDAALVDVRMLDKATSDPFAGWRSLALANLKASYDDARGTDV
FT                   DASRVTFSNFYGRVLLDAQGKLNLREVVAKESGPAQSLTRDASGKEPIPLTPQAASQAK
FT                   AAIAASAVEPASAPVLASAAAASAAAAAGASAVAASPASGAAVVRAAAPPQHPVRLHFG
FT                   QLLLQRGRVTYTDNFIKPNYTANLVAINGTIGAFGTDSTAPAPVDVGANLAGNGPITIK
FT                   GTVNPLIEKPSLDLTATAHDIELTNLTPYSAKYAGYPITKGKLNVDLHYKLDNDLLSAN
FT                   NHIFIDQLTFGEHVENDTATKLPVRLAIALLKNSRGEIDVNVPVSGSLSNPEFSIGGLI
FT                   WRAVLNLIAKAVTSPFTLLAHAFGGDGEALGYVEFEPGRSKLSDASQKKLDTISKMLAE
FT                   KPSIRLDLIGRVDPDKDLPGLRDAYVERLVRQQKLKDVVGQGESVDPMTVKVDPAEYTK
FT                   YLTKAYKAADFKKPRNMIGFTKTLPDDDMKKALADHASVDDSSLRALAQARAQAVRQYL
FT                   EGKVDSSRMFIVAPKLDAKGIEDKGATTRVDFGLK"
FT   misc_feature    307608..307676
FT                   /note="1 probable transmembrane helix predicted for
FT                   BPSS0227 by TMHMM2.0 at aa 59-81"
FT   CDS_pept        complement(311611..311874)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0228"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37673"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NS1"
FT                   /protein_id="CAH37673.1"
FT                   /translation="MSCDKKIVLIRSIPMATLEAFRCVLDDARTPEIIRHHIIDALQYA
FT                   LRNYGQVFTAKEVEWLAAWDDPRIPLAARKELDRREPAAAAR"
FT   CDS_pept        complement(312200..313861)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0229"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium loti hypothetical protein
FT                   mlr2187 SWALL:Q98IY7 (EMBL:AP002999) (508 aa) fasta scores:
FT                   E(): 1.1e-53, 43.19% id in 551 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37674"
FT                   /db_xref="GOA:Q63NS0"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NS0"
FT                   /protein_id="CAH37674.1"
FT                   /translation="MKRNSKQFEIGAWLGACALAFAGAASAAAVQDRDHDSRPVDAKRV
FT                   LLVSIDGLHEQDLARCIGANTCPNLALLAKSGVTYTNARTPGLSDSFPGLAALVTGGSP
FT                   KSAGLFYDVSYDRTLYAPSDATCSGKQGWNVVFDETTGIDAMNGGALTHLDGGGAFNPQ
FT                   AIPHARVNGQCVSVYPHDYVKTNTVFEVVKEHLRGSHTAWADKHAWGYDWVNGPSGKGV
FT                   DDLARTEINSIDPATGTPYTDIYTHTEKFDDYHVQAIVNQIDGKNSTGTAAAPVPTLFG
FT                   TNFQTLSVAQKATVASGGGYLDASFTPGPEVANAIAYVDGALGRIVAELRQRGLYDSTV
FT                   VIVTAKHGQSPTDHTKLVKHGDTLTALLEANGFVDPNGNFGQNNTASGNPNDGTGLVGT
FT                   GFVQTDDVGLVWLRDPRQLSAAVATLKANLGCNAPGICADGPQAYILYGPSVAERFGDP
FT                   ALGRTPDIVVQPNPGVIYTSSKKKDEEHGGNAPDDSHLGLLVSYAGLRQGRTIDAPVLT
FT                   TQVAPTILRSLGLEPRLLHAVALEGTRVLPGLGLER"
FT   misc_feature    complement(313781..313861)
FT                   /note="Signal peptide predicted for BPSS0229 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.900 between residues 39 and 40"
FT   CDS_pept        complement(314442..314834)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0230"
FT                   /product="Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily protein"
FT                   /note="Similar to Photorhabdus luminescens ORF38
FT                   SWALL:AAO18063 (EMBL:AY144116) (131 aa) fasta scores: E():
FT                   1.7e-23, 47.61% id in 126 aa, and to Bacillus subtilis
FT                   hypothetical protein YycE SWALL:YYCE_BACSU (SWALL:P37479)
FT                   (139 aa) fasta scores: E(): 1.1e-16, 38.52% id in 122 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37675"
FT                   /db_xref="GOA:Q63NR9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NR9"
FT                   /protein_id="CAH37675.1"
FT                   /translation="MMNPPVLRVARPTNDIDTLVRFYTKALGFDVVARFENHEGFDGAI
FT                   VGRAGYPWQIEFTHQHGVTVARAPTAEHLLVFYLPDRGAWTEAVARMRAYGATPCRSEN
FT                   PYWDREGVTFEDPDGYRIVLQNAQPA"
FT   misc_feature    complement(314445..314801)
FT                   /note="Pfam match to entry PF00903 Glyoxalase,
FT                   Glyoxalase/Bleomycin resistance protein/Dioxygenase
FT                   superfamily , score 42.0, E-value 8.8e-10"
FT   CDS_pept        complement(314959..315243)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0231"
FT                   /product="hypothetical protein"
FT                   /note="Similar to the N-terminal region of Ralstonia
FT                   solanacearum hypothetical protein RSP1103 or RS02609
FT                   SWALL:Q8XQW5 (EMBL:AL646082) (56 aa) fasta scores: E(): 2,
FT                   45.65% id in 46 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37676"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NR8"
FT                   /protein_id="CAH37676.1"
FT                   /translation="MAMKKTDLEKNKALKLTHAMKQTTSARFGKGAEDAAADRRERRRL
FT                   EQAQGLVPFACKLNIELVARLNERAAAHPDGMTGLLTELLQRGLDETAK"
FT   CDS_pept        315412..316482
FT                   /transl_table=11
FT                   /locus_tag="BPSS0232"
FT                   /product="putative squalene/phytoene synthase"
FT                   /note="Similar to Methylococcus capsulatus squalene
FT                   synthase Sqs SWALL:O69445 (EMBL:Y09978) (362 aa) fasta
FT                   scores: E(): 8.3e-20, 29.1% id in 323 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37677"
FT                   /db_xref="GOA:Q63NR7"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NR7"
FT                   /protein_id="CAH37677.1"
FT                   /translation="MTDLIRSMGNSTRAFLLGPLLKGVSRSFYLTLRVLPQGMRDPIGL
FT                   AYLLARAADTIADTSLIPPAQRLELLLSLRAQINGAPDPHALARIAGEVAGQQAQTDEK
FT                   TLLESLGPALAVLSQLSAPDRAAVRGVVTTLTEGMEFDLRTFPDESSGRVVALREWPAL
FT                   DRYTYLVAGCVGEFWTKMTCAHLPGLLTEREDTMSERGIRFGKALQMTNVLRDCGRDLR
FT                   IGRCYLPQAMLDEYGLRAEDLLGPGASLRARPLMHALVRTTLAHFHAGIDYTFAIPRRA
FT                   PRLRLACFWPIAIGLRTLALLASNDAWLDPARASKVRRGDVYRILAYSLPLAMSNGALR
FT                   AWLDRLIADVEARLIA"
FT   misc_feature    315472..316416
FT                   /note="Pfam match to entry PF00494 SQS_PSY,
FT                   Squalene/phytoene synthase , score 27.3, E-value 4.2e-13"
FT   misc_feature    315853..315891
FT                   /note="PS00018 EF-hand calcium-binding domain."
FT   CDS_pept        complement(join(316508..316633,316633..316734,
FT                   316734..316817,316820..317098))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPSS0233"
FT                   /product="LysR-family regulatory protein (fragment)"
FT                   /note="Probable gene rement. Similar to the C-terminal
FT                   regions of Bordetella pertussis probable LysR-family
FT                   transcriptional regulator bp1607 SWALL:Q7VXW7
FT                   (EMBL:BX640415) (300 aa) fasta scores: E(): 3.4e-41, 62.98%
FT                   id in 181 aa, and Ralstonia solanacearum probable
FT                   transcription regulator protein rsc1152 or rs04599
FT                   SWALL:Q8Y092 (EMBL:AL646063) (297 aa) fasta scores: E():
FT                   5.8e-37, 59.66% id in 181 aa. CDS contains several
FT                   framshift mutations"
FT                   /db_xref="PSEUDO:CAH37678.1"
FT   misc_feature    complement(316844..317098)
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain , score 47.4, E-value 6.8e-13"
FT   CDS_pept        join(317332..317361,317365..317523)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPSS0233a"
FT                   /product="putative membrane protein (pseudogene)"
FT                   /note="Similar to Chromobacterium violaceum hypothetical
FT                   protein cv0784 SWALL:Q7NZY5 (EMBL:AE016912) (62 aa) fasta
FT                   scores: E(): 1.1e-20, 82.25% id in 62 aa, and to Bordetella
FT                   bronchiseptica putative membrane protein bb2409
FT                   SWALL:Q7WJT4 (EMBL:BX640444) (64 aa) fasta scores: E():
FT                   1.1e-18, 74.6% id in 63 aa. CDS contains a nonsense
FT                   mutation (opal) after codon 10"
FT   CDS_pept        complement(318009..319016)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0234"
FT                   /product="putative cytochrome oxidase subunit II"
FT                   /note="Similar to Pseudomonas aeruginosa cyanide
FT                   insensitive terminal oxidase CioB or pa3929 SWALL:O07441
FT                   (EMBL:Y10528) (335 aa) fasta scores: E(): 3.3e-78, 60.59%
FT                   id in 335 aa, and to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 cytochrome D ubiquinol oxidase
FT                   subunit II CydB or Cyd-2 or b0734 or c0812 or z0901 or
FT                   ecs0769 SWALL:CYDB_ECOLI (SWALL:P11027) (379 aa) fasta
FT                   scores: E(): 1.3e-21, 28.22% id in 372 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37680"
FT                   /db_xref="GOA:Q63NR6"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NR6"
FT                   /protein_id="CAH37680.1"
FT                   /translation="MDVTVIWAAIIALGLFMYVVLDGFDLGIGIVFPFFPAEQERDLMM
FT                   NTVAPVWDGNETWLVLGGAGLFAVFPIVYSTVLSALYLPLVFMLVCLIFRGVSFEIRAK
FT                   ARRTKHLWDLAFIGGSTGATFFQGVALGAFLQGIPVDGGRFAGDAFGWLTPFSLLTGLG
FT                   LIATYALLGCCWLVAKTEGDLQRRLHRVVWPLTVVLLGFIAVVSLWTPLQDTNIAQRWF
FT                   ATGLFWRLLPVPFLVAGCAALMRRAVRERHDTTPFALALALVFLGYVGLLASLWPYAIP
FT                   QSVTLWEAAAPRSSQTFTLIGAAVIIPVILAYTTMGYWVFRGKVRHEDQHYYHH"
FT   misc_feature    complement(318039..319016)
FT                   /note="Pfam match to entry PF02322 Cyto_ox_2, Cytochrome
FT                   oxidase subunit II , score 465.2, E-value 3.4e-137"
FT   misc_feature    complement(order(318054..318122,318180..318248,
FT                   318285..318344,318387..318446,318483..318551,
FT                   318609..318677,318735..318803,318912..318980))
FT                   /note="8 probable transmembrane helices predicted for
FT                   BPSS0234 by TMHMM2.0 at aa 13-35, 72-94, 114-136, 156-178,
FT                   191-210, 225-244, 257-279 and 299-321"
FT   CDS_pept        complement(319052..320464)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0235"
FT                   /product="putative cytochrome oxidase subunit I"
FT                   /note="Similar to Salmonella typhimurium cytochrome BD2
FT                   subunit I stm0360 SWALL:Q8ZRG3 (EMBL:AE008712) (467 aa)
FT                   fasta scores: E(): 1e-118, 65.73% id in 467 aa, and to
FT                   Escherichia coli, and Escherichia coli O6 cytochrome D
FT                   ubiquinol oxidase subunit I CydA or Cyd-1 or b0733 or c0811
FT                   SWALL:CYDA_ECOLI (SWALL:P11026) (522 aa) fasta scores: E():
FT                   2.4e-39, 31.67% id in 502 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37681"
FT                   /db_xref="GOA:Q63NR5"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NR5"
FT                   /protein_id="CAH37681.1"
FT                   /translation="METAFSALDLARVQFAFTVSFHIVFPALSIGLASFIAVLEYRWLK
FT                   TGKAYYKSLCLFWSKIFAVAFGMGVVSGVVMAYQFGTNWSGFSSFAGSVTGPLLMYEVM
FT                   TAFFLEAGFLGIMLFGWNRVSPRAHFGATLMVAIGTLISTFWILASNSWMQTPQGFEIV
FT                   DGQVVPTDWFAIIFNPSFPYRLAHMAIAAFVVAALVVAATAAWHLLKGRRDKAVKKMFS
FT                   MSLWLLLVLAPLQAVIGDQHGINTLRHQPAKLAAIEGLWETEPGGTALNLFGIPDMKAQ
FT                   TTRYAVSIPHLGSLILTHSWDGEIRGLKSFPPQDRPNSTVVFWSFRIMVGLGLAMIGLA
FT                   ALAWLLRRRGRLYEAKWFHRFALAMGPTGFVSLLAGWVTTEVGRQPWVVYGVMRTSHAV
FT                   SPLSTQQVSVSLMTFVVVYFLVFGTGVYYMLKLMRKGPALPGDTPDDAHDARPERTARR
FT                   PLSAANQLIDAA"
FT   misc_feature    complement(319106..320437)
FT                   /note="Pfam match to entry PF01654 Bac_Ubq_Cox, Bacterial
FT                   Cytochrome Ubiquinol Oxidase , score 718.0, E-value
FT                   2.8e-213"
FT   misc_feature    complement(order(319175..319243,319328..319396,
FT                   319430..319498,319748..319801,319838..319906,
FT                   320015..320083,320102..320170,320228..320296,
FT                   320354..320422))
FT                   /note="9 probable transmembrane helices predicted for
FT                   BPSS0235 by TMHMM2.0 at aa 15-37, 57-79, 99-121, 128-150,
FT                   187-209, 222-239, 323-345, 357-379 and 408-430"
FT   CDS_pept        321065..322078
FT                   /transl_table=11
FT                   /gene="ltaE"
FT                   /locus_tag="BPSS0236"
FT                   /product="L-allo-threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /note="Similar to Escherichia coli low-specificity
FT                   L-threonine aldolase LtaE or b0870 SWALL:LTAE_ECOLI
FT                   (SWALL:P75823) (333 aa) fasta scores: E(): 1.4e-68, 58.98%
FT                   id in 334 aa, and to Salmonella typhimurium LT2
FT                   L-allo-threonine aldolase LtaA SWALL:Q8ZQF1 (EMBL:AE008737)
FT                   (333 aa) fasta scores: E(): 1.3e-70, 61.07% id in 334 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37682"
FT                   /db_xref="GOA:Q63NR4"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NR4"
FT                   /protein_id="CAH37682.1"
FT                   /translation="MIDLRSDTVTRPSAPMLAAMTAAEVGDDVWGDDPTVARLQAVVAE
FT                   RAGKEAALFFPSGTQSNLAALMSHCERGDEYIVGQAAHTYKYEGGGAAVLGSIQPQPIE
FT                   NAADGTLPLEKIAAAIKPIDDHFARSRLFTLENTIGGKVLPAGYVDEAVALARSRGLAA
FT                   HLDGARVCNAAVASGRAIAELCAPFDSVSICFSKGLGAPVGSVLVGSGALIERAHRWRK
FT                   VLGGGMRQAGVLAAACLYALEHNVERLADDHANAERLAQGLARIEPVKVLSQATNMVFA
FT                   QFPEADCAPLEAWLKERGILTQMLYASRFVTHCDVSRDDIDTAVAAISAYFARSRA"
FT   CDS_pept        complement(322047..323024)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0237"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 chromosome initiation
FT                   inhibitor IciA or b2916 or c3497 or z4253 or ecs3786
FT                   SWALL:ICIA_ECOLI (SWALL:P24194) (297 aa) fasta scores: E():
FT                   4.6e-31, 35.83% id in 293 aa, and to Aeromonas salmonicida
FT                   chromosome initiation inhibitor IciA SWALL:ICIA_AERSA
FT                   (SWALL:P70773) (299 aa) fasta scores: E(): 6.5e-37, 38.17%
FT                   id in 296 aa. CDS is extended at the C-terminus in
FT                   comparison to orthologues"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37683"
FT                   /db_xref="GOA:Q63NR3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NR3"
FT                   /protein_id="CAH37683.1"
FT                   /translation="MTIDPKQAAALVAVADTGSFEQAAARLHVTASAVTQRVRALEASL
FT                   GAPLLLRTRPCRPTAAGQRVLQHLRRMALLQVDLQAELEAERGSTIAVAIALNSDSLGS
FT                   WFLPALTSVLAGERMLFELIVEDQDHTFALLESGMAIGCVTTQSKPMRGCFATPLGTMR
FT                   YRLIAAEEFAARWFAQGLTRESAREAPVVAHGRRDTLQSSFLRDKLGLPDGAFPCHYVP
FT                   GTHAHFAAVRHGLGYAMVPELLLGTTPLAEQRLVDLAPAHSTDVSLYWHAWTVQSPKME
FT                   SLSSRVVEAAQQLLAPPPRGAAAAGGRAAAAPAPVKRANARNTR"
FT   misc_feature    complement(322836..323012)
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family , score
FT                   69.2, E-value 5.8e-18"
FT   misc_feature    complement(322878..322970)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(322908..322973)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1497.000, SD 4.29 at aa 27-48, sequence
FT                   GSFEQAAARLHVTASAVTQRVR"
FT   CDS_pept        323180..325342
FT                   /transl_table=11
FT                   /locus_tag="BPSS0238"
FT                   /product="putative penicillin-binding protein"
FT                   /note="Similar to Bacillus subtilis penicillin-binding
FT                   protein 1A/1B PonA SWALL:PBPA_BACSU (SWALL:P39793) (914 aa)
FT                   fasta scores: E(): 8.7e-44, 30.94% id in 685 aa, and to
FT                   Escherichia coli penicillin-binding protein 1B MrcB or PonB
FT                   or PbpF or b0149 SWALL:PBPB_ECOLI (SWALL:P02919) (844 aa)
FT                   fasta scores: E(): 9.3e-43, 31.98% id in 591 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37684"
FT                   /db_xref="GOA:Q63NR2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NR2"
FT                   /protein_id="CAH37684.1"
FT                   /translation="MPTKDFDMTDHTPHSSPPASPTPPQGPAPKRRRYFRTLAGLVLGA
FT                   AIAGGAVGTWTLHRIWTALPSVEPLAVYRPALPLRIFSREGELLAEYGVERREFVPLDR
FT                   IPPLVRHALLAAEDAQFYTHGVVDIGGLARATVANVVTGQPGQGGSTITMQVARNFFLT
FT                   REKVLSRKLAEILMSYKLERAYSKDKLLELYMNEIYLGERAYGFAAAASVYFGKPLDAL
FT                   TPGEAAVLAGLPKAPSAFNPVVNPARATMRRNYVLGRMRALGYLDEAAYRQAADAPIAL
FT                   ATTPPPGILAAPYVAERARRMMVERFHDDAYTLGLDVTTTIAMREQRAADAALARGLAQ
FT                   VGRRDAKDALEGALVSIDAATGDILALVGGADFSHNVFDHALQAYRQPGSSFKPFVYSA
FT                   ALEKGMFPGVLIDDTQRTLSRDETGANPWRPRNFGNHYEGFIPVRRGLMRSKNLVAVSL
FT                   MQVARPDFVQQHAARFGFEPLRNPASLPLALGAGSATPLEVASAYGVFANGGVRMEPRL
FT                   IESVRQRHGGALFDAQPAPGVRVISARNAFVMDSMLRDVVAHGTARRAVALKRADAAGK
FT                   TGTSNGSKDVWFAGYSSGVVSVVWMGYDAPRSLGRATGSSAALPVWVDYMKTAVDGRGA
FT                   IERTPPADVALVDGDFVYAEYANGDKCAPSLPPFVRSPFACGAARGAPADGGAPASAAG
FT                   AAGAPTPAAVDAAERARVLELFRTED"
FT   misc_feature    323291..323350
FT                   /note="1 probable transmembrane helix predicted for
FT                   BPSS0238 by TMHMM2.0 at aa 38-57"
FT   misc_feature    323414..323920
FT                   /note="Pfam match to entry PF00912 Transglycosyl,
FT                   Transglycosylase , score 300.6, E-value 1.2e-87"
FT   misc_feature    324149..325051
FT                   /note="Pfam match to entry PF00905 Transpeptidase,
FT                   Penicillin binding protein transpeptidase domain , score
FT                   64.6, E-value 1.4e-16"
FT   CDS_pept        325355..325963
FT                   /transl_table=11
FT                   /locus_tag="BPSS0239"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   hypothetical protein YicG or b3646 or c4470
FT                   SWALL:YICG_ECOLI (SWALL:P31432) (205 aa) fasta scores: E():
FT                   5.6e-29, 42.57% id in 202 aa, and to Vibrio cholerae
FT                   hypothetical protein Vc2115 vc2115 SWALL:Q9KQ86
FT                   (EMBL:AE004285) (207 aa) fasta scores: E(): 1.2e-32, 51.77%
FT                   id in 197 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37685"
FT                   /db_xref="GOA:Q63NR1"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NR1"
FT                   /protein_id="CAH37685.1"
FT                   /translation="MHTLYLIAIVAEAMSGALMGMQRGMDRFGLALVGAVTALGGGTVR
FT                   DVLLGRYPLTWVAHPEYLLLTLAAATFASMTATHVARLKSLFTAVDALGLAAFSIIGCD
FT                   VAAAVNGSPVVIVLAGAITGVCGGMLRDLLCNEMPLVLRKELYASIALLTGGLYVGMKA
FT                   IGAAQGFATVVALAVGFALRMLAVRRGWRLKAFQAADAG"
FT   misc_feature    325355..325612
FT                   /note="Pfam match to entry PF03458 UPF0126, UPF0126 domain
FT                   , score 99.2, E-value 5.2e-27"
FT   misc_feature    order(325364..325417,325436..325495,325538..325597,
FT                   325610..325678,325688..325756,325790..325849,
FT                   325862..325915)
FT                   /note="7 probable transmembrane helices predicted for
FT                   BPSS0239 by TMHMM2.0 at aa 4-21, 28-47, 62-81, 86-108,
FT                   112-134, 146-165 and 170-187"
FT   misc_feature    325613..325882
FT                   /note="Pfam match to entry PF03458 UPF0126, UPF0126 domain
FT                   , score 86.9, E-value 2.7e-23"
FT   CDS_pept        complement(326012..326830)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0240"
FT                   /product="putative hemin ABC transport system, ATP-binding
FT                   protein"
FT                   /note="Similar to Yersinia pestis hemin transport system
FT                   ATP-binding protein HmuV or ypo0279 or y0539
FT                   SWALL:HMUV_YERPE (SWALL:Q56993) (266 aa) fasta scores: E():
FT                   6.3e-13, 45.05% id in 253 aa, and to Bordetella avium BhuV
FT                   SWALL:AAM28272 (EMBL:AY095952) (261 aa) fasta scores: E():
FT                   6.9e-20, 46.64% id in 253 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37686"
FT                   /db_xref="GOA:Q63NR0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63NR0"
FT                   /protein_id="CAH37686.1"
FT                   /translation="MLNADHLHVARDGRAILNDLSIRIAPGCVTALLGRNGAGKSTLLG
FT                   VLAGDLPAGGLARGATVRGGVALNGEPLHAIDAPRLARLRAVLPQASRPAFAFSAREIV
FT                   LLGRYPHARRAGALTHADGEIASQALALAGATALDARDVTTLSGGELARVQFARVLAQL
FT                   WPPPGAAQPPRYLLLDEPTAALDLAHQHQLLDTVRRLSRDWNLGVLTIVHDPNLAARHA
FT                   DRIAMLADGAIVAQGAPADVLRPEPIARCYGFRVRLVDAGDGVAPVIVPA"
FT   misc_feature    complement(326012..333184)
FT                   /note="putative hmu cluster"
FT   misc_feature    complement(326138..326752)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter , score 141.9, E-value 7.2e-40"
FT   misc_feature    complement(326351..326395)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(326708..326731)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(327285..328406)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0241"
FT                   /product="putative hemin ABC transport system, membrane
FT                   protein"
FT                   /note="Similar to Yersinia pestis hemin transport system
FT                   permease protein HmuU or ypo0280 or y0540 SWALL:HMUU_YERPE
FT                   (SWALL:Q56992) (334 aa) fasta scores: E(): 2.6e-43, 45.48%
FT                   id in 343 aa, and to Bordetella avium BhuU SWALL:Q8L1U4
FT                   (EMBL:AY095952) (334 aa) fasta scores: E(): 9.1e-45, 49.41%
FT                   id in 344 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37687"
FT                   /db_xref="GOA:Q63NQ9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NQ9"
FT                   /protein_id="CAH37687.1"
FT                   /translation="MSLAARRHSARPISAERGSTCASRALAALRRRRARWTLAALIAAL
FT                   AAASIAALCIGAYRLSPAQLLGALTATDAQLAGDAALRQARAVLVDIRAPRVVLALFVG
FT                   AGFGAAGAAMQALFRNPLADPGLIGVSSGAALGASALIVLGPLFAARLALGLLPVAAFA
FT                   GALAVAALVYRLAIARGRLALPLLLLAGIAINALAGAGIGLLTYLADDAQLRSLTFWSL
FT                   GSVGGAQWRTIAAVAPFALAGCVLLARERHALNALQLGEAEAMHLGVPVPRVKRRVLVG
FT                   TAMCVGALVSCTGAIGFIGLVAPHCVRLAAGADQRIVMPGAALFGALLAVAADLAARTL
FT                   AAPAEIPLGILTALIGAPFFLALLWKRRGALGG"
FT   misc_feature    complement(327309..328241)
FT                   /note="Pfam match to entry PF01032 FecCD, FecCD transport
FT                   family , score 310.3, E-value 1.5e-90"
FT   misc_feature    complement(order(327312..327371,327408..327461,
FT                   327504..327572,327666..327725,327783..327851,
FT                   327885..327953,327963..328031,328050..328118,
FT                   328227..328295))
FT                   /note="9 probable transmembrane helices predicted for
FT                   BPSS0241 by TMHMM2.0 at aa 38-60, 97-119, 126-148, 152-174,
FT                   186-208, 228-247, 279-301, 316-333 and 346-365"
FT   CDS_pept        complement(328774..329700)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0242"
FT                   /product="putative hemin transport system,
FT                   substrate-binding protein"
FT                   /note="Similar to Yersinia pestis hemin-binding periplasmic
FT                   protein precursor HmuT or ypo0281 or y0541 SWALL:HMUT_YERPE
FT                   (SWALL:Q56991) (279 aa) fasta scores: E(): 2.7e-17, 41.72%
FT                   id in 266 aa, and to Escherichia coli O157:H7 putative
FT                   periplasmic binding protein ChuT or z4913 or ecs4382
FT                   SWALL:Q8X5N7 (EMBL:AE005576) (304 aa) fasta scores: E():
FT                   8.4e-22, 32.97% id in 276 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37688"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NQ8"
FT                   /protein_id="CAH37688.1"
FT                   /translation="MSKPPRIDARRRAWLAGTGALVFAAAHPGAFARAPASAPPKRVVA
FT                   IGGALAETIYALGGARTARYELVGTDTTCTYPEAARRLPKVGYQRALSTEGLLSLRPDV
FT                   VLASAEAGPAAALSQLARAGVAVTTFDEAHDVESVRRKIRGIANALSLQATGDMLLARF
FT                   DRDWLAARAAADAAPPRGRERTPARVLFVLNHTGNQALVAGQQTAADAMIRYAGAHNAM
FT                   QGFDRYKPLTAEALVAAAPDVVLITDEGLQAAGGRDALLAAPGFGATPAGRARRVVSLD
FT                   ALFLLGFGPRLPQAVTALQRRLNSVLA"
FT   misc_feature    complement(328852..329583)
FT                   /note="Pfam match to entry PF01497 Peripla_BP_2,
FT                   Periplasmic binding protein , score 128.7, E-value 6.7e-36"
FT   misc_feature    complement(329605..329664)
FT                   /note="1 probable transmembrane helix predicted for
FT                   BPSS0242 by TMHMM2.0 at aa 13-32"
FT   misc_feature    complement(329605..329700)
FT                   /note="Signal peptide predicted for BPSS0242 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.843 between residues 32 and 33"
FT   CDS_pept        complement(329697..330848)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0243"
FT                   /product="putative hemin ABC transport system-related
FT                   protein"
FT                   /note="Similar to Yersinia pestis hemin transport protein
FT                   HmuS or ypo0282 or y0542 SWALL:HMUS_YERPE (SWALL:Q56990)
FT                   (345 aa) fasta scores: E(): 1.8e-45, 42.2% id in 327 aa,
FT                   and to Ralstonia solanacearum probable hemin transport
FT                   protein rsp0243 or rs03723 SWALL:Q8XT72 (EMBL:AL646077)
FT                   (380 aa) fasta scores: E(): 3.5e-70, 56.7% id in 358 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37689"
FT                   /db_xref="GOA:Q63NQ7"
FT                   /db_xref="InterPro:IPR007845"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NQ7"
FT                   /protein_id="CAH37689.1"
FT                   /translation="MMNTAAPAASPARALAPDELRDAFLHLKETRKLRNRDVAQLLGVS
FT                   EGEALAAFAGERVVRLESSFVELFEEMPRLGGVMALTRNAAAVHEKDGAFEQMSHDGPV
FT                   GLAFGAIDLRIFYRNWAAGFAVYEPTAHGVMKSLQFFDAQGDAVHKVYLRKHSDHAAFD
FT                   AFVSRWRMPVQSPAFAVEPAPPAHVERPDGEIDAAGLRAAWDAMTDTHQFHGVVRRHGV
FT                   SRTQALRLAGASRAHRVATDAARRVLERAAQTRLPIMVFVGNRGMIQIHTGAVTNIRRM
FT                   GTWINVLDEDFNLHLREDLVASAWVVRKPTSDGAVTSVELFDAAGDNIAMLFGARKPGQ
FT                   PELAGWRELAGALPRLDTADAADAATVAHAADVPVATDAGAAR"
FT   CDS_pept        complement(330905..333184)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0244"
FT                   /product="putative exported heme receptor protein"
FT                   /note="Similar to Caulobacter crescentus TonB-dependent
FT                   receptor cc2194 SWALL:Q9A6A0 (EMBL:AE005891) (733 aa) fasta
FT                   scores: E(): 4.5e-100, 41.94% id in 739 aa, and to Vibrio
FT                   mimicus heme receptor precursor MhuA SWALL:Q9AQK5
FT                   (EMBL:AB048382) (710 aa) fasta scores: E(): 1.9e-33, 29.43%
FT                   id in 727 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37690"
FT                   /db_xref="GOA:Q63NQ6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR011276"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NQ6"
FT                   /protein_id="CAH37690.1"
FT                   /translation="MARRPLRAALFGAFGLYAAAARAAGPASEPAAAASAASTSQVRHA
FT                   AIAAARKDAPALDPITVTATRTASAASRTAASVSVITDSDLEEQQADNIKDALRYEPGV
FT                   TVRRTAYRPANAALGGGRDGDSSINIRGLEGNRVLLMEDGIRLPSAFSFGPLEAGRGDY
FT                   ADLDTLARIEILRGPASALYGSDGLTGAVNFITKDPSDLLSIHRKKTYFSFRPSYDSVD
FT                   RSIGATVTAAGGNDRVQAMLIASGRRGHELDTHGDDNSASTRRTRANPQDVYTESLLGK
FT                   LTITPTARDTIKLAAETVRRRIDTNVLSAINPPTTLGLTANDRLERNRFSIDYDLRDAA
FT                   ARGFQTAHVQFYYQESTQDQDAFETRGGRLQSRSRSNHYSERALGGSAFAESGFATGPL
FT                   AHKLLYGVDGSIDRIKSLREGTVASPGESFPNKAFPDTDYSLFGAFVQDQIGFGKLLVT
FT                   PGLRFDAYRLSPSSGDPLFTGKTVSSSDHELSPRVAMLYEVSPALIPYAQYAHGFRTPT
FT                   PDQINNSFSNPIYGYTSIGNPNLKPETSDTLEAGLRGTLGTGYGPLRYSVAAFAGRYRN
FT                   FISQRTVGGSGRPNDPLVFQYVNFANARIHGFEGRAEWVMPNGFTLKTAMAFTKGTTQD
FT                   NGAASEPLDTVNPFSAVFGVRYEPSERWFAQADLLWQAGKRGRDVSSAACQKKTCFTPP
FT                   SSFVVDLRGGYRFNKHVSAYLGIHNLFDRKYWNWSDVRGIAADSNVLDAYTAPGRSVAV
FT                   SMKVDF"
FT   misc_feature    complement(330908..331264)
FT                   /note="Pfam match to entry PF00593 TonB_boxC, TonB
FT                   dependent receptor C-terminal region , score 63.9, E-value
FT                   2.3e-16"
FT   misc_feature    complement(333116..333184)
FT                   /note="Signal peptide predicted for BPSS0244 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.852 between residues 23 and 24"
FT   CDS_pept        complement(333659..333886)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0245"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37691"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NQ5"
FT                   /protein_id="CAH37691.1"
FT                   /translation="MNVQTLSGVLHAQELLFVSLIRVLPLETRQALADEFDRQIQLAET
FT                   SRLEAPHDREAHDAFLAHVRKLLIRLESMA"
FT   CDS_pept        complement(334048..334944)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0246"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 glycine cleavage system
FT                   transcriptional activator GcvA or b2808 or c3378 or z4125
FT                   or ecs3668 SWALL:GCVA_ECOLI (SWALL:P32064) (305 aa) fasta
FT                   scores: E(): 7.3e-26, 32.88% id in 298 aa, and to
FT                   Pseudomonas aeruginosa probable transcriptional regulator
FT                   pa0448 SWALL:Q9I670 (EMBL:AE004482) (302 aa) fasta scores:
FT                   E(): 2.3e-33, 37.07% id in 294 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37692"
FT                   /db_xref="GOA:Q63NQ4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NQ4"
FT                   /protein_id="CAH37692.1"
FT                   /translation="MKHLYPNVAELHAFASSAKHLNFSYAARELGLTPSAVSRQIASLE
FT                   ALLGVKLFVREGRNLALTRAGQVYQARVAGPLREIGNASLELLSAREDSNLLTIASVPT
FT                   FTTKWLVPRLPRFLETAPDITLSFRRHLAPGDLFPLGLDAAIRYGDGRWEGVQCDYLDG
FT                   RTFVPVCAPGFAERHALREPADIAAAPRLVHEQAECAWLAWADRHRATQMNALAGPRFE
FT                   QYSVLIQAAQAGLGIALIPAFLIRAPLAAGTLVQPLDAPVDVDEQSHYLCYAPERLQAS
FT                   ASLRLLREWMLAECACA"
FT   misc_feature    complement(334057..334677)
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain , score 117.2, E-value 2e-32"
FT   misc_feature    complement(334744..334923)
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family , score
FT                   87.5, E-value 1.7e-23"
FT   misc_feature    complement(334789..334881)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(334819..334884)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2037.000, SD 6.12 at aa 21-42, sequence
FT                   LNFSYAARELGLTPSAVSRQIA"
FT   CDS_pept        335111..335959
FT                   /transl_table=11
FT                   /locus_tag="BPSS0247"
FT                   /product="putative ABC transport system, membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa probable permease
FT                   of ABC transporter pa3253 SWALL:Q9HYY7 (EMBL:AE004747) (265
FT                   aa) fasta scores: E(): 2.2e-19, 29.32% id in 266 aa, and to
FT                   Ralstonia solanacearum probable permease transmembrane ABC
FT                   transporter protein rsc1793 or rs04192 SWALL:Q8XYG5
FT                   (EMBL:AL646066) (265 aa) fasta scores: E(): 1e-14, 28.15%
FT                   id in 238 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37693"
FT                   /db_xref="GOA:Q63NQ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NQ3"
FT                   /protein_id="CAH37693.1"
FT                   /translation="MRSSTTAGFAGGIPFRRGKRRPSFGAIVVNGVVALFALYLLMPIV
FT                   LLLIGSIGQSWTNTLLPAGFTWRWFAELAADPSLRRAFGVSFVVALACCALDTLAGVPL
FT                   AYALHHRALRGRGVAARVVMLTPIGVPALTLGFGYIVVFGGDALPWLGTLPLMIAAHAV
FT                   LTLPYLLQTLLSDLRHLDLAKLEACAATLGAPPLRQFFTIVLPNLRQSLFSGLVMVAAL
FT                   SIGEFQVSNLIAGFRYRNFPVVLLQAFYGASGIACAASVVLLLLAVLATLASTHTVQRL
FT                   K"
FT   misc_feature    order(335240..335308,335366..335434,335471..335539,
FT                   335552..335620,335741..335809,335852..335920)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPSS0247 by TMHMM2.0 at aa 3-25, 45-67, 80-102, 107-129,
FT                   170-192 and 207-229"
FT   misc_feature    335567..335599
FT                   /note="PS00435 Peroxidases proximal heme-ligand signature."
FT   misc_feature    335636..335860
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component , score 23.1, E-value 0.00032"
FT   CDS_pept        335964..337007
FT                   /transl_table=11
FT                   /locus_tag="BPSS0248"
FT                   /product="putative ABC transport system, ATP-binding
FT                   protein"
FT                   /note="Similar to Rhizobium loti ABC transporter,
FT                   ATP-binding protein mll2948 SWALL:Q98HB1 (EMBL:AP003000)
FT                   (371 aa) fasta scores: E(): 8.1e-41, 43.31% id in 314 aa,
FT                   and to Alicyclobacillus acidocaldarius putative
FT                   ABC-transporter ATP-binding protein CysA SWALL:Q9RHZ7
FT                   (EMBL:AJ252160) (393 aa) fasta scores: E(): 1.4e-37, 46.1%
FT                   id in 295 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37694"
FT                   /db_xref="GOA:Q63NQ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NQ2"
FT                   /protein_id="CAH37694.1"
FT                   /translation="MSLEFDNVSFRYPGGAHGVDAVTLHAQPGELLAVIGRSGSGKSTL
FT                   LRLSAGLLDGYAGRIAIGGADMAGVPVWRREVGMVFQQYALFPHLSVADNVAYGLRMRG
FT                   VATAERRRRALEMLERVGLAAHAARSTTQLSGGQQQRVALARALVIEPALLLLDEPLAA
FT                   LDAGIRHQLRDEIRALQRACRATTLFVTHDQDEALSMADRVAIVDGGRVLQVGTPRSLY
FT                   ERPVSAQVARFIGHSTILRGRVQAGGTIDVRFATLCADTGAHRPGAEVDVLVRPEHVEP
FT                   DPPAQCVNRIEGALGEVRYFGATHRYDFLPHGAAHPLLCEGRVLAARGVAIEPRHLLVL
FT                   PASGGAR"
FT   misc_feature    336048..336593
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter , score 229.2, E-value 3.9e-66"
FT   misc_feature    336069..336092
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    336363..336407
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        337034..338122
FT                   /transl_table=11
FT                   /locus_tag="BPSS0249"
FT                   /product="putative ABC transport system, substrate-binding
FT                   exported protein"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   solute-binding periplasmic rsc1791 or rs04190 SWALL:Q8XYG7
FT                   (EMBL:AL646066) (343 aa) fasta scores: E(): 1.5e-37, 37.27%
FT                   id in 330 aa, and to Campylobacter jejuni putative
FT                   periplasmic solute-binding protein cj0727 SWALL:Q9PPI0
FT                   (EMBL:AL139076) (348 aa) fasta scores: E(): 8.9e-28, 31.05%
FT                   id in 351 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37695"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NQ1"
FT                   /protein_id="CAH37695.1"
FT                   /translation="MSENRPLLTALRRAALAFGMCATLVANGASAEPLYAGEDALYAKA
FT                   ADEGLVVSFDTGPEWANWKALFAAFRKRYPKVELTYNDIGSAATVVALDKSRRRPQADT
FT                   AYYFAASALDAAGKDVVAPFKPVNFDKLPPVFREADGRWFTVHSLNVAFLVNRKLVKNV
FT                   PRRWSDLLKPEYRNAVVYLDPRSTGQGQVVVFAAASALGGGVDDPKPGAEFFGKLKHAG
FT                   NVLRIEGTTPYAKFVKGEIPILIGYENDGLKAKYADGLGDAVDVVIPQDGSVCAPYAMS
FT                   LVKNGPNPAAAQLWLNFVMSDAGQALFAHGYVRPAVPGVALAPDVAAKMPNAPQVRALD
FT                   VAKAAARKAEVDRLWSQAALGQ"
FT   misc_feature    337034..337126
FT                   /note="Signal peptide predicted for BPSS0249 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.999) with cleavage site
FT                   probability 0.894 between residues 41 and 42"
FT   misc_feature    337196..338101
FT                   /note="Pfam match to entry PF01547 SBP_bac_1, Bacterial
FT                   extracellular solute-binding protein , score 45.7, E-value
FT                   6.9e-11"
FT   CDS_pept        338112..338960
FT                   /transl_table=11
FT                   /locus_tag="BPSS0250"
FT                   /product="putative ABC transport system, membrane protein"
FT                   /note="Similar to Ralstonia solanacearum probable transport
FT                   system permease transmembrane ABC transporter protein
FT                   rsc1792 or rs04191 SWALL:Q8XYG6 (EMBL:AL646066) (282 aa)
FT                   fasta scores: E(): 4.9e-17, 35.03% id in 254 aa, and to
FT                   Agrobacterium tumefaciens ABC transporter, membrane
FT                   spanning protein atu2148 or agr_c_3892 SWALL:Q8UDH7
FT                   (EMBL:AE009165) (331 aa) fasta scores: E(): 3.4e-15, 31.53%
FT                   id in 260 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37696"
FT                   /db_xref="GOA:Q63NQ0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NQ0"
FT                   /protein_id="CAH37696.1"
FT                   /translation="MASKERDVQRSFLERSLLRRFGAAPAGGLLALFFVLPLAALVSAA
FT                   FAEGGRAFAAVLHDPLVGDAIGRSLALAVGTGTLSTCVGVPLALSFAEQPPARRRWLLA
FT                   LLGVPLAFSGLVIAYGFILTFGRAGFVTTLLAGLGADAAKVGGVIYTTFGLVVAYAYYL
FT                   IPRVALMLFPAFANLERRPLEAAMSLGAKPWRAWLDVAWRELWPSVMAAWCLVTAIALG
FT                   TYGTALALAGTQINILPLLMYLKLSDGQTDFSQAAVLSIVLTALCTCVLAMGEYVGRRH
FT                   R"
FT   misc_feature    order(338172..338240,338316..338384,338418..338486,
FT                   338544..338603,338748..338816,338874..338942)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPSS0250 by TMHMM2.0 at aa 21-43, 69-91, 103-125, 145-164,
FT                   213-235 and 255-277"
FT   CDS_pept        338974..339486
FT                   /transl_table=11
FT                   /locus_tag="BPSS0251"
FT                   /product="Lysine decarboxylase family protein"
FT                   /note="C-terminal region is similar to Methanosarcina mazei
FT                   hypothetical protein mm3075 SWALL:Q8PSK4 (EMBL:AE013563)
FT                   (156 aa) fasta scores: E(): 3.9e-14, 43.38% id in 136 aa,
FT                   and Aquifex pyrophilus hypothetical protein SWALL:AAN12294
FT                   (EMBL:AY135660) (150 aa) fasta scores: E(): 1.4e-12, 38.62%
FT                   id in 145 aa. Possible alternative start codon at codon 20"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37697"
FT                   /db_xref="InterPro:IPR005268"
FT                   /db_xref="InterPro:IPR041164"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NP9"
FT                   /protein_id="CAH37697.1"
FT                   /translation="MADALARVALRQQGPRRHLMPVGLIGPRDATGEQLRIAEGVARAL
FT                   AATGLVIVGGGKGGVMEAAARGARRANGLVIGLLPEDDAGGANPHLSVALPTGLGITRN
FT                   ALIARASLCLVAVGGGLGTLSEIALGLQWGKPVFTICDAPQVTGVENFDAPDRLLARVA
FT                   QWLADSA"
FT   misc_feature    339154..339354
FT                   /note="Pfam match to entry PF03641 Lysine_decarbox, Lysine
FT                   decarboxylase family , score 19.1, E-value 7.1e-06"
FT   CDS_pept        339553..340752
FT                   /transl_table=11
FT                   /locus_tag="BPSS0252"
FT                   /product="putative porin membrane protein"
FT                   /note="Similar to Ralstonia solanacearum probable porin
FT                   transmembrane protein rsc1082 or rs04105 SWALL:Q8Y0G2
FT                   (EMBL:AL646062) (394 aa) fasta scores: E(): 3.1e-44, 43.06%
FT                   id in 404 aa, and to Bordetella pertussis outer membrane
FT                   porin protein precursor SWALL:OMP_BORPE (SWALL:Q04064) (385
FT                   aa) fasta scores: E(): 3.1e-20, 34.18% id in 392 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37698"
FT                   /db_xref="GOA:Q63NP8"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NP8"
FT                   /protein_id="CAH37698.1"
FT                   /translation="MKKAAAAWLVAGSMCAGAHAQGTVTLYGIVDAGLGYTSDQRVAQT
FT                   KGALGSPVGYRNESSYGFASGTWSGSRWGLKGKEELGGGLAAVFQLENGFNIGTGQAGQ
FT                   GGRMFGRQAWMGLSSERYGTLTMGRQYDPIVDFVGTIGAGAFLTGMGAHPGDLDNIDNQ
FT                   ARENNSIKYVSPKFGGLALGALYGFGNQAGSVKNQNTWSVGGQYVNGPFSLGAAYLYAT
FT                   NAYGANGGAWTGSYDGTFASSINEGFASAKSMQIVAAASTYQIGAVTLGLSYSNTRYKS
FT                   GAFSTFNGTATYNSIGGTVSWQATPELRVAAGYDFTRGSSIDGQSAPKYHQVNFASYYY
FT                   LSKRTALYGLVGYQKASGKTLDAYGNVVAATASVGDVGNGISSAGDTQTLVRIGVRHTF
FT                   "
FT   misc_feature    339673..340749
FT                   /note="Pfam match to entry PF00267 Gram-ve_porins,
FT                   Gram-negative porin , score -51.1, E-value 0.0003"
FT   CDS_pept        complement(340812..341774)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0253"
FT                   /product="putative DNA-binding protein"
FT                   /note="Similar to Pasteurella multocida hypothetical
FT                   protein pm1646 SWALL:Q9CKH2 (EMBL:AE006201) (317 aa) fasta
FT                   scores: E(): 1.2e-59, 52.68% id in 317 aa, and to Bacillus
FT                   halodurans transcriptional regulator bh0780 SWALL:Q9KER9
FT                   (EMBL:AP001509) (316 aa) fasta scores: E(): 1.7e-24, 29.83%
FT                   id in 305 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37699"
FT                   /db_xref="GOA:Q63NP7"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NP7"
FT                   /protein_id="CAH37699.1"
FT                   /translation="MTNEELTQLAKCYYIDGLTQEELAQKFAISRPKVGRLLKRAIEEG
FT                   IVEIRVRHHPRAVQDLEQELVTRFGIQRAIISVDHKDQDSQRELLAGLVASYLDRVLAD
FT                   GAIVAVGMGRNVSAVSRHAVSTTQRNCSFVSAIGGSYRGGETMNADHICRRLAARFGGE
FT                   SETLYAPALVNDPQLFTALLENDVVRQSLDKARRASIALVGIGDILEDSNMVRMGWFTP
FT                   EEMAEAKRAGAVGDIMGYDFIDIHGRPATTMLHGRVIGLTLEDLKRIPNVIATASEPTK
FT                   ATGILGALRAGVINTLATTQSIAQTVLSLAQATETASAA"
FT   misc_feature    complement(341658..341723)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1806.000, SD 5.34 at aa 18-39, sequence
FT                   LTQEELAQKFAISRPKVGRLLK"
FT   CDS_pept        complement(341809..342303)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0254"
FT                   /product="putative ribose 5-phosphate isomerase"
FT                   /note="Similar to Escherichia coli ribose 5-phosphate
FT                   isomerase B RpiB or b4090 SWALL:RPIB_ECOLI (SWALL:P37351)
FT                   (149 aa) fasta scores: E(): 5.9e-21, 46.62% id in 148 aa,
FT                   and to Yersinia pestis ribose 5-phosphate isomerase B RpiB
FT                   or ypo3353 or y0837 SWALL:AAM84422 (EMBL:AJ414156) (151 aa)
FT                   fasta scores: E(): 1.7e-28, 55.4% id in 148 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37700"
FT                   /db_xref="GOA:Q63NP6"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NP6"
FT                   /protein_id="CAH37700.1"
FT                   /translation="MKVAIGCDEAAYALKESIKRHLRATHPELELVDFGTHSADEAVLY
FT                   PDIAIEVAQRVAAGEFPRAILLCGTGIGVAISANKVPGIRAAQCHDTYSAERARRSNDA
FT                   QIVTMGARVIGTELANSIVDAWLRAEFDGGRSQPKVQRIADYERRAGLTQAGPNDAHRG
FT                   S"
FT   misc_feature    complement(341872..342114)
FT                   /note="Pfam match to entry PF02502 LacAB_rpiB,
FT                   Ribose/Galactose Isomerase , score 163.1, E-value 3e-46"
FT   CDS_pept        342542..344059
FT                   /transl_table=11
FT                   /locus_tag="BPSS0255"
FT                   /product="putative ribose ABC transport system, ATP-binding
FT                   protein"
FT                   /note="Similar to Escherichia coli ribose transport
FT                   ATP-binding protein RbsA or b3749 SWALL:RBSA_ECOLI
FT                   (SWALL:P04983) (501 aa) fasta scores: E(): 2.6e-60, 40.89%
FT                   id in 494 aa, and to Yersinia pestis sugar transport
FT                   ATP-binding protein ypo0858 SWALL:Q8ZHN2 (EMBL:AJ414145)
FT                   (502 aa) fasta scores: E(): 1.6e-74, 48.77% id in 490 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37701"
FT                   /db_xref="GOA:Q63NP5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NP5"
FT                   /protein_id="CAH37701.1"
FT                   /translation="MSKSSVTLRDTTVTPVLLEASQVAKRFNGVSALRDGRLSLAAGRV
FT                   HALCGGNGTGKSTFLNILMGLLRRDEGTIRLNGRDVDFASPAEALASRMAIITQELSPV
FT                   PGMTVAENLYLGREPTRAGVVVDFRALKRRAQALLDRLGFAIDAGAPMHRLSLAQTQLV
FT                   EIAKAFSHDCQVMIMDEPTSAIGERETETLFAAVRNVTAHGAGIIYVSHRLSELFDIAD
FT                   DYTVFRDGAYVESGRLADIDRAHLVRAIVGREMPVVDKARRPAHGEPCLKVEGLTRANE
FT                   FEDVSLDVRRGEILGIYGLMGSGRSEFLNCVYGLTRPDAGAATLGGKPLPHGEPARSIR
FT                   AGIALVTEDRKDSGLVLCGSVQENIAMAAYRRLSRGGVIRRSLVRRLAQAMVERLRIKA
FT                   ASLRMPVSAMSGGNQQKVVLAKCLSTAPVLLLCDEPTRGIDEGAKQEIYRLLDAFARDG
FT                   GAVIVVSSEAPELLYLSDRIAVFKGGRVAAVRPGDGATQESLLHLAS"
FT   misc_feature    342668..343231
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter , score 157.1, E-value 2e-44"
FT   misc_feature    342689..342712
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    343415..343993
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter , score 113.8, E-value 2.1e-31"
FT   misc_feature    343766..343810
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        344068..345045
FT                   /transl_table=11
FT                   /gene="rbsC"
FT                   /locus_tag="BPSS0256"
FT                   /product="putative ABC ribose transport system, permease
FT                   protein"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 ribose transport system
FT                   permease protein RbsC or b3750 or c4678 or z5251 or ecs4692
FT                   SWALL:RBSC_ECOLI (SWALL:P04984) (321 aa) fasta scores: E():
FT                   1.3e-45, 53.31% id in 302 aa, and to Salmonella
FT                   typhimurium, and Salmonella typhi ABC superfamily stm3883
FT                   or sty3895 SWALL:Q8XFM3 (EMBL:AE008881) (321 aa) fasta
FT                   scores: E(): 5.1e-46, 53.97% id in 302 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37702"
FT                   /db_xref="GOA:Q63NP4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NP4"
FT                   /protein_id="CAH37702.1"
FT                   /translation="MNTQTLSRLDAAPRRVNVAELASRFGIPIVFVALCVVLAFASPYF
FT                   LTWRNWSDILRQTSINGILAIGMTYVILTKGIDLSVGSVLALAGIVSGLAGAAGHGLAV
FT                   SLAAGVACGAALGAINGVAIARLNVPPFVATLGMLSVARGVTYIANDGSPVANLPDDYL
FT                   SLGIGRLGPLGMPVLIFAGVALACWWVLRYTTYGRYLYAVGGNEKSARTSGIGVRKVVF
FT                   SVYVVSGALAGLAGMILAARTTSALPQAGVSYELDAIAAVVIGGTSLSGGQGGVVGTLF
FT                   GALLIGVINNGLNLLGVSSYYQQIAKGLIIVLAVLIDVARKQQR"
FT   misc_feature    344110..345036
FT                   /note="Pfam match to entry PF02653 BPD_transp_2,
FT                   Branched-chain amino acid transport system / permease
FT                   component , score -45.1, E-value 0.00012"
FT   misc_feature    order(344140..344208,344236..344289,344302..344361,
FT                   344374..344442,344461..344514,344572..344640,
FT                   344725..344793,344893..344961)
FT                   /note="8 probable transmembrane helices predicted for
FT                   BPSS0256 by TMHMM2.0 at aa 29-51, 61-78, 83-102, 107-129,
FT                   136-153, 173-195, 224-246 and 280-302"
FT   CDS_pept        345077..346105
FT                   /transl_table=11
FT                   /locus_tag="BPSS0257"
FT                   /product="putative ribose ABC transport system,
FT                   substrate-binding exported protein"
FT                   /note="Similar to Escherichia coli D-ribose-binding
FT                   periplasmic protein precursor RbsB or RbsP or PrlB or b3751
FT                   SWALL:RBSB_ECOLI (SWALL:P02925) (296 aa) fasta scores: E():
FT                   4.1e-13, 28.18% id in 298 aa, and to Brucella melitensis
FT                   D-ribose-binding periplasmic protein precursor bmei0393
FT                   SWALL:Q8YIQ0 (EMBL:AE009482) (325 aa) fasta scores: E():
FT                   6.3e-54, 51.09% id in 321 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37703"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NP3"
FT                   /protein_id="CAH37703.1"
FT                   /translation="MQTRKTWFGRFAAAAALGATLAIAAAGSAAHAASGPYRIGAAVYG
FT                   MKGQFMQNWVREIKAHPAVKSGAVQLTVFDGNYDALTQNNQIETMLTQQYSGILFVPID
FT                   TKAGIGVAARAGASDTPLVASNTMLATPKVPYIGNDDVEGGRLQAEALARRIGGKGNVV
FT                   IIQGPIGQSAQIDREKGEMEVLAKYPGIKVIEKKTANWSRAEAMNLMEDWLNAHPKQIN
FT                   GVIAQNDDMALGALQAIKNRGLTPKDIPITSIDGMPDAIQAAKRGEITTFLQDAQAQSQ
FT                   GALDLVLRQLVGAGYKPQSVIWQRYAKDLKWDGGTAKRYILPWVPVTPANADQLYKQVT
FT                   GG"
FT   misc_feature    345077..345172
FT                   /note="Signal peptide predicted for BPSS0257 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.996 between residues 32 and 33"
FT   misc_feature    345182..346018
FT                   /note="Pfam match to entry PF00532 Peripla_BP_like,
FT                   Periplasmic binding proteins and sugar binding domain of
FT                   the LacI family , score -15.6, E-value 0.00015"
FT   CDS_pept        346117..346887
FT                   /transl_table=11
FT                   /locus_tag="BPSS0258"
FT                   /product="putative dehydrogenase"
FT                   /note="Similar to Escherichia coli 2-deoxy-D-gluconate
FT                   3-dehydrogenase KduD or b2842 SWALL:KDUD_ECOLI
FT                   (SWALL:P37769) (253 aa) fasta scores: E(): 9.3e-24, 37.45%
FT                   id in 251 aa, and to Yersinia pestis putative dehydrogenase
FT                   ypo3351 or y0839 SWALL:Q8ZBQ6 (EMBL:AJ414156) (256 aa)
FT                   fasta scores: E(): 1.7e-39, 52.17% id in 253 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37704"
FT                   /db_xref="GOA:Q63NP2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NP2"
FT                   /protein_id="CAH37704.1"
FT                   /translation="MTNLWDRAFDLTGRVALVTGGAAGIGHACARLLAQRGASVALVDR
FT                   HPETAGIAAKLEGGAARHSGMSLDLRDCSAAQAGVALAASRFGGVDMLVNSAGVALLDK
FT                   ALDVGEAAWDATMAINVKASFFVAQAAARQMIAGARGGRIVNLASQASVVGLERHAAYC
FT                   ASKAAIVGMTKALALEWAPHGITVNAVSPTIVETALGKQAWAGEAGERAKREIPAGRFA
FT                   QPDEIAALVLYLLSDAAAMMTGENVVIDGGYTVR"
FT   misc_feature    346150..346875
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase , score 265.1, E-value 5.9e-77"
FT   misc_feature    346561..346647
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   CDS_pept        346953..348089
FT                   /transl_table=11
FT                   /locus_tag="BPSS0259"
FT                   /product="putative dehydrogenase"
FT                   /note="Similar to Pseudomonas putida 2,3-butanediol
FT                   dehydrogenase Adh SWALL:Q59696 (EMBL:L35343) (362 aa) fasta
FT                   scores: E(): 2.8e-32, 32.12% id in 358 aa, and to Yersinia
FT                   pestis putative zinc-binding dehydrogenase ypo3352
FT                   SWALL:Q8ZBQ5 (EMBL:AJ414156) (371 aa) fasta scores: E():
FT                   7.9e-88, 61.51% id in 356 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37705"
FT                   /db_xref="GOA:Q63NP1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NP1"
FT                   /protein_id="CAH37705.1"
FT                   /translation="MPQTAEAPPQRAAERGETPALPATMRAVVCHGPQDYRLEQVPVPK
FT                   PGPDEILTQVERVGICMGDIKTFRGAPSFWGDAVQPRYVKPPMIPGHEFVCRVVALGPG
FT                   AERRGVKAGDRVISEQIVPCWSCRFCGHGQYWMCQKHDLYGFQNNVHGAMAEYMIFTKE
FT                   AIVHRVPDSIPTDEAILIEPLSCSLHAADRANVGFDDVVVVAGAGTLGLGIIGAVRLRH
FT                   PKQLIVLDMKPERAALARRMGADDVWNPAEENVIEKIRAITGGYGCDIYIEATGHHRAV
FT                   GQGLAMLRKLGRFVEFSVFNDEASVDWSIIGDRKELDVLGSHLGPYMYPRAIEFIASRR
FT                   IDVRGIVTHTFPLSRFADAFAVMERGEQSLKVVLDPRG"
FT   misc_feature    347040..348080
FT                   /note="Pfam match to entry PF00107 adh_zinc, Zinc-binding
FT                   dehydrogenase , score 246.5, E-value 2.5e-71"
FT   CDS_pept        348094..349098
FT                   /transl_table=11
FT                   /locus_tag="BPSS0260"
FT                   /product="putative kinase"
FT                   /note="Similar to Yersinia pestis putative dihydroxyacetone
FT                   kinase DhaK or ypo3350 SWALL:Q8ZBQ7 (EMBL:AJ414156) (333
FT                   aa) fasta scores: E(): 2.1e-72, 62.72% id in 330 aa, and to
FT                   Selenomonas ruminantium subsp. ruminantium dihydroxyacetone
FT                   kinase DhaK1 SWALL:Q93PV9 (EMBL:AF297121) (329 aa) fasta
FT                   scores: E(): 2.6e-45, 43.3% id in 321 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37706"
FT                   /db_xref="GOA:Q63NP0"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NP0"
FT                   /protein_id="CAH37706.1"
FT                   /translation="MNRVINHPDYVVEDMLRGIVAAHPALALDADNPRVIGVAHPVPGK
FT                   VGVVTGGGSGHEPAFVGYTGPGLVDAVAIGEIFSSPTAKSFLDAFRRADRGAGVACLYG
FT                   NYAGDNMNVKMAIKMAAAQGIDVKTVVANDDVASAPREERAKRRGVAGEILMWKAGGAR
FT                   AAAGGDLDAVIASAKKAIDNTRSVGIGLSACTIPANGKANFHIADGEMEVGIGHHGEHG
FT                   VRVMRTVSAKDMAAMMLDIVLPDFPLERGEEVAVLVSGLGATPLMEQYILYAEVSQRLA
FT                   AAGLKIGFRLVGNLFTSLEMMGVTLTVTRLDDELKQLFAAPCSSIGLTVGERA"
FT   misc_feature    348121..349089
FT                   /note="Pfam match to entry PF02733 Dak1, Dak1 domain ,
FT                   score 259.4, E-value 3.2e-75"
FT   CDS_pept        349095..349754
FT                   /transl_table=11
FT                   /locus_tag="BPSS0261"
FT                   /product="putative kinase"
FT                   /note="Similar to the plasmid-borne Rhizobium meliloti
FT                   putative dihydroxyacetone kinase protein rb0299 or smb20313
FT                   SWALL:Q92WN3 (EMBL:AL603643) (213 aa) fasta scores: E():
FT                   5.6e-36, 54.93% id in 213 aa, and to Selenomonas
FT                   ruminantium subsp. ruminantium dihydroxyacetone kinase
FT                   DhaK2 SWALL:Q9F677 (EMBL:AF297121) (207 aa) fasta scores:
FT                   E(): 1.2e-19, 37.18% id in 199 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37707"
FT                   /db_xref="GOA:Q63NN9"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NN9"
FT                   /protein_id="CAH37707.1"
FT                   /translation="MNTAAIQCLPLADAGFVVRELVDVIRRNRDHLSEIDAAIGDGDHG
FT                   INMSKGFGQCGARLDARGATSLPDALDVLSTALMDGIGGSMGPLYGSFFMDFAAPLKGR
FT                   DTLDAALFGEALAAGFAGVQAISDAKIGDKTLIDTLAPAAAAFHEALRAGDDFRHALAA
FT                   MSAAAERGKESTRWLQARVGRASRLGERSVGTLDAGAASCCLILCSLASSIGARLN"
FT   misc_feature    349203..349730
FT                   /note="Pfam match to entry PF02734 Dak2, DAK2 domain ,
FT                   score 97.4, E-value 1.8e-26"
FT   CDS_pept        complement(349788..350261)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0262"
FT                   /product="putative aminoglycoside 6'-N-acetyltransferase"
FT                   /note="Similar to Salmonella typhi aminoglycoside
FT                   6'-N-acetyltransferase Aac or sty1445 SWALL:Q8Z762
FT                   (EMBL:AL627270) (172 aa) fasta scores: E(): 4.6e-23, 49.65%
FT                   id in 145 aa, and to Enterobacter aerogenes aminoglycoside
FT                   N AacA7 SWALL:AAC6_ENTAE (SWALL:P50858) (152 aa) fasta
FT                   scores: E(): 9.3e-17, 43.91% id in 148 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37708"
FT                   /db_xref="GOA:Q63NN8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024170"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NN8"
FT                   /protein_id="CAH37708.1"
FT                   /translation="MTHPAALFKIRAAQASDAAAWRQLRRALWPHADDIEHARDIARQL
FT                   DAPARHACFIASPPGILAPVGFAEVAVRHDDVNGCGASPVLFLEGVFVEPAARRRGVAR
FT                   ALCAAAAAWGTARGCAAFASDAPLENAASHALHRALGFDETERVVFFRKPLAR"
FT   misc_feature    complement(349833..350081)
FT                   /note="Pfam match to entry PF00583 Acetyltransf,
FT                   Acetyltransferase (GNAT) family , score 51.3, E-value
FT                   1.3e-12"
FT   CDS_pept        complement(350258..350713)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0263"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37709"
FT                   /db_xref="GOA:Q63NN7"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NN7"
FT                   /protein_id="CAH37709.1"
FT                   /translation="MRRRVPFTRRSNLLRCAFSIRTHLMENAFNERGVMVTRNGLSAAG
FT                   QIFALREIRGVEVRTVRKNKLVPCAISLTGAAAAIAGGALGSSALLVAGVMLVVVGYLA
FT                   WTTQDVTHRLIVDMPDGKREAIMSVDREFVERVAHAVDAARAAGAST"
FT   misc_feature    complement(order(350396..350449,350459..350518))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPSS0263 by TMHMM2.0 at aa 66-85 and 89-106"
FT   CDS_pept        complement(351133..351393)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0264"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37710"
FT                   /db_xref="InterPro:IPR021294"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NN6"
FT                   /protein_id="CAH37710.1"
FT                   /translation="MVEDTVFSGLRTLLTHEHAFPVQSCRVSIEMQRPWGRPYRLVEWT
FT                   MHLDAPARRRIVPAESTEAEIAEAVASHVPGRLYEGGAALY"
FT   CDS_pept        complement(351601..352749)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0265"
FT                   /product="putative porin-related protein"
FT                   /note="Similar to Bordetella pertussis outer membrane porin
FT                   protein precursor SWALL:OMP_BORPE (SWALL:Q04064) (385 aa)
FT                   fasta scores: E(): 1.1e-21, 33.58% id in 405 aa, and to
FT                   Ralstonia solanacearum probable porin signal peptide
FT                   protein rsp0051 or rs02026 SWALL:Q8XTQ5 (EMBL:AL646076)
FT                   (382 aa) fasta scores: E(): 1.6e-34, 39.75% id in 405 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37711"
FT                   /db_xref="GOA:Q63NN5"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NN5"
FT                   /protein_id="CAH37711.1"
FT                   /translation="MNKKLLTTAILAATASAAHAQSSVTLYGLIDAGVSYVNHSKSASG
FT                   SDKLFKYDDGIAQGSRWGLRGAEDLGGGLKAIFVLENGFNSGNGTIGQGGAIFGRQAYV
FT                   GLSHKDAGTLTFGRQYSFTTDILGANYSTGGNTVAGNYAYHVNDIDQLTSSRINNAVKF
FT                   QSANYAGFTFGALYGFSNSTSFAGAPATTTGTTTTPGSSRAYSFGLNYANGPIGLGAAY
FT                   TDIRYPSQATPAFTTNIANLTISNVRDLRSFGVGGRYIWGPATLWALWTNTRLEPVTGG
FT                   STTYNAYEAGGKYAFTTALSAGVGYTYSRVSGANSGHWNQVNGALDYALSKRTDVYLLA
FT                   IYQEASGKNLQAQIGSSTSYFNTSGTGSKNQFAARVGIRHKF"
FT   misc_feature    complement(351604..352656)
FT                   /note="Pfam match to entry PF00267 Gram-ve_porins,
FT                   Gram-negative porin , score -40.6, E-value 0.00012"
FT   misc_feature    complement(352495..352521)
FT                   /note="PS00572 Glycosyl hydrolases family 1 active site."
FT   misc_feature    complement(352690..352749)
FT                   /note="Signal peptide predicted for BPSS0265 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.997 between residues 20 and 21"
FT   CDS_pept        353062..353862
FT                   /transl_table=11
FT                   /locus_tag="BPSS0266"
FT                   /product="putative exported protein"
FT                   /note="Similar to Ralstonia solanacearum probable signal
FT                   peptide protein rsc0922 or rs04493 SWALL:Q8Y0X1
FT                   (EMBL:AL646061) (266 aa) fasta scores: E(): 4.7e-57, 62.54%
FT                   id in 259 aa, and to Brucella melitensis ABC transporter
FT                   substrate binding protein bmei1954 SWALL:Q8YEC4
FT                   (EMBL:AE009628) (268 aa) fasta scores: E(): 7.2e-42, 46% id
FT                   in 263 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37712"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NN4"
FT                   /protein_id="CAH37712.1"
FT                   /translation="MTSIIRRVAGGAVWALAATLAHAGGPALKIGTMSGPDAQIWAEVT
FT                   KVAARDGLAIKVIEFNDYVQPNAALDAGDLDANGFQHQPFLDSQIRQRGYRIVNVGLTY
FT                   TSPMGFYSKRLKSLKDLPVGAKVGIQNDPSNGNRALLLLQKYGIVKLKPGAGVNGVNAT
FT                   PLDVAENPRKIRLVELDAAQLPRALPDLDAASINTDYAVKAGLSPVKDAIAIEDLKGPY
FT                   ANLIAVRAQDKDKPWVKKLVAAYESNDVRKFIETKFNGAIIPAF"
FT   misc_feature    353062..353130
FT                   /note="Signal peptide predicted for BPSS0266 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 23 and 24"
FT   misc_feature    353140..353859
FT                   /note="Pfam match to entry PF03180 Lipoprotein_9, NLPA
FT                   lipoprotein , score 401.9, E-value 4.1e-118"
FT   CDS_pept        complement(354335..355450)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa arginine/ornithine
FT                   transport operon protein Aot AotO or pa0891 SWALL:O50184
FT                   (EMBL:AF012537) (370 aa) fasta scores: E(): 1.3e-51, 43.39%
FT                   id in 371 aa, and to Rhizobium loti hypothetical protein
FT                   mlr2771 SWALL:Q98HP7 (EMBL:AP003000) (351 aa) fasta scores:
FT                   E(): 1.3e-09, 30.34% id in 379 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37713"
FT                   /db_xref="GOA:Q63NN3"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NN3"
FT                   /protein_id="CAH37713.1"
FT                   /translation="MQTQTHPLISPAVGTARHITSFHYGPRGGKKVYIQASLHADELPG
FT                   MLVATLLRRKLAALEAAGRLRDEIVVVPVANPIGLAQHVFGDHLGRFELGSMQNFNRNF
FT                   HDLAALVIPRIEGRLTHDAAANLAAVRGAMREALAEQKPRTELESQRLALQRLSYDADI
FT                   VLDLHCDCDAVMHIYTNPDLWDDVEPLSRYLGAKASLLALNSVGNPFDEIHSFCWSELR
FT                   GRFGERHPIPNGTISVTVELRSERDVSYELAEHDAQALVEYLTLRGAIDGTPAPQPPLE
FT                   FAATPLAGTDPLVAPVSGVIVFHTPVGVWIEAGQDVADIVDPLTDRVVTLKSSVSGVLY
FT                   ARQIARFATAGMEVARIAGATPIRTGSLLSA"
FT   CDS_pept        355722..357836
FT                   /transl_table=11
FT                   /locus_tag="BPSS0268"
FT                   /product="putative O-antigen acetylase"
FT                   /note="Similar to Rhizobium loti O-antigen acetylase
FT                   mlr0695 SWALL:Q98M77 (EMBL:AP002995) (688 aa) fasta scores:
FT                   E(): 1.3e-66, 42.93% id in 694 aa, and to Pseudomonas
FT                   aeruginosa probable O-antigen acetylase pa5238 SWALL:Q9HTV2
FT                   (EMBL:AE004936) (662 aa) fasta scores: E(): 6e-32, 31.62%
FT                   id in 702 aa. CDS is extended at the N-terminus in
FT                   comparison to orthologues. Possible alternative
FT                   translational start site"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37714"
FT                   /db_xref="GOA:Q63NN2"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NN2"
FT                   /protein_id="CAH37714.1"
FT                   /translation="MSVSELRWAGSQAGGPAAHGKTAYLPYIDGLRAWAVLSVMLYHLD
FT                   ARWLPGGFAGVDIFFVISGFVVSVSVANRGPMSLGPFLLFFYARRMRRILPALVAALLA
FT                   TALVSTLFIPASYLSDRNRTTGLLAFFGLSNVILGAPGGDYFSPKAEFNPYTHTWSLGV
FT                   EEQFYLLFPLLFHAWRAGGKRRYASAALFAAGLCASLAWSVWARPAMHAQAFYLIFGRF
FT                   WELAAGVLLYQCVARAGRPAGRPAAAFGIEAGVWASAVAVLAGFVASKPALYPFPGALV
FT                   PVAGALGLLGLLHGRARASPVRAALEQPALRFVGRISYSLYLWHWPVFVVFRWTLGLDS
FT                   AGGKASALLVACALATASYRFIETPLRRGGAAARRAPRVAALAGGAGVLAAGAALSSML
FT                   AAAQPQLSLSTVARHRLDWYPYGVETNAAYPGCVADVGARDVRGGKLWIYARKGCGRPP
FT                   ESRQRVFVIGDSHAMAYAGMFKQFVVRTGIAVYSYNNAGCPFVSLQPWRERGEPGCRRY
FT                   GDAALDDMLSKLAQGDIVFLPSLRLPRFVTQWAFVGDDDARRLSSGREAAQVRERAIAD
FT                   AVAVLREIGRRGARIVLEAPPPVFRTVPYRCSDWFNRRNAICARGPLVGRGEIDALRAP
FT                   VLTAYARIAAQVPDVHTWDPLPLLCDEKACSAYDGARPLFFDGDHLSGYGNLRVLPGFE
FT                   AFVRELIEAA"
FT   misc_feature    355764..355787
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    355860..356792
FT                   /note="Pfam match to entry PF01757 Acyl_transf_3,
FT                   Acyltransferase family , score 150.9, E-value 1.5e-42"
FT   misc_feature    order(355872..355940,356001..356069,356097..356165,
FT                   356277..356336,356349..356417,356454..356522,
FT                   356532..356600,356658..356726,356754..356807,
FT                   356856..356924)
FT                   /note="10 probable transmembrane helices predicted for
FT                   BPSS0268 by TMHMM2.0 at aa 51-73, 94-116, 126-148, 186-205,
FT                   210-232, 245-267, 271-293, 313-335, 345-362 and 379-401"
FT   CDS_pept        357861..357995
FT                   /transl_table=11
FT                   /locus_tag="BPSS0268A"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0268A"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37715"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NN1"
FT                   /protein_id="CAH37715.1"
FT                   /translation="MEVMEAIEATAVRLPGEGGRSAGKPNRAMPAGGAGMSGERMKSA"
FT   CDS_pept        complement(358089..358871)
FT                   /transl_table=11
FT                   /gene="argT"
FT                   /locus_tag="BPSS0269"
FT                   /product="lysine-arginine-ornithine transport system,
FT                   binding exported protein"
FT                   /note="Similar to Escherichia coli
FT                   lysine-arginine-ornithine-binding periplasmic protein
FT                   precursor ArgT or b2310 SWALL:ARGT_ECOLI (SWALL:P09551)
FT                   (260 aa) fasta scores: E(): 2.6e-52, 53.66% id in 259 aa,
FT                   and histidine-binding periplasmic protein precursor HisJ or
FT                   b2309 or c2851 or z3571 or ecs3193 SWALL:HISJ_ECOLI
FT                   (SWALL:P39182) (260 aa) fasta scores: E(): 3.5e-52, 52.51%
FT                   id in 259 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37716"
FT                   /db_xref="GOA:Q63NN0"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NN0"
FT                   /protein_id="CAH37716.1"
FT                   /translation="MKKILAALTVALLAVSAGGVQAKDWSTIRFGVDASYPPFESKGPD
FT                   GKVVGFDVDLGNEICKRVKAKCVWIENDFDGMIPALKARKFDGVLSSMSMTPQREEQIA
FT                   FSSKLFNTPTRLVTKKGANLMPTAESLKGKTVGVEQGTIQETYAKVHWAPMGVKVQPYQ
FT                   NQDQVYADLIAGRLDAALQDAVQADIGFLKTPRGKDYAFAGTDLNDPKTLGEGAGIGLR
FT                   KEDTDLKAKIDKAIADMHKDGTYDKIAKKYFDFDVYGK"
FT   misc_feature    complement(358107..358790)
FT                   /note="Pfam match to entry PF00497 SBP_bac_3, Bacterial
FT                   extracellular solute-binding proteins, family 3 , score
FT                   280.6, E-value 1.3e-81"
FT   misc_feature    complement(358467..358490)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(358683..358724)
FT                   /note="PS01039 Bacterial extracellular solute-binding
FT                   proteins, family 3 signature."
FT   misc_feature    complement(358806..358871)
FT                   /note="Signal peptide predicted for BPSS0269 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.997 between residues 24 and 25"
FT   CDS_pept        complement(359105..360004)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0270"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator pa2921 SWALL:Q9HZS6
FT                   (EMBL:AE004718) (329 aa) fasta scores: E(): 2.7e-26, 37% id
FT                   in 300 aa, and to Escherichia coli putative transcriptional
FT                   regulator AbgR or b1339 SWALL:ABGR_ECOLI (SWALL:P77744)
FT                   (302 aa) fasta scores: E(): 2e-21, 29.96% id in 297 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37717"
FT                   /db_xref="GOA:Q63NM9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NM9"
FT                   /protein_id="CAH37717.1"
FT                   /translation="MKLQQLQAFVCAAHHKSLRAAARALGVTQPAITHTIRELEAALNA
FT                   ELLVRSVRGVELTACGHALLPRAEQLLGDMRRTVEAVEQVRGELSGRVAIGTMPSIALT
FT                   ALPRAVMKFRATMPHVSLSLEEVTVPNALARLRNGELDIAAIHHIPALERDFAQLPLCS
FT                   TEFVVAMREGHPLAGARRLAELLDAEWIVTVGADHFPHSVMMSMFNAHGLPLPQRLLRA
FT                   PSSFAVTLGLVARSDVIGCFTKPLAAMVAPLGIRPARLDDRLPSYDLSILSRRDLLPTP
FT                   AVTQFIACLRQAADETLT"
FT   misc_feature    complement(359120..359749)
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain , score 121.8, E-value 8.2e-34"
FT   misc_feature    complement(359819..359998)
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family , score
FT                   79.5, E-value 4.5e-21"
FT   misc_feature    complement(359864..359956)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(359894..359959)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1789.000, SD 5.28 at aa 16-37, sequence
FT                   KSLRAAARALGVTQPAITHTIR"
FT   misc_feature    complement(359960..359980)
FT                   /note="PS00290 Immunoglobulins and major histocompatibility
FT                   complex proteins signature."
FT   CDS_pept        360140..361327
FT                   /transl_table=11
FT                   /locus_tag="BPSS0271"
FT                   /product="family M20D unassigned peptidase"
FT                   /note="Similar to Campylobacter jejuni hippurate hydrolase
FT                   HipO or cj0985C SWALL:HIPO_CAMJE (SWALL:P45493) (383 aa)
FT                   fasta scores: E(): 5.6e-56, 44.44% id in 387 aa, and to
FT                   Agrobacterium tumefaciens amidohydrolase atu3635 or
FT                   agr_l_2386 SWALL:Q8U9U0 (EMBL:AE009292) (430 aa) fasta
FT                   scores: E(): 6.1e-67, 47.84% id in 395 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37718"
FT                   /db_xref="GOA:Q63NM8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NM8"
FT                   /protein_id="CAH37718.1"
FT                   /translation="MNDARFTEVDDLAPLAEALREIRHRIHRHPELAYEEVETAALVAD
FT                   KLEAWGWRVTRGVGGTGVVGTLRVGDGARSVGVRADMDALPIAEATGLPYASAVPGKMH
FT                   ACGHDGHTAMLLGAAWRLAQARHFSGTVHLYFQPAEEHGVDSGAKRMIDDGLFERFPCD
FT                   AVFGMHNHPGVEPGVFLTRRGAFMSAGDKAVIDIHGVGGHAARPHLAVDPVVVAASVVM
FT                   ALQTIVARNVDPAQPAVVTVGSLHAGTANNVIPSRARLELSVRSFDPEVRALLRRRITE
FT                   LAQAQAASYGASANVEYIEGYPVVVNSDAETDFAAQVAKELVGERNVVEQADILMGSED
FT                   FAFMLQRRPGSFVRLGNGAGEEGCMVHNPKYDFNDRNLVTGAAFWARLVERYLAR"
FT   misc_feature    360185..361144
FT                   /note="Pfam match to entry PF01546 Peptidase_M20, Peptidase
FT                   family M20/M25/M40 , score 283.6, E-value 1.6e-82"
FT   CDS_pept        361615..362931
FT                   /transl_table=11
FT                   /locus_tag="BPSS0272"
FT                   /product="putative transporter protein"
FT                   /note="Similar to Pseudomonas aeruginosa probable MFS
FT                   transporter pa4343 SWALL:Q9HW58 (EMBL:AE004850) (439 aa)
FT                   fasta scores: E(): 2.3e-64, 46.82% id in 425 aa, and to
FT                   Escherichia coli citrate-proton symporter CitA or Cit
FT                   SWALL:CIT1_ECOLI (SWALL:P07661) (431 aa) fasta scores: E():
FT                   1.3e-45, 36.77% id in 416 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37719"
FT                   /db_xref="GOA:Q63NM7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NM7"
FT                   /protein_id="CAH37719.1"
FT                   /translation="MPADGAGVAPADAVSAAGLRTARGGAIAAAVIGNWLEFFDFTVYG
FT                   FFAVIIGKLYFPSHDATTSLLLSVATFAAGFFTRPLGSIVLGVYADRRGRKAALNLTIL
FT                   LMALGTGMIALAPTYAQIGVLAPVIVVCARLMQGFSQGGEFGAATSTLVEHGGAARRGF
FT                   RASWQLATQGGAALMGSGFAALLSNTLAKDALESWGWRVPFALGVLIAPVGMYLRRRLA
FT                   DDAPGAGHHGIDGGVLRELFARHGRTVLLLTLTVMGGTVSTYILTFYMPTYAIHTLGLP
FT                   MKLSMFVGVASGCVMLVTCPLFGWLSDRIGSRRLPIFVGRGVLVVLLFPAFVLMNRYPS
FT                   LAVVMPLTGLMLLFYSMGSASEFALMCESFPRRVRATGISIAYALAVTLFGGTAQLVAT
FT                   WLVRVTGSTLAPAAYVAVCVIVSLVAVGMLRETATETAD"
FT   misc_feature    361687..362928
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter , score 64.3, E-value 1.7e-16"
FT   misc_feature    order(361702..361770,361813..361881,361915..361983,
FT                   362206..362265,362356..362424,362467..362535,
FT                   362554..362613,362641..362709,362746..362814,
FT                   362842..362901)
FT                   /note="10 probable transmembrane helices predicted for
FT                   BPSS0272 by TMHMM2.0 at aa 30-52, 67-89, 101-123, 198-217,
FT                   248-270, 285-307, 314-333, 343-365, 378-400 and 410-429"
FT   CDS_pept        complement(363494..364213)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0273"
FT                   /product="putative TetR-family regulatory protein"
FT                   /note="Similar to Escherichia coli and Escherichia coli O6
FT                   hypothetical transcriptional regulator YcdC or b1013 or
FT                   c1150 SWALL:YCDC_ECOLI (SWALL:P75899) (212 aa) fasta
FT                   scores: E(): 8.2e-22, 38.42% id in 190 aa, and to
FT                   Pseudomonas putida transcriptional regulator, TetR family
FT                   pp0594 SWALL:AAN66221 (EMBL:AE016776) (247 aa) fasta
FT                   scores: E(): 8e-30, 37.39% id in 238 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37720"
FT                   /db_xref="GOA:Q63NM6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NM6"
FT                   /protein_id="CAH37720.1"
FT                   /translation="MPHDDPTTTPPDAPAPRARTKAAHAPSRARKAHIRELNEAHLLAC
FT                   AEAVFAERGFEGASTALIAERAGLPKANLHYYFPTKLALYRRVLDDLLEDWHAAADSFD
FT                   VGDDPVAALGGYVRAKMALSRERPLGSKVWANEIISGATHMQDLLLERVKPWMDTRIAL
FT                   IERWIARGLVEPVEPKTLLYMIWATTQHYADFDAQIVALSGKHGLSAKAFDATTDEVVR
FT                   LILRACGARSPHARQPA"
FT   misc_feature    complement(363950..364090)
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family , score 65.4, E-value
FT                   7.9e-17"
FT   CDS_pept        complement(364563..365420)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0274"
FT                   /product="putative IclR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas putida pca regulon regulatory
FT                   protein PcaR SWALL:PCAR_PSEPU (SWALL:Q52154) (291 aa) fasta
FT                   scores: E(): 1.8e-38, 42.85% id in 273 aa, and to Ralstonia
FT                   solanacearum probable transcription regulator protein
FT                   rsc2255 or rs01304 SWALL:Q8XX61 (EMBL:AL646069) (275 aa)
FT                   fasta scores: E(): 1.2e-68, 67.75% id in 276 aa. Possible
FT                   alternative translational start site"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37721"
FT                   /db_xref="GOA:Q63NM5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR012794"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NM5"
FT                   /protein_id="CAH37721.1"
FT                   /translation="MRGAGWRNPTPCANLLRCTSFPPAMSTEFQAKPGDSYVQSFARGL
FT                   AVIRAFDAEHPEQTLTEVASATGLTRAGARRILLTLQTLGYVEADGRLFRLTPKILDLG
FT                   FAYLTSMPFWNLAEPVMEQLSARIHESCSAAVLDRTEIVYVLRVPTHKIMTINLSIGSR
FT                   LPAYCTSMGRVLLSSLDAAALDDTLAQSTLRAYTPRTLTDPAALKDEIATVRSQGWAIV
FT                   DQELEAGLISLSAPIRNRRGQVIAAMNISGNAQRHTAKQMVKAFLDPLLEASQTVSQLV
FT                   ARRG"
FT   misc_feature    complement(364581..365141)
FT                   /note="Pfam match to entry PF01614 IclR, Bacterial
FT                   transcriptional regulator , score 217.4, E-value 1.4e-62"
FT   misc_feature    complement(365184..365249)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1014.000, SD 2.64 at aa 58-79, sequence
FT                   QTLTEVASATGLTRAGARRILL"
FT   CDS_pept        365585..366787
FT                   /transl_table=11
FT                   /gene="pcaF"
FT                   /locus_tag="BPSS0275"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /note="Previously sequenced as Burkholderia pseudomallei
FT                   beta-ketoadipyl CoA thiolase PcaF SWALL:Q9F4K2
FT                   (EMBL:AY007371) (400 aa) fasta scores: E(): 1.8e-145, 100%
FT                   id in 400 aa. Similar to Pseudomonas putida beta-ketoadipyl
FT                   CoA thiolase PcaF SWALL:PCAF_PSEPU (SWALL:Q51956) (400 aa)
FT                   fasta scores: E(): 7.4e-106, 73.56% id in 401 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37722"
FT                   /db_xref="GOA:H7C731"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:H7C731"
FT                   /protein_id="CAH37722.1"
FT                   /translation="MTEAFLCDAIRTPIGRYGGALAPVRADDLGAVPLKALVERNRDVD
FT                   WAAVDDVIYGCANQAGEDNRNVARMSLLLAGLPHAVPGATINRLCGSGMDAIGLAARAI
FT                   KAGEASLMIAGGVESMSRAPFVTGKATSAFSRQAEIFDTTIGWRFVNPLMKQRYGVDSM
FT                   PETAENVATDYRVSRADQDAFALRSQQKAARAQADGTLAQEIAPVTIAQKQGEPLVVAR
FT                   DEHPRETTLEALAKLKGVVRPDGTVTAGNASGVNDGACALLVASEAAARRHGLVPRARV
FT                   LGIATAGVEPRVMGIGPAPATQKLLARLGMTLDQFDVIELNEAFASQGLAVLRLLGVAD
FT                   DDARVNPNGGAIALGHPLGASGARLVTTATYQLHRTGGRFALCTMCIGVGQGIAIAIER
FT                   V"
FT   misc_feature    365585..366388
FT                   /note="Pfam match to entry PF00108 thiolase, Thiolase,
FT                   N-terminal domain , score 332.6, E-value 2.9e-97"
FT   misc_feature    365840..365896
FT                   /note="PS00098 Thiolases acyl-enzyme intermediate
FT                   signature."
FT   misc_feature    366401..366781
FT                   /note="Pfam match to entry PF02803 thiolase_C, Thiolase,
FT                   C-terminal domain , score 207.0, E-value 1.9e-59"
FT   misc_feature    366620..366670
FT                   /note="PS00737 Thiolases signature 2."
FT   misc_feature    366725..366766
FT                   /note="PS00099 Thiolases active site."
FT   CDS_pept        367570..369114
FT                   /transl_table=11
FT                   /gene="aer"
FT                   /gene_synonym="air"
FT                   /locus_tag="BPSS0276"
FT                   /product="aerotaxis receptor"
FT                   /note="Similar to Escherichia coli aerotaxis receptor Aer
FT                   or Air or b3072 SWALL:AER_ECOLI (SWALL:P50466) (506 aa)
FT                   fasta scores: E(): 7.6e-83, 51.65% id in 515 aa, and to
FT                   Ralstonia solanacearum probable aerotaxis sensor receptor
FT                   rsp1224 or rs03168 SWALL:Q8XQK0 (EMBL:AL646083) (514 aa)
FT                   fasta scores: E(): 8.2e-120, 69.84% id in 514 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37723"
FT                   /db_xref="GOA:Q63NM3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NM3"
FT                   /protein_id="CAH37723.1"
FT                   /translation="MRNNQPVTQHEFELPDDATLMSTTDPHGRITYANATFVHVSGFSS
FT                   DEIVGAPHNVVRHLDMPRDAFADMWATLKRGEPWTALVKNRRKNGDHYWVRANAVPVIR
FT                   GGQTQGYMSVRTKPARAETAAADALYRDFREGRAGSRRFHKGLIVRTGLLRACSLLQTM
FT                   SVRARIHLPIVALTPAIVGAAWAAGVAGAPLAQLAGATLGGAALAAWWLDAQIARPLRT
FT                   LRRQALDVATGASRRGVNMNRVDEIGMSLRTINQLGLMFRWLIDDVSEQVLTVQRAVNE
FT                   IAQGNHDLSARTEQAATSVQQTAASMAQMTATVSSNAQTATQANRLSESASHAAERGGQ
FT                   AVREVVSTMGEITESSRRISEIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAG
FT                   EVRALAQRSANAAKEIKALIGASVERVESGAQTVDYAGRTMGEIVSQVKRVSDLIAEIS
FT                   ASTSEQRAGVTQVDDAVVHLDSITQQNAALVEQSAAASESLRQQATLLVDAVGVFR"
FT   misc_feature    367807..367917
FT                   /note="Pfam match to entry PF00785 PAC, PAC motif , score
FT                   22.3, E-value 7.8e-06"
FT   misc_feature    368080..368148
FT                   /note="1 probable transmembrane helix predicted for
FT                   BPSS0276 by TMHMM2.0 at aa 171-193"
FT   misc_feature    368149..368358
FT                   /note="Pfam match to entry PF00672 HAMP, HAMP domain ,
FT                   score 21.6, E-value 0.0012"
FT   misc_feature    368419..369111
FT                   /note="Pfam match to entry PF00015 MCPsignal,
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain
FT                   , score 341.4, E-value 6.6e-100"
FT   CDS_pept        complement(369207..370223)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0277"
FT                   /product="putative methyltransferase"
FT                   /note="Similar to Streptomyces sp. JP95 putative
FT                   methyltransferase GrhL SWALL:Q8KSX2 (EMBL:AF509565) (343
FT                   aa) fasta scores: E(): 2e-16, 27.32% id in 333 aa, and to
FT                   Mycobacterium tuberculosis putative methyltransferase
FT                   rv0567 or mt0593 or mtv039.05 SWALL:O53764 (EMBL:AL021942)
FT                   (340 aa) fasta scores: E(): 1.1e-16, 28.03% id in 321 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37724"
FT                   /db_xref="GOA:Q63NM2"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NM2"
FT                   /protein_id="CAH37724.1"
FT                   /translation="MTLTSPHHDDVAVYDLTLGLFACPAMLIAHRAGLFRRLGESPSTL
FT                   KELGAALGLARRPTEALANTAAALGFVRRDADRYALTALGADLLVERSPTYFGAFLDLM
FT                   YEASETFSLKSLEAAIRDDAAHAYGSPDVFQSHEQQLALAQRFTRAMESVSAAHAPVWP
FT                   TQLDLSRHRVMLDIGAGSGAHTRGALSAWPALRAIVFDLPGVCELSRPYFETSPVRERV
FT                   TLHPADMRHDPFPDADLHFYSNVFHACPREKNALLARKSSDALPPGGRIVLHEVLYRDD
FT                   KSGPLAAAASSLMMISWTEGEQYSSRELTEILANAGFSSLETIPSAGYYSLVTGVKR"
FT   misc_feature    complement(369282..370001)
FT                   /note="Pfam match to entry PF00891 Methyltransf_2,
FT                   O-methyltransferase , score 50.1, E-value 8.8e-13"
FT   CDS_pept        complement(370641..371681)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0278"
FT                   /product="putative oxygenase"
FT                   /note="Low similarity to Pseudomonas sp. vanillate
FT                   O-demethylase oxygenase subunit VanA SWALL:VANA_PSESP
FT                   (SWALL:O05616) (354 aa) fasta scores: E(): 1.9e-06, 24.49%
FT                   id in 298 aa, and to Xanthomonas campestris vanillate
FT                   O-demethylase oxygenase subunit xcc0363 SWALL:AAM39682
FT                   (EMBL:AE012132) (358 aa) fasta scores: E(): 1.7e-08, 25.98%
FT                   id in 304 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37725"
FT                   /db_xref="GOA:Q63NM1"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NM1"
FT                   /protein_id="CAH37725.1"
FT                   /translation="MMLSVGNEDLDLTNRHNAEDWLPDRIRLRNVWLPLAHTFEIGERA
FT                   SRWYVHSEPCYLWRAAGRIHACPWHPGLPAAKRPTPRPRDADAACYPVVERFGYVWVWY
FT                   GEPEAASDAFVPDVPFLPRDGGLPKYMQGNIRVDCCAPLLIENLLDLTHSDFLHAKVFG
FT                   DQHADEDRVDVSYTSETVTMIRRCKNKSILPIMRWFGGVRAKYQDIHAVVHVHVRSSIA
FT                   LAYGRHTPGSDLPLFHPCVPESRNYCRLNFALNATQAPWPLRLLLPFVPYVVGLQDNSM
FT                   VRRQSGRYLDAGERRDLYSRFDRAGLRYRILLQQLAKRQSEGDFSYADDALPSRDARGI
FT                   LGMPNE"
FT   CDS_pept        complement(371678..372625)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0279"
FT                   /product="putative rieske iron-sulfur protein"
FT                   /note="Very low similarity to parts of Arabidopsis thaliana
FT                   putative rieske iron-sulfur protein at2g24820 SWALL:Q9SK50
FT                   (EMBL:AC006585) (539 aa) fasta scores: E(): 8e-13, 29.8% id
FT                   in 255 aa, and to Anabaena sp. hypothetical protein all3866
FT                   SWALL:Q8YQG5 (EMBL:AP003594) (351 aa) fasta scores: E():
FT                   8.4e-10, 32.89% id in 152 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37726"
FT                   /db_xref="GOA:Q63NM0"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NM0"
FT                   /protein_id="CAH37726.1"
FT                   /translation="MPVALSEQVSGRAALAVICMEQPLVLFRDASGAVCAMEDRCAHRR
FT                   APLSLGRVTPDGRLQCAYHGWTYDGATGACVAIPNLSASERVPAHYAAHAYKTLERDGF
FT                   IWACARDAPPPAEAIPRAPRSARRFAGSVTVAIARDEYVAALADGPHLTMRIAGLYITD
FT                   YVIADATPHDGDIATERGVTWLAHIVDRHFGVRYPWTLRVTSPRDGALASVELASRDGA
FT                   TALWASIAITPAARGATNVLWRGGVAADASGFGAKLFRTWARLHAAPFAMLAHVDGRAL
FT                   STLDALYSRAWRGPIPEGIAHTRPMPADYRTRSR"
FT   misc_feature    complement(372317..372598)
FT                   /note="Pfam match to entry PF00355 Rieske, Rieske [2Fe-2S]
FT                   domain , score 54.3, E-value 1.8e-13"
FT   CDS_pept        complement(374061..375530)
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BPSS0280"
FT                   /product="succinate-semialdehyde dehydrogenase [NADP+]"
FT                   /EC_number="1.2.1.16"
FT                   /note="Similar to Escherichia coli succinate-semialdehyde
FT                   dehydrogenase [NADP+] GabD or b2661 SWALL:GABD_ECOLI
FT                   (SWALL:P25526) (482 aa) fasta scores: E(): 1.4e-130, 69.7%
FT                   id in 482 aa, and to Salmonella typhi
FT                   succinate-semialdehyde dehydrogenase sty2911 SWALL:Q8Z4F8
FT                   (EMBL:AL627276) (482 aa) fasta scores: E(): 7.2e-131,
FT                   70.12% id in 482 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37727"
FT                   /db_xref="GOA:Q63NL9"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NL9"
FT                   /protein_id="CAH37727.1"
FT                   /translation="MTTAHETLALKDPALLRERAFVAGEWQAADGGATLEVRNPATGAL
FT                   IGTVPAMGAAETRRAIDAANAAWPAWRKKTAKERAAILRKWHDLMIAHADDLALILTTE
FT                   QGKPLVEAKGEIGYAASFLEWFAEEGKRVYGDTIPTPAADKRIVVTKEPVGVCAAITPW
FT                   NFPAAMITRKVGPALAAGCPIVVKPAEATPFSALAMAVLAERAGVPAGVFSVVTGEPKA
FT                   IGGELTSNPIVRKLSFTGSTPVGRLLMAQCAATVKKVSLELGGNAPFIVFDDADLDAAV
FT                   EGAIASKYRNSGQTCVCTNRFYVHEKVYDAFAEKLTAAVAKLKVGPGTEAGVVQGPLIN
FT                   GAAVRKVEAHIADALDKGARVTTGGQRHPLGHGFFEPTVLTGVTPDMKVAKEETFGPLA
FT                   PLFRFSTEEEAIRYANDTEFGLAAYFYSRDIGRVWRVAEALEYGMVGINAGIISNEVAP
FT                   FGGVKQSGLGREGSHYGIDDYVVIKYMCVAV"
FT   misc_feature    complement(374064..375458)
FT                   /note="Pfam match to entry PF00171 aldedh, Aldehyde
FT                   dehydrogenase family , score 719.4, E-value 1.1e-213"
FT   misc_feature    complement(374631..374666)
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT   misc_feature    complement(374727..374750)
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT   CDS_pept        complement(375588..376871)
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="BPSS0281"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /EC_number="2.6.1.19"
FT                   /note="Similar to Escherichia coli 4-aminobutyrate
FT                   aminotransferase GabT or b2662 SWALL:GABT_ECOLI
FT                   (SWALL:P22256) (426 aa) fasta scores: E(): 4.8e-79, 54.24%
FT                   id in 424 aa, and to Ralstonia solanacearum probable
FT                   4-aminobutyrate aminotransferase protein rsc0029 or rs01852
FT                   SWALL:Q8Y3F1 (EMBL:AL646057) (426 aa) fasta scores: E():
FT                   1.5e-108, 71.29% id in 418 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37728"
FT                   /db_xref="GOA:Q63NL8"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NL8"
FT                   /protein_id="CAH37728.1"
FT                   /translation="MNNADLHARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDF
FT                   AAGIAVLNTGHRHPRIVKAIADQLGQFTHTAYQIVPYASYVELAEKINARAPIAQPKKT
FT                   AFFTTGAEAVENAVKIARAYTGRPGVIAFAGGFHGRTMMGMALTGKVAPYKIGFGPFPG
FT                   DVFHAPYPNALHGVTSADSIAAVETLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVR
FT                   ALRKLCDAHGILLIADEVQTGFARTGKLFAMEHYDVSADLMTIAKSLAGGMPLSGVVGR
FT                   ADVMDAAAPGGLGGTYAGNPLAVAAAHAVLDVIDEEKLAERATVLGDKLKAKLAALRAE
FT                   LPQIVDVRGPGAMVAAEFVDPHTRASDAAFTKRVQTLALERGLLLLICGVDANVIRFLF
FT                   PLTIEDAVFDEALGILESVLREAVGVPA"
FT   misc_feature    complement(375603..376835)
FT                   /note="Pfam match to entry PF00202 aminotran_3,
FT                   Aminotransferase class-III , score 550.8, E-value 6.1e-163"
FT   misc_feature    complement(376056..376169)
FT                   /note="PS00600 Aminotransferases class-III
FT                   pyridoxal-phosphate attachment site."
FT   misc_feature    complement(376743..376802)
FT                   /note="PS00636 Nt-dnaJ domain signature."
FT   CDS_pept        377013..378707
FT                   /transl_table=11
FT                   /locus_tag="BPSS0282"
FT                   /product="putative GntR-family regulatory protein"
FT                   /note="Similar to Ralstonia solanacearum putative
FT                   transcription regulator protein rsc0030 or rs01853
FT                   SWALL:Q8Y3F0 (EMBL:AL646057) (509 aa) fasta scores: E():
FT                   3e-74, 57.69% id in 520 aa, and to Yersinia pestis putative
FT                   GntR-family regulatory protein ypo2845 or y1389
FT                   SWALL:Q8ZCW3 (EMBL:AJ414154) (501 aa) fasta scores: E():
FT                   3e-61, 46.1% id in 514 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37729"
FT                   /db_xref="GOA:Q63NL7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NL7"
FT                   /protein_id="CAH37729.1"
FT                   /translation="MRVSVLSDWLAQRIVRGGGAQPIYRQLHRLLQQAILTRELPAGAR
FT                   VPSSRLLAAELGIARNTVTQVYEQLALEGYVSSATGRGTFVADSAPDEIVGAPADSPPG
FT                   LPRPGLPGTRGAAAGAEAAAGIGFDPTLEPGAARRSLSARGARLVGGAGVSKRQGGAFM
FT                   PGVPDVSRFPARVWTRLHNKYWRRLRPELLTYAPGGGLAPLREALADYLRTSRSVRCAP
FT                   EQIIVTTGIHQSIDLAVRLLTDPGDVIWTEDPCYWGVRSVMHVSGLTTRPIPVDEEGIA
FT                   PAAADFAAPPKLMLVTPSHQYPLGMVMSLARRRMLLEYARQHGAWIIEDDYDSEFRYGS
FT                   RPLASLQGLDTAGQVIYVGSFSKTLFPGLRVGYLVAPEPLAESFATASAELYREGQLLQ
FT                   QAVLAEFIAEGHFVSHIRKMRTLYGQRRQTLLDALARRYGDALPAVGGDAGLHLVMRLP
FT                   DGADDRALARAALERDIVVRALSGYYAQATRAASGLLLGYACVPEDEIGCAFDALSRAI
FT                   DDVAFGRAAAASSAPASTSAAAASSASSASAASTTSAAARMPAAVAR"
FT   misc_feature    377091..377270
FT                   /note="Pfam match to entry PF00392 gntR, Bacterial
FT                   regulatory proteins, gntR family , score 48.9, E-value
FT                   7.2e-12"
FT   misc_feature    377640..378563
FT                   /note="Pfam match to entry PF00155 aminotran_1_2,
FT                   Aminotransferase class I and II , score 14.5, E-value
FT                   1.9e-07"
FT   CDS_pept        complement(378724..380208)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0283"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Bacillus halodurans hypothetical protein
FT                   bh2308 SWALL:Q9KAH9 (EMBL:AP001515) (470 aa) fasta scores:
FT                   E(): 1.9e-35, 25.87% id in 460 aa, and to Salmonella typhi
FT                   putative membrane protein sty4802 SWALL:Q8Z128
FT                   (EMBL:AL627283) (467 aa) fasta scores: E(): 6.2e-19, 28.75%
FT                   id in 480 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37730"
FT                   /db_xref="GOA:Q63NL6"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NL6"
FT                   /protein_id="CAH37730.1"
FT                   /translation="MPDMPDMSDMSDMPDTRGTPAHDASPRPEHKPHGKMLHPVVMMIW
FT                   VLAAAVALTWLVDSGRYARNGKLVVPGTYQVVPKATSLATLVAPAVSKSTPQLAMPASL
FT                   VSAFVAVPGGLVKNAPLIVMVMFVGGMFGVMRRTGVVDAGIDRLLQLTGNDVYLLTPLL
FT                   MILIGLGSTLLGFISEYLVIIPMVMVIAKRLGLSNLFAVALVALAAKIGYIASVTNPLA
FT                   LAVAQPLVGVPLFSGVALRAAVFAVYLALGILYLLHHVKRSGYRRERAKALAHAHGVAR
FT                   LSVRHQATLALLAAAVAMLVFGTRELKWGNVELAAFYAFVAIAAAAIGGLDSRSAADAF
FT                   VDGMKSMMLAALLMGLAASVELLLQNSLVLDTLIHLFTRLANGQSPVWVANGLMAVQMV
FT                   LDVFIPSVSGKAAVSMPIIGPIAQLSGVSGQTSVLAFVLGGGLTNLVTPTSGMLLAYLA
FT                   TARVDFGAWLRFVLPLFAVLLALSCGVLAFAVQIGY"
FT   misc_feature    complement(order(378733..378801,378838..378906,
FT                   378988..379056,379117..379173,379216..379284,
FT                   379429..379497,379555..379623,379657..379725,
FT                   379822..379890,380038..380091))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BPSS0283 by TMHMM2.0 at aa 40-57, 107-129, 162-184,
FT                   196-218, 238-260, 309-331, 346-364, 385-407, 435-457 and
FT                   470-492"
FT   CDS_pept        complement(380274..381041)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0284"
FT                   /product="putative IclR-family transcriptional regulator"
FT                   /note="Similar to Escherichia coli transcriptional
FT                   regulator KdgR or b1827 SWALL:KDGR_ECOLI (SWALL:P76268)
FT                   (263 aa) fasta scores: E(): 1.8e-15, 30.92% id in 249 aa,
FT                   and to Bacillus halodurans transcriptional regulator bh2137
FT                   SWALL:Q9KAZ9 (EMBL:AP001514) (251 aa) fasta scores: E():
FT                   1e-18, 31.85% id in 248 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37731"
FT                   /db_xref="GOA:Q63NL5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NL5"
FT                   /protein_id="CAH37731.1"
FT                   /translation="MNYIVDAVDSALKLLSFVAEHPHLGVTELASKLGINKSRTYRMLC
FT                   TLELHRFVVQDARTSTYALGPQAFVIGVAAAQQNALVRAAQRHMLALSQAINETVVLRV
FT                   REGLETVCVARCETTHEIRTIGSVGNRRPVGLGASGKVLLAFAPDAVRNEYFARVRKAA
FT                   QGDPLRLVEELDAISRKGYAVSVGEVTAGAVAIAVPVRDLTGETLASVSVAGPEMRISR
FT                   VEIPDYLERLQACSHAISAELGYVPARAALQPA"
FT   misc_feature    complement(380316..380858)
FT                   /note="Pfam match to entry PF01614 IclR, Bacterial
FT                   transcriptional regulator , score 123.2, E-value 3.1e-34"
FT   misc_feature    complement(380559..380642)
FT                   /note="PS00107 Protein kinases ATP-binding region
FT                   signature."
FT   misc_feature    complement(380907..380972)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1495.000, SD 4.28 at aa 24-45, sequence
FT                   LGVTELASKLGINKSRTYRMLC"
FT   CDS_pept        complement(381038..381946)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium loti N-formylglutamate
FT                   amidohydrolase mll3040 SWALL:Q98H42 (EMBL:AP003001) (313
FT                   aa) fasta scores: E(): 1.5e-28, 37.72% id in 273 aa, and to
FT                   Agrobacterium tumefaciens hypothetical protein atu3884 or
FT                   agr_l_1927 SWALL:Q8U946 (EMBL:AE009319) (294 aa) fasta
FT                   scores: E(): 8.5e-28, 36.49% id in 274 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37732"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NL4"
FT                   /protein_id="CAH37732.1"
FT                   /translation="MLTFNRHTVALDERFACFVAQPLDAALPIVVDSPHSGIAYPPDFG
FT                   AVAPRHAILTSWDAFVDELWAGAPERGCALVGARFPRAYIDPNRAVTDIDAALLAEPWP
FT                   EPLAPQSYTRRGMGLIRRYALPGVPLYDRKLSLDEVRHRIDTYYLPYRRALADAAEPLY
FT                   AKHGALWHVDCHSMKSRGNAMNLDAGAARPDVVVSDRLGTSADPAFTQWTADWFAHAGY
FT                   RVRINAPYQGGDLLNALAAPARRRHSIQIEFNRALYMNEAAFDKHAGFAALKRTVDAYL
FT                   DALAAHVRTQLPPPRGQGVSR"
FT   CDS_pept        join(382289..382465,382467..382526,382529..382624,
FT                   382678..382725,382729..382830)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPSS0285A"
FT                   /product="putative outer membrane porin precursor
FT                   (fragment)"
FT                   /note="Gene remnant. N-terminus is similar to the
FT                   N-terminal region of Burkholderia pseudomallei outer
FT                   membrane porin precursor Omp38 SWALL:Q7WZL2 (EMBL:AY312416)
FT                   (374 aa) fasta scores: E(): 6.6e-05, 36.28% id in 113 aa.
FT                   C-terminus is similar to the C-terminal region of
FT                   Burkholderia pseudomallei outer membrane porin precursor
FT                   Omp38 SWALL:Q7WZL2 (EMBL:AY312416) (374 aa) fasta scores:
FT                   E(): 0.00059, 51.85% id in 54 aa. CDS contains frameshift
FT                   and nonsense mutations and a deletion relative to the B.
FT                   pseudomallei protein"
FT   CDS_pept        complement(382862..383695)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0286"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Rhizobium loti hypothetical protein
FT                   mlr7896 SWALL:Q984Q1 (EMBL:AP003012) (278 aa) fasta scores:
FT                   E(): 7.6e-27, 40.14% id in 269 aa, and to Streptomyces
FT                   coelicolor putative integral membrane protein sco3164 or
FT                   sce87.15C SWALL:Q9RKC3 (EMBL:AL939115) (281 aa) fasta
FT                   scores: E(): 1.8e-26, 39.63% id in 275 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37734"
FT                   /db_xref="GOA:Q63NL3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NL3"
FT                   /protein_id="CAH37734.1"
FT                   /translation="MEHRFVLLVLLCALLHAVWNALLHASEDRVAQLGTMSVPYLLAGA
FT                   AGALALPPPPAPAWPYVAASALLELGYCAALLRAYRSGDFSRIYPIARGLSPLTVCALA
FT                   LIALGERPTPFALAGIALVSLGIASLALRRGLRWSGESVPYALVTGLFIAAYSVVDGRG
FT                   VRLAGDPLAYVAWVYLLWNAPQFALICRLRGWRALARSRAAVSRGLAAGVLSLAAYAIA
FT                   IAAYRHLPVATVSALRETSSIFAIAIGWFALRERPSARRLAACALVVAGAMLIRM"
FT   misc_feature    complement(382865..383245)
FT                   /note="Pfam match to entry PF00892 DUF6, Integral membrane
FT                   protein DUF6 , score 38.5, E-value 1e-08"
FT   misc_feature    complement(order(382937..383005,383018..383086,
FT                   383120..383179,383222..383281,383300..383359,
FT                   383372..383431,383468..383527,383540..383608,
FT                   383627..383683))
FT                   /note="9 probable transmembrane helices predicted for
FT                   BPSS0286 by TMHMM2.0 at aa 5-23, 30-52, 57-76, 89-108,
FT                   113-132, 139-158, 173-192, 204-226 and 231-253"
FT   misc_feature    complement(383621..383695)
FT                   /note="Signal peptide predicted for BPSS0286 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.990) with cleavage site
FT                   probability 0.435 between residues 25 and 26"
FT   CDS_pept        383913..384977
FT                   /transl_table=11
FT                   /gene="selD"
FT                   /gene_synonym="fdhB"
FT                   /locus_tag="BPSS0287"
FT                   /product="selenide, water dikinase"
FT                   /EC_number="2.7.9.3"
FT                   /note="Similar to Escherichia coli selenide,water dikinase
FT                   SelD or FdhB or b1764 SWALL:SELD_ECOLI (SWALL:P16456) (347
FT                   aa) fasta scores: E(): 2.8e-57, 52.6% id in 346 aa, and to
FT                   Pseudomonas straminea selenide SelD SWALL:Q9AQI4
FT                   (EMBL:AB050935) (357 aa) fasta scores: E(): 4.1e-88, 71.42%
FT                   id in 343 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37735"
FT                   /db_xref="GOA:Q63NL2"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63NL2"
FT                   /protein_id="CAH37735.1"
FT                   /translation="MTETKQTDAAAPRLTSLSHGGGCGCKIAPGVLSELLRRTAPPALF
FT                   PDLLVGTETSDDAAVYRLNDEQAIVATTDFFMPIVDDPFDFGRIAATNALSDVYAMGGK
FT                   PILALALVGMPINVLPHETIAAVLRGGEAVCADAGIPVAGGHSIDSVEPIYGLAALGVV
FT                   HPARVKRNAAARAGDVLVLGKPLGVGVLSAALKKDRLDAQGYAQMIATTTKLNRPGTAL
FT                   AALPGVHALTDVTGFGLLGHTLELARGAGLTARVRYGALPWLAGVEALVADGVLTGASG
FT                   RNWAAYGHDVRLGDGLPAVAQALLTDPQTSGGLLVACAPEAVDDVLACFRDDGFERAAA
FT                   IGEMVDGAARVDVS"
FT   misc_feature    383949..384404
FT                   /note="Pfam match to entry PF00586 AIRS, AIR synthase
FT                   related protein, N-terminal domain , score 60.2, E-value
FT                   2.9e-15"
FT   misc_feature    384435..384968
FT                   /note="Pfam match to entry PF02769 AIRS_C, AIR synthase
FT                   related protein, C-terminal domain , score 65.9, E-value
FT                   5.7e-17"
FT   CDS_pept        386335..387396
FT                   /transl_table=11
FT                   /locus_tag="BPSS0288"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Ralstonia solanacearum putative purine
FT                   nucleoside permease protein rsc0798 or rs05039 SWALL:Q8Y192
FT                   (EMBL:AL646061) (381 aa) fasta scores: E(): 2e-74, 56.32%
FT                   id in 348 aa, and to Brucella melitensis purine nucleoside
FT                   permease bmei0469 SWALL:Q8YIH5 (EMBL:AE009489) (345 aa)
FT                   fasta scores: E(): 3.8e-56, 48.11% id in 318 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37736"
FT                   /db_xref="GOA:Q63NL1"
FT                   /db_xref="InterPro:IPR009486"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NL1"
FT                   /protein_id="CAH37736.1"
FT                   /translation="MLTRSIFSAAVFSLAACAMAPSVAQNNGEAFAEAGAQGRPAKVMI
FT                   ISMFGPEGQAWLDRLGPWKDVAVPGLSPDYPNVHCNKQDVCVVTTGMGYANAASTIMAL
FT                   TFSRRFDLRRTYFLISGIAGVDPARGTLGTAAWAKYLVDFGLQWELDAREIPAGWNGGY
FT                   LGINTKSPSDKPPLDYRTEVFELNGKLADTAYALSRNVQLADSAQAQAARAKFNYAPAN
FT                   QPPVVTRCDTSSGNTWFSGTLLGERARQWTKLLTDNKGTYCMTAQEDNATFEALKRAAS
FT                   VNRVDLSRVAVLRTGSDFDRPYQGQTSVDNLLNYADQGGFPLATENLYRAGNPLVQDIA
FT                   THWGEWKDGVPRR"
FT   misc_feature    386335..386406
FT                   /note="Signal peptide predicted for BPSS0288 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.945 between residues 24 and 25"
FT   misc_feature    386353..386385
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(387636..387929)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0289"
FT                   /product="putative exported protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37737"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NL0"
FT                   /protein_id="CAH37737.1"
FT                   /translation="MKRSSLLAFAAIALAVAAPAFADGGIGPAGGYGDASGHSHGARTR
FT                   AEVRAELEQAQRDGTLAALRKSMSYAPPGAELGAPRPYRPDPDTNQLAGAGR"
FT   misc_feature    complement(387864..387929)
FT                   /note="Signal peptide predicted for BPSS0289 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.998 between residues 22 and 23"
FT   CDS_pept        complement(388854..389858)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0290"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /note="Similar to Burkholderia cepacia putative
FT                   transcriptional regulator CeoR SWALL:Q8VL17 (EMBL:AY008288)
FT                   (334 aa) fasta scores: E(): 8.5e-123, 91.01% id in 334 aa,
FT                   and to Salmonella typhi putative transcriptional regulator
FT                   sty1386 SWALL:Q8Z7A3 (EMBL:AL627270) (301 aa) fasta scores:
FT                   E(): 8.7e-49, 43.79% id in 290 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37738"
FT                   /db_xref="GOA:Q63NK9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NK9"
FT                   /protein_id="CAH37738.1"
FT                   /translation="MDRLQAMQVFTRVVDTNSFTKAAETLGLPRASVTTIIQNLEAFLG
FT                   VRLMHRTTRRLSLTPDGAAYYERCVRILADVEETEASFQVNNRKPHGKLRVDMPGSIGR
FT                   LILIPSLCEFHSRYPDIDLQLGLSDRPVDLLQEGVDCVIRVGALQDSSLVARRVGLFEG
FT                   TTVASPAYLEKYGEPQTIEELAQHKAVNYFSSRTGRTIDWAFLIDGKEVEVKMNGLVSV
FT                   NDADAYVTCGLEGFGLIQPPLFMVLPHLRNGTLKEVLPGHKPLPMPISVVYPHSRHLSP
FT                   KVRVFVDWVAEIFERCPLLSGRKGLDATCSKRTFEEAERAPSLDTPVLNEWVA"
FT   misc_feature    complement(388974..389600)
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain , score 160.6, E-value 1.7e-45"
FT   misc_feature    complement(389670..389849)
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family , score
FT                   69.9, E-value 3.4e-18"
FT   misc_feature    complement(389715..389807)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(389745..389810)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1172.000, SD 3.18 at aa 17-38, sequence
FT                   NSFTKAAETLGLPRASVTTIIQ"
FT   CDS_pept        389951..390901
FT                   /transl_table=11
FT                   /locus_tag="BPSS0291"
FT                   /product="putative carboxylesterase"
FT                   /note="C-terminal region is similar to Burkholderia cepacia
FT                   lipase-like protein LlpE SWALL:Q8VL16 (EMBL:AY008288) (286
FT                   aa) fasta scores: E(): 7.8e-78, 74.55% id in 283 aa.
FT                   C-terminus is similar to the C-terminal region of Ralstonia
FT                   solanacearum probable lipase protein rsp1111 or rs02619
FT                   SWALL:Q8XQV7 (EMBL:AL646082) (357 aa) fasta scores: E():
FT                   5.4e-46, 50.9% id in 277 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37739"
FT                   /db_xref="GOA:Q63NK8"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NK8"
FT                   /protein_id="CAH37739.1"
FT                   /translation="MCCRIIGIYPDVCRTQNAIHLAMDARRRATHVMDAFDFRRQISST
FT                   SAESARVRPALAVSDVVIGGYAQDIALRLYRRPDKSSLPVVLYFHGGGFVRGSLDDAER
FT                   AARHLAEHVPALVVSVDYSLAPRHPFPAAPEDAYCAARWAEARARAFGGNPRKIGVAGH
FT                   DAGGQLANCLAFIARDRGEIRIAAQALIGPMLDPSLTRLADATRLASSDTSAQECAACY
FT                   RAYLPQPSQRMHPYAAPLESVRLAGLPPTLVATAQNDVLHVEAEKYASCLIDAGVPTQV
FT                   VRYRDVSHAALADHASALEEVARFFQFRFSAGAPG"
FT   misc_feature    390179..390244
FT                   /note="Pfam match to entry PF00135 COesterase,
FT                   Carboxylesterase , score 10.4, E-value 0.0018"
FT   CDS_pept        390952..392181
FT                   /transl_table=11
FT                   /locus_tag="BPSS0292"
FT                   /product="putative multidrug efflux system exported
FT                   protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 acriflavine resistance protein A precursor AcrA or
FT                   MtcA or Lir or b0463 or z0578 or ecs0516 SWALL:ACRA_ECOLI
FT                   (SWALL:P31223) (397 aa) fasta scores: E(): 5.3e-33, 32.98%
FT                   id in 385 aa, and to Ralstonia solanacearum probable
FT                   transmembrane multidrug efflux system transmembrane protein
FT                   ys02620 or rsp1112 or rs02620 SWALL:Q8XQV6 (EMBL:AL646082)
FT                   (438 aa) fasta scores: E(): 6.1e-78, 57.77% id in 405 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37740"
FT                   /db_xref="GOA:Q63NK7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NK7"
FT                   /protein_id="CAH37740.1"
FT                   /translation="MAILRTSRSRIAAAAFAVVFIAGLGTFGAIRVNAGAPEKSAAPLP
FT                   EVDVATVLSKTITDWQSYSGRLEAVEKVDVRPLVSGTIVSVNFKDGALVKKGDVLFVID
FT                   PRPYQAEVDRAAAQLAGAQARNGYAQSDWQRAQRLIGDNAIAKRDYDEKQNAAREASAN
FT                   LKAAEAALETARINLGYTRITAPVSGRVSRAEITLGNVVSAGASAAPLTTLVSVSPIYA
FT                   SFDADEQTYLQYIGGAKDGRKVPVELGLANESGYSRQGVIDSVDNRLDTSSGTIRVRAR
FT                   FDNADGALVPGLYARVKVGGSAPHPALLIDDAAINTDQDKKFVFVVDQQGRVSYREVQL
FT                   GAQHGNQRVIVGGLAASERIVVNGTQRVRPGEQVKPHLVPMTGGDDAAAATPVAGGVQR
FT                   PRAAQGNARA"
FT   misc_feature    390952..391053
FT                   /note="Signal peptide predicted for BPSS0292 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.518 between residues 34 and 35"
FT   misc_feature    391162..392037
FT                   /note="Pfam match to entry PF00529 HlyD, HlyD family
FT                   secretion protein , score 173.1, E-value 3e-49"
FT   CDS_pept        392243..395428
FT                   /transl_table=11
FT                   /locus_tag="BPSS0293"
FT                   /product="multidrug-efflux transporter protein"
FT                   /note="Similar to Pseudomonas aeruginosa multidrug
FT                   resistance protein MexB or pa0426 SWALL:MEXB_PSEAE
FT                   (SWALL:P52002) (1046 aa) fasta scores: E(): 3e-158, 42.63%
FT                   id in 1046 aa, and to Escherichia coli probable
FT                   aminoglycoside efflux pump AcrD or b2470 SWALL:ACRD_ECOLI
FT                   (SWALL:P24177) (1037 aa) fasta scores: E(): 5.4e-157,
FT                   41.32% id in 1038 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37741"
FT                   /db_xref="GOA:Q63NK6"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NK6"
FT                   /protein_id="CAH37741.1"
FT                   /translation="MNISKFFIDRPIFAGVLSVIILLAGMIAMFLLPISEYPEVVPPSV
FT                   IVKAQYPGANPKVIAETVASPLEEQINGVEDMLYMQSQANSDGNMTITVTFKLGTDPDK
FT                   ATQLVQNRVNQALPRLPEDVQRLGITTVKSSPTLTMVVHLISPNDSYDMTYLRNYALIN
FT                   VKDRLSRIQGVGQVQLWGAGDYAMRVWLDPQKVAQRNLTADDVVRAIREQNVQVAAGVI
FT                   GASPTLPGTPLQLSVNARGRLQNEDEFGDIVVKTAPDGGVTHLRDIARIELDASEYGLR
FT                   SLLDNKPAVAMAINQSPGANSLAISDEVRKTMAELKQDFPAGVDYRIVYDPTQFVRSSI
FT                   KAVVHTLLEAIALVVIVVIVFLQTWRASIIPLIAVPVSIVGTFSLLLLFGYSINALSLF
FT                   GMVLAIGIVVDDAIVVVENVERNIENGLTARAATYKAMQEVSGPIIAIALTLVAVFVPL
FT                   AFMSGLTGQFYKQFAMTIAISTVISAFNSLTLSPALSAILLKGHGDKEDWLTRVMNRVL
FT                   GGFFRGFNKVFHRGAENYGRGVRGVLSRKAVMLGLYLVLVGATLMVSKIVPGGFVPAQD
FT                   KEYLIAFAQLPNGASLDRTEKVIRDMGAIALKQPGVESAVAFPGLSVNGFTNSSSAGIV
FT                   FVTLKPFDQRHGKALSAGAIAGALNQKYAALKDSFVAVFPPPPVLGLGTLGGFKMQIED
FT                   RGAVGYARLADATNDFIKRAQQAPELGPLFTSYQINVPQLNVDLDRVKAKQLGVNVTDV
FT                   FDTMQIYLGSLYVNDFNRFGRVYQVRVQADAPFRQRADDILQLKTRNAAGEMVPLSSLV
FT                   TVSPTFGPEMVVRYNAYTAADVNGGPAPGYSSGQAQAAVERIAAQTLPRGVKFEWTDLT
FT                   YQQILAGDSAFWVFPISVLLVFLVLAALYESLTLPLAVILIVPMSILSALTGVWLTQGD
FT                   NNIFTQIGLMVLVGLSAKNAILIVEFARELEHDGKTPFEAAVEASRLRLRPILMTSIAF
FT                   IMGVVPLVLSTGAGAEMRHAMGVAVFFGMLGVTLFGLMLTPVFYVVLRTLAGGKIHVAQ
FT                   KDSAGYGVPAPDA"
FT   misc_feature    392249..395353
FT                   /note="Pfam match to entry PF00873 ACR_tran, AcrB/AcrD/AcrF
FT                   family , score 1584.5, E-value 0"
FT   misc_feature    order(392276..392344,393269..393328,393347..393415,
FT                   393428..393496,393557..393625,393668..393736,
FT                   393890..393958,394883..394942,394961..395029,
FT                   395042..395110,395186..395254,395282..395350)
FT                   /note="12 probable transmembrane helices predicted for
FT                   BPSS0293 by TMHMM2.0 at aa 12-34, 343-362, 369-391,
FT                   396-418, 439-461, 476-498, 550-572, 881-900, 907-929,
FT                   934-956, 982-1004 and 1014-1036"
FT   CDS_pept        395439..396971
FT                   /transl_table=11
FT                   /locus_tag="BPSS0294"
FT                   /product="putative multidrug efflux system lipoprotein"
FT                   /note="Similar to Ralstonia solanacearum putative
FT                   outer-membrane drug efflux protein rsp1114 or rs05506
FT                   SWALL:Q8XQV4 (EMBL:AL646082) (508 aa) fasta scores: E():
FT                   8.9e-99, 59.63% id in 493 aa, and to Pseudomonas aeruginosa
FT                   outer membrane protein precursor OprM or OprK or pa0427
FT                   SWALL:OPRM_PSEAE (SWALL:Q51487) (485 aa) fasta scores: E():
FT                   2.2e-39, 35.33% id in 484 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37742"
FT                   /db_xref="GOA:Q63NK5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NK5"
FT                   /protein_id="CAH37742.1"
FT                   /translation="MNKTNINERIARVAKIAAASGLLVALLAACAVGPDYRRPDVATPA
FT                   AFKEAPALAPGEQAGTWKAAEPADAAHRGEWWRVFGDPVLDALETQALAANQNLKAAAA
FT                   RVEQARAATRAARSQWFPQVGVGFGPTREGLSSASQFQPQGSGPTNATLWRAQGTVSYE
FT                   ADLFGRVGRNVEASRADEAQSQALFRSVQLALQADVAQNYFELRRLDSDQDLYRRTVGL
FT                   REEALKLVQRRFAEGDISELDVSRAKNELATAQADAVGVARRRAASEHALAILLGKAPA
FT                   DFSFSETPIAPVVVRVPAGLPSALLERRPDIAAAERAMMAANARIGLAKSAYFPKLDIT
FT                   GAFGYEAATLGNLFLWSSRTFLLGPFAGTALTLPIFDGGRRSAGVAQARAKYDEEVANY
FT                   RQQVLVAFREVEDNLADLRLLDDQIRAQSDAVNASRRAAKLSRTQYQEGAVSYLDVIDS
FT                   ERSVLESQLQSNQLTGTQAVSTVNLIRALGGGWGSDAALGSREPGKQDVATR"
FT   misc_feature    395439..395531
FT                   /note="Signal peptide predicted for BPSS0294 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.998) with cleavage site
FT                   probability 0.725 between residues 31 and 32"
FT   misc_feature    395496..395528
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    395691..396302
FT                   /note="Pfam match to entry PF02321 OEP, Outer membrane
FT                   efflux protein , score 163.3, E-value 2.7e-46"
FT   misc_feature    396330..396935
FT                   /note="Pfam match to entry PF02321 OEP, Outer membrane
FT                   efflux protein , score 182.3, E-value 5.1e-52"
FT   CDS_pept        complement(397880..399121)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0295"
FT                   /product="putative transport related membrane protein"
FT                   /note="Similar to Escherichia coli O157:H7 putative symport
FT                   protein z0888 or ecs0758 SWALL:Q8X4W0 (EMBL:AE005251) (426
FT                   aa) fasta scores: E(): 2.6e-37, 33% id in 406 aa, and to
FT                   Bacillus subtilis C4-dicarboxylate transport protein DctA
FT                   or DctP SWALL:DCTA_BACSU (SWALL:P96603) (421 aa) fasta
FT                   scores: E(): 2.4e-35, 30.53% id in 393 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37743"
FT                   /db_xref="GOA:Q63NK4"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NK4"
FT                   /protein_id="CAH37743.1"
FT                   /translation="MTLANKKISLPLQMILGLALGVVFGLLAPAASRDLAFISTLFGHA
FT                   IKMVVLPLILLSVTLGAFRAGTQRGRLGKTAAFSLVFFVLMTVIAAALGLALNWLFRPG
FT                   IGASHAQTASMPANLASGIDWMKFLTDMIPSNIVGALAAGNSLPVLVFGVLLGCALAAV
FT                   EDRAAPFVAVCESMLAAFFKMTEWVVSLSPIAIFAAIAVLLSSKGLAAMAPLAKLLGIA
FT                   YLGMALLAAWLTLIVKLAGHSPRAVVRKVSEPLILGFTTRSSEITFPVHLKKLTEMGVP
FT                   SSVASTVLPLSYIFNREGAVLYTVLAVCYLADAYQLAWSWPLMITIAVLTIITIDGAAN
FT                   VPSGAVVAITVILAAIGLPADAVLLILGVDAFFDMGRTALNVYASTVATTLASRVSGAA
FT                   PEIAQATTAHASRA"
FT   misc_feature    complement(397937..399094)
FT                   /note="Pfam match to entry PF00375 SDF,
FT                   Sodium:dicarboxylate symporter family , score 209.7,
FT                   E-value 2.9e-60"
FT   misc_feature    complement(order(398021..398089,398117..398173,
FT                   398399..398467,398510..398563,398645..398713,
FT                   398828..398896,398933..399001,399029..399097))
FT                   /note="8 probable transmembrane helices predicted for
FT                   BPSS0295 by TMHMM2.0 at aa 9-31, 41-63, 76-98, 137-159,
FT                   187-204, 219-241, 317-335 and 345-367"
FT   CDS_pept        complement(399105..399764)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0296"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /note="Similar to Bradyrhizobium japonicum transcriptional
FT                   regulatory protein bll4018 SWALL:BAC49283 (EMBL:AP005949)
FT                   (230 aa) fasta scores: E(): 1.8e-26, 40.8% id in 223 aa,
FT                   and to Thermoanaerobacter tengcongensis transcriptional
FT                   regulator tte2558 SWALL:Q8R766 (EMBL:AE013196) (225 aa)
FT                   fasta scores: E(): 1e-12, 31.52% id in 203 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37744"
FT                   /db_xref="GOA:Q63NK3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NK3"
FT                   /protein_id="CAH37744.1"
FT                   /translation="MEKISSDTGSAYDEIRSRIFDGRLSPGQKISHRGLAHELGVGQMP
FT                   VRSALQLLASEGLVNIVDKSGTFVNEPTRDDLREIYELRLALESTAAYLAARGGVTDGL
FT                   SRSHAQMRRLVDENIADIMTEQKIGWVFHDEIFKAARNDRLFTTYKLLRAQTHALNELP
FT                   RSDFATVRRGTLEHLEIYAAIDARDAETARRRMWNHVIDGTPDRIRLIRAQYDTGQ"
FT   misc_feature    complement(399558..399689)
FT                   /note="Pfam match to entry PF00392 gntR, Bacterial
FT                   regulatory proteins, gntR family , score 38.4, E-value
FT                   1.7e-11"
FT   misc_feature    complement(399612..399677)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1246.000, SD 3.43 at aa 7-28, sequence
FT                   ISHRGLAHELGVGQMPVRSALQ"
FT   CDS_pept        399920..400390
FT                   /transl_table=11
FT                   /locus_tag="BPSS0297"
FT                   /product="putative acetyltransferase"
FT                   /note="Similar to Listeria innocua hypothetical protein
FT                   lin2871 SWALL:Q927B8 (EMBL:AL596173) (153 aa) fasta scores:
FT                   E(): 5.2e-07, 33.61% id in 119 aa, and to Bacillus subtilis
FT                   YitI protein SWALL:O06744 (EMBL:Z99109) (154 aa) fasta
FT                   scores: E(): 4.6e-05, 27.48% id in 131 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37745"
FT                   /db_xref="GOA:Q63NK2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NK2"
FT                   /protein_id="CAH37745.1"
FT                   /translation="MLVHQQSYSIVTVPVASVLPLRARILLDGDENASRFPCDDHDATL
FT                   HLAARTSDGIVAVATICRQPFREFPPDGAWRLRGVAVEPLMQGHGVGTRLMHACIEHAQ
FT                   RQDARVVWCTARDSARGFYAALGFATSGTPLAIAARPDMVFHEMHLLLPGRA"
FT   misc_feature    400058..400306
FT                   /note="Pfam match to entry PF00583 Acetyltransf,
FT                   Acetyltransferase (GNAT) family , score 56.3, E-value
FT                   4.2e-14"
FT   CDS_pept        complement(400571..401470)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0298"
FT                   /product="putative transport related membrane protein"
FT                   /note="Similar to Xanthomonas axonopodis hypothetical
FT                   protein xac0191 SWALL:AAM35083 (EMBL:AE011644) (305 aa)
FT                   fasta scores: E(): 3.3e-21, 31.86% id in 295 aa, and to
FT                   Aquifex aeolicus hypothetical protein aq_1392 SWALL:O67397
FT                   (EMBL:AE000738) (292 aa) fasta scores: E(): 3e-14, 28.85%
FT                   id in 298 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37746"
FT                   /db_xref="GOA:Q63NK1"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NK1"
FT                   /protein_id="CAH37746.1"
FT                   /translation="MASLILVLACLVAGAALARSKRLPANFPASLNYFVIQISLPALVL
FT                   QHLHRIAFGADVVWLFATPAIVFAATAALALAAGALLRLDKATVGCLTLVCGTSNTSIV
FT                   GVPVVQALIGSAAVGHALVVDQANFIVMCTAGLVAADLYAGGATRWRGVARQLAGYRPI
FT                   QAMALALLLRPVPFAPVVEDVLTLLGATLTPIAMISVGASFSVRHARDAARNFLVGIGL
FT                   KLLVVPAIVLACGLYVFSQQGVPLAVALVQATMPPMIVAGLIAIDKKLDPPLAGALMTL
FT                   GVPVSIAAAWLWRGVLPY"
FT   misc_feature    complement(order(400586..400654,400673..400741,
FT                   400751..400819,400853..400921,401099..401167,
FT                   401225..401293,401336..401404,401417..401461))
FT                   /note="8 probable transmembrane helices predicted for
FT                   BPSS0298 by TMHMM2.0 at aa 4-18, 23-45, 60-82, 102-124,
FT                   184-206, 218-240, 244-266 and 273-295"
FT   misc_feature    complement(401054..401380)
FT                   /note="Pfam match to entry PF03547 Auxin_eff, Auxin Efflux
FT                   Carrier , score 24.6, E-value 3.1e-06"
FT   CDS_pept        complement(401900..403765)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0299"
FT                   /product="putative fatty-acid CoA ligase"
FT                   /note="Similar to the N-terminal region of Streptomyces
FT                   coelicolor polyketide synthase sco5892 or sc3f7.12
FT                   SWALL:O54155 (EMBL:AL939125) (2297 aa) fasta scores: E():
FT                   2.6e-69, 41.73% id in 587 aa, and to the full length of
FT                   Mycobacterium tuberculosis putative fatty-acid--CoA ligase
FT                   rv1521 or mt1572 or mtcy19g5.07 SWALL:FD25_MYCTU
FT                   (SWALL:Q50586) (583 aa) fasta scores: E(): 5.3e-56, 36.65%
FT                   id in 592 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37747"
FT                   /db_xref="GOA:Q63NK0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NK0"
FT                   /protein_id="CAH37747.1"
FT                   /translation="MSSIQSALAACRSLTAPPPLAPAANFADVLRYRAETTPDEFAYGY
FT                   LGFGRMPDRVMRYGDIHRRALGIAREIVAHGRPADPVLLIFPSAADFVEAFFGCLYAGR
FT                   MAVPALPPRTEKERRRLISIARDCAPSFAICGNGEMDAVLAELCAAGVVAPPCREVGAI
FT                   ADGGDIGDAPGALPAIAPGSIAFLQYTSGSTSDPKGVMVGHDNLLANERLLRRHWGSDR
FT                   ERWLIVSWLPHYHDMGLIGGILQPIYAGRPAVFMSPQDFLQHPARWLHAVSDYGATCSG
FT                   APNFGYELCRRRASRMDLARLDLSTWEQAFNGAEPVRPRTLREFADAFACAGFRYDAFA
FT                   PCYGLAELTLAATSKQIGESVVIRRADRAALAAGRFEPQQDGGRSVDAVSVGALEHAHQ
FT                   TFCIVDPATGEPQPTGAIGEICVASDSVCHGYFGRPDATEATFHAYRSSAFPDGMLRTG
FT                   DLGFIDEAGHLFVSGRIKDLIILNGVNYYPQDIEGAVLNVSDQIRANRLAAIMVERDEQ
FT                   AGVVVVLEAIGRFDLAALAPEIAREVWDACQLTLSGVIRVKKGEIHTTSSGKIQRATCA
FT                   KMLADGAFTIEDAHLHDTARAWLAPVVERCGRACREPSADTPAVA"
FT   misc_feature    complement(402248..403594)
FT                   /note="Pfam match to entry PF00501 AMP-binding, AMP-binding
FT                   enzyme , score 226.4, E-value 2.8e-65"
FT   misc_feature    complement(403172..403207)
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT   CDS_pept        complement(403782..404681)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0300"
FT                   /product="putative malonyl CoA-acyl carrier protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   malonyl CoA-acyl carrier protein transacylase FabD or TfpA
FT                   or b1092 or c1361 SWALL:FABD_ECOLI (SWALL:P25715) (308 aa)
FT                   fasta scores: E(): 2.6e-24, 34.75% id in 305 aa, and to
FT                   Bacillus subtilis PksC protein SWALL:O34825 (EMBL:Z99112)
FT                   (288 aa) fasta scores: E(): 1.3e-39, 43.35% id in 286 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37748"
FT                   /db_xref="GOA:Q63NJ9"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NJ9"
FT                   /protein_id="CAH37748.1"
FT                   /translation="MKALIFPGQGAQAAGMGAGLFERFPEIVATANDVMGLSIERLCLD
FT                   DPHGQLADTRYAQPAIFVVNALHLAAWRDAHDTGDGAPVWLAGHSLGEYSALLAAGVFD
FT                   FRTGLEIVKRRGELFASAGGGAMAAVVGVTAAELGRRLRAAGFDDIDLANLNSAEQTVI
FT                   AGPAASVDAAASMLDAGGDVTVHPLKVSGAFHSRRMTPLKPAFEAFVSRFALAEPARPV
FT                   VSNVTARPYQPPGTPADYLVEQLDQPVRWRDSVRHMLRAGVDEWIELGPGRRILTRLVD
FT                   AIRLEPPERHAAPQPALP"
FT   misc_feature    complement(403788..404678)
FT                   /note="Pfam match to entry PF00698 Acyl_transf, Acyl
FT                   transferase domain , score 69.3, E-value 5.4e-18"
FT   CDS_pept        complement(404682..405113)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0301"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37749"
FT                   /db_xref="GOA:Q63NJ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NJ8"
FT                   /protein_id="CAH37749.1"
FT                   /translation="MKLVLFLHLIFVAAWMSCVIVEGIFEHAIDRSPEQRAFISKLHWT
FT                   TDKYVEIPAFTIVLITGAVLLMHRAPTPLLLTKVAFGTLAIALNAVCVWIVIRRMRYAA
FT                   QADHAAWERIDRLQHKLGGVVAISMLVALGIGGYLFAGG"
FT   misc_feature    complement(order(404694..404753,404823..404891,
FT                   404901..404969))
FT                   /note="3 probable transmembrane helices predicted for
FT                   BPSS0301 by TMHMM2.0 at aa 34-56, 60-82 and 106-125"
FT   CDS_pept        complement(405181..407040)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0302"
FT                   /product="putative fatty acid biosynthesis-related CoA
FT                   ligase"
FT                   /note="Similar to Escherichia coli probable
FT                   crotonobetaine/carnitine-CoA ligase CaiC or b0037
FT                   SWALL:CAIC_ECOLI (SWALL:P31552) (522 aa) fasta scores: E():
FT                   2.8e-37, 29.91% id in 488 aa, and to Mycobacterium
FT                   tuberculosis putative chain fatty-acid-CoA ligase FadD13 or
FT                   rv3089 or mtv013.10 or mt3174 SWALL:O53306 (EMBL:AL021309)
FT                   (503 aa) fasta scores: E(): 5.9e-43, 32.62% id in 518 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37750"
FT                   /db_xref="GOA:Q63NJ7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NJ7"
FT                   /protein_id="CAH37750.1"
FT                   /translation="MSSLSQQLSALGSRIFTSAPFGPGVSMQNLAEWSSLAHVQLLGRV
FT                   AAEFGVDIDIEEAYRLDSFERLLHYIERQRGPGDEAPPASAASATAAGDAGEAPATIGA
FT                   LLRARAAALPDEPFLFFPADDRSYTYRAFHGLACAAAETLRAHGLARGDRLCVVLPNGP
FT                   EFLAYYFGAHLLGVVSVPINPALTAAECAYIVRNSGAKLVVFDRRMTNLREAVRTELAD
FT                   DRGARLASADAASGFGLEALAAAADHATLAPEPGLAADDDASILYTSGTTGHPKGVVLS
FT                   HRNLLSDARALVDWFAFEPGTRTMCILPLFHNNGQVITLLSPLFAGGSSVILEGKSALP
FT                   SFWKLIDTYRVNWTSVMPAFLSAFLEYGLKRTDDTLRGIVCGGQVLLDEVRSRFETEYR
FT                   VPVFEGFGLTETTSFATMNRHPAERRRFGSIGVALPCNALRIVDANGREAAANETGEIL
FT                   IRGENVAVRYHGRAELTAERFRDGWLHTGDYGYRDDDGHFFFATRIDDLIIKGGENIYP
FT                   AEIENVLHGCGDVVECAALGVPDPILGQEVCVYVKLRPASTLGKDDIRRLCEGRIAHYK
FT                   CPRHVVLLNELDDLPELPKGPTRKILRRKLLAHFATLRERAAA"
FT   misc_feature    complement(405436..406656)
FT                   /note="Pfam match to entry PF00501 AMP-binding, AMP-binding
FT                   enzyme , score 415.1, E-value 4.1e-122"
FT   misc_feature    complement(406213..406248)
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT   CDS_pept        complement(407070..408329)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0303"
FT                   /product="putative diaminopimelate decarboxylase"
FT                   /note="Similar to Pseudomonas aeruginosa diaminopimelate
FT                   decarboxylase pa5277 SWALL:DCDA_PSEAE (SWALL:P19572) (415
FT                   aa) fasta scores: E(): 1.6e-21, 31.68% id in 404 aa, and to
FT                   Escherichia coli diaminopimelate decarboxylase LysA or
FT                   b2838 SWALL:DCDA_ECOLI (SWALL:P00861) (420 aa) fasta
FT                   scores: E(): 4.8e-19, 31.76% id in 403 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37751"
FT                   /db_xref="GOA:Q63NJ6"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NJ6"
FT                   /protein_id="CAH37751.1"
FT                   /translation="MNANLHAFTAADAAPSTEYWWARERLHYRGNALHFCGRDVAELAA
FT                   AFAEPVFLYDPQRALDNVARLQRALGDLQRGDFRLHYAMKANRFRPLLSELRRSPLFGI
FT                   DACSPEELREALACGFAPERISYTAHGMMPDEAALLAALPGVHVNCDTLSAIALLGSRS
FT                   PGREIGIRVNPGVGIGYGDSERLSYAGAAVTKFGIYAEQFGAALELAARHGLAVTWLHC
FT                   HAGCGYLDAQLESFERVLDALDAFAARVPGLRGINLGGGLGLPHRATDRPLDLERWRAA
FT                   VHARFGGRPLAIAIEPGDFIAKDAGMLVLRVAYVELKRNRRFVGLNGGFNLAIEPAFYD
FT                   LPCEPVPCVRRPGPAQSVCVAGNINEALDVWGNDVSLPPVEPGDFIALLNAGGYASSMS
FT                   SNHCLRGQFRELALFDAAPH"
FT   misc_feature    complement(407088..407411)
FT                   /note="Pfam match to entry PF00278 Orn_DAP_Arg_deC,
FT                   Pyridoxal-dependent decarboxylase, C-terminal sheet domain
FT                   , score 48.8, E-value 8e-12"
FT   misc_feature    complement(407418..408161)
FT                   /note="Pfam match to entry PF02784 Orn_Arg_deC_N,
FT                   Pyridoxal-dependent decarboxylase, pyridoxal binding domain
FT                   , score 63.3, E-value 3.4e-16"
FT   CDS_pept        complement(408326..409807)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0304"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37752"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NJ5"
FT                   /protein_id="CAH37752.1"
FT                   /translation="MSARRLYVGATFTASPLDPLLRARGFGDVAFARYNQLLQALVAPD
FT                   PRHADDATLLLVRLADFVRHEANDRAQSPDALAALLAQRADAWLDALASFAAGRARPPC
FT                   IVVLPSPALDARGAAPADTGRRLERALLGVPGLRALDWADFAASSAIAQPFDPIADKLG
FT                   HVPLSIEGFAAFAQWLAERLRGEAGEAAHAGKHGGDAAPAGANANPSARAEADAARSPA
FT                   GAHANVDPHAAADIAAATGRAAAAHPGAEAAGPADAAAARAAVPPHARAPADAPAPAAS
FT                   PAAPSPSLARFFERLQLRIAGVALDDETALAKSARLSHTAATFHLSGRPYLEADLLDAT
FT                   SRDAAALALTAADRFGQYGCSGFVLVRADAGLPVLAEFVLSCTVLGKQVEHGVLLALAQ
FT                   AARRAALPAVALDYVRTDGNRPAVDFVDAIAAQAGVALDRSGPRARLRIAPCALAEAVL
FT                   ACAKAPQALAAAAQALDLAPLFSHSNATAHPAAHR"
FT   CDS_pept        complement(409804..410859)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0305"
FT                   /product="putative ketol-acid reductoisomerase"
FT                   /note="Similar to Bacillus subtilis ketol-acid
FT                   reductoisomerase IlvC SWALL:ILVC_BACSU (SWALL:P37253) (342
FT                   aa) fasta scores: E(): 7e-27, 36.91% id in 298 aa, and to
FT                   Neisseria meningitidis ketol-acid reductoisomerase nma1763
FT                   SWALL:ILVC_NEIMA (SWALL:Q9JTI3) (337 aa) fasta scores: E():
FT                   9.9e-31, 35.71% id in 322 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37753"
FT                   /db_xref="GOA:Q63NJ4"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NJ4"
FT                   /protein_id="CAH37753.1"
FT                   /translation="MNDLIYQDEHASLQPLEGLTVTVIGYGIQGRAFAANLRDSGVAVR
FT                   VGNIDDRYFELARAEGHRVTDIAEAVAHADIVLLLIPDEAHGAVFDVDIAPNLREGALL
FT                   CVAHGHSLVQGDVRPLAGRDLAMLAPRMYGDPIRRYYLAGQGAPAYFDIVADHTGRARD
FT                   RVLAIARAVGFTRAGVMALGYRQETFLDLFQEQFLAPALVDLVETGFQVLVERGFNPKA
FT                   ALLEVYGSGEMGKMMLDGADIGLDEVVALQGSPTCQVGYHRWRGRTLPAAVRELAARVL
FT                   DQIDSGDFAAYLKEHAANDYAALDEARRAALKRPLNVAHAQVRAAFRFPTEAAGGLYQA
FT                   APAGAEPELAR"
FT   CDS_pept        complement(410865..423266)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0306"
FT                   /product="putative multifunctional polyketide-peptide
FT                   syntase"
FT                   /note="Similar to Xanthomonas albilineans albicidin
FT                   multifunctional polyketide-peptide synthase XabB
FT                   SWALL:Q9AIT3 (EMBL:AF239749) (4801 aa) fasta scores: E():
FT                   1.4e-123, 36.11% id in 3458 aa, and to Bacillus subtilis
FT                   putative polyketide synthase PksM or PksY SWALL:PKSM_BACSU
FT                   (SWALL:P40872) (4273 aa) fasta scores: E(): 2.3e-93, 36% id
FT                   in 2861 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37754"
FT                   /db_xref="GOA:Q63NJ3"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NJ3"
FT                   /protein_id="CAH37754.1"
FT                   /translation="MTASPPSSALVTAVEAAVLSLAGDVAGRAFDASAAERPLHALGFD
FT                   SVQYVELSGCLNEYYGLDLAPTLFFDVHVPRRIAEHLVARHPAALARKHGIGAGDDADT
FT                   AARARAAAAENGAPQPDMRAGAARPAGEPLLDTHASPGEPRGDAHENPCDDTRGAAAAD
FT                   AHESAADIAIVGMAGIFPQSADLDAFWRHLAAGDDLIAEAPASRWDWRAGDGEPASRWG
FT                   GFIPRIEYFDAAFFGISPREAEQMDPQQRLLMQTAWAALEDAAVRPSDLMGSDAAVFVG
FT                   VSTSDYMALLPGADGHLAVGNAHAMLPNRLSHLLGAHGPSEAVDTACSSSLVALHRAVR
FT                   ALRRGESSVAIVGGVNVMLTTRLHRALAAAGMLSPDGRCKTFDAAANGYVRGEGIAALV
FT                   LMPLERARANGHPVRAVIKGSAVNHGGRAAFLTAPDINAQAALIEAAYRDAGVDPATVS
FT                   YIEAHGTGTSLGDPIEVQALRQGLDACARDLAGTASHAPARCGLGSVKTNIGHLEAAAG
FT                   LAGVVKVVLAMDRRMLPPSLHCRELNPYLKLDGSRYHVVTEPTPWPDEATPTPLRAGVS
FT                   SFGFGGSNAHVVLQSAHARPIARASAPPPPHTNEQAGADAPAADGPRAWFIPLSARTDA
FT                   ALHARAAQLAHWLDTEPADDAWLPALAKTLSIGREPMACRFGITCASLDELRAQLAIAL
FT                   GGRATSLARDDARLRPHAPACAAWLAGETDPLPAAWDDATPRLRLPVYPFEGERHWPTE
FT                   AAPAARFALAPDADGAYRIAIAPDAPLVADHRLAGEPVLAAAAQIVIAWRAFEADALAG
FT                   DAGQAGDVGESMESMESMESNGSSASKPAATSADSGTAADSRDLHDSYHSHDFRHTIDT
FT                   IDTIDTIDTNATSAATPIALCDIEWLAPIAIGAPTDLCITLARDAHGDIDARRGEAAHR
FT                   RANGRAARFAIAAAPAIDTPLGRGHATRIASAPSNAPELDIEAIRARCTQAVSADACYD
FT                   AFAAIGIDYGPTFRPLRAIAVGRDEALAEFDASALARTTGDARIVALLDGAFQAIAGLT
FT                   LAHAASLESGLLPASLARIEFTGPLADSVRAWIREAPSDTGRRTFDIDLVTASGRSCAS
FT                   LRGLALASGRSATSREAPRITTPGDHLFAPQWLPCATNAAGAATPSPRAGALAIMGGTP
FT                   AQRAALAATHAAAQRLIDDIAELDANVSHLVWLPSAPADTHAPLAQCASLDGLRLVKRL
FT                   LALGAGDRAFDLTVLTVRSWTMPGDAPAFPAHADLAGLCGALANEYPHWRVRLIDLPDA
FT                   AALPADWHARSAEGGHPLLLHRHGQWFARRLVPLAALPAPAAQPYRPGGVYVAIGGAGG
FT                   LGRVWTEHAIRACGAQVVWIGRRPLDAQIDAHCDALAALGPRPSYLSADASDAESLRAA
FT                   RDAVLERFGRLDGVVHTAIVLEDGGLAQLDEARFSAALNAQVATTANLARVFGSDPLDF
FT                   ILFFSSLQSAFVAAGQSNYAAGCTFRDAFADWLRTQLRCAVKVVNWGYWGQTGVVATEP
FT                   YRARMAALGIGSIEPAPAMAVVDALLASNVDQVGYLKTIASAAVPTLAPALAARIAPRT
FT                   RALAGTPPRVDATDDSAAWRDALAALERAIARRLFAELGALRVFGGSGAPGGHAFDDGA
FT                   ARNSAAGQRSADDRAPDAAPFDIDTALRTGRIAPAYRRWLAHALTLIARHGPLAWDGRS
FT                   GRLAEAPPTPDAARAEWARARAELERTALLDAHLALVDATLDALPAILQGSVPATSILF
FT                   PDGDLSRVEAVYQRNEQADRCNRALADAVLHLVGDASSAQPAALAEIGAGTGGTTVPLL
FT                   AALDARGARLGRYDFTDISKAFLLNAEQTFGRGRDMLRYRLFDVERPIAEQALDTGGYD
FT                   IVIATNVLHATQDIGVTLRNAKALLKAGGHLIINELLGTHGFAHATFGLLPGWWRHRDS
FT                   ARRLPGSPLLSRDGWTRALREAGFAVLDGGSAGAAAGQGVIVALSDGVIVQPSHADARA
FT                   ASCAASRAAPGDDAGAHASAARPAASACSTASPAHAPAASPIAAAPTGASLRARCVQAL
FT                   AQLVARTLKMPVGKLAPDQPLGSYGVDSILVIGLTKTLRETFGVALSNATLFEHATLNA
FT                   LAEFFVAEHRAACERVLGGGAEPAPNAPNGPNAASAAAATRPAMPPARAGAPSPAAASA
FT                   APKPRESNVCAPPAADDTAVAVIGMSGRYAQADNLREFWANLRAGRHCITEVPAERWDW
FT                   RTHFDAEKGAPGRTYSRWGGFLTQIDRFDAAFFRIAPNDAEQIDPQGRLFLEESWAAIE
FT                   DAGYTSDTLSADRRVGVFVGVMNGDYPTGAQFWSIANRVSHALDLHGPSLAVDTACSSS
FT                   LTAIHLALDSLRSGTCDCALAGGVNLIQSPKHLVGLASLTMLSAGDACRAFGAGADGFV
FT                   DGEGVGVLVLKPLSRALADGDAIHGIIRGSMINAGGKTHGLTVPNPRAQQAVVGAALAR
FT                   SGVPARAVGYIEAHGTGTALGDPIELAGLTRAFAEATDELGFCALGSVKSNIGHCESAA
FT                   GVAGVTKVLLQMKHRELVPTLHAHEPNPDIDFARSPFVLQRTLAPWPQPALDGWPRIAG
FT                   VSSFGAGGANAHVVLEEFIETRAAGGDDAGPAIVVLSAATDAALRRRARQLHAALAAGE
FT                   IGDERLHDLAYTLQIGRAAMVSRFGCVAGSAAELQAQLAAFVEGDASRGWHAHRLAGDR
FT                   HGLAELDADPELRASLVEQCVAAGKLDRLAALWCQGLGIDWPTLHRGRARRRMHLPTYP
FT                   FDGPRYWLRDDAAHAAEPAPADGAAEDASADAPNAANAPTPDVATLVRRTVAQVLGYPD
FT                   VDMNESFLSLGGDSIRAARAHRVLQRALDTRIPLSLMLEASTLAECAQAIDALLSTQPE
FT                   PASALACETNAGAAGAPIADAAALESPAPPSRESASPPHPASPPRDARPRVHPLSSNQQ
FT                   QFFFLDRLNPANPAFNLPGALRVRGEWHAHALEATYQALIDTHDVLRTRFVVRGGEPCA
FT                   EVAPHRAAAIRRHDLTALLPKHQAARVAECLTESSREGFALEQGEPSRLTVLELRDDDH
FT                   VILLNLHHIVGDAVSVVVLLDALARAALTGRAAAPDRARPQYAQWAAHERDALPATIER
FT                   ELPYWLERLRDVPPPLPLPCDRARPPVPSYRGRSVPLAFAPALITLLDAYCKAHGLSRF
FT                   VVMLAAFKLALRVLSGRDDVVVGSPYANRAEDDTADMIGSLAYALVLRTRLGEAQTFAD
FT                   AVALVRRTVHDAFDHLGVPYPRLVEALNPARHGGANPLYQIMFNVIPMPALPEGVEPVE
FT                   VDSGWLDYDLFVRLRASSHAIDGVLQFSADLFDRSTAEAIAAYYVELLHTLLAHPSLPL
FT                   ASLAPPAELALERTIADAMPPLRIEIASTFTDRPLAGTLRYWGTATGQPIEPNFAPYGQ
FT                   LFQTLYDPSTPFHANRHGTNVVLVRPCDWLRFDDANADAARADLTGDAGAAAAERIALY
FT                   ADELADALRDAAPSLAVPVLVLVLPDDAASLAARDEHTGTATEAPAEALADARAGKPSP
FT                   DTSLAPYRMLRAALADLPSITVAHWRDVAAIYPVADVFDPHADAAGHVPFTSEYYAALA
FT                   SYIARTAFQHASVPLDDAWNRLAAQIRDDAEHLLAAPADGARARRAPHAAPTNETQATL
FT                   LPIFAAALKLDDPGIDDNFFDCGGHSILAIGVVHQINEAFGTSLSVADIFMAPTVRRLA
FT                   ERMRDAPDGPEYVELASAAALPDDIAPLPGPVADAPRALLLTGATGFVGRHLLRELIDR
FT                   TSATIYCLVRAPDAAQGLARIRATLERWSLWRDGDAARVIAVPGDLGRPRIGLSDAARA
FT                   RLVAEVDAIYHNGTSMNHLESFEMARAANVGGVIELLRIATEGRPKTFNYVSTLAVFSM
FT                   RERTGTHVFDESAPIDGERHPSDQGYTTSKWVGEQLTHLAAARGVPCNVFRLGLVTGDV
FT                   RHGHYDELQAYYRLLKSCILMGAAFDDFRYDLVITPVDYVARALAHLGARHSQGGRVFH
FT                   LSTMQVTPMRTVFEMMNAHLRTPMRMLTHRAWIDELRVRYRRGDVQSIVPVVQWMMNMS
FT                   DAELVKLAREREETTFIYDCTATHRELEQAGIVVPVFDDALLQRYLRGMFNDDADLRAL
FT                   AAQLDGGECASPLHSHT"
FT   misc_feature    complement(412149..412343)
FT                   /note="Pfam match to entry PF00550 pp-binding,
FT                   Phosphopantetheine attachment site , score 66.4, E-value
FT                   3.9e-17"
FT   misc_feature    complement(412227..412274)
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT   misc_feature    complement(413595..414494)
FT                   /note="Pfam match to entry PF00668 Condensation,
FT                   Condensation domain , score 157.6, E-value 1.4e-44"
FT   misc_feature    complement(414663..414857)
FT                   /note="Pfam match to entry PF00550 pp-binding,
FT                   Phosphopantetheine attachment site , score 31.4, E-value
FT                   1.3e-06"
FT   misc_feature    complement(415464..415982)
FT                   /note="Pfam match to entry PF02801 ketoacyl-synt_C,
FT                   Beta-ketoacyl synthase, C-terminal domain , score 276.3,
FT                   E-value 2.5e-80"
FT   misc_feature    complement(416004..416711)
FT                   /note="Pfam match to entry PF00109 ketoacyl-synt,
FT                   Beta-ketoacyl synthase, N-terminal domain , score 365.5,
FT                   E-value 3.6e-107"
FT   misc_feature    complement(416217..416267)
FT                   /note="PS00606 Beta-ketoacyl synthases active site."
FT   misc_feature    complement(416922..417122)
FT                   /note="Pfam match to entry PF00550 pp-binding,
FT                   Phosphopantetheine attachment site , score 54.0, E-value
FT                   2.1e-13"
FT   misc_feature    complement(417000..417047)
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT   misc_feature    complement(421488..422027)
FT                   /note="Pfam match to entry PF02801 ketoacyl-synt_C,
FT                   Beta-ketoacyl synthase, C-terminal domain , score 274.2,
FT                   E-value 1.1e-79"
FT   misc_feature    complement(422049..422765)
FT                   /note="Pfam match to entry PF00109 ketoacyl-synt,
FT                   Beta-ketoacyl synthase, N-terminal domain , score 363.9,
FT                   E-value 1.1e-106"
FT   misc_feature    complement(422262..422312)
FT                   /note="PS00606 Beta-ketoacyl synthases active site."
FT   misc_feature    complement(423021..423221)
FT                   /note="Pfam match to entry PF00550 pp-binding,
FT                   Phosphopantetheine attachment site , score 32.2, E-value
FT                   7.8e-07"
FT   CDS_pept        complement(423325..424737)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0307"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /note="Similar to Bacillus subtilis betaine aldehyde
FT                   dehydrogenase GbsA SWALL:DHAB_BACSU (SWALL:P71016) (490 aa)
FT                   fasta scores: E(): 6.9e-59, 40.08% id in 474 aa, and to
FT                   Salmonella typhi putative aldehyde dehydrogenase sty1467
FT                   SWALL:Q8Z747 (EMBL:AL627270) (481 aa) fasta scores: E():
FT                   1.2e-101, 59.02% id in 471 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37755"
FT                   /db_xref="GOA:Q63NJ2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015657"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NJ2"
FT                   /protein_id="CAH37755.1"
FT                   /translation="MLINGLCIEGGGEPLPIVDPATGEPLAAPAAASAADLERAVAAAE
FT                   AAFPAWRATTPATRASLLLALADEIDRQAGALARIESRNTGKPLHLVVQDELPAVADCF
FT                   RFYAGAARTASGPSAGEYVEGHTSMVRRDPVGVVAQIAPWNYPLMMAAWKLAPALAAGN
FT                   TIVFKPSEWTPLSIVALEAALARIFPAGVVNIVLGDGASVGRALATHPRVRMISLTGSV
FT                   EAGKSVLAAAACNLKRTHLELGGKAPVLVFDDADLDAAVAGIRYAGFYNAGQDCTAATR
FT                   IYVQRGIYDTLAQRLADAASTLRVGPPDRADAEMGPLVSAAHRARVERFVREAAALRHA
FT                   RVLTGGAPLPGPGCYYAPTVIAGVRHDDAPMRREAFGPVVTLTPFDTESQALRWANDSE
FT                   YGLASSVWTRDAARGMRLAACIDAGVTWVNAHFTYTADMPHGGTKQSGYGSDLSTLGLA
FT                   DYTQPRHVMWRH"
FT   misc_feature    complement(423328..424719)
FT                   /note="Pfam match to entry PF00171 aldedh, Aldehyde
FT                   dehydrogenase family , score 569.6, E-value 1.4e-168"
FT   misc_feature    complement(423898..423933)
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT   misc_feature    complement(423994..424017)
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT   misc_feature    complement(424057..424080)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(424731..426152)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0308"
FT                   /product="putative aminotransferase"
FT                   /note="Similar to Rhizobium loti aminotransferase mll3663
FT                   SWALL:Q98FQ6 (EMBL:AP003002) (472 aa) fasta scores: E():
FT                   4.5e-88, 48.42% id in 444 aa, and to Pseudomonas aeruginosa
FT                   probable class III aminotransferase pa4805 SWALL:Q9HV04
FT                   (EMBL:AE004893) (468 aa) fasta scores: E(): 4.9e-82, 47.21%
FT                   id in 449 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37756"
FT                   /db_xref="GOA:Q63NJ1"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NJ1"
FT                   /protein_id="CAH37756.1"
FT                   /translation="MAYRNDSLLTSAQQDTRHLLHPWADLSALGRETPTVIVEAQGTRV
FT                   TDAEGRTYLDAIGGMWCVTLGYGRREIADAIRDQALRMPFYTPFGAMTNEPAAALGARL
FT                   AALAPGDLKRVHLTTCGSTAVESALRFAHYYFGATGRPHKRHIVTRGDAYHGSTYLAAS
FT                   ISGKAWDRTCFHYDSTIVHHLSSPNPYRRPAGMSVDAFCASLVDEFDALIAKLGAEQIA
FT                   CFIAEPILASGGVIVPPPGYLAAMRERCRRHDILYISDEVVTGFGRVGHFFASHAHFGI
FT                   EPDMIVVAKGLTSGYQPLGAVLISERLVDAVSGEHAYGNGVFTNGFTYSGHPVACAAAL
FT                   ANIELMERERICEHVRDVGPYFIRRLDALRRLPIVGDVRGDHLMACIECTSGAGATGAL
FT                   PTPADIAIAQRVDRHCEEMGLLVRPYESMCILSPPLTVTRADIDEICAILAAALERAQR
FT                   ELAQHAPVREENETC"
FT   misc_feature    complement(424782..426077)
FT                   /note="Pfam match to entry PF00202 aminotran_3,
FT                   Aminotransferase class-III , score 325.3, E-value 4.5e-95"
FT   misc_feature    complement(425268..425384)
FT                   /note="PS00600 Aminotransferases class-III
FT                   pyridoxal-phosphate attachment site."
FT   CDS_pept        complement(426161..427240)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0309"
FT                   /product="putative peptide synthase regulatory protein"
FT                   /note="Similar to Pseudomonas syringae syringomycin
FT                   biosynthesis enzyme SyrP SWALL:P97053 (EMBL:U88574) (353
FT                   aa) fasta scores: E(): 2.4e-22, 31.43% id in 334 aa, and to
FT                   Streptomyces verticillus SyrP-like protein SWALL:Q9FB16
FT                   (EMBL:AF210249) (339 aa) fasta scores: E(): 1.8e-21, 29.51%
FT                   id in 332 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37757"
FT                   /db_xref="GOA:Q63NJ0"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NJ0"
FT                   /protein_id="CAH37757.1"
FT                   /translation="MRDRAPRRPLHQYKEKRAMDSFIELQENDRRQVPVRGRAYLAGAD
FT                   SPLVPVTIPIANDLALGLAQAAATPAEAAALCRDAIDARLPATGALLFRGLPIADRAGF
FT                   DTFMRALGYAPRSYDGGIAVRARDAGYALVASQEDPRITMAPHNEMAYLPNPPRKVFFF
FT                   CAAAADEGGEVPINDVRLAAAQIPDEVLAQFERKRIGYHRHLPRESTPTQIGWTDTFGV
FT                   RERDAVDALMRDKGYEHRWLDGDGLGYGYVHDAFLDDPAGGAPLWFNQVTELHASYWRS
FT                   HPLFPSDWDDARYPATTTYGDGEPIDPELVTKLRAALWRTSRAVAMRPGDVLVLDNVYV
FT                   QHGRFAFSGPRLHLVSLTD"
FT   CDS_pept        complement(428238..428756)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0310"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37758"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NI9"
FT                   /protein_id="CAH37758.1"
FT                   /translation="MTITLIEPVQQRTGIYPSSDLKVEDGYPSSDTFQIIQTQDGRGAG
FT                   VRVLKAFARGRRMARVSGQITAFCRLHTLQINAHTHLYDPHFSGLLLHSCDPNVRLDMA
FT                   GFELWSLRDIAAGEMLTMDYASTEDVLMRQFECHCGAPNCRRWITGAKELPNDSGQTLL
FT                   AGLRAAEIA"
FT   CDS_pept        complement(428856..437384)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0311"
FT                   /product="putative multifunctional polyketide-peptide
FT                   syntase"
FT                   /note="Similar to Microcystis aeruginosa peptide synthetase
FT                   and polyketide synthase McyG SWALL:Q9FDT8 (EMBL:AB032549)
FT                   (2632 aa) fasta scores: E(): 1.9e-45, 25.62% id in 2420 aa,
FT                   and to Ralstonia solanacearum probable polyketide synthase
FT                   protein rsc1810 or rs04235 SWALL:Q8XYE8 (EMBL:AL646066)
FT                   (2380 aa) fasta scores: E(): 1.5e-46, 29.7% id in 2013 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37759"
FT                   /db_xref="GOA:Q63NI8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NI8"
FT                   /protein_id="CAH37759.1"
FT                   /translation="MVLMRQIVSTSNGSLDSRARIIAFPFAGGSGASYADIARELGDAF
FT                   AFTTLSLPGRGATQHIPFYDDWPSLVDDLAAEVARLDDGTPFFLFGHSLGALLAYEVAR
FT                   TLEQRGGARPAGVFLSGHPAPSRERAAPAWRRQTHALPDAEFVEAVRRWGFFPEGALDD
FT                   PDVARYVLPPLRADLRLAETYRHARGDALRAPCAIYGGAADPSTSADDLRAWRAHVSPQ
FT                   HACPVESFDGHHFYFLDPSSRAALCASLAGHIEQRLAQRPASIVAAAPDPGSRVAACLR
FT                   TAGDWGDAQAVLAAIREHVARTPDALALQDGERTWTYRQLASHAAELADAFRAAGVGRQ
FT                   DVIGVFLPHGAEYVLTIVGAWSIGASVCLLEKSWPDSLVGEFVASCRVAQLATTPALLA
FT                   RAAKHLPDARCTLVGARPPLAQRAWTSVAPRPDDIAFVSLTSGSTGKPKAVLTTHVGTS
FT                   YCFHARDALYPYADGEREGLNVFLAWECLRPLMFGRPAVVIGDDVIFDPPRLVALLRRE
FT                   RITRLVVTPSLLESVLDFPGIAGQLRDALAHMSAWFLMGEVVPQRVVDKARAAFPPSVR
FT                   LVNAYSTWESLDVCYADLLPSRASDDGRRVPIGRPLPGCALAVLDEAGRAVPAGETGEL
FT                   YIASPALGPGYLDDAARTAEKFLPSVAALAERGHDAPAYRTGDRARLLPDGQIAILGRI
FT                   DNTVKIRGFKVLLHAIENVLDAVDGVSKTLVVPIDDPHTKQPSALAAYVVGRGGAPSET
FT                   TLARLRQQARAKLPEYAVPAHFIGLEAFPLRAGTSRKLDRRALPPPEPPAGASPAERGA
FT                   VPAAAGDGLEARLAEVWRDVLGVASVARDDNFFELGGNSLSAAKAVGALGERLGLSLAV
FT                   VDLYQHSRLRDLADYCRRSREEDAARGRADAARDARAARTASGAGAPKVAIVGMAGRFP
FT                   GADSVDAFWRNLTQGVDSLSRFTREQLLAKGVDAAQLDHPDWVSAAQVVGDADKFDALF
FT                   FGIGRREAVLMDPQHRLFMEVAWSALEQAGYARAENRYRTRTGVFASCGIDGYLVHHLQ
FT                   GGGLLTPLDPGRLMLTEIGNEKDYVATRVAYQLDLGGPAVSVGAACSSALVAVVQAVQA
FT                   IRAGQCEMAIAGASALSFPNFGFCYEDGLVGSADGHVRPFDARASGTLFGDAVGAVVLK
FT                   RLDLAEADGDPILAVISGVGLSNDGRMKAGYTAPNADAQRRCIVDALDMADVRSEQISY
FT                   VECHATATLIGDAIELKGLSDAFAQTRGADADAAAVAGRCAIGCVKGNIGHANCAAGIT
FT                   GLIKTVLQLRHRQRVPTVHFDTLNPKLVPFVEHDASPFVVQRHADDWTVADPATQLPRR
FT                   AGVSSFGIGGTNAHVIVEEAPPPARAAAPAESVPRAHHLMTVSARTPGALARNLQALAG
FT                   RLAALDAADLGCAAHTLHVAREAHPLRVALAVPARPADAAAALRASAAALAEASVDMPD
FT                   MSDAPAAPVRAKPGATVAFCFSGQGSQHPGMARELYRSNTEAGRFRHHFDAACAALERA
FT                   LGAPIAYAILNADDEAMRRPLVTQCGLFALEHALAAVLGEYGVRPVAVAGHSIGQYAAA
FT                   VAAEALTLEQAAALVAARAGATEALNAFSAGGGAPARGGMLAVTGDDARIEQWAAGRAD
FT                   VWIAVRNAPRTLVLAGAQPALADAARALAALGCRCRPVPVSHPFHTPLMQPVADAIIAQ
FT                   RIAGAAPRIPMTCNVTGGWLGADAASPGYWARHLLEPVRWSDNVAALLRWQPDVVLEIG
FT                   PGTVLCSLIGKHLAGGANAGAPARPNGHAGANAAALAPRVLPTLPAAGDDAHDAAHFCN
FT                   TIGQLWCAGVPIDWRAYHAHEAAAPGRALARVPLPGYAFERDSYWTRPRASIYVDAAQA
FT                   DAEPDAAPAAADHTDAADADSARAALADASDKTPAARAASTHTCSGECACERACAAEPR
FT                   PSGGVERVTAPPAPSSRGLVRLKPRRRPRMKLYCFPYAGGSSRSFDGWARTAPDWLDIV
FT                   AIEWAGRNARAEESLARDDAADLAAREAIAAAIVADAGELPVAFCGLSYGGAAATELLG
FT                   GPLRAWAASGRVKGLAIVGRAPLLEQPAIDAPADSFLLVPDALRDDPLWQEIFRPVLEA
FT                   DLDADARCAHRIAQRWRDGGRQPLLTVPLQIHGAHDDPAFDWRLAGDWARISSAPLASL
FT                   HRYPGGHDFMIRCEAEIVARVAAWLRPQRAARTAAPAPTFALHWQPRAIAPIAPITPNP
FT                   LAAADGSSAGASLADASQADTSGAAMGAAPGAAPLPECAVYAAGGEASAFERLAPLLRE
FT                   SGDEAALLCIGAADDPLGAAQCAGFVKLWQALAARECAGTLTLVLPAGAASGPLVGAAR
FT                   VASAEHAALRMRLVLADDHPDLAPRAADPRWAAGLARDAAHCGDEPWLLRRAGRMFAPR
FT                   LMPHAAPALPEGTLGAAGGPYLVTGAAGGVGRALVDWLIDEQQVPPQRLIALCRNADLA
FT                   PRGVRAVAADLADARALGAALESIGEVEGIFHLAGVLDDGVIANLDEARLRRVLAPKQS
FT                   LAALLAHAPRWRTRWAVAFSSTSALLGVPGQANYAAANAWLDQLACWPARAGEPPVLSI
FT                   QWGSWADVGMSARSDRAQRRAMQDGERALAPDAAFAALGALLAGMLGGAAAARQFAVCD
FT                   VDWPRSPWRDAPIVEAVARGAPNAGSEAEAAKVASATNRTKRADEASGANGWIAASSTP
FT                   VAMSSATPAAHVCGNACVDAAAPRAGDESDRARSPRPASEPARFAAPTVEAAAVAQAPA
FT                   ARATRSASAPDPVRAFLEDYVSRWDERLDLATLGLDSLDLAQMRNGFFKKFGVQIPLST
FT                   LASPTLKIGELARRMRNVAGIADE"
FT   misc_feature    complement(428925..429035)
FT                   /note="Pfam match to entry PF00550 pp-binding,
FT                   Phosphopantetheine attachment site , score 15.4, E-value
FT                   0.00082"
FT   misc_feature    complement(428967..429014)
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT   misc_feature    complement(429861..429893)
FT                   /note="PS00136 Serine proteases, subtilase family, aspartic
FT                   acid active site."
FT   misc_feature    complement(430026..430103)
FT                   /note="PS00217 Sugar transport proteins signature 2."
FT   misc_feature    complement(430803..431498)
FT                   /note="Pfam match to entry PF00975 Thioesterase,
FT                   Thioesterase domain , score 19.3, E-value 3e-05"
FT   misc_feature    complement(431904..432953)
FT                   /note="Pfam match to entry PF00698 Acyl_transf, Acyl
FT                   transferase domain , score 148.2, E-value 9.7e-42"
FT   misc_feature    complement(433293..433850)
FT                   /note="Pfam match to entry PF02801 ketoacyl-synt_C,
FT                   Beta-ketoacyl synthase, C-terminal domain , score 233.6,
FT                   E-value 1.9e-67"
FT   misc_feature    complement(433872..434636)
FT                   /note="Pfam match to entry PF00109 ketoacyl-synt,
FT                   Beta-ketoacyl synthase, N-terminal domain , score 230.3,
FT                   E-value 1.8e-66"
FT   misc_feature    complement(434082..434132)
FT                   /note="PS00606 Beta-ketoacyl synthases active site."
FT   misc_feature    complement(434724..434918)
FT                   /note="Pfam match to entry PF00550 pp-binding,
FT                   Phosphopantetheine attachment site , score 64.3, E-value
FT                   1.6e-16"
FT   misc_feature    complement(434787..434828)
FT                   /note="PS00105 Aminotransferases class-I
FT                   pyridoxal-phosphate attachment site."
FT   misc_feature    complement(434802..434849)
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT   misc_feature    complement(435210..436436)
FT                   /note="Pfam match to entry PF00501 AMP-binding, AMP-binding
FT                   enzyme , score 299.2, E-value 3.2e-87"
FT   misc_feature    complement(436041..436076)
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT   misc_feature    complement(436623..437330)
FT                   /note="Pfam match to entry PF00975 Thioesterase,
FT                   Thioesterase domain , score 143.8, E-value 1.9e-40"
FT   CDS_pept        438602..439306
FT                   /transl_table=11
FT                   /locus_tag="BPSS0312"
FT                   /product="putative LuxR-family transcriptional regulator"
FT                   /note="Similar to Vibrio anguillarum transcriptional
FT                   activator protein VanR SWALL:VANR_VIBAN (SWALL:P74946) (240
FT                   aa) fasta scores: E(): 2e-21, 34.32% id in 201 aa, and to
FT                   Ralstonia solanacearum transcriptional activator protein
FT                   SolR or rsc3287 or rs02516 SWALL:SLR1_RALSO (SWALL:P58590)
FT                   (236 aa) fasta scores: E(): 2.2e-22, 37.76% id in 233 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37760"
FT                   /db_xref="GOA:Q63NI7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NI7"
FT                   /protein_id="CAH37760.1"
FT                   /translation="MSIGSFNEILNATCKKSLFEQTAYHVRQLGFKNFAYRHQISGAAS
FT                   SRCMLDGFPAEWRLRYDAADYLSIDPVVQHCRCRTVPLIWHDDLYTTSRAKLMRDEAKS
FT                   YGLVYGLSCPVHDRSGAISMLSMATDDPFEHDASDILRLLSLSQLLASFVHAAMHELLD
FT                   CRLRRQGSCDLTARERESLQWAGRGKTAWEISKILGISERTVVFHLSNAARKIGANNRA
FT                   QAVVIASARGLI"
FT   misc_feature    438641..439081
FT                   /note="Pfam match to entry PF03472 Autoind_bind,
FT                   Autoinducer binding domain , score 109.4, E-value 4.4e-30"
FT   misc_feature    439112..439303
FT                   /note="Pfam match to entry PF00196 GerE, Bacterial
FT                   regulatory proteins, luxR family , score 67.6, E-value
FT                   1.7e-17"
FT   misc_feature    439163..439246
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT   misc_feature    439166..439231
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1440.000, SD 4.09 at aa 189-210, sequence
FT                   KTAWEISKILGISERTVVFHLS"
FT   CDS_pept        439636..440475
FT                   /transl_table=11
FT                   /locus_tag="BPSS0313"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Pasteurella haemolytica outer membrane
FT                   lipoprotein 2 precursor PlpB SWALL:PLPB_PASHA
FT                   (SWALL:Q08869) (276 aa) fasta scores: E(): 4.2e-28, 40.69%
FT                   id in 231 aa, and to Escherichia coli O157:H7
FT                   D-methionine-binding lipoprotein precursor MetQ or z0209 or
FT                   ecs0199 SWALL:Q8X8V9 (EMBL:AE005195) (271 aa) fasta scores:
FT                   E(): 4.8e-28, 40.24% id in 246 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37761"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NI6"
FT                   /protein_id="CAH37761.1"
FT                   /translation="MQSRLFLARLLRRASRAAAAAFALAVFAEFAVPLAHADSTPLKVG
FT                   IATSPQIDALKVAAKEAKAQGLDVKIIEFTDWNTPNAALANQDIDVNYFQHIPFLENAK
FT                   KQRGYDFVAIAPGTIMKIGLYSKKIKSFDQLKNGATVAIANDPVNGGRGLLLLQRAGLI
FT                   ALKPGADYRATTRDIVSNPKHLKILQLEASQLARSLDDVDLAQGYPSFIKLAGTADPNG
FT                   ALLFDGLENKLFALQWVVRPERANDPRIRRFIAIYQHSPAVRQALDDAFGRLYAIAW"
FT   misc_feature    439636..439746
FT                   /note="Signal peptide predicted for BPSS0313 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.954 between residues 37 and 38"
FT   misc_feature    439756..440472
FT                   /note="Pfam match to entry PF03180 Lipoprotein_9, NLPA
FT                   lipoprotein , score 323.3, E-value 1.8e-94"
FT   CDS_pept        440493..441887
FT                   /transl_table=11
FT                   /locus_tag="BPSS0314"
FT                   /product="putative monooxygenase"
FT                   /note="Similar to Rhodococcus sp. dibenzothiophene
FT                   desulfurization enzyme A SoxA or DdszA SWALL:SOXA_RHOSG
FT                   (SWALL:P54995) (453 aa) fasta scores: E(): 5.2e-52, 38.32%
FT                   id in 454 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37762"
FT                   /db_xref="GOA:Q63NI5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NI5"
FT                   /protein_id="CAH37762.1"
FT                   /translation="MTNKKILLNAFDMNCVGHINHGLWTHPRDRSAQYTDLDYWSDLAR
FT                   TLERGKFDAIFLADIVGVYDVYGGGPDLALRESVQVPVNDPLLLVPAMAQVTKHLGFGV
FT                   TANLTYEPPYLFARRMSTLDHLTKGRIGWNIVTGYLDSAARGMGLARQIGHDDRYARAD
FT                   DYMEVVYQLWERSWDDDAVIRDRAARVFARPDKVRRVRHDGPYYSVDAIHLSEPSPQRT
FT                   PVLYQAGASARGVEFAAKHAECVFVNGQSKAAARSAVADIRAAAARIGRDPASIKVFAG
FT                   ITVVTDENERAAREKFDEYRRHANPEAGLAHFASSTGIDFSRFGLDEPIAHVKTDSIQS
FT                   AVDAISKKSASGAWTVRRMLDQMSIGGRYQPVVGSPSQVADELAAWVDETDVDGFNVTR
FT                   TVVPESFDDFVDRVVPALQDRGLYKEDYDRAPTLRAKLFGAGGRLPDWHAGARHRFGRA
FT                   RETART"
FT   CDS_pept        441956..443098
FT                   /transl_table=11
FT                   /locus_tag="BPSS0315"
FT                   /product="putative ABC transport system, ATP-binding
FT                   protein"
FT                   /note="Similar to Escherichia coli D-methionine transport
FT                   ATP-binding protein MetN or Abc or b0199 SWALL:METN_ECOLI
FT                   (SWALL:P30750) (343 aa) fasta scores: E(): 6.1e-42, 46.32%
FT                   id in 354 aa, and to Pseudomonas putida ABC transporter,
FT                   ATP-binding protein pp0220 SWALL:AAN65852 (EMBL:AE016774)
FT                   (369 aa) fasta scores: E(): 5.1e-52, 53.03% id in 379 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37763"
FT                   /db_xref="GOA:Q63NI4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63NI4"
FT                   /protein_id="CAH37763.1"
FT                   /translation="MPHKAAAAPATRDAAAPAAVPGAAVSFELVGKVFDGPRGPAAALR
FT                   EVTLDIARGGVFGVIGRSGAGKSTLLRLVNGLERPTSGAVRVNGVDVGTLDERGLVALR
FT                   RRIGMVFQHFNLLSAKTVAQNIGLPLKIAGVPKAERARKVDALLDLVGLAAKRDAYPAS
FT                   LSGGQKQRVGIARALVHDPALLLCDEATSALDPETTQSILALLADINRRLGLTIMLITH
FT                   EMEVIRAVCDTVAVVEQGEVVETGPVWRVFGDPRHGATRALLRTLVHDLPADLAARVRP
FT                   LDGAAPLPCGAQLLLDVRYTGASGGEPDLGALTAALARNVGDAVHFVHGGLDRIQGRVQ
FT                   GRLVIAASLAARGAAGPDRIAAALAAARRHANRVEVLGYV"
FT   misc_feature    442115..442675
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter , score 232.0, E-value 5.5e-67"
FT   misc_feature    442136..442159
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    442445..442489
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        443091..443747
FT                   /transl_table=11
FT                   /locus_tag="BPSS0316"
FT                   /product="putative ACB transport system, membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa probable permease
FT                   of ABC transporter pa2351 SWALL:Q9I1C7 (EMBL:AE004661) (217
FT                   aa) fasta scores: E(): 5.6e-52, 68.66% id in 217 aa, and to
FT                   Brucella melitensis ABC transporter permease protein
FT                   bmeii0336 SWALL:Q8YD41 (EMBL:AE009671) (230 aa) fasta
FT                   scores: E(): 3.7e-47, 62.21% id in 217 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37764"
FT                   /db_xref="GOA:Q63NI3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NI3"
FT                   /protein_id="CAH37764.1"
FT                   /translation="MSELWLPELADAIRDTLWMVGASALVAALVGVPLALVLVTTAPGG
FT                   LYERRGVNAALGAIVNAFRSTPFVILLVALLPFTRFVIGTTIGVWAAIVPLSIAAIPFF
FT                   ARIAEVSLREVDKGLVEAAQAMGAERRHIVLHVLLPEALPGIVGGFTITVVALIGSTAM
FT                   AGAVGAGGLGDLAIRYGYQRFDTAVMATVIAILIALVTVVQFTGDRVVRRLAKRA"
FT   misc_feature    order(443148..443216,443250..443318,443331..443399,
FT                   443523..443591,443649..443708)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BPSS0316 by TMHMM2.0 at aa 20-42, 54-76, 81-103, 145-167
FT                   and 187-206"
FT   misc_feature    443421..443633
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component , score 60.1, E-value 3.2e-15"
FT   misc_feature    443424..443510
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        444511..445713
FT                   /transl_table=11
FT                   /locus_tag="BPSS0317"
FT                   /product="putative monooxygenase"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   FMNH2-dependent monooxygenase pa2355 SWALL:Q9I1C3
FT                   (EMBL:AE004661) (394 aa) fasta scores: E(): 3.6e-63, 46.03%
FT                   id in 391 aa, and to Rhodococcus sp. dibenzothiophene
FT                   desulfurization enzyme C SoxC or DszC SWALL:SOXC_RHOSO
FT                   (SWALL:P54998) (417 aa) fasta scores: E(): 5.9e-34, 41.04%
FT                   id in 402 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37765"
FT                   /db_xref="GOA:Q63NI2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NI2"
FT                   /protein_id="CAH37765.1"
FT                   /translation="MNDPRVLVEMTEQAGRTPRTLAELIAALRASAPERDRAGGHAARE
FT                   KRWIADAGLLTLAVPREFGGQEAGWPVIYHTIRALARVDSALAHLLGFQCLQIVSVDVW
FT                   GSAAQRERYLRGTVEHDWWWGNAVNPLDTRLVARATGDGGYRLDGVKGFCSGTRGSQRM
FT                   TVSAHDSVTGKPVFAVVPTQREGIAVRDDWDPIGQRQTDSGSVAFDGVRVVPDEVLHRS
FT                   EAPPTPRATLRALVSQLVLTNLFVGIAEGALAEARDYVQRAGRPWLHSGVERAVDDPYT
FT                   LQRFGDMRVQTVSAEALADRAARALQGAWAKHDALTADARAEVALAISEAKIVAQRAAL
FT                   DVSEALFDACGARATAAPLALDRFWRNARTHTLHDPLDYRLRDVGRYALTGALPDASLY
FT                   T"
FT   misc_feature    445204..445677
FT                   /note="Pfam match to entry PF00441 Acyl-CoA_dh, Acyl-CoA
FT                   dehydrogenase, C-terminal domain , score -9.5, E-value
FT                   8.3e-05"
FT   CDS_pept        complement(445815..446642)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0318"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37766"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NI1"
FT                   /protein_id="CAH37766.1"
FT                   /translation="MISRPASGAGARAPRRPGRTGTDMKARPMLEYALHPLEDRLVHVD
FT                   ELCRADPVPRGWARCPLCLEALYVVQLRDRSHARRFAHLAGEFARCPLVNDALPNPLAV
FT                   HVGPPLDEHGRQARATFFRHWQRHLHTIRQTASAFGIARFMRAIELADVLKLWAWPTLA
FT                   QRDIPYILLVLTEFIAAPRGERKQAAWSRFWFDASVQRVDDLRKPRGVLPRLFRLRYRL
FT                   PRMSKFPNARHLIDCQPVLMNDIGPSDAALGTPRADIAMFEAFAARFARRPAE"
FT   CDS_pept        complement(446938..447537)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0319"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37767"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NI0"
FT                   /protein_id="CAH37767.1"
FT                   /translation="MLHWGFRRGARMSPDHPWNSLEIVKLAAEVLTPVSVAAFGWLVSH
FT                   RLKQLELVQWTNQKLIEKRLALYDTIAPLLNRLLCFYTWVGPWKDISPDDVIRAKRELD
FT                   QTIHIYRHLFDDDVYRAYQAYLDALFDTHSGAGRDARIKSTIASPDGDRIGNGTYRWNP
FT                   AWAERFTDANVASRDEVRARYQRIMDGLRISLGVAR"
FT   CDS_pept        complement(447574..448293)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0320"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /note="Similar to Escherichia coli, Escherichia coli O6,
FT                   and Escherichia coli O157:H7 pyruvate dehydrogenase complex
FT                   repressor PdhR or GenA or AceC or b0113 or c0140 or z0123
FT                   or ecs0117 SWALL:PDHR_ECOLI (SWALL:P06957) (254 aa) fasta
FT                   scores: E(): 3.5e-24, 39.48% id in 233 aa, and to Yersinia
FT                   pestis transcriptional regulator for pyruvate dehydrogenase
FT                   complex y0766 SWALL:AAM84353 (EMBL:AE013678) (278 aa) fasta
FT                   scores: E(): 9.3e-25, 38.75% id in 240 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37768"
FT                   /db_xref="GOA:Q63NH9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NH9"
FT                   /protein_id="CAH37768.1"
FT                   /translation="MTFQPVESYTRVRLSDVVSDQIKSLISAGKLLPGQKLPTERELAA
FT                   QLNVSRPSLREALVRLEADGFIGSVGRGGFVVSDITAPVVSSPLADLLLQNPEASHDVL
FT                   ELRHGLETISTAYAAERATPGDLAKIKEAFDTLAGHSLKHEPGRLAEVDANFHLAIADA
FT                   THNVALIHVMHGIHGLLQESMHKSHRLVNHADAMERALLEQHTEIYEAIAAKDPERARA
FT                   AAERHLRYVRALYEQAA"
FT   misc_feature    complement(448063..448242)
FT                   /note="Pfam match to entry PF00392 gntR, Bacterial
FT                   regulatory proteins, gntR family , score 85.5, E-value
FT                   6.9e-23"
FT   misc_feature    complement(448111..448185)
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT   misc_feature    complement(448117..448182)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1149.000, SD 3.10 at aa 129-150, sequence
FT                   PTERELAAQLNVSRPSLREALV"
FT   CDS_pept        448742..449548
FT                   /transl_table=11
FT                   /locus_tag="BPSS0321"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YkgE or b0306 SWALL:YKGE_ECOLI (SWALL:P77252) (239 aa)
FT                   fasta scores: E(): 5.7e-35, 43.03% id in 237 aa, and to
FT                   Ralstonia solanacearum hypothetical protein rsc1611 or
FT                   rs03974 SWALL:Q8XYZ5 (EMBL:AL646065) (241 aa) fasta scores:
FT                   E(): 5.5e-50, 56.25% id in 240 aa. Note: This CDS is longer
FT                   in its N-terminal region than most of its database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37769"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NH8"
FT                   /protein_id="CAH37769.1"
FT                   /translation="MDSSPQTAGAPGGTRETPRVGLFVTCLANLFRPSAALAAVQLLEA
FT                   AGCAVDAPRAQTCCGQPALNSGDFDDARGIARRTIEAFERYDYVVAPSGSCIRTLRHDY
FT                   PDLLANDPAWRPRAEQLAARAHELTSFLVDVLGWAGPERAAVPECTLTYHDTCSGLRGL
FT                   GIKAQPRALLARVEGVALTEMKDAEVCCGFGGTFCVKYPEISTKIVSDKTANVAASGAA
FT                   VLAGGDLGCLMNIGGRLKREGSAVRVYHVAEVLAGMNVEPICGEGE"
FT   misc_feature    448868..449044
FT                   /note="Pfam match to entry PF02754 DUF224, Domain of
FT                   unknown function (DUF224) , score 52.4, E-value 6.6e-13"
FT   misc_feature    449261..449449
FT                   /note="Pfam match to entry PF02754 DUF224, Domain of
FT                   unknown function (DUF224) , score 37.3, E-value 2.4e-08"
FT   CDS_pept        449545..450993
FT                   /transl_table=11
FT                   /locus_tag="BPSS0322"
FT                   /product="putative iron-sulfur binding protein"
FT                   /note="Similar to Ralstonia solanacearum putative
FT                   iron-sulfur binding protein rsc1612 or rs03975 SWALL:Q8XYZ4
FT                   (EMBL:AL646065) (469 aa) fasta scores: E(): 3.2e-76, 46.45%
FT                   id in 465 aa, and to Pasteurella multocida hypothetical
FT                   protein pm1854 SWALL:Q9CJY4 (EMBL:AE006223) (467 aa) fasta
FT                   scores: E(): 9.4e-67, 41.59% id in 464 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37770"
FT                   /db_xref="GOA:Q63NH7"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NH7"
FT                   /protein_id="CAH37770.1"
FT                   /translation="MSATPLNAPATFKARASAALHDAQLQEALGMLGEGWIEKRRRVVS
FT                   LLPEFEMLRERAKAVKDHVLANLDTYLERYEAAVTRAGGVVHWANDAAQAREIVLRICR
FT                   DANAKTITRGKSMVGEEIGLPAALEGAGMEVVETDLGEYIVQLAHEGPSHIVFPALHKT
FT                   IGQVTELFAGNHSSAQYDGPRETVADVVGEARQVLREKFFVADVGITGANYLVAETGSN
FT                   VICTNEGNGDLTSTLARVHIVTAGIERVVPTLDDVALFVRLLGRSATGQEITSYTTFST
FT                   GPRRGDDLDGPQEYHVVLVDNGRTRMLAGEFRDMLRCIRCGACMNHCPVYGAVGGHAYG
FT                   WVYPGPMGAVLTPLLQGIEHDTDLPNACTLNGRCAEVCPVKIPLPTLLKKLRGMQFDAR
FT                   LTAPGTRFLLRAFGAIARRPALYHWLTRVGARALRALGGKRGSIARVPFASGWTDSREL
FT                   PKPPPRTFFETWDATRTNQPEVRR"
FT   misc_feature    450475..450546
FT                   /note="Pfam match to entry PF00037 fer4, 4Fe-4S binding
FT                   domain , score 19.2, E-value 0.00017"
FT   misc_feature    450496..450531
FT                   /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
FT                   region signature."
FT   misc_feature    450625..450696
FT                   /note="Pfam match to entry PF00037 fer4, 4Fe-4S binding
FT                   domain , score 9.0, E-value 0.0067"
FT   CDS_pept        450990..451715
FT                   /transl_table=11
FT                   /locus_tag="BPSS0323"
FT                   /product="hypothetical protein"
FT                   /note="C-terminus is similar to the C-terminal regions of
FT                   Ralstonia solanacearum putative transmembrane protein
FT                   rsc1032 or rs04218 SWALL:Q8Y0L1 (EMBL:AL646062) (243 aa)
FT                   fasta scores: E(): 7.3e-15, 41.11% id in 180 aa, and
FT                   Bacillus subtilis YvbY protein SWALL:O32259 (EMBL:Z99121)
FT                   (240 aa) fasta scores: E(): 3.6e-07, 30.86% id in 162 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37771"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NH6"
FT                   /protein_id="CAH37771.1"
FT                   /translation="MSARDDILGRIRAALGSERARLAAQFPAPVQAKGAGASAAPNANA
FT                   AFAPDASLSTASSAARGSAISLGDVDLVARFVAKAQQVSATCTHIATAAGAPAAVDAYL
FT                   RDAGLADAPLVVAAALDALPWRAHRALPGVDLRRDGLVSVTPSFAAIAETGSVVCLSSS
FT                   ATPTSLNFVAATHVVLVNRSAIVATMEDAWARVRATIATLPRAVNVITGPSRTADVEQT
FT                   VQVGVHGPKRVLVLICDDA"
FT   misc_feature    451326..451703
FT                   /note="Pfam match to entry PF02589 DUF162, Uncharacterized
FT                   ACR, YkgG family COG1556 , score 47.1, E-value 2.6e-11"
FT   CDS_pept        452083..453801
FT                   /transl_table=11
FT                   /gene="glcA"
FT                   /locus_tag="BPSS0324"
FT                   /product="glycolate permease"
FT                   /note="Similar to Escherichia coli glycolate permease GlcA
FT                   or b2975 SWALL:GLCA_ECOLI (SWALL:Q46839) (560 aa) fasta
FT                   scores: E(): 3.4e-77, 68.47% id in 571 aa, and to
FT                   Escherichia coli L-lactate permease LldP or LctP or b3603
FT                   SWALL:LLDP_ECOLI (SWALL:P33231) (551 aa) fasta scores: E():
FT                   3.5e-65, 59.47% id in 570 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37772"
FT                   /db_xref="GOA:Q63NH5"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NH5"
FT                   /protein_id="CAH37772.1"
FT                   /translation="MQVWNQVYLPLGGVGWSALAAGAPIILFFVSLAVLRLKGHVAGAL
FT                   TLALALVIAIAVYGMPAERAFASAAYGFAYGLWPIAWIIVTAVFLYKIVVKSGQFDVIR
FT                   SSIVALTDDQRLQMLLIGFSFGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLCLIA
FT                   DTAPVAFGALGIPVIVAGQVSGLDPMAVGAMAGRQLPFLSFFLPFWLVFVMDGVKGVRE
FT                   TWPAALVAGGSFALVQFFTSNYIGPELPDVTSALASLVALASFLKVWRPLRAREAARAQ
FT                   RLVSAGGGALALGGMPGGLGGARATGGREPSPYSFAQIARAWSPFVVLTVMVTIWSMKP
FT                   FKALFAKGGALAFTTLQFHVAHLDKLTQKMAPVVAHPTPVPAVFNWDLLAATGTAILLS
FT                   AIVSMAILNVPARTGVRTFFEVLKDLKRPVLSIGLVLAFAFVENYSGMSTTLALLLAGT
FT                   GAAFPFFSPLLGWIGVFLTGSDTSSNALFCSLQATTAQQIGVPSTLLVAANTTGGVAGK
FT                   MISPQSIAVACAAVGLVGHEADLFRFTLRHSLFFALVVGVMTCVQAYWLTGMIVH"
FT   misc_feature    order(452119..452187,452200..452268,452287..452355,
FT                   452464..452532,452551..452619,452662..452721,
FT                   452740..452808,452836..452889,452926..452994,
FT                   453037..453090,453109..453165,453244..453312,
FT                   453370..453438,453448..453516,453727..453795)
FT                   /note="15 probable transmembrane helices predicted for
FT                   BPSS0324 by TMHMM2.0 at aa 13-35, 40-62, 69-91, 128-150,
FT                   157-179, 194-213, 220-242, 252-269, 282-304, 319-336,
FT                   343-361, 388-410, 430-452, 456-478 and 549-571"
FT   misc_feature    452128..453768
FT                   /note="Pfam match to entry PF02652 Lactate_perm, L-lactate
FT                   permease , score 964.7, E-value 1.5e-287"
FT   CDS_pept        454103..454540
FT                   /transl_table=11
FT                   /locus_tag="BPSS0325"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YphA or b2543 SWALL:YPHA_ECOLI (SWALL:P77751) (140 aa)
FT                   fasta scores: E(): 8.9e-16, 40.32% id in 124 aa, and to
FT                   Ralstonia solanacearum probable transmembrane protein
FT                   rsc2500 or rs01095 SWALL:Q8XWH4 (EMBL:AL646070) (136 aa)
FT                   fasta scores: E(): 2.5e-14, 42.85% id in 119 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37773"
FT                   /db_xref="GOA:Q63NH4"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NH4"
FT                   /protein_id="CAH37773.1"
FT                   /translation="MTRSVDSGVIFFARLLLAVLFLWGGAMKLMGYGEFVGYLKGLGVP
FT                   FTQVAAPVIVALEAIGGVLLIVGYQVKPLALVLALYTLAAALIGHNFWDATSSALQRDM
FT                   VVHFWKNVAIAGGFLLLYVTGAGGASIDGARRPSSSYGSLR"
FT   misc_feature    order(454121..454180,454238..454306,454325..454393,
FT                   454436..454495)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BPSS0325 by TMHMM2.0 at aa 7-26, 46-68, 75-97 and 112-131"
FT   CDS_pept        complement(454731..456302)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0326"
FT                   /product="putative transport-related membrane protein"
FT                   /note="Similar (appart from the internal repeat region) the
FT                   plasmid-borne Streptomyces coelicolor methylenomycin A
FT                   resistance protein Mmr or scp1.237C SWALL:MMR_STRCO
FT                   (SWALL:P11545) (475 aa) fasta scores: E(): 7.2e-20, 32.75%
FT                   id in 464 aa, and to Rhizobium loti probable transporter
FT                   mll2542 SWALL:Q98I66 (EMBL:AP002999) (505 aa) fasta scores:
FT                   E(): 8.6e-22, 32.99% id in 494 aa. The effect of the extra
FT                   internal amino acids on the function of protein is not
FT                   known"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37774"
FT                   /db_xref="GOA:Q63NH3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NH3"
FT                   /protein_id="CAH37774.1"
FT                   /translation="MDTHLPHPALSRAALVRIVSTVSASFVITQLDVTIVNVALARIGI
FT                   DLHTSVAGLQWIVDAYTLALAGLMLSAGALGDRFGARRLFAAGLALFAVASFVCGIAAN
FT                   AATLIAARALQGLAAAAMLPNSLALLNHACAHDPRLRARAVGWWTASGAISIAAGPVIG
FT                   GVLIAQFGWRSIFFVNLPLCAASLAATRLWIDSDDTRAAAASSASSASSASSASSASSA
FT                   SSASSAADGAHHSHPAADRRASGPNACAPAPKRAAGAGTRGLDLPGQCLAVVALTLFTG
FT                   AVIDWHPALVAIALAAGAAFVFVESRSAHPMMPLALFRRRTFSVAVLFGVCMNLSYYGI
FT                   IFVLSLYLQRVRHNTPLEAGLAFLPLTGGFLLSNVASGWATAHYGSRRPMIAGALIGAT
FT                   GFALLSAVRADTPIAMLVVPFLLIPGGMGLAVPAMTTTVLASVERARAATASAVLNTAR
FT                   QAGGAIGVAAFGALASGARPPDIVSGLHASAYVSAALFVFASAMAAFVHGAPQPAAGKP
FT                   ANANAR"
FT   misc_feature    complement(order(454776..454844,454872..454925,
FT                   454986..455054,455082..455135,455154..455222,
FT                   455265..455333,455391..455459,455721..455780,
FT                   455799..455867,455973..456041,456078..456146,
FT                   456174..456242))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BPSS0326 by TMHMM2.0 at aa 21-43, 53-75, 88-110, 146-168,
FT                   175-194, 282-304, 324-346, 361-383, 390-407, 417-439,
FT                   460-477 and 487-509"
FT   misc_feature    complement(455946..456095)
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter , score 18.8, E-value 7.4e-06"
FT   CDS_pept        complement(456588..457880)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0327"
FT                   /product="putative sugar transport-related, membrane
FT                   protein"
FT                   /note="Similar to Pseudomonas aeruginosa probable MFS
FT                   transporter pa5370 SWALL:Q9HTJ4 (EMBL:AE004949) (438 aa)
FT                   fasta scores: E(): 1.6e-109, 66.82% id in 425 aa, and to
FT                   Agrobacterium tumefaciens MFS permease[proline/betaine]
FT                   TphA or atu2154 or agr_c_3904 SWALL:Q8UDH1 (EMBL:AE009165)
FT                   (443 aa) fasta scores: E(): 1.5e-88, 55.76% id in 416 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37775"
FT                   /db_xref="GOA:Q63NH2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NH2"
FT                   /protein_id="CAH37775.1"
FT                   /translation="MPASELSAVSSAPPRALTGRDYKTLGLAALGGALEFYDFIIFVFF
FT                   APAIGQLFFPHDIPDWLRQLQTFGIFAAGYLARPLGGIVMAHFGDLIGRKRMFTLSVLL
FT                   MSVPTLLMGLLPTYDSVGILAPVVLLLLRVLQGAAVGGEVPGAWVFVSEHVPPQRIGYA
FT                   CGTLTAGLTIGILLGSLVATAVNSRFSTAEVAAFAWRIPFLLGGVFGLFSVYLRRWLHE
FT                   TPVFAEMKARKTLAAEIPLKAVIRDHGRAVIVSMLITWMLSAAIVVVILMTPTLLQKQF
FT                   HIAPATALFANSIATLCLTAGCITAGSLADRFGAKAVLSIGGVALAACYYAMYTQIAVD
FT                   AARLVPLYGLAGFTVGTIGAVPFVLVKSFPAVVRFSGISFSYNVAYAVFGGLTPVIVSL
FT                   LMKSHSLAPAHYVAAICVLGAVAMLFSKDAE"
FT   misc_feature    complement(order(456606..456665,456678..456746,
FT                   456783..456851,456864..456932,456951..457019,
FT                   457062..457130,457233..457292,457335..457403,
FT                   457428..457496,457509..457577,457614..457682,
FT                   457740..457808))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BPSS0327 by TMHMM2.0 at aa 25-47, 67-89, 102-124, 129-151,
FT                   160-182, 197-216, 251-273, 288-310, 317-339, 344-366,
FT                   379-401 and 406-425"
FT   misc_feature    complement(456606..457811)
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter , score 54.9, E-value 1.1e-13"
FT   CDS_pept        complement(458196..459230)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0328"
FT                   /product="putative malate/L-lactate dehydrogenase"
FT                   /note="Similar to Methanothermus fervidus
FT                   malate/L-sulfolactate dehydrogenase Mdh SWALL:MDH_METFE
FT                   (SWALL:P16142) (339 aa) fasta scores: E(): 6.7e-22, 31.76%
FT                   id in 277 aa, and to Pseudomonas aeruginosa hypothetical
FT                   oxidoreductase pa1252 SWALL:YC52_PSEAE (SWALL:Q9I492) (334
FT                   aa) fasta scores: E(): 5.2e-77, 61.56% id in 333 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37776"
FT                   /db_xref="GOA:Q63NH1"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NH1"
FT                   /protein_id="CAH37776.1"
FT                   /translation="MHDRPDLTRPDVVLSLDDVRALALRVLAHHGLSDAHARAIANVIT
FT                   QGQRDECHSHGVYRLLVCARSLRLGKVDPQAVPTLRRLSPSIVAVDAHRGFSLLAFETG
FT                   LPVLVEMARRHGIAAMAINRCYHFSALWPEVEALAAHGLAGLAMNPSHGWVAPEGGTRP
FT                   VFGTNPLAFAWPRPGGTPFVFDFATSAIARGDLELHAKAGKPIPPHWAIDANGAPTTDP
FT                   QAALQGAMRTFGGHKGSALAAMIELLAGALIGDMTSAESLAFDEGAGATPCHGELVIAL
FT                   DPKTFLGDALDAGLARGERMFEAIVAQGARLPSQRRFDARARSAAHDVRIPARLHDEIV
FT                   ALLD"
FT   misc_feature    complement(458205..459197)
FT                   /note="Pfam match to entry PF02615 ldh_2, Malate/L-lactate
FT                   dehydrogenase , score 148.4, E-value 8.4e-42"
FT   CDS_pept        complement(459223..460815)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0329"
FT                   /product="putative fatty aldehyde dehydrogenase"
FT                   /note="Similar to Caulobacter crescentus fatty aldehyde
FT                   dehydrogenase cc2791 SWALL:Q9A4N9 (EMBL:AE005944) (528 aa)
FT                   fasta scores: E(): 6.8e-120, 65.7% id in 522 aa, and to
FT                   Vibrio harveyi fatty aldehyde dehydrogenase AldH
FT                   SWALL:DHAF_VIBHA (SWALL:Q56694) (510 aa) fasta scores: E():
FT                   1.5e-76, 47.22% id in 504 aa. Note: Also similar to
FT                   BPSS0034 (527 aa) fasta scores: E(): 7.3e-87, 60.803%
FT                   identity in 523 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37777"
FT                   /db_xref="GOA:Q63NH0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NH0"
FT                   /protein_id="CAH37777.1"
FT                   /translation="MRLTGELLIGQSATFGQHGAFRAIEAATGAPLEPAFGGASLQDLD
FT                   AACALADDAFDAYRETSLDARAAFLDAIGRHIVALGDALIERCAAESGLPRARIEGERA
FT                   RTVGQLALFAAVVRDGGFIDARIDPARAQRKPLPRVDLRLRNIAIGPVAVFGASNFPLA
FT                   FSVAGGDTASALAAGCPVIVKAHGAHPGTSELVGRAIQAAVRECGLPAGVFSLLFDASR
FT                   EIGQALVADPRIKAVGFTGSRRGGVALMRIAAARPEPVPVYAEMSSINPVVLMPGALAA
FT                   RHDAIAQQFVASLTLGAGQFCTNPGLILAIDGPALRAFEKAAAAAIDAAAAQTMLTPPI
FT                   HASYREGVARLASHRAVERLGEGPAGGPFAARAALFATTADALLSHAELRDEVFGPASL
FT                   VVRCADADALHRVLKSLEGQLTIAAHLGERDAPLFAALRPTLERRAGRILVNGFGTGVE
FT                   VGHAMVHGGPFPATSDPRTTSVGARAIERFLRPVSYQDVPDALLPDALRDANPLRVPQR
FT                   IDGALAPREARDA"
FT   misc_feature    complement(459370..460758)
FT                   /note="Pfam match to entry PF00171 aldedh, Aldehyde
FT                   dehydrogenase family , score -129.3, E-value 5.9e-10"
FT   CDS_pept        complement(460891..462516)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0330"
FT                   /product="putative amino-acid permease membrane protein"
FT                   /note="Similar to Xanthomonas campestris amino acid
FT                   permease YveA or xcc2406 SWALL:AAM41684 (EMBL:AE012351)
FT                   (528 aa) fasta scores: E(): 4.7e-138, 70.19% id in 520 aa,
FT                   and to Ralstonia solanacearum probable amino-acid permease
FT                   transmembrane protein rsp0282 or rs03682 SWALL:Q8XT33
FT                   (EMBL:AL646077) (543 aa) fasta scores: E(): 4.4e-69, 38.47%
FT                   id in 512 aa. Note: This CDS is longer in its N-terminal
FT                   region than most of its database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37778"
FT                   /db_xref="GOA:Q63NG9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NG9"
FT                   /protein_id="CAH37778.1"
FT                   /translation="MPAQGNAQRTAPLARPAPTDAGHGKFKKQLSLTDLTFIGLGAIFG
FT                   SGWLFAASHVSMIAGPAGILSWLLGGFAVLLLGIVYCELGAALPRAGGVVRYPVFSHGP
FT                   LLGYLMGAITLIAFSSLIAIEVVAARQYAAAWFAGLTVEGSGNPTTLGWLVQAALLCFF
FT                   FYLNYSSVKTFAKANNVISVFKFVVPLAVIVVLFAFFKPANLTLHGFAPFGMPGVEMAV
FT                   SAGGIIFAYLGLTPIVSVASEVRDPQRTIPIALILSIVLSTLIYVLLQLAFLGGIPSAM
FT                   LAGGWHDIGKAFSLPYRDIALALGVGWLAYMVVADAMISPSGCGNIYMNATPRVVYGWA
FT                   KTGTFFKVFARVDEASGIPRAGLWLTFALALFWTLPFPSWEALINTVSAALVLSYAVAP
FT                   VSVAALRRTAPGLPRPFRASAFALTGPASFVIAALIVYWSGWRTVSWLLGLQIAMFAVY
FT                   LACRRRVPTAHLSLAEQVRSCAWLIAFYALMIVASYFGGFGGTGQLAHPYDTFAVAAVA
FT                   LVIYYWGAHTGVPSAKLQLDDDEN"
FT   misc_feature    complement(order(460942..460995,461005..461073,
FT                   461134..461187,461197..461265,461302..461370,
FT                   461383..461451,461551..461619,461686..461754,
FT                   461791..461859,461917..461985,462004..462072,
FT                   462136..462204,462265..462333,462361..462429))
FT                   /note="14 probable transmembrane helices predicted for
FT                   BPSS0330 by TMHMM2.0 at aa 30-52, 62-84, 105-127, 149-171,
FT                   178-200, 220-242, 255-277, 300-322, 356-378, 383-405,
FT                   418-440, 444-461, 482-504 and 508-525"
FT   misc_feature    complement(461128..462441)
FT                   /note="Pfam match to entry PF00324 aa_permeases, Amino acid
FT                   permease , score -147.8, E-value 1.3e-06"
FT   CDS_pept        complement(462961..463881)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0331"
FT                   /product="putative dihydrodipicolinate synthase"
FT                   /note="Similar to Prochlorococcus marinus
FT                   dihydrodipicolinate synthase DapA SWALL:DAPA_PROMA
FT                   (SWALL:P49423) (302 aa) fasta scores: E(): 1.1e-19, 30.24%
FT                   id in 291 aa, and to Pseudomonas aeruginosa probable
FT                   dihydrodipicolinate synthetase pa1254 SWALL:Q9I490
FT                   (EMBL:AE004555) (305 aa) fasta scores: E(): 3.3e-92, 73.52%
FT                   id in 306 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37779"
FT                   /db_xref="GOA:Q63NG8"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NG8"
FT                   /protein_id="CAH37779.1"
FT                   /translation="MSRHAIQWSGVFPAVSTQFKPDFSLDVDATHRVVKNLVNDGVSGL
FT                   VVCGTVGENTSLGTAEKLAVIEAARDAAGGKVPVIAGVAEFTTEFARNTVREAQRVGVD
FT                   GVMVMPALVYSAKPHETAAHFRAVASSTDLPVMVYNNPPIYRNDVTPDVLIALQDCENI
FT                   VCFKDSSGDTRRFVDLRNAVGDRFVLFAGLDDVVVESIAVGAQGWVSGMSNAFPKEGET
FT                   LFRLAKQKRFDEALALYRWFMPLLHLDARPDLVQCIKLCEELVGRGSALTRPPRLALQG
FT                   DTLAHVKAIVAKALETRPTLPDVGL"
FT   misc_feature    complement(462997..463863)
FT                   /note="Pfam match to entry PF00701 DHDPS,
FT                   Dihydrodipicolinate synthetase family , score 172.3,
FT                   E-value 5.2e-49"
FT   CDS_pept        464132..465064
FT                   /transl_table=11
FT                   /locus_tag="BPSS0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein pa1268 SWALL:Q9I476 (EMBL:AE004556) (314 aa) fasta
FT                   scores: E(): 1.1e-84, 71.79% id in 312 aa, and to
FT                   Xanthomonas axonopodis hypothetical protein xac2550
FT                   SWALL:AAM37401 (EMBL:AE011895) (312 aa) fasta scores: E():
FT                   5e-64, 57.82% id in 313 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37780"
FT                   /db_xref="GOA:Q63NG7"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63NG7"
FT                   /protein_id="CAH37780.1"
FT                   /translation="MKHIHIIDSHTGGEPTRVVVSGFPALGGGTMAERLAVLAREHDRY
FT                   RAACILEPRGSDVLVGALLCEPVSAGAAAGVIFFNNAGYLGMCGHGTIGLVRTLHHMGR
FT                   IGPGVHRIETPVGDVEATLHDDLSVSVRNVLAYRHAKDVVVDVPGHGAVTGDVAWGGNW
FT                   FFLVSDHGQRVAGENVAALAAYASAVRAALERAGVTGRDGAPIDHIELFADDPEYDSRS
FT                   FVLCPGHAYDRSPCGTGTSAKLACLAADGKLAAGVTWRQASVIGSVFSASYAAAEGGVV
FT                   PTIRGSAHLSAEATLVIEDDDPFGWGIAS"
FT   CDS_pept        465061..466194
FT                   /transl_table=11
FT                   /locus_tag="BPSS0333"
FT                   /product="putative oxidase"
FT                   /note="Similar to Xanthomonas campestris D-amino acid
FT                   oxidase xcc2414 SWALL:AAM41692 (EMBL:AE012352) (389 aa)
FT                   fasta scores: E(): 7.1e-63, 53.84% id in 364 aa, and to
FT                   Rhizobium meliloti opine oxidase subunit B OoxB
FT                   SWALL:OOB2_RHIME (SWALL:P72299) (371 aa) fasta scores: E():
FT                   1.2e-08, 26.24% id in 381 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37781"
FT                   /db_xref="GOA:Q63NG6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NG6"
FT                   /protein_id="CAH37781.1"
FT                   /translation="MTDSPTDVIVIGAGIVGAACAHEFALRGLRVVVVDDGGGGATAAG
FT                   MGHLVAMDDNAAELALTHYSIGLWRALRDAMPEGCAYRNCGTLWLAADAHEMDLARAKQ
FT                   AALGARGVAGELIGRAALAALEPMLRTDLGGALKVPGDGILYAPAAAHWLLHRLPGVAL
FT                   RRARAVALDGARVALEGGDVLRANAVVVANGVAARALVPELPLRPKKGHLLITDRYPAR
FT                   VSHQLVELGYAASAHASDGTSVAFNVQPRPTGQLLIGSSRQFDTEDPRVEAPVLARMLR
FT                   RALGYLPALAGLNGIRAWTGFRAASPDGLPLLGEHPSRRGVWLALGHEGLGVTTAPGSA
FT                   RVLAALMFGERAAIDAEPYRPARFLSTSKSAAAGELR"
FT   misc_feature    465076..466122
FT                   /note="Pfam match to entry PF01266 DAO, FAD dependent
FT                   oxidoreductase , score -27.4, E-value 1.8e-06"
FT   CDS_pept        466191..466424
FT                   /transl_table=11
FT                   /locus_tag="BPSS0334"
FT                   /product="putative oxidase"
FT                   /note="Similar to Xanthomonas campestris sarcosine oxidase
FT                   alpha subunit SoxA or xcc2413 SWALL:AAM41691
FT                   (EMBL:AE012352) (81 aa) fasta scores: E(): 3.1e-08, 48.61%
FT                   id in 72 aa, and to Pseudomonas aeruginosa hydrogen cyanide
FT                   synthase HcnA or pa2193 SWALL:Q9REV9 (EMBL:AF208523) (104
FT                   aa) fasta scores: E(): 1.3e-07, 45.33% id in 75 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37782"
FT                   /db_xref="GOA:Q63NG5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NG5"
FT                   /protein_id="CAH37782.1"
FT                   /translation="MIIYLDRRALEVADGTTVAAALALAGDDTARTSCTGAARAPFCGM
FT                   GMCHECRVTIDGRRRLACQTLCREGMQVERTR"
FT   misc_feature    466197..466397
FT                   /note="Pfam match to entry PF00111 fer2, 2Fe-2S iron-sulfur
FT                   cluster binding domain , score 12.8, E-value 0.0018"
FT   CDS_pept        466421..467713
FT                   /transl_table=11
FT                   /locus_tag="BPSS0335"
FT                   /product="putative oxidoreductase"
FT                   /note="Similar to Rhizobium meliloti opine oxidase subunit
FT                   A OoxA or ra1200 or sma2225 SWALL:OOA1_RHIME (SWALL:Q92XP4)
FT                   (458 aa) fasta scores: E(): 3.2e-06, 32.88% id in 450 aa,
FT                   and to Xanthomonas campestris oxidoreductase xcc2412
FT                   SWALL:AAM41690 (EMBL:AE012352) (444 aa) fasta scores: E():
FT                   4.9e-58, 48.15% id in 434 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37783"
FT                   /db_xref="GOA:Q63NG4"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NG4"
FT                   /protein_id="CAH37783.1"
FT                   /translation="MTNEILTVDVAIVGAGPAGLAAARAAARSGCTVAIVDDNPRAGGQ
FT                   VWRHGPHAAPGALARASFGVLRQPNVRHLAAARVVAAPRPGALLVEDEQRALVLGYRKL
FT                   ILCCGARELLLPFAGWTLPGVTGAGGLQALVKGGAPVRGERVVIAGSGPLLIASLATAR
FT                   AAGARVVALVEQAPPGALARFALSLAATPSKLAQAARLTRGFVGTRYLTGAVVREAHGD
FT                   ARVRAVTIEQGGARETLDCERLACGFGLVPNLTLALALGCAVRERAIAVDDAQRTSVEH
FT                   VYAAGECTGVGGVELARIEGELAGLAAGGAHAAPHGRARMAALLRRRARWRRFAARVAR
FT                   TFALRDAARALPPDDTLLCRCEDVTIGAVRAHASARDAKLLTRCAMGACQGRVCGAAAH
FT                   AYFGWDDAPPRPPFSPARIDTLLAASDDALL"
FT   misc_feature    466445..467317
FT                   /note="Pfam match to entry PF00070 pyr_redox, Pyridine
FT                   nucleotide-disulphide oxidoreductase , score 69.7, E-value
FT                   4.1e-18"
FT   CDS_pept        467905..468621
FT                   /transl_table=11
FT                   /locus_tag="BPSS0336"
FT                   /product="putative AraC-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator pa1261 SWALL:Q9I483
FT                   (EMBL:AE004555) (224 aa) fasta scores: E(): 6.8e-51, 58.48%
FT                   id in 224 aa, and to Xanthomonas axonopodis transcriptional
FT                   regulator xac2551 SWALL:Q8PJI0 (EMBL:AE011895) (226 aa)
FT                   fasta scores: E(): 1.5e-38, 45.53% id in 224 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37784"
FT                   /db_xref="GOA:Q63NG3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NG3"
FT                   /protein_id="CAH37784.1"
FT                   /translation="MLAHFAQLEPVFDALPDVAFFVKDVRARYALVNRTLAQRCGYKDK
FT                   RDLYGKAADEVFPRRFGRSYVEQDLTIIAGGRQLTDQLELHLYSGRQPGWCLTCKEPLR
FT                   NAQGRIVGIAGLSRDLRAHESSHPAYSRIADVVRYIHAHYVQPLNLKHLAGMAGMSVAQ
FT                   LERYFHKVFHLTPRQMLLKARLDAATALLVTHDKVTDVAALCGYTDHSAFTRQFKATVG
FT                   VTPTEYRLMLQEGRGA"
FT   misc_feature    468310..468447
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family , score
FT                   30.9, E-value 1.9e-06"
FT   misc_feature    468346..468411
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1559.000, SD 4.50 at aa 200-221, sequence
FT                   LNLKHLAGMAGMSVAQLERYFH"
FT   misc_feature    468454..468579
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT   misc_feature    468463..468594
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family , score
FT                   46.7, E-value 3.4e-11"
FT   CDS_pept        complement(468818..469087)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0337"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37785"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NG2"
FT                   /protein_id="CAH37785.1"
FT                   /translation="MSAVDTSAAVRPAAPSAKPKTMLRRLLSHHEIATLLILLHAPIGA
FT                   NAKPELPALQEAGLVEMIRSDMDAAPSFRLTEDGNAVLKGLGYR"
FT   CDS_pept        complement(469303..470526)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0338"
FT                   /product="putative insertion element protein"
FT                   /note="Similar to Shigella flexneri putative transposase
FT                   for IS110 s0128 SWALL:Q9AFS5 (EMBL:AF348706) (398 aa) fasta
FT                   scores: E(): 3e-111, 76.73% id in 404 aa, and to
FT                   Streptomyces coelicolor insertion element IS110
FT                   hypothetical 43.6 kDa protein SWALL:YIS1_STRCO
FT                   (SWALL:P19780) (405 aa) fasta scores: E(): 3.9e-75, 58.71%
FT                   id in 390 aa. Note: Also similar to BPSS1472 (428 aa) fasta
FT                   scores: E(): 9.1e-117, 88.732% identity in 426 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37786"
FT                   /db_xref="GOA:Q63NG1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NG1"
FT                   /protein_id="CAH37786.1"
FT                   /translation="MQEATQHDAVDVFVGVDVDVGVDVGKGQHHAVALDRNGKRLYNKA
FT                   LPNDEVKLRALIAELKTHRRLLFVVDQPSTIGALPVAVARAEGVLVAYLPGLAMRRIAD
FT                   LHAGEAKTDARDAAIIAEAARSMPHTLRSLRLADEQLAELTMLRGFDDDLAAQLTQTSN
FT                   RIRGLLTQIHPALERVLGPRLDHPAVLDLLERYPSPSALAAANEKTLANRLTKLAPRMG
FT                   KNWAAEIVQALNEQAVIVPGTQAATIVMPRLAQQLAALRKQRDEIAAEVERLVLAHPFW
FT                   PVLTSMPGVGVRTAARRLTEAAQKAFATAAHLAAYAGLAPVTRRSGSSIRGEHPSRRGN
FT                   KVLKRALFLSAFAALRDPVSRAYSSRKIQQGKRHNQALIALARRRCDVLFAMLRDGTIY
FT                   PPKSAPDA"
FT   misc_feature    complement(469435..469758)
FT                   /note="Pfam match to entry PF02371 Transposase_20,
FT                   Transposase IS116/IS110/IS902 family , score 118.4, E-value
FT                   8.9e-33"
FT   misc_feature    complement(469981..470277)
FT                   /note="Pfam match to entry PF01548 Transposase_9,
FT                   Transposase , score 108.4, E-value 8.9e-30"
FT   CDS_pept        complement(470668..472722)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0339"
FT                   /product="putative amino acid dioxygenase"
FT                   /note="Similar to Pseudomonas putida
FT                   4-hydroxyphenylpyruvate dioxygenase, putative pp2554
FT                   SWALL:AAN68163 (EMBL:AE016783) (635 aa) fasta scores: E():
FT                   2.8e-61, 53.44% id in 683 aa. CDS contains region with
FT                   additional internal amino acids (residues 272 to 338) in
FT                   comparison to orthologues"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37787"
FT                   /db_xref="GOA:Q63NG0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NG0"
FT                   /protein_id="CAH37787.1"
FT                   /translation="MQRSIATVSLSGTLVEKLRAIRAAGFDGVEIFENDLLYFDGSPAD
FT                   VRAIAADLGLAIVLFQPFRDFEGVPPERLARNLERAKRKFELMHALGANRMLVCSNMSP
FT                   DAIGDDALLIDQLGALARAAQAAGVVAAYEALAWGRNVKTYGHAWRLVDAVNHPSLGLA
FT                   LDSFHTLSLGDSPDGIARIPGERIAFVQIADAPKLAMDVLEWSRHYRSFPGQGDFDLAG
FT                   FTARVIESGYAGPLSLEIFNDGFRAAPTALTAADGYRSLLYLEETTRERLACDARRARR
FT                   AGGAPGAGETRGERERHDAHGERGEHRAHDKDDKPDDKRGGPDERESRAAHPRPAQPLF
FT                   APPPAPAHVGFQFIEFAVDAAAAENVAGWLGKLRFRRAGRHRSKDVTLYQHGAASIVLN
FT                   AERDSFADAFFQEHGLSLCASAFRVDDARLAFERAAGYGYAPFSGRVGPNERVLPSVRA
FT                   PDGSLNYFVDEAPGAPTLYESDFVLTDIDGPSEVGPLAGIDHVCLALPADALDTWVLFF
FT                   KTAFGFEAERNWLVPDPYGLVRSRAVRSPDGSVRIALNASVDRHTAVVRSLERYRGTGL
FT                   NHVAFRADDIVAAIAEFAADGVPFLRIPRNYYDDLAARYALPDETIDTLRRHHLLYDRD
FT                   DAGGEFLHAYTELVDGRFSFEIVERRGGYDGYGAANAAVRLAAQAQRRG"
FT   misc_feature    complement(470866..471207)
FT                   /note="Pfam match to entry PF00903 Glyoxalase,
FT                   Glyoxalase/Bleomycin resistance protein/Dioxygenase
FT                   superfamily , score 17.5, E-value 6.8e-05"
FT   misc_feature    complement(470986..471033)
FT                   /note="PS00063 Aldo/keto reductase family putative active
FT                   site signature."
FT   CDS_pept        472982..473437
FT                   /transl_table=11
FT                   /gene="aroQ2"
FT                   /locus_tag="BPSS0340"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="Similar to Streptomyces coelicolor 3-dehydroquinate
FT                   dehydratase AroQ or sco1961 or scc54.21C SWALL:AROQ_STRCO
FT                   (SWALL:P15474) (156 aa) fasta scores: E(): 7.9e-35, 60.92%
FT                   id in 151 aa, and to Pseudomonas aeruginosa
FT                   3-dehydroquinate dehydratase 2 AroQ2 or pa0245
FT                   SWALL:ARQ2_PSEAE (SWALL:Q9I6P3) (148 aa) fasta scores: E():
FT                   4e-32, 63.5% id in 137 aa. Note: Also similar to BPSL2982
FT                   AroQ1 (150 aa) fasta scores: E(): 4.2e-26, 56.296% identity
FT                   in 135 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37788"
FT                   /db_xref="GOA:Q63NF9"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NF9"
FT                   /protein_id="CAH37788.1"
FT                   /translation="MNKPKVLVLNGPNLNLLGKREPRIYGSETLQDVERRCADAAHALG
FT                   LALEFRQSNAEHQLIDWLHDAREHVAGVVINPAAYTHTSVAIADALAALGKPIIEVHIS
FT                   NVHRREAFRHHSFVSALADGVICGCGTEGYVFALRRLATLIGGEGAR"
FT   misc_feature    472991..473422
FT                   /note="Pfam match to entry PF01220 DHquinase_II,
FT                   Dehydroquinase class II , score 276.9, E-value 1.7e-80"
FT   misc_feature    473006..473059
FT                   /note="PS01029 Dehydroquinase class II signature."
FT   CDS_pept        473434..474288
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="BPSS0341"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="Similar to Corynebacterium glutamicum shikimate
FT                   5-dehydrogenase AroE or cgl0424 SWALL:AROE_CORGL
FT                   (SWALL:Q9X5C9) (280 aa) fasta scores: E(): 8.9e-36, 48.39%
FT                   id in 281 aa, and to Ralstonia solanacearum probable
FT                   shikimate 5-dehydrogenase oxidoreductase protein rsp1398 or
FT                   rs02060 SWALL:Q8XQ88 (EMBL:AL646084) (315 aa) fasta scores:
FT                   E(): 3.2e-68, 72.92% id in 277 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37789"
FT                   /db_xref="GOA:Q63NF8"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NF8"
FT                   /protein_id="CAH37789.1"
FT                   /translation="MSGRSFLIGLIGAGIGGSLSPAMHEAEGCGQGLNYVYRRIDLDAL
FT                   GLTADALPELLAAAERMGFDGLNITHPCKQRVIEHLDELSADAAALGAVNTVCFAHGRR
FT                   IGHNTDWSGFAKAFARGLPGASLERVVQLGAGGAGAAVAHAALTMGAAQLALFDVDPVR
FT                   ARSLADQLQARFPHARLSAGGTLADALANATGLIHATPTGMLGHPGLPLPAHLLRSGLW
FT                   VADIVYFPLETELIRAARALGCRTLPGGGMAVYQAVDAFELFTGRAPDAERMFEHFRAL
FT                   VAR"
FT   misc_feature    473500..474234
FT                   /note="Pfam match to entry PF01488 Shikimate_DH, Shikimate
FT                   / quinate 5-dehydrogenase , score 158.7, E-value 6.7e-45"
FT   CDS_pept        474336..475682
FT                   /transl_table=11
FT                   /locus_tag="BPSS0342"
FT                   /product="putative sugar transport-related, membrane
FT                   protein"
FT                   /note="Similar to Ralstonia solanacearum putative glucarate
FT                   transporter GudP or rsp0828 or rs05367 SWALL:Q8XRK3
FT                   (EMBL:AL646081) (450 aa) fasta scores: E(): 9.1e-73, 44.14%
FT                   id in 444 aa, and to Escherichia coli, and Escherichia coli
FT                   O6 D-galactonate transporter DgoT or b3691 or c4612
FT                   SWALL:DGOT_ECOLI (SWALL:P31457) (430 aa) fasta scores: E():
FT                   9.8e-71, 46.26% id in 428 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37790"
FT                   /db_xref="GOA:Q63NF7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NF7"
FT                   /protein_id="CAH37790.1"
FT                   /translation="MPQPIHTDAAPRAAVAAARAASPARPRSNARYRILALLAFGTMIN
FT                   YLDRTVLGVAAPGLTKELGIGAAAMGVMFSAFSWTYVLAQVPGGLLLDRFGSKLTYYWS
FT                   MTLWSLFTLLQGFVHGVAPLLACRLGLGLSEAPCFPTNSRVVATWFPQKERAMATGTYT
FT                   VGEYIGLAFLSPVLFALMGAFGWRSLFWVVGGVGIVFGFVWWKFYHEPHDHPRANAAEL
FT                   AYIEEGGGLVQATAGGGSRAKFNWRVAGRLLKKRQLAGICLGQFAGNSTLVFFLTWFPT
FT                   YLATERHMGWLKIGFFAVMPFIAASVGVMFGGLFSDWLLRRGRSANVARKLPIIAGLLL
FT                   ASTIVLANYVRSNEAVIAIMSVAFFAQGMAALGWTLVSDIAPEGLLGATGGIFNLAANL
FT                   AGIVTPLVVGFIVAATGSFVGALAFIGVIALIGALSYIFVVGDIKRIEL"
FT   misc_feature    474429..475676
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter , score -85.0, E-value 7.6e-05"
FT   misc_feature    order(474435..474503,474522..474590,474633..474701,
FT                   474819..474887,474900..474959,475104..475172,
FT                   475215..475283,475317..475385,475401..475469,
FT                   475506..475574,475587..475655)
FT                   /note="11 probable transmembrane helices predicted for
FT                   BPSS0342 by TMHMM2.0 at aa 34-56, 63-85, 100-122, 162-184,
FT                   189-208, 257-279, 294-316, 328-350, 356-378, 391-413 and
FT                   418-440"
FT   CDS_pept        complement(476085..477194)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0343"
FT                   /product="putative aminotransferase protein"
FT                   /note="Similar to Pseudomonas putida putative 2aep:pyruvate
FT                   aminotransferase PhnW SWALL:Q8RSQ4 (EMBL:AJ437001) (369 aa)
FT                   fasta scores: E(): 2.3e-80, 59.83% id in 366 aa, and to
FT                   Salmonella typhimurium PhnW or stm0431 SWALL:P96060
FT                   (EMBL:U69493) (367 aa) fasta scores: E(): 2.9e-55, 44.23%
FT                   id in 364 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37791"
FT                   /db_xref="GOA:Q63NF6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR012703"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63NF6"
FT                   /protein_id="CAH37791.1"
FT                   /translation="MPERDPILLTPGPLTTSRMTRDAMLRDWGSWDAAFNRLTKSVCAD
FT                   LVRIAGGGDAYVCVPLQGSGTFAVEATLGTLVPRDARVLVPNNGAYCARIAAILRRLGI
FT                   AHVELPFAEDEPASAHAIDAALARDARLTHVALVHLETSAGLLNPLDDIAAVCRARGRA
FT                   LIVDAMSSFGALPIALAASDIDALISASGKCLEGVPGMGFAIVRRSALEAAEGRSPSVA
FT                   LDLHDQYAYMQRTSQWRFTPPTHVLAALRAALDQFFDEGGQPARGARYARNCATLVDGM
FT                   RALGFEPFLDARAQASVIVTFYAPADPAYAFPAFYAAVRDAGYVLYPGKLTTADTFRVG
FT                   CIGALGADEMRGAVAAIGGALESLGIAMR"
FT   misc_feature    complement(476145..477167)
FT                   /note="Pfam match to entry PF00266 aminotran_5,
FT                   Aminotransferase class-V , score -37.2, E-value 1.6e-06"
FT   CDS_pept        477432..478514
FT                   /transl_table=11
FT                   /locus_tag="BPSS0344"
FT                   /product="putative exported protein"
FT                   /note="Similar to Salmonella typhi probable periplasmic
FT                   binding component of 2-aminoethylphosphonate transporter
FT                   PhnS or sty0468 SWALL:Q8Z8W7 (EMBL:AL627266) (337 aa) fasta
FT                   scores: E(): 1.8e-31, 37.03% id in 324 aa, and to
FT                   Pyrococcus furiosus putative solute binding lipoprotein
FT                   pf1751 SWALL:Q9HH27 (EMBL:AF307052) (357 aa) fasta scores:
FT                   E(): 2.2e-19, 29.26% id in 352 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37792"
FT                   /db_xref="InterPro:IPR017637"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NF5"
FT                   /protein_id="CAH37792.1"
FT                   /translation="MTYTNFPRGGAWRRFALAAGAAALLQGAAAQAQAAAVVLYTADGL
FT                   ENLYRDVLPAFEKQEGVKVNIVTAGSGEVVNRANVEKGSPKADVIVTLPPFIQQAGQFG
FT                   LLQPYRSVNYKNVPAIAKAEDGSWATFVNNYFSFAINPSVVKSQPKTFADLLHPDYSGK
FT                   LAYSNPATAGDGMAVIILTSALMGEDKAFDYLAKLERSVKFHTKGTGYLNVLLSRNEIA
FT                   VANGDLQMDLDDAEHGGLSIKPIFVAAKAGEPPTTFQLPYAIGLVKGGPNQDAGRKLID
FT                   YLMSADVQAKVPDMFGIPGRTDVPLSGKNGEAVKRAIAGVKLIPVDWDAVMAKKPVWTE
FT                   RWKKEVIGDSGKQTEVVKPK"
FT   misc_feature    477432..477527
FT                   /note="Signal peptide predicted for BPSS0344 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.491 between residues 32 and 33"
FT   misc_feature    477552..478505
FT                   /note="Pfam match to entry PF01547 SBP_bac_1, Bacterial
FT                   extracellular solute-binding protein , score 34.3, E-value
FT                   1.8e-07"
FT   CDS_pept        478571..479668
FT                   /transl_table=11
FT                   /locus_tag="BPSS0345"
FT                   /product="putative ABC transport system, ATP-binding
FT                   protein"
FT                   /note="Similar to Agrobacterium tumefaciens ABC
FT                   transporter, nucleotide binding/ATPase protein AfuC or
FT                   atu4786 or agr_l_193 SWALL:Q8U6M1 (EMBL:AE009407) (353 aa)
FT                   fasta scores: E(): 7e-41, 40.4% id in 349 aa, and to
FT                   Brucella melitensis iron(III)-transport ATP-binding protein
FT                   bmeii0567 SWALL:Q8YCG3 (EMBL:AE009693) (353 aa) fasta
FT                   scores: E(): 2.6e-40, 44.59% id in 305 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37793"
FT                   /db_xref="GOA:Q63NF4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017662"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NF4"
FT                   /protein_id="CAH37793.1"
FT                   /translation="MDIASLTHPGAFDAARPHAAPRAGACGGVRIEHLSVRYGARTVLD
FT                   DLSLEIGAGELLAVLGKSGCGKTTLLRFIAGFVKADGLTGTLAVAGRDLTHAPPHKRNL
FT                   GLLFQNYALFPHLTVFENVAFGLRARRMSSADIARRVADALKLVQLGDAGHHLPAQLSG
FT                   GMQQRIALARALVIEPDVLLLDEPLSALDANLRASVRSELKALHERLPNLTVVCVTHDR
FT                   DDALVLADRALLMREGRVAQLGTPQQLYDAPADGFVARYLGAANLLPPNVVFAFGDPRH
FT                   DVRDKVACVRPERLAVRPLGEGRLHGTIASVEWHGAALSLTVMLDAACDEPVLVTMQRG
FT                   RGPAPERGARVSLDCEADDVVLISP"
FT   misc_feature    478730..479284
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter , score 213.9, E-value 1.6e-61"
FT   misc_feature    478751..478774
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    479051..479095
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        479646..480593
FT                   /transl_table=11
FT                   /locus_tag="BPSS0346"
FT                   /product="putative ABC transport system, membrane protein"
FT                   /note="Similar to Salmonella typhimurium PhnU or stm0427
FT                   SWALL:P96064 (EMBL:U69493) (286 aa) fasta scores: E():
FT                   5.1e-28, 36.78% id in 261 aa, and to Brucella melitensis
FT                   iron(III)-transport system permease protein bmeii0585
FT                   SWALL:Q8YCE6 (EMBL:AE009695) (448 aa) fasta scores: E():
FT                   2.7e-14, 32.28% id in 285 aa. CDS is extended at the
FT                   N-terminus in comparison to orthologues"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37794"
FT                   /db_xref="GOA:Q63NF3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017636"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NF3"
FT                   /protein_id="CAH37794.1"
FT                   /translation="MSSLSHLEPRAALAADPAAAARIRASAAAHDAAARRRERRASARI
FT                   VALAAVVLGPLVLYPLVRLVLLSAFGAHGPTLAAYRAFFASHDVRDVLGTTLWVLFASA
FT                   GTASIVGVLLAALLFFRPFPGASLVTRFLELYVAFPSFLVAFTLIFLYGSQGSVSIALQ
FT                   RVLGLDAPPLDFLFGPGGVILAQTVFYTPFVVRPALASFATLDARLVEAAASLGANGWT
FT                   LARRVVLPLAWPGIAAGVILCFLLTLNEFGILLVLGSARLVTLPVAIYSSATVDIDLPA
FT                   AAAGAVVMLAMSLTLYALYRRMSRRANEGGRDVR"
FT   misc_feature    order(479778..479846,479937..480005,480042..480110,
FT                   480168..480227,480348..480416,480474..480542)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPSS0346 by TMHMM2.0 at aa 45-67, 98-120, 133-155, 175-194,
FT                   235-257 and 277-299"
FT   misc_feature    480246..480467
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component , score 47.7, E-value 1.7e-11"
FT   misc_feature    480249..480335
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        480583..481437
FT                   /transl_table=11
FT                   /locus_tag="BPSS0347"
FT                   /product="putative ABC transport system, membrane protein"
FT                   /note="Similar to Salmonella typhimurium PhnV or stm0426
FT                   SWALL:P96065 (EMBL:U69493) (265 aa) fasta scores: E():
FT                   2.7e-22, 34.97% id in 243 aa, and to Rhizobium meliloti
FT                   putative spermidine putrescine ABC transporter permease
FT                   protein PotC or rb0779 or smb21275 SWALL:Q92VC9
FT                   (EMBL:AL603644) (259 aa) fasta scores: E(): 5.8e-13, 30.54%
FT                   id in 239 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37795"
FT                   /db_xref="GOA:Q63NF2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017661"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NF2"
FT                   /protein_id="CAH37795.1"
FT                   /translation="MSADFPARAAPVPRRELRWTDAASRVASRALVALAAAACCWLFVL
FT                   PVVVVALSSVAGHWSGTILPAGYSLRWFERLGRPEFDALAASLEIGLGVAALGTALGVA
FT                   LALALEGRTRRGVGALVDALVMLPNGVPSVVLGLAVLIAYHAKPVDLSSSPAIVVFVQL
FT                   ALVLPFCYRCAAAALRPELAVLREAAASLGAPPAMVLRRVLLPQLVPAIRASLALGFAL
FT                   SLGELGATLTVYPPGFATVPIVVIGAVERGYYLPASALSLLLLGASLVALIAIAARAPR
FT                   PAR"
FT   misc_feature    order(480670..480738,480847..480915,480952..481020,
FT                   481048..481116,481228..481296,481339..481407)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPSS0347 by TMHMM2.0 at aa 30-52, 89-111, 124-146, 156-178,
FT                   216-238 and 253-275"
FT   misc_feature    481111..481341
FT                   /note="Pfam match to entry PF00528 BPD_transp,
FT                   Binding-protein-dependent transport systems inner membrane
FT                   component , score 21.2, E-value 0.0005"
FT   misc_feature    481114..481200
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        481481..482752
FT                   /transl_table=11
FT                   /locus_tag="BPSS0348"
FT                   /product="putativephosphonoacetate hydrolase"
FT                   /note="Similar to Pseudomonas fluorescens phosphonoacetate
FT                   hydrolase PhnA SWALL:Q51782 (EMBL:L49465) (407 aa) fasta
FT                   scores: E(): 1.5e-94, 60.48% id in 410 aa, and to Rhizobium
FT                   meliloti putative phosphonoacetate hydrolase protein rb0978
FT                   or smb21538 SWALL:Q92UV8 (EMBL:AL603645) (424 aa) fasta
FT                   scores: E(): 3.1e-85, 56.06% id in 412 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37796"
FT                   /db_xref="GOA:Q63NF1"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR012710"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023116"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NF1"
FT                   /protein_id="CAH37796.1"
FT                   /translation="MNEGPEGRNTMNRHIEVNGRVYRMPAEPTVAVCVDGCEYDYLEEA
FT                   ASAGVAPFLARMLREGSAFEADCVIPSFTNPNNLSIVCGAPPSVHGICGNFFWDQNAQG
FT                   GAGAAVMMNDPAYLRAGTLLAAAADAGAKVAVVTAKDKLRRLLGWRMRGVCFSAEKANQ
FT                   ANLGENGIADVLDFVGLPSPDVYSAALSEFVLAAGVRLAQSRRADLMYLSTTDYVQHKC
FT                   APGSEGANAFYAMMDRYLAALDALGWVIGVTADHGMNAKHDPRTGEPNVVYLQDALDAW
FT                   LGPRLARVILPITDPYVVHHGALGSFATIYVEQGVDAGTVIGRLREFDGVELALDNATA
FT                   AERFELPADRIGDVVVVGRRDVVLGTRAREHDLSGLTVPLRSHGGLSEQRVPLLFNRRI
FT                   EHVEPGRRLRNFDLFDLALNRTVQ"
FT   CDS_pept        482758..484203
FT                   /transl_table=11
FT                   /locus_tag="BPSS0349"
FT                   /product="putative NADP-dependent
FT                   glyceraldehyde-3-phosphate dehydrogenase"
FT                   /note="Similar to Streptococcus mutans NADP-dependent
FT                   glyceraldehyde-3-phosphate dehydrogenase GapN or smu.676
FT                   SWALL:GAPN_STRMU (SWALL:Q59931) (475 aa) fasta scores: E():
FT                   3.5e-48, 35.32% id in 453 aa, and to Methanobacterium
FT                   thermoautotrophicum NADP-dependent
FT                   glyceraldehyde-3-phosphate dehydrogenase mth978
FT                   SWALL:O27059 (EMBL:AE000871) (455 aa) fasta scores: E():
FT                   8.9e-58, 42.3% id in 442 aa. Note: Also similar to BPSS0607
FT                   (491 aa) fasta scores: E(): 2.8e-91, 59.244% identity in
FT                   476 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37797"
FT                   /db_xref="GOA:Q63NF0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017656"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NF0"
FT                   /protein_id="CAH37797.1"
FT                   /translation="MPLRDHAAYRRETLRWCGQRAARARTLDVFDPYSGLRVGTVPLAT
FT                   VDDVRRAFDYAVAYRPALSRYERSQILERAAARLTARAEEASTLISLESGLSKQDSRYE
FT                   IGRVADVFKFASIEALRDDAQSYSCDLTPHGKSRRVFSQRQPLDGVIVAITPFNHPMNQ
FT                   VAHKIAPAIATNNRVIVKPSEKVPLSALYLADVLYEAGLPEPMLQVLTGDPREIADELL
FT                   THPSATLITFTGGVAIGKSIAAKAGYRRIVLELGGNDPLIVLDDADLERAAALAAQGSY
FT                   KNSGQRCTAVKRILVHKRVAPRFTELLVEHTRAWTYGDPFDPANRMGTVIDEAAAALFE
FT                   ARVDEAVAQGARLLTGNARRGALYAPTVLDRVDASMTLVREETFGPVSPIIAFDTIDDA
FT                   IRISNGTAFGLSSGVCTDRADAIVRFVNELNVGTVNVWEVPGYRLELTPFGGIKDSGLG
FT                   YKEGVQEAMKSFTNLKTFSLPWA"
FT   misc_feature    482800..484197
FT                   /note="Pfam match to entry PF00171 aldedh, Aldehyde
FT                   dehydrogenase family , score 361.8, E-value 4.8e-106"
FT   misc_feature    483457..483480
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    483514..483537
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT   misc_feature    483598..483633
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT   CDS_pept        484208..484759
FT                   /transl_table=11
FT                   /locus_tag="BPSS0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Anabaena sp. hypothetical protein all2220
FT                   SWALL:Q8YUW1 (EMBL:AP003588) (186 aa) fasta scores: E():
FT                   2.9e-29, 47.54% id in 183 aa, and to Pseudomonas aeruginosa
FT                   hypothetical protein pa2804 SWALL:Q9I039 (EMBL:AE004707)
FT                   (193 aa) fasta scores: E(): 1.4e-25, 49.71% id in 175 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37798"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR017670"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NE9"
FT                   /protein_id="CAH37798.1"
FT                   /translation="MALTLDDIRMLFDRHGDIAYSGEPVTQREHALQSAQLAEQAGAND
FT                   ALIAAALLHDLGHLLNRRGETPTAHGIDDLHQYCVLPFLRPLFPDAVLEPIRLHVDAKR
FT                   CLCAIDASYYARLSADSVRSLHLQGGVFSDAEAEAFLKRPYAPDAIRVRRWDDLAKMAG
FT                   KPTPGLDHYMRAVARAAIAK"
FT   rRNA            485360..486852
FT                   /note="16S rRNA"
FT   tRNA            486946..487022
FT                   /note="tRNA Ile anticodon GAT, Cove score 93.29"
FT   tRNA            487057..487132
FT                   /note="tRNA Ala anticodon TGC, Cove score 90.89"
FT   rRNA            487486..490367
FT                   /note="23S rRNA"
FT   rRNA            490549..490664
FT                   /note="5S rRNA"
FT   CDS_pept        491060..491464
FT                   /transl_table=11
FT                   /locus_tag="BPSS0351"
FT                   /product="putative copper-related MerR-family
FT                   transcriptional regulator"
FT                   /note="Similar to Escherichia coli transcriptional
FT                   regulator CueR or b0487 SWALL:CUER_ECOLI (SWALL:P77565)
FT                   (135 aa) fasta scores: E(): 4.6e-18, 44.27% id in 131 aa,
FT                   and to Rhizobium meliloti transcriptional regulator HmrR
FT                   SWALL:HMRR_RHIME (SWALL:Q9X5X4) (147 aa) fasta scores: E():
FT                   1.9e-30, 65.35% id in 127 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37799"
FT                   /db_xref="GOA:Q63NE8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NE8"
FT                   /protein_id="CAH37799.1"
FT                   /translation="MNIGEAAKVSGVSAKMIRYYESVGLLNPAKRTDSGYRVYHDDEIH
FT                   LLRFIRQARRLGFLVDDIRKLLALWQDRSRASAEVKAIALEHVAELDGRIAELTDMRNT
FT                   LVNLAAHCSGDDRPDCSILERLADPCCDPK"
FT   misc_feature    491060..491125
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1203.000, SD 3.28 at aa 11-32, sequence
FT                   VNIGEAAKVSGVSAKMIRYYES"
FT   misc_feature    491069..491137
FT                   /note="PS00552 Bacterial regulatory proteins, merR family
FT                   signature."
FT   misc_feature    491069..491176
FT                   /note="Pfam match to entry PF00376 merR, Bacterial
FT                   regulatory proteins, merR family , score 57.7, E-value
FT                   1.7e-14"
FT   CDS_pept        complement(492322..493167)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YhiR or b3499 SWALL:YHIR_ECOLI (SWALL:P37634) (280 aa)
FT                   fasta scores: E(): 7.5e-46, 48.28% id in 263 aa, and to
FT                   Ralstonia solanacearum hypothetical protein rsc3368 or
FT                   rs02643 SWALL:Q8XU26 (EMBL:AL646075) (285 aa) fasta scores:
FT                   E(): 1.4e-73, 62.1% id in 285 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37800"
FT                   /db_xref="GOA:Q63NE7"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NE7"
FT                   /protein_id="CAH37800.1"
FT                   /translation="MLSYRHGFHAGNHADVLKHTVVVQLLRYLNKKDKSYWYIDTHAGA
FT                   GVYSLFDGYAAKTGEFGTGIEKIWDATDLPEALSDYVDEVRALNRDGELRYYPGSPYLA
FT                   WRLMREQDRMRLFELHSTEIDVLRHNFRDAGRRAMIYAGDGFEGIKALLPPPPRRALVL
FT                   VDPSYEDKRDYAKTTACVEESLKRFATGCYAIWYPQVSRPESQKFPDHLKQLQPNNWLH
FT                   LSLTVSRPPSDGFGLFGSGMFILNPPYTLVDTMKEALPYLVEALGQDSGAKFAIEHRAN
FT                   "
FT   CDS_pept        complement(493316..494287)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0353"
FT                   /product="putative potassium channel subunit"
FT                   /note="Similar to the C-terminal region of Homo sapiens
FT                   voltage-gated potassium channel beta-2 subunit KCNAB2 or
FT                   KCNA2b or KCNK2 SWALL:KVB2_HUMAN (SWALL:Q13303) (367 aa)
FT                   fasta scores: E(): 4.2e-56, 45.79% id in 321 aa, and to
FT                   Xanthomonas campestris voltage-gated potassium channel beta
FT                   subunit XCC0766 SWALL:AAM40081 (EMBL:AE012176) (322 aa)
FT                   fasta scores: E(): 5.7e-62, 52.97% id in 319 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37801"
FT                   /db_xref="InterPro:IPR005399"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NE6"
FT                   /protein_id="CAH37801.1"
FT                   /translation="MNYRRLGRSGLQVSELSIGSWVTYGNQVDRRAARESLAAARDAGV
FT                   NFFDNAEVYAGGKSEEIMGHALKSLGWPRISYVVSTKFFWGLAEAPNQYHTLNRKYLLN
FT                   AIDASLQRLQLDYVDLVFCHRPDPNTPIEETVWAMSDIIARGKALYWGTSEWSADEIRA
FT                   AYEIADRHHLRKPTMEQPQYNLFHRKRVEQEYRRLYEDFGMGLTTWSPLASGLLTGKYR
FT                   HGVPAGSRAEIHGYDWLRAQLTDPAKNRVVEALGEIANDLGCTVGQLALAWVLKNPRVS
FT                   TVITGASRVEQIIENMRSLDVATQITPDTKQQIEQIVGDAYQ"
FT   misc_feature    complement(493325..494269)
FT                   /note="Pfam match to entry PF00248 aldo_ket_red, Aldo/keto
FT                   reductase family , score 247.6, E-value 1.2e-71"
FT   CDS_pept        494475..495263
FT                   /transl_table=11
FT                   /locus_tag="BPSS0354"
FT                   /product="putative D-beta-hydroxybutyrate dehydrogenase"
FT                   /note="Similar to Rhizobium meliloti D-beta-hydroxybutyrate
FT                   dehydrogenase BdhA or rb1136 or smb21010 SWALL:BDHA_RHIME
FT                   (SWALL:O86034) (258 aa) fasta scores: E(): 5.6e-27, 40.45%
FT                   id in 262 aa, and to Alcaligenes eutrophus
FT                   D-beta-hydroxybutyrate dehydrogenase HbdH1 SWALL:BDHA_ALCEU
FT                   (SWALL:Q9X6U2) (258 aa) fasta scores: E(): 1.7e-22, 36.68%
FT                   id in 259 aa. Note: Also similar to BPSS0017 (262 aa) fasta
FT                   scores: E(): 3.7e-83, 99.615% identity in 260 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37802"
FT                   /db_xref="GOA:Q63NE5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NE5"
FT                   /protein_id="CAH37802.1"
FT                   /translation="MTSNLNGKAAIVTGAASGIGKEIALELARAGAAVAIADLNQDGAN
FT                   AVAELIEQAGGRAIGVAMDVTNEDAVNAGIDKVAQTFGSVDILVSNAGIQIVNPIENYA
FT                   FADWKKMQAIHVDGAFLTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHG
FT                   LLGLARVLAKEGAKHNVRSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGQT
FT                   VDGVFTTVEDVAKTVLFLSAFPSAALTGQSFVVSHGWFMQ"
FT   misc_feature    494490..495251
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase , score 236.2, E-value 3.1e-68"
FT   misc_feature    494904..494990
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   CDS_pept        complement(495489..496688)
FT                   /transl_table=11
FT                   /gene="tyrB"
FT                   /locus_tag="BPSS0355"
FT                   /product="aromatic-amino-acid aminotransferase"
FT                   /EC_number="2.6.1.57"
FT                   /note="Similar to Escherichia coli aromatic-amino-acid
FT                   aminotransferase TyrB or b4054 SWALL:TYRB_ECOLI
FT                   (SWALL:P04693) (397 aa) fasta scores: E(): 1.3e-80, 54.63%
FT                   id in 399 aa, and to Pseudomonas aeruginosa aspartate
FT                   aminotransferase AspC or pa3139 SWALL:AAT_PSEAE
FT                   (SWALL:P72173) (398 aa) fasta scores: E(): 2.6e-111, 73.86%
FT                   id in 398 aa. Note: Also similar to BPSS0808 (401 aa) fasta
FT                   scores: E(): 7.1e-72, 53.149% identity in 397 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37803"
FT                   /db_xref="GOA:Q63NE4"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="PDB:4EFF"
FT                   /db_xref="PDB:4F4E"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NE4"
FT                   /protein_id="CAH37803.1"
FT                   /translation="MSLFSAVELAPRDPILGLNEAFNADTRPTKVNLGVGVYTNEDGKI
FT                   PLLRAVRDAEKARVEAGLPRGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVTAQALG
FT                   GTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYYDAKTNGVNFDG
FT                   MLAALNGYEPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGES
FT                   IEADAAAVRLFAAANLNVFVSSSFSKSFSLYGERVGALSIITDSKDEAARVLSQLKRVI
FT                   RTNYSNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGLVERLKAAGIERDF
FT                   SFINAQRGMFSYSGLTSAQVDRLREEFGIYAVSTGRICVAALNTRNLDVVANAIAAVLK
FT                   "
FT   misc_feature    complement(495495..496445)
FT                   /note="Pfam match to entry PF00155 aminotran_1_2,
FT                   Aminotransferase class I and II , score 336.2, E-value
FT                   2.4e-98"
FT   misc_feature    complement(495915..495956)
FT                   /note="PS00105 Aminotransferases class-I
FT                   pyridoxal-phosphate attachment site."
FT   CDS_pept        496976..499066
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="BPSS0356"
FT                   /product="excinuclease ABC subunit B"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 excinuclease ABC subunit B UvrB or b0779 or z0998
FT                   or ecs0857 SWALL:UVRB_ECOLI (SWALL:P07025) (673 aa) fasta
FT                   scores: E(): 6.3e-155, 66.17% id in 671 aa, and to
FT                   Burkholderia cepacia excinuclease ABC subunit B UvrB
FT                   SWALL:Q93LP1 (EMBL:AY036068) (697 aa) fasta scores: E(): 0,
FT                   94.52% id in 694 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37804"
FT                   /db_xref="GOA:Q63NE3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63NE3"
FT                   /protein_id="CAH37804.1"
FT                   /translation="MSEHHSDTRDDLDESKFVTFEGSPFQLYQPYPPSGDQPTAIATLV
FT                   EGVEDGLSFQTLLGVTGSGKTYTMANTIARLGRPAIVFAPNKTLAAQLYAEFREFFPRN
FT                   AVEYFVSYYDYYQPEAYVPQRDLFIEKDSSINEHIEQMRLSATKSLMERRDVVIVATVS
FT                   AIYGIGNPSEYHQMILTLRTGDKIGQREVIARLIAMQYTRNEQDFQRGTFRVRGDTIDI
FT                   FPAEHAEMAVRVELFDDEVDTLHLFDPLTGRVRQKIPRFTVYPSSHYVTPRETVMRAVE
FT                   TIKDELRERLEFFHRDGKLVEAQRLEQRTRFDLEMLQELGFCKGIENYSRHFSGAAPGE
FT                   PPPTLVDYLPPDALMLLDESHVLIGQLNGMYNGDRARKENLVDYGFRLPSALDNRPLKF
FT                   PEFERKMRQVVFVSATPADYEQRVSGQTAEQVVRPTGLVDPQIEVRPASTQVDDVLSEI
FT                   TERVKANERVLITVLTKRMAEQLTEFLADHGVKVRYLHSDIDTVERVEIIRDLRLGTFD
FT                   VLVGINLLREGLDIPEVSLVAILDADKEGFLRAERSLIQTIGRAARNVNGKALLYADRI
FT                   TDSMRRAIDETERRRAKQIAYNEKMGITPRGVVKRIKDIIDGVYNADEARAELKEAQQR
FT                   AKFEDMSEKQIAKEIKRLEKQMADYAKNLEFEKAAQTRDQLALLRERVFGANVGDHVSG
FT                   GE"
FT   misc_feature    497150..497173
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    498440..498670
FT                   /note="Pfam match to entry PF00271 helicase_C, Helicase
FT                   conserved C-terminal domain , score 70.1, E-value 3.1e-18"
FT   misc_feature    498914..499021
FT                   /note="Pfam match to entry PF02151 UVR, UvrB/uvrC motif ,
FT                   score 45.6, E-value 7.4e-11"
FT   CDS_pept        499290..499841
FT                   /transl_table=11
FT                   /locus_tag="BPSS0357"
FT                   /product="putative exported protein"
FT                   /note="Similar to Brucella melitensis 19 kDa periplasmic
FT                   protein bmeii0885 SWALL:Q8YBL4 (EMBL:AE009722) (185 aa)
FT                   fasta scores: E(): 2.8e-42, 61.62% id in 185 aa, and to
FT                   Brucella suis membrane antigen, putative bra0381
FT                   SWALL:AAN33579 (EMBL:AE014537) (182 aa) fasta scores: E():
FT                   4.4e-42, 67.27% id in 165 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37805"
FT                   /db_xref="InterPro:IPR018470"
FT                   /db_xref="InterPro:IPR038482"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NE2"
FT                   /protein_id="CAH37805.1"
FT                   /translation="MLRSSFVRSGVALAAACAALSATAAEYPIGKHQIQGGMEIGAVYL
FT                   QPITMDPEGMMRKASDSDIHLEADIHAVKNNPTGFAEGDWMPYLQVTYKLTKQGDAKWA
FT                   AQGDLMGMVASDGPHYGDNVKLNGPGKYHLTLVVKPPMQTGHMAFGRHVDKETGVGAWF
FT                   KPITLEYDFPFAGIGKKGGY"
FT   misc_feature    499290..499361
FT                   /note="Signal peptide predicted for BPSS0357 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.997 between residues 34 and 35"
FT   CDS_pept        499901..500230
FT                   /transl_table=11
FT                   /locus_tag="BPSS0358"
FT                   /product="putative exported protein"
FT                   /note="Similar to Brucella melitensis hypothetical protein
FT                   bmeii0884 SWALL:Q8YBL5 (EMBL:AE009722) (124 aa) fasta
FT                   scores: E(): 2.2e-13, 46.29% id in 108 aa, and to
FT                   Rickettsia conorii hypothetical protein rc0541 SWALL:Q92I79
FT                   (EMBL:AE008615) (126 aa) fasta scores: E(): 2.7e-07, 38.27%
FT                   id in 81 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37806"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NE1"
FT                   /protein_id="CAH37806.1"
FT                   /translation="MTFPRAYAFAAAILVAGAAHAADLPTFRLEMADGKLNPARIEVPA
FT                   GQRIKIQIRNTGKGAVEFESVQLRKEKVLAPGGESFVVIAPLSPGEYKFFDDFHQQAQG
FT                   VIVAK"
FT   misc_feature    499901..499963
FT                   /note="Signal peptide predicted for BPSS0358 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 1.000 between residues 21 and 22"
FT   misc_feature    499901..500158
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT   CDS_pept        500290..501132
FT                   /transl_table=11
FT                   /locus_tag="BPSS0359"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YcdN or b1016/b1017 SWALL:YCDN_ECOLI (SWALL:P75901) (276
FT                   aa) fasta scores: E(): 5e-17, 30.28% id in 284 aa, and to
FT                   Brucella melitensis high-affinity iron permease bmeii0883
FT                   SWALL:Q8YBL6 (EMBL:AE009722) (278 aa) fasta scores: E():
FT                   6.8e-49, 53.58% id in 265 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37807"
FT                   /db_xref="GOA:Q63NE0"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NE0"
FT                   /protein_id="CAH37807.1"
FT                   /translation="MGQILFIVWRESVEALLVVGILYAWLKNGDDEARRGLPYLWAGVG
FT                   AGLLMAVGLGAALVGFTEVLSGDAQDYFQTAMVLIACVLIVQMVLWMKQHGRTLKRDME
FT                   RSLQKSTQDANWWGVAVLVALAIAREGSETAIFLYGLGFGQSGHVDGSQMLAVLIGLGL
FT                   AFLTFYVLQLGGKYFSWRHFFRVTEIMLLFLGAGLFQTGIDKLIDKEILPLGIAQLWDT
FT                   SAILDDSSTFGSLVSTLTGYRAHPSLTNLVAYVAYWAIVYLLLKRAARRPAATAGRPA"
FT   misc_feature    500290..501105
FT                   /note="Pfam match to entry PF03239 FTR1, Iron permease FTR1
FT                   family , score 50.8, E-value 2e-12"
FT   misc_feature    order(500299..500367,500404..500472,500500..500568,
FT                   500629..500697,500740..500808,500845..500898,
FT                   501031..501084)
FT                   /note="7 probable transmembrane helices predicted for
FT                   BPSS0359 by TMHMM2.0 at aa 4-26, 39-61, 71-93, 114-136,
FT                   151-173, 186-203 and 248-265"
FT   CDS_pept        501129..502529
FT                   /transl_table=11
FT                   /locus_tag="BPSS0360"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Brucella melitensis nitrogen fixation
FT                   protein VnfA bmeii0882 SWALL:Q8YBL7 (EMBL:AE009722) (457
FT                   aa) fasta scores: E(): 3.1e-104, 54.08% id in 453 aa, and
FT                   to the C-terminal region of Anabaena sp. nitrogen
FT                   assimilation regulatory protein all3558 SWALL:Q8YR90
FT                   (EMBL:AP003593) (841 aa) fasta scores: E(): 7.5e-11, 27.25%
FT                   id in 466 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37808"
FT                   /db_xref="GOA:Q63ND9"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:Q63ND9"
FT                   /protein_id="CAH37808.1"
FT                   /translation="MSAVVGCRRTSLVAQAGHWMQRHGALIRGIQWVVVLVYAFLILVP
FT                   AFTPLPDDTAHLWSNLTLAAQFVFWGIWWPFVLLSMVMLGRVWCGVLCPEGALSEFASK
FT                   FGRGRAIPRWMRWGGWPFVAFGLTTIYGQMVSVYQYPRAVLLVLGGSTLAAIVIGFLYG
FT                   REKRVWCRYLCPVNGVFSLLARLSPLRYKVDEDAWRRSYRKGEDGHRVIPINCAPLVPL
FT                   RNMKGAAACHMCGRCSGHRGAIELTARSPSEEVVALGDRQASSWDTALILYGLLGIAIG
FT                   AFHWTVSPWFVQIKQTLAGWLIDHDIMWPLDTNAPWFIFTHYPEHNDVFSWLDGSLVVA
FT                   YIVGTGLVYGTALAVLLAGAAAMLGRFERVRLHHLAQALIPLAGAGVFLGLSATTLSLL
FT                   RAEHVPLGWASDVRIAILVGANLWSAWLAWLVTGRYASWPRRLLAMLWFGAALAVVDSA
FT                   WWLMFWGF"
FT   misc_feature    order(501201..501269,501312..501380,501477..501545,
FT                   501555..501614,501936..502004,502137..502205,
FT                   502242..502310,502353..502421,502455..502523)
FT                   /note="9 probable transmembrane helices predicted for
FT                   BPSS0360 by TMHMM2.0 at aa 25-47, 62-84, 117-139, 143-162,
FT                   270-292, 337-359, 372-394, 409-431 and 443-465"
FT   CDS_pept        502589..502999
FT                   /transl_table=11
FT                   /locus_tag="BPSS0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   protein GlcG or b2977 or c3706 SWALL:GLCG_ECOLI
FT                   (SWALL:P45504) (134 aa) fasta scores: E(): 1.9e-20, 49.24%
FT                   id in 132 aa, and to Pseudomonas aeruginosa hypothetical
FT                   protein pa5352 SWALL:Q9HTK6 (EMBL:AE004947) (133 aa) fasta
FT                   scores: E(): 6.9e-22, 53.38% id in 133 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37809"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:Q63ND8"
FT                   /protein_id="CAH37809.1"
FT                   /translation="MRTKPVLTSDDVNKMAAAAEAFAAANQWAVTVAIFDDGAHLLHLH
FT                   RMDGAAPSTVEMAIGKGRTAALGRRESKVYEDIVLQGRISFLSVPLVGLVEGGVPIVVD
FT                   GETVGAIGVSGVKSEQDAAVARAGIAALTDAG"
FT   misc_feature    502598..502984
FT                   /note="Pfam match to entry PF03928 DUF336, Domain of
FT                   unknown function (DUF336) , score 160.7, E-value 1.7e-45"
FT   CDS_pept        complement(503302..503565)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="Low similarity to Ralstonia solanacearum putative
FT                   hemin uptake protein HemP or rsc1966 or rs03540
FT                   SWALL:Q8XXZ7 (EMBL:AL646067) (92 aa) fasta scores: E():
FT                   0.0018, 39.02% id in 82 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37810"
FT                   /db_xref="InterPro:IPR019600"
FT                   /db_xref="UniProtKB/TrEMBL:Q63ND7"
FT                   /protein_id="CAH37810.1"
FT                   /translation="MTEPMRSTTLTLRRTSDTAPGSRSKAAAVTTPAESAKAAMKPAAA
FT                   SAGQRVVSSDALLQGQSHVSIAHNGETYQLRATRLGKLILTK"
FT   CDS_pept        complement(503709..504194)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein rsc1364 or rs04646 SWALL:Q8XZN1 (EMBL:AL646064)
FT                   (156 aa) fasta scores: E(): 3.5e-24, 49.67% id in 155 aa,
FT                   and to Pseudomonas aeruginosa hypothetical protein pa1206
FT                   SWALL:Q9I4D2 (EMBL:AE004550) (157 aa) fasta scores: E():
FT                   6e-14, 38.81% id in 152 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37811"
FT                   /db_xref="InterPro:IPR015075"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q63ND6"
FT                   /protein_id="CAH37811.1"
FT                   /translation="MNFEHLIQINAADNPAVPTLTRAQLWEGLVLRAEQPQLFVLGLDS
FT                   CIVHERTETTLERELHYGNATVRDHVTFTPNEQVRYDIHAADGEIGGSLTMTIEERDDQ
FT                   QLFLRFEYRTTLPVSNDSEDARQTQEIVKEAYRTSDIDTVRLIREYAQGRKDPDPLH"
FT   CDS_pept        complement(504313..505185)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0364"
FT                   /product="putative chromosome condensation protein"
FT                   /note="Similar to Streptomyces coelicolor possible
FT                   chromosome condensation protein sco3798 or scac2.06C
FT                   SWALL:Q9F320 (EMBL:AL939117) (325 aa) fasta scores: E():
FT                   1.5e-47, 45.39% id in 293 aa, and to Lycopersicon
FT                   esculentum pirin-like protein SWALL:PIRL_LYCES
FT                   (SWALL:Q9SEE4) (291 aa) fasta scores: E(): 4.2e-45, 45.93%
FT                   id in 283 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37812"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q63ND5"
FT                   /protein_id="CAH37812.1"
FT                   /translation="MTIARSIQRTYPAHRTTEGGGFVVHRPFPTRLLTDFDPFLLLDEM
FT                   GPVDYAPNDAKGAPDHPHRGFETVTYVLEGWFRHRDSAGHAGALGPGDVQWMTAGAGVV
FT                   HSEMPDPEFARRGGRAHAFQLWVNLPRRDKMIAPRYQDIPAARIPSAKSPDGRAKVRVI
FT                   AGEAFGACATIETRTPMLYLHFTLSPGAVVEQPVPAGFRVFAYPFEGGGFYGGDREAVD
FT                   ARHVVVYAEDGDTAVIAAGEAPLDLLLIGGAPLNEPIVRYGPFVMNTEDEIREAVADYQ
FT                   TGRMGRISA"
FT   misc_feature    complement(504427..505122)
FT                   /note="Pfam match to entry PF02678 DUF209, Uncharacterized
FT                   BCR, YhhW family COG1741 , score -43.9, E-value 3.3e-08"
FT   CDS_pept        505308..506279
FT                   /transl_table=11
FT                   /locus_tag="BPSS0365"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /note="Similar to Xanthomonas axonopodis transcriptional
FT                   regulator xac1655 SWALL:AAM36523 (EMBL:AE011797) (333 aa)
FT                   fasta scores: E(): 1.4e-49, 45.39% id in 315 aa, and to
FT                   Yersinia pestis lysr-family transcriptional regulatory
FT                   protein ypo2150 SWALL:Q8ZEL4 (EMBL:AJ414151) (301 aa) fasta
FT                   scores: E(): 4.5e-45, 43.33% id in 300 aa. Note: This CDS
FT                   contains two possible alternative start codons at residues
FT                   8 or 18"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37813"
FT                   /db_xref="GOA:Q63ND4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63ND4"
FT                   /protein_id="CAH37813.1"
FT                   /translation="MTIDAHNLNDLMYFSQVVEHGGFSAAERVLGISKSRLSRRLTELE
FT                   ATLGVRLLQRSTRKLALTEAGQLFYQHCQAMLSEAQAAMNAVQQLRSAPRGTVRVSVPV
FT                   TVSQTMLSRLLPEFLRRYPEVRVQIRVTNRVIDLFEDSIDVALRVRSEPPQSANIVVRP
FT                   LWRTEQMLVGAPSLLQQNAPPLAPDDLAGFDTLDTPSGDGRHVFNLIAPDGTRHTHEHE
FT                   PRLVTADLMTIREAVLDGVGIAALPESMYGNALRAGQLSPVMPGWTLPVPQLYAVFVSR
FT                   QGMPPAVRAFVDYLVEKLDNERYEEPGCPERGAKDTQTKISI"
FT   misc_feature    505329..505508
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family , score
FT                   72.4, E-value 6.2e-19"
FT   misc_feature    505368..505433
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1203.000, SD 3.28 at aa 28-49, sequence
FT                   GGFSAAERVLGISKSRLSRRLT"
FT   misc_feature    505578..506207
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain , score 163.8, E-value 1.9e-46"
FT   CDS_pept        complement(506662..507084)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0366"
FT                   /product="putative biopolymer transport protein"
FT                   /note="Similar to Xanthomonas campestris biopolymer
FT                   transport protein ExbD1 or xcc0010 SWALL:EXB1_XANCP
FT                   (SWALL:O34259) (140 aa) fasta scores: E(): 4.8e-18, 43.18%
FT                   id in 132 aa, and to Ralstonia solanacearum probable
FT                   biopolymer transport transmembrane protein rsc1965 or
FT                   rs03539 SWALL:Q8XXZ8 (EMBL:AL646067) (137 aa) fasta scores:
FT                   E(): 4.7e-30, 61.76% id in 136 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37814"
FT                   /db_xref="GOA:Q63ND3"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:Q63ND3"
FT                   /protein_id="CAH37814.1"
FT                   /translation="MNTSFGDDDDDGLMNEINMTPLVDVMLVLLIIFLVTIPAMHHAVK
FT                   IDLPRASSQPVEVKPKTIDVAIESDGTVLWDDHPVSAADLQARIAQAAQTNPQPELHLR
FT                   ADRKVAYERVAEVMSAAQAGGLTKLGFVTEPKSNAK"
FT   misc_feature    complement(506677..507057)
FT                   /note="Pfam match to entry PF02472 ExbD, Biopolymer
FT                   transport protein ExbD/TolR , score 84.2, E-value 1.7e-22"
FT   misc_feature    complement(506953..507021)
FT                   /note="1 probable transmembrane helix predicted for
FT                   BPSS0366 by TMHMM2.0 at aa 22-44"
FT   CDS_pept        complement(507104..507832)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0367"
FT                   /product="putative bipolymer transport protein"
FT                   /note="Similar to Xanthomonas campestris biopolymer
FT                   transport protein ExbB or xcc0009 SWALL:EXBB_XANCP
FT                   (SWALL:O34260) (253 aa) fasta scores: E(): 1.3e-30, 42.46%
FT                   id in 219 aa, and to Pseudomonas aeruginosa TolQ protein or
FT                   pa0969 SWALL:TOLQ_PSEAE (SWALL:P50598) (231 aa) fasta
FT                   scores: E(): 1.7e-15, 30.95% id in 210 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37815"
FT                   /db_xref="GOA:Q63ND2"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:Q63ND2"
FT                   /protein_id="CAH37815.1"
FT                   /translation="MQSYGIAHVWAQGDFVTRFIAIALLVMSILSWMVIVIKGWNVIRL
FT                   KRLSKDAEQSFWHSDDFDEGVDKLGRASSSSQDNPFLALALSGKEAADHHHQTQPHLHD
FT                   RMDVSDWVTRCLKDTMDEGIARMQGGLAILASIGSTAPFVGLFGTVWGIYHALLVIGAT
FT                   GQTSIDQVAGPVGESLIMTAFGLFVAIPAVLGYNALTRANKSVVSRLRRFAHGLHAYFV
FT                   TGTRLASSQRDGLRLAARAN"
FT   misc_feature    complement(507188..507601)
FT                   /note="Pfam match to entry PF01618 MotA_ExbB,
FT                   MotA/TolQ/ExbB proton channel family , score 146.5, E-value
FT                   3e-41"
FT   misc_feature    complement(order(507233..507301,507380..507448,
FT                   507722..507790))
FT                   /note="3 probable transmembrane helices predicted for
FT                   BPSS0367 by TMHMM2.0 at aa 15-37, 129-151 and 178-200"
FT   CDS_pept        complement(507869..508564)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0368"
FT                   /product="putative TonB-like transport protein"
FT                   /note="Similar to Ralstonia solanacearum probable TonB
FT                   transmembrane protein or rsc1963 or rs03537 SWALL:Q8XY00
FT                   (EMBL:AL646067) (221 aa) fasta scores: E(): 5.8e-10, 35.71%
FT                   id in 238 aa, and to Bordetella bronchiseptica TonB
FT                   SWALL:Q9ZG18 (EMBL:AF087669) (268 aa) fasta scores: E():
FT                   2.4e-06, 33.86% id in 251 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37816"
FT                   /db_xref="GOA:Q63ND1"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q63ND1"
FT                   /protein_id="CAH37816.1"
FT                   /translation="MNPRIVTAAVTVLAGHALLLTGALLMRNDVPHRPLESKTITAQLL
FT                   SAPVAQPAGIQSAPAPTPPQPVPKAKPKPAPTPVPRPVAKSSRTPMPVTHEPAPNAITA
FT                   PEPAPAAPVAPAETSAKAAPPAGAPTNRPTMEIVAPKEGAHLSCQIAKAAYPSMSKRRG
FT                   ETGVVKVRFVVGLTGKIESAQVVQSSGFARLDDAALDAIRSSPCQPYLQNGQPMRAAYT
FT                   QPYDFTLTD"
FT   misc_feature    complement(508007..508111)
FT                   /note="Pfam match to entry PF03544 TonB, Gram-negative
FT                   bacterial tonB protein , score 40.4, E-value 2.6e-09"
FT   misc_feature    complement(508508..508564)
FT                   /note="Signal peptide predicted for BPSS0368 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.828) with cleavage site
FT                   probability 0.315 between residues 19 and 20"
FT   CDS_pept        complement(508840..509079)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0369"
FT                   /product="putative bacterioferritin ferredoxin protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   bacterioferritin-associated ferredoxin Bfd or b3337 or
FT                   c4108 SWALL:BFD_ECOLI (SWALL:P13655) (64 aa) fasta scores:
FT                   E(): 0.002, 35.84% id in 53 aa, and to Ralstonia
FT                   solanacearum putative bacterioferritin-associated
FT                   ferredoxin protein rsc0349 or rs03316 SWALL:Q8Y2I7
FT                   (EMBL:AL646058) (91 aa) fasta scores: E(): 6.3e-07, 45.45%
FT                   id in 55 aa. CDS is extended at the C-terminus in
FT                   comparison to orthologues"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37817"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q63ND0"
FT                   /protein_id="CAH37817.1"
FT                   /translation="MIVCVCKSVSDRKIRASLAEGVNTFEELQFELGVATCCGKCEETV
FT                   REIMAEQGVCASRCGAERPAAVPVAVTFYERKAA"
FT   CDS_pept        complement(509211..510083)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0370"
FT                   /product="putative glutamate racemase"
FT                   /note="Similar to Pediococcus pentosaceus glutamate
FT                   racemase MurI SWALL:MURI_PEDPE (SWALL:Q08783) (265 aa)
FT                   fasta scores: E(): 1.1e-24, 33.2% id in 265 aa, and to
FT                   Escherichia coli glutamate racemase MurI or Dga or Glr or
FT                   b3967 SWALL:MURI_ECOLI (SWALL:P22634) (285 aa) fasta
FT                   scores: E(): 6.4e-23, 37.75% id in 249 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37818"
FT                   /db_xref="GOA:Q63NC9"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NC9"
FT                   /protein_id="CAH37818.1"
FT                   /translation="MTTPYAPDSPAPSARAPIGVFDSGLGGLSVLRAVRERLPDEALVY
FT                   VADSRHAPYGPRDDVFIVERTLAIGEWLVAQGAKALVVACNTATAQSIAIVRERLPIPL
FT                   VGVEPGIKPAALHSKTRVAGVLATQATLRSARFEALLARHAADCRFLCQPGHGLVEAIE
FT                   RGDTGSPALRALLASYLEPMLEAGADTLVLGCTHYPFLDAAIRDVTRNRLHLIDTGDAI
FT                   ARQLARVLDERGLRAPASPRPAPLPRFCSTSDGRQLQALAATLLGLDAPVESVTISSPS
FT                   TAASAADPA"
FT   misc_feature    complement(509391..510032)
FT                   /note="Pfam match to entry PF01177 Asp_Glu_race,
FT                   Asp/Glu/Hydontoin racemase , score 208.6, E-value 6.3e-60"
FT   misc_feature    complement(509481..509513)
FT                   /note="PS00924 Aspartate and glutamate racemases signature
FT                   2."
FT   misc_feature    complement(509814..509840)
FT                   /note="PS00923 Aspartate and glutamate racemases signature
FT                   1."
FT   CDS_pept        complement(510130..510606)
FT                   /transl_table=11
FT                   /gene="bfr"
FT                   /locus_tag="BPSS0371"
FT                   /product="bacterioferritin"
FT                   /note="Similar to Azotobacter vinelandii bacterioferritin
FT                   Bfr SWALL:BFR_AZOVI (SWALL:P22759) (156 aa) fasta scores:
FT                   E(): 3.7e-38, 68.83% id in 154 aa, and to Serratia
FT                   marcescens bacterioferritin Bfr SWALL:BFR_SERMA
FT                   (SWALL:O68935) (159 aa) fasta scores: E(): 1.2e-32, 59.74%
FT                   id in 154 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37819"
FT                   /db_xref="GOA:Q63NC8"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NC8"
FT                   /protein_id="CAH37819.1"
FT                   /translation="MQGDKKVIEYLNAQLKNELTAINQYFLHARMYKHWGLEKLGKHEY
FT                   DESIGEMKHADWLIERVFMLDGLPNLQDLHKLLVGEETEEILKCDLKLEQVSQATCKEA
FT                   IAYCESVRDYVSREIFEKILDDTEEHIDWLETQIDLIGKVGIQNYQQSMMGSPE"
FT   misc_feature    complement(510175..510585)
FT                   /note="Pfam match to entry PF00210 ferritin, Ferritin-like
FT                   domain , score 170.0, E-value 2.6e-48"
FT   CDS_pept        complement(510761..512296)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0372"
FT                   /product="putative fumarate hydratase"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   fumarate hydratase class I, aerobic FumA or b1612 or c2004
FT                   SWALL:FUMA_ECOLI (SWALL:P00923) (547 aa) fasta scores: E():
FT                   1.1e-29, 33.89% id in 472 aa, and to Ralstonia solanacearum
FT                   probable fumarate hydratase protein rsc1955 or rs03529
FT                   SWALL:Q8XY08 (EMBL:AL646067) (507 aa) fasta scores: E():
FT                   1.3e-168, 85.51% id in 511 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37820"
FT                   /db_xref="GOA:Q63NC7"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NC7"
FT                   /protein_id="CAH37820.1"
FT                   /translation="MTVIKQEDLIQSIADSLQYISYYHPLDYIQALGRAYELEQSPAAK
FT                   DAIAQILTNSRMCAAGKRPICQDTGIVTIFVKVGMDVRWASENGAATMSVTDMINEGVR
FT                   RGYTHPDNVLRASIVNPPEGARKNTKDNTPAVIHYEIVPGDKVDVQVAAKGGGSENKSK
FT                   FVMLNPSDSIVDWVLKTVPTMGAGWCPPGMLGIGIGGTAEKAMLMAKESLMEPIDIQEI
FT                   IARGPKDWVEELRVELHEKVNALGIGAQGLGGLATVLDVKILAAPTHAASKPVAMIPNC
FT                   AATRHAHFVLDGSGAAKLEAPSLDAWPKVQWEPNTETSKRVDLNTLTPEEVASWKPGQT
FT                   LLLSGKMLTGRDAAHKRIADMLAKGEPLPVDFKNRVIYYVGPVDPVRDEVVGPAGPTTA
FT                   TRMDKFTETMLAQTGLISMVGKAERGPVAIDAIKKHKAAYLMAVGGAAYLVSKAIRGAK
FT                   VLAFEDLGMEAIYEFDVQDMPVTVAVDSQGTSVHQTGPKEWQAKIGKIPVASA"
FT   CDS_pept        complement(512336..512944)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0373"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 hypothetical protein YqhA or b3002 or z4355 or
FT                   ecs3886 SWALL:YQHA_ECOLI (SWALL:P52082) (164 aa) fasta
FT                   scores: E(): 8.3e-22, 37.65% id in 162 aa, and to Ralstonia
FT                   solanacearum probable transmembrane protein rsc1954 or
FT                   rs03528 SWALL:Q8XY09 (EMBL:AL646067) (179 aa) fasta scores:
FT                   E(): 6.6e-50, 78.78% id in 165 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37821"
FT                   /db_xref="GOA:Q63NC6"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NC6"
FT                   /protein_id="CAH37821.1"
FT                   /translation="MSAAPTDPRAARPARRKMRPLPAVIFMSRWLQVPLYLGLIVAQAI
FT                   YVFLFLKEVWHLLSHATGLDETNIMLAVLGLIDVVMISNLLIMVIVGGYETFVSRLGVE
FT                   GHPDEPEWLDHVNAGVLKVKLSMALISISSIHLLKTFINPDQHTTHAIMWQVLIHVAFL
FT                   VSALVMAWVDRLTTHTHPEHFHEASTPPSAPREPAQQSA"
FT   misc_feature    complement(512405..512896)
FT                   /note="Pfam match to entry PF03350 UPF0114, Uncharacterized
FT                   protein family, UPF0114 , score 244.4, E-value 1.1e-70"
FT   misc_feature    complement(order(512429..512497,512666..512734,
FT                   512792..512860))
FT                   /note="3 probable transmembrane helices predicted for
FT                   BPSS0373 by TMHMM2.0 at aa 29-51, 71-93 and 150-172"
FT   CDS_pept        complement(513177..514076)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0374"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   transmembrane protein rsc1953 or rs03527 SWALL:Q8XY10
FT                   (EMBL:AL646067) (336 aa) fasta scores: E(): 2.9e-71, 66.1%
FT                   id in 298 aa, and to Bacillus subtilis hypothetical
FT                   transport protein YetK SWALL:YETK_BACSU (SWALL:O31540) (330
FT                   aa) fasta scores: E(): 2.6e-32, 33.55% id in 295 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37822"
FT                   /db_xref="GOA:Q63NC5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NC5"
FT                   /protein_id="CAH37822.1"
FT                   /translation="MNRYAFFLIASMLLVGSNVGIGKSIVAFVPVVILATLRFVIANAV
FT                   LWPLFSPVKMRAVKRGEWLNLFLQAFFGTFMFTLLMLNGVQRTSAVAAGVITSTIPAVV
FT                   ALFAWLFLREKPNGRALVSIALAIVGVVTINVANGTASEGGAHASSLAGNLLMLGAVCC
FT                   ESIYVILSRRLTQTLAPIDICAYTHLFGLLLMLPLGAGALWHFDYASVPAGIWALVVWY
FT                   GVSASIFSFWLWMKGIRHVPGSLAGVFSAVLPIAAAIYGILFLGERPTLAHGFALACVV
FT                   TGIVLASLRVRRAPPVSP"
FT   misc_feature    complement(513210..513593)
FT                   /note="Pfam match to entry PF00892 DUF6, Integral membrane
FT                   protein DUF6 , score 79.0, E-value 6.5e-21"
FT   misc_feature    complement(order(513210..513269,513282..513350,
FT                   513375..513434,513462..513530,513567..513626,
FT                   513654..513722,513741..513809,513822..513890,
FT                   513927..513986,513996..514064))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BPSS0374 by TMHMM2.0 at aa 5-27, 31-50, 63-85, 90-112,
FT                   119-141, 151-170, 183-205, 215-234, 243-265 and 270-289"
FT   misc_feature    complement(513669..514040)
FT                   /note="Pfam match to entry PF00892 DUF6, Integral membrane
FT                   protein DUF6 , score 83.8, E-value 2.3e-22"
FT   misc_feature    complement(514011..514076)
FT                   /note="Signal peptide predicted for BPSS0374 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.898) with cleavage site
FT                   probability 0.420 between residues 22 and 23"
FT   CDS_pept        514366..516348
FT                   /transl_table=11
FT                   /gene="acoE"
FT                   /locus_tag="BPSS0375"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /note="Similar to Alcaligenes eutrophus acetyl-coenzyme A
FT                   synthetase AcoE SWALL:ACSA_ALCEU (SWALL:P31638) (660 aa)
FT                   fasta scores: E(): 0, 79.54% id in 660 aa, and to Ralstonia
FT                   solanacearum probable acetyl-coenzyme A synthetase protein
FT                   rsc1952 or rs03526 SWALL:Q8XY11 (EMBL:AL646067) (660 aa)
FT                   fasta scores: E(): 1.2e-213, 79.24% id in 660 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37823"
FT                   /db_xref="GOA:Q63NC4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q63NC4"
FT                   /protein_id="CAH37823.1"
FT                   /translation="MSAIESVLHERRQFAPPAAVEKAAAISGMAAYRALAEEAERDYEG
FT                   FWARLARETLEWRKPFGKVLDETNAPFYKWFEDGELNASYNCLDRHVAAGLGERVAVIF
FT                   EADDGTVTRVTYADLLARVSRFANALKKRGVGRGDRVVIYIPMSVEGIVAMQACARIGA
FT                   THSVVFGGFSSKSLHERIVDVGATALVTADEQMRGGKTLPLKSIADEALAMGGCDAVKT
FT                   VVVYRRTGGNVDWHAGRDVWMHEMVANESDACEPEWVGAEHPLFILYTSGSTGKPKGVQ
FT                   HSTAGYLLWVAQTMKWTFDWKPDDVFWCTADIGWVTGHSYITYGPLAVGATQVVFEGVP
FT                   TYPNAGRFWKMIGDHKVTVFYTAPTAIRSLIKAAEADDRVHPRSYDLSSLRIIGTVGEP
FT                   INPEAWIWYHKNVGQARCPIVDTWWQTETGGHMITPLPGATPTVPGSCTLPLPGIMAAV
FT                   VDETGQDVPNGQGGILVVKRPWPAMARTIWGDPERFKKSYFPEELGGRLYLAGDGTVRD
FT                   KETGYFTIMGRIDDVLNVSGHRLGTMEIESALVSHELVAEAAVVGRPDDTTGEAVVAFV
FT                   VLKRSRPEGEEAAALAKTLRDWVGKEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLA
FT                   KGEAITQDTSTLENPAILEQLAEVR"
FT   misc_feature    514708..516045
FT                   /note="Pfam match to entry PF00501 AMP-binding, AMP-binding
FT                   enzyme , score 445.6, E-value 2.9e-131"
FT   misc_feature    515164..515199
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT   CDS_pept        516446..516826
FT                   /transl_table=11
FT                   /locus_tag="BPSS0376"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37824"
FT                   /db_xref="GOA:Q63NC3"
FT                   /db_xref="InterPro:IPR019886"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NC3"
FT                   /protein_id="CAH37824.1"
FT                   /translation="MAASSGTSSPTPSHAAEPPFVPAPLARAHARYWRFNVALIAVLMT
FT                   IGFAVSFLVPLFAPALAHVRFAGFSLPFYVGAQGAILVYLGLIGAYIVLMQRADRVLRR
FT                   DYDAYAAEAKRRAAASTDADAC"
FT   misc_feature    order(516548..516616,516659..516727)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPSS0376 by TMHMM2.0 at aa 35-57 and 72-94"
FT   CDS_pept        516820..518835
FT                   /transl_table=11
FT                   /locus_tag="BPSS0377"
FT                   /product="putative transport related membrane protein"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   solute:Na+ symporter permease transmembrane protein rsc1951
FT                   or rs03525 SWALL:Q8XY12 (EMBL:AL646067) (688 aa) fasta
FT                   scores: E(): 2.8e-156, 62.25% id in 673 aa, and to
FT                   Alcaligenes eutrophus hypothetical protein in acoE 3'region
FT                   SWALL:YACO_ALCEU (SWALL:P31640) (332 aa) fasta scores: E():
FT                   1e-66, 59.31% id in 322 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37825"
FT                   /db_xref="GOA:Q63NC2"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR019899"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NC2"
FT                   /protein_id="CAH37825.1"
FT                   /translation="MLTNRLVRAYALYTIGFAAFVLLLWRIERATGPGVWIGYVFLFVP
FT                   IAVYAVIGLLSRTSDLVEYYVAGRRVPSAFNGMATAADWLSAASFIGLAGSLYATGYDA
FT                   LAYLMGWTGGFCLVAFLLAPYVRKLARYTIPDFLGTRFSSTLVRALAAIAAILCSFVYL
FT                   VAQIQGIGLIATRFIGVDFSIGIFCGLAGILVCSFLGGMRAVTWTQVAQYIILIIAFLL
FT                   PVSLIAMKNGLGPVPQFNYGRLMSRVETLEGEMRDAPQERQVRETYRRQAGAIQARLDR
FT                   LPASYDEARAKLVDQVAELRRHNGPLREINQRERALAEFPRDPAAARVVWEQARDELLA
FT                   RAAAPVPMHEPFPAASGDDRRPRGRNFLALLLCLSLGTASLPHILTRYNTTTSVAAARR
FT                   SVGWTLFFIALFYLTVPVLAVLIKYEILTNLVGRPFADLPAWITQWHRFEPGLIGVADL
FT                   LRDGIVHWSEIQMQPDIVVLAAPEIAGLPYVVSGLIAAGALAAALSTADGLLLTIANAL
FT                   SHDVYYHMVAPDASSQRRVTISKVLLLGVALFASYVASLNTGKILFLVGAAFSLAASSF
FT                   FPVLVLGVFWKRTTTRGAVAGMMTGLGVCVYYIVSTYPFFTQITGFAGPGWLGIEPISS
FT                   GVFGVPAGFATAIVVSLLDRRPDAYTNALVDYIRHP"
FT   misc_feature    order(516838..516891,516919..516987,517048..517116,
FT                   517129..517197,517255..517323,517351..517419,
FT                   517456..517524,517915..517983,518017..518085,
FT                   518296..518364,518425..518481,518509..518577,
FT                   518596..518664,518707..518775)
FT                   /note="14 probable transmembrane helices predicted for
FT                   BPSS0377 by TMHMM2.0 at aa 7-24, 34-56, 77-99, 104-126,
FT                   146-168, 178-200, 213-235, 366-388, 400-422, 493-515,
FT                   536-554, 564-586, 593-615 and 630-652"
FT   misc_feature    517009..518622
FT                   /note="Pfam match to entry PF00474 SSF, Sodium:solute
FT                   symporter family , score 52.6, E-value 5.5e-13"
FT   misc_feature    518566..518628
FT                   /note="PS00457 Sodium:solute symporter family signature 2."
FT   tRNA            518898..518987
FT                   /note="tRNA Ser anticodon GGA, Cove score 75.69"
FT   repeat_region   518974..518994
FT                   /note="Genomic island repeat"
FT   misc_feature    518995..538104
FT                   /note="Genomic island GI 13"
FT   CDS_pept        519142..520371
FT                   /transl_table=11
FT                   /locus_tag="BPSS0378"
FT                   /product="putative phage integrase"
FT                   /note="Similar to Escherichia coli prophage CP4-57
FT                   integrase IntA or SlpA or IntX or b2622 SWALL:INTA_ECOLI
FT                   (SWALL:P32053) (413 aa) fasta scores: E(): 2.6e-30, 31.07%
FT                   id in 399 aa, and to Ralstonia solanacearum putative
FT                   integrase prophage protein rsc1896 or rs03460 SWALL:Q8XY67
FT                   (EMBL:AL646067) (411 aa) fasta scores: E(): 2.3e-67, 49.59%
FT                   id in 373 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37826"
FT                   /db_xref="GOA:Q63NC1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NC1"
FT                   /protein_id="CAH37826.1"
FT                   /translation="MPESLLRDLQCRSAKPRERVYRLSDGGGLALLVKPNGLKYWQFRY
FT                   MKPDGREGLIQIGPYPRITLEAARAARNEHRVAVQGGDDPATLRKQEKARRKIDAARAL
FT                   NFKQCATAFIEARSAEWVNPKHAQQWTNTLSTYAYPIIGALRPADIDTDLVRKVLEPIW
FT                   LTKNETASRVRGRIESVLDWAKVRGLRDGENPARWSGHLDQLLAAPGKVQKPKHHAALP
FT                   FTEIGAFVAELRGMVGTAARALEFTILTAMRTGEVIGARHDEFDADAQLWTVPAERMKA
FT                   KRAHRVPLSSSALELLKTLPTSADSPVVFEGMRARRPLSNMAMLQVLERMKRGALTVHG
FT                   FRSTFRDWAAECTPFSNEVVEMALAHAIRDKTEAAYRRGDLFEKRRTLMQAWADYIEQE
FT                   VAATLTKAAA"
FT   misc_feature    519157..526273
FT                   /note="Region with similarity of part of (BPSL0081 to
FT                   BPSL0086) Genomic island GI 1"
FT   misc_feature    519793..520299
FT                   /note="Pfam match to entry PF00589 Phage_integrase, Phage
FT                   integrase family , score 27.3, E-value 1.5e-06"
FT   CDS_pept        520625..520948
FT                   /transl_table=11
FT                   /locus_tag="BPSS0379"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37827"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NC0"
FT                   /protein_id="CAH37827.1"
FT                   /translation="MRWAQQCGWGRVADFPCRNAFSMASNSRRAAPGLRLRLSRVSAAM
FT                   PLSAKHVGDLEINARIGRKALWRKALVVSKQIWRTLEILEINSLGSLRIQQDSRPASPA
FT                   CAQ"
FT   repeat_region   520964..521346
FT                   /note="Imperfect repeat, similar to region containing
FT                   BPSS0381"
FT   CDS_pept        521079..521324
FT                   /transl_table=11
FT                   /locus_tag="BPSS0380"
FT                   /product="putative DNA-binding regulatory protein"
FT                   /note="Similar to Bacillus subtilis BglII control element
FT                   BglIIC SWALL:Q45487 (EMBL:U49842) (77 aa) fasta scores:
FT                   E(): 3e-06, 40.98% id in 61 aa, and to Salmonella enterica,
FT                   and Salmonella paratyphi-A regulatory protein SbaIC
FT                   SWALL:Q9EZ27 (EMBL:AF508974) (78 aa) fasta scores: E():
FT                   4.9e-06, 44.44% id in 72 aa. Note: Also similar to BPSS0381
FT                   (82 aa) fasta scores: E(): 2.7e-27, 88.889% identity in 81
FT                   aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37828"
FT                   /db_xref="GOA:Q63NB9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NB9"
FT                   /protein_id="CAH37828.1"
FT                   /translation="MARISGKLDKDGNLVSLGAAIRARRKELVMSQEALADFAEIDRSH
FT                   MGKIERGERNVTFMNIVRIARALQLLPSELLRNAGL"
FT   misc_feature    521139..521303
FT                   /note="Pfam match to entry PF01381 HTH_3, Helix-turn-helix
FT                   , score 41.3, E-value 1.5e-09"
FT   misc_feature    521166..521231
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1113.000, SD 2.98 at aa 30-51, sequence
FT                   MSQEALADFAEIDRSHMGKIER"
FT   CDS_pept        complement(521382..521678)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0380A"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0380A"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37829"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NB8"
FT                   /protein_id="CAH37829.1"
FT                   /translation="MEHVEMEYLIEAAVFRKDVCAGFDHKMVVKALMKRGVLMPRSDGS
FT                   PYRQECIPSHGKFMVYRAFARRSSSSNCESRRRRAGGWWRAIPCAGFRACASK"
FT   CDS_pept        complement(521774..522100)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0380B"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0380B"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37830"
FT                   /db_xref="GOA:Q63NB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NB7"
FT                   /protein_id="CAH37830.1"
FT                   /translation="MALRPPRYSAQARSKSGGRQEVPLPRNTVIRYQGRHGVAAGEHLA
FT                   GLWVVIATISLSLGFNSPYIVYYARHCADRKCNHPRSNSKVVRGLKMVKEAAAIGRTRR
FT                   TARA"
FT   repeat_region   522360..522742
FT                   /note="Imperfect repeat, similar to region containing
FT                   BPSS0380"
FT   CDS_pept        522475..522720
FT                   /transl_table=11
FT                   /locus_tag="BPSS0381"
FT                   /product="putative DNA-binding regulatory protein"
FT                   /note="Similar to Bacillus subtilis BglII control element
FT                   BglIIC SWALL:Q45487 (EMBL:U49842) (77 aa) fasta scores:
FT                   E(): 1.2e-05, 37.7% id in 61 aa, and to Salmonella
FT                   enterica, and Salmonella paratyphi-a regulatory protein
FT                   SbaIC SWALL:Q9EZ27 (EMBL:AF508974) (78 aa) fasta scores:
FT                   E(): 1.2e-05, 38.88% id in 72 aa. Note: Also similar to
FT                   BPSS0380 (82 aa) fasta scores: E(): 6.3e-28, 88.889%
FT                   identity in 81 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37831"
FT                   /db_xref="GOA:Q63NB6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NB6"
FT                   /protein_id="CAH37831.1"
FT                   /translation="MARVSGKLDKDGNLVLLGAAIRARRKELAMSQEVLADFVEIDRSH
FT                   LGKIERGERNVTFMNIIRIARVMQLLPSELLRNAGL"
FT   misc_feature    522535..522699
FT                   /note="Pfam match to entry PF01381 HTH_3, Helix-turn-helix
FT                   , score 45.8, E-value 6.3e-11"
FT   misc_feature    522562..522627
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1158.000, SD 3.13 at aa 30-51, sequence
FT                   MSQEVLADFVEIDRSHLGKIER"
FT   CDS_pept        complement(522852..525719)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0382"
FT                   /product="hypothetical protein"
FT                   /note="Similar in its N-terminal region to Escherichia coli
FT                   DNA primase TraC SWALL:TRC4_ECOLI (SWALL:P27189) (1061 aa)
FT                   fasta scores: E(): 5.5e-22, 32.87% id in 362 aa, and in its
FT                   C-terminal region to Salmonella typhimurium putative inner
FT                   membrane protein stm2745 SWALL:Q8ZMQ9 (EMBL:AE008824) (689
FT                   aa) fasta scores: E(): 2.7e-61, 33.57% id in 691 aa. Note:
FT                   Also similar to BPSL0082 (956 aa) fasta scores: E(): 0,
FT                   91.832% identity in 955 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37832"
FT                   /db_xref="GOA:Q63NB5"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="InterPro:IPR014819"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NB5"
FT                   /protein_id="CAH37832.1"
FT                   /translation="MSNAPMSEFERASVALGYVPADDRDTWRQAGMALKAEFGEEGFTL
FT                   WNEWSQGAQNYNVRDARDVWKSFKGGKITINTLFHLAKLGGFDPRAHRAMPIDPAQRER
FT                   QHAERATREAAEMATLTEKQQAASALAESIWSTAEPAPADHPYLVRKRIPADALRVYRG
FT                   NLSIGTAACDGALVIPARDADGKLWTLEFILTDGQKRYLPNGRKAGCFALIGGAVSSVL
FT                   LVGEGYATCATLAAATGYPAAVAFDAGNLHAVATALRDQYPDARIVVCADDDHTTNGNP
FT                   GVTKARAAADAVGGVVAVPDFGPNRPAAGTDFNDVAAHLGPDAVAAAVRAALAVDGSPG
FT                   SDKGKARPPVTKPAKRPKTARAQDGTWRFEVDDEGVWYHGFNNQGDPLPPHWISTRIDV
FT                   IAETRNEMSSEWGYLLEFTDRDGIQKRWAVPAGLFAGDGTELRRMLLDMGVKLGVTQTA
FT                   RTQIANYIQMARPDERVRCVPRVGWHHGAFVLPDRVIGTGKEALIYQADTPIQSQFKER
FT                   GTLDDWRRDVAAYCVGNSRLLFCVATAFAGSLLHFSGLQSGGFHLLGTTSKGKSTGGVI
FT                   AASVFGSPDYVRSWKATDNALEAVATQHSDALLILDEIGQVEPRLVGDVIYMLANESGK
FT                   ARASRSGSAKPVLTWRLLFLSNGEKSVSALMAEANKPMKGGIEVRLPAIPAEVGDMGVV
FT                   EELHDFPTPAALIEHLERHAGRYYGTAGPVFIEFASTQADELAEHLRTRVDELVTEWVP
FT                   DGAHSQVARVAKRFCLVAVAGELATAHGLTGWPEGASVDAARRCFEGWMELRGGAGNSD
FT                   EAEAVRQVLHFLVAHGDNRFVWMNRAQDDHRPNVPHRAGFKQHVKRNERRTAIASDREY
FT                   YAEFGGKMSADDAEHVETEYLIEAAVFRKDVCAGFDHKMVAKALMKRGVLMPRSDGYPY
FT                   RQEYIPGHGKFMVYRVRPSIFTLEL"
FT   misc_feature    complement(524007..524030)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(526300..526518)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0383"
FT                   /product="putative DNA-binding protein"
FT                   /note="Similar to Yersinia pestis putative regulatory
FT                   protein ypo0878 or y3260 SWALL:Q8ZHL3 (EMBL:AJ414145) (66
FT                   aa) fasta scores: E(): 8.5e-05, 42% id in 50 aa, and to
FT                   Vibrio cholerae transcriptional regulator vc1785
FT                   SWALL:Q9KR58 (EMBL:AE004255) (68 aa) fasta scores: E():
FT                   8.8e-05, 37.03% id in 54 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37833"
FT                   /db_xref="GOA:Q63NB4"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NB4"
FT                   /protein_id="CAH37833.1"
FT                   /translation="MTVQFQATAIQPRRIVRMPALLERVGLSESEVRRRIKAGTFPRPV
FT                   KLGPRAIGFVVADVDAWLEALTTRVAA"
FT   misc_feature    complement(526408..526473)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1189.000, SD 3.24 at aa 16-37, sequence
FT                   VRMPALLERVGLSESEVRRRIK"
FT   CDS_pept        complement(526611..527657)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0384"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37834"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NB3"
FT                   /protein_id="CAH37834.1"
FT                   /translation="MQYGLYRSFGAVVEDIEYETNSLETIALRNQRVPINPLSDDFCED
FT                   LLAPLDRANIARLRKEWRDMAGSLIEIIDAARDRHWKRDGPYRLRYCWRRAEIVEEEAY
FT                   PAWAHHATQDLLRNAYSIFKRGGEAEADDGHLLTLARHYIRPHVSLTDAHLLSGLAIRE
FT                   AVRAVEHLTTLVDHVEQDEHVAVWLKEWLRQDVQDNDYARKAYGAELNARIDRAALDIF
FT                   HPDLETVTDYRIHAEKLLLLADVCATGRLSSTESSRLFAQLEVREQHIEELDSTVAAMR
FT                   AKRENFQIKGTLARTKLTTADKDEVKRQYDDLIAAHPDKQVKDIELTLADQWGVARSTI
FT                   QRATGKKR"
FT   CDS_pept        complement(527939..528640)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0384A"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0384A"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37835"
FT                   /db_xref="GOA:Q63NB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NB2"
FT                   /protein_id="CAH37835.1"
FT                   /translation="MCMRRHLEEIREFLMLISRRVSAWLTGGVIAALLFVYEHASGNIP
FT                   VSAVYLGVLVYTTLASYLAWRSERRARAGVEEAFERATRSAAQLQAARQERRRLSLHWS
FT                   FVVADRLRGANLEEVEHPFVLSTADASGERFAEVWTLIRYAIKGANVIAPPPHDLNSMK
FT                   LPAPKKPGIIIYGRNGFADAIATALSEVADVVRSTEYVDELNAYYATFGKNGVIGIAIG
FT                   PGVPWKSTCLD"
FT   CDS_pept        529868..532291
FT                   /transl_table=11
FT                   /locus_tag="BPSS0385"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37836"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NB1"
FT                   /protein_id="CAH37836.1"
FT                   /translation="MNASPSVDSIDVAFEALQRLLKELPAFESTLNSEADVRLKIVDTM
FT                   LSDVLGWTKAEMQTEESAGTGFLDYKLSVNGIARVVVEAKRAERVFDLGGRECGFPYKL
FT                   SGPALKNIDLVEGIRQAIQYSAYKGTELACVTNGHEWLVFRSNRHGDGTDTLEGKAFAF
FT                   GSLECVRDQFKNFFNLLAKVRVASLAFRGLFQEAEGRVIRHSGFRRVLRPPETAAFLPQ
FT                   PEIIPELDRLMTSFFQRLANERDREMIDYCFVETKESKVAEGRLLRLAEDLVGHVRALN
FT                   TQSGQQLTELLTRARTASLNQFILIVGTKGAGKSTFINRFFNTKLNQELRDACVPIIVN
FT                   LSDSDGDHKTVVEWLRRNLLAKAEAAISDKAPTWDELIGHMFFSEYQRWSTATMANLYG
FT                   RDKEAFKVEFGKHIEGIRRDNPLEYIHGLLRNFVKGRKQLPCLVFDNADHFSIEFQEHV
FT                   FQFARSLFEQELCVVIMPITDKTSWHLSRQGALHSFENEALLLPTPPAKQVLEKRINFV
FT                   LKKIEDADVHGRGTYFIGKGIRVDVSDLLKFVCGLQEIFLNTDKTTYVLGQLANHNVRD
FT                   VLQLSRDVVNSPHIGLDETFKAYVLKSAIHIPEYKTRRALIRGRYDIFVPSSNQYVRNI
FT                   FALNTELETTPLLGIRMLQTLSDAVVHSGDTQSRYMAKDDLYAYLLAMGIERRAISLWL
FT                   DALLKTVLVINYDPTCTDESAATQLEISPAGEQHLFWGTGNYDYVEAMAEVTPVLDGAA
FT                   FTDMETASRGYGAQRSMELRKAFVAYLTGEDKFFCQVPDHESYRGQRNPIHRLS"
FT   misc_feature    530789..530812
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        532668..533243
FT                   /transl_table=11
FT                   /gene="tnpR"
FT                   /locus_tag="BPSS0386"
FT                   /product="transposon Tn2501 resolvase"
FT                   /note="Similar to Escherichia coli transposon tn2501
FT                   resolvase TnpR SWALL:TNR0_ECOLI (SWALL:P05823) (194 aa)
FT                   fasta scores: E(): 6.7e-43, 67.02% id in 188 aa, and to
FT                   Salmonella typhimurium DNA-invertase Hin or stm2772
FT                   SWALL:HIN_SALTY (SWALL:P03013) (190 aa) fasta scores: E():
FT                   4.3e-17, 37.7% id in 183 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37837"
FT                   /db_xref="GOA:Q63NB0"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NB0"
FT                   /protein_id="CAH37837.1"
FT                   /translation="MSRTFAYARVSKIDQTATNQLHEIEAAGFAVDKRRVVTESISGSV
FT                   GASQRPGFSKLLDKMEEGDVLIVTKLDRLGRNAMDVRATVETLAERSIRIHCLALGGVD
FT                   LTSAAGRMTMQVLNAVAEFERDLSIERTQAGIARAKSEGKAMGRPSALTKQQQQDVRQR
FT                   LHEGASVASLAKFYGTSRQTIMRVRDSV"
FT   misc_feature    532671..533102
FT                   /note="Pfam match to entry PF00239 resolvase, Resolvase, N
FT                   terminal domain , score 198.5, E-value 6.8e-57"
FT   misc_feature    532854..532892
FT                   /note="PS00398 Site-specific recombinases signature 2."
FT   misc_feature    533106..533240
FT                   /note="Pfam match to entry PF02796 HTH_7, Helix-turn-helix
FT                   domain of resolvase , score 30.9, E-value 1.9e-06"
FT   misc_feature    533169..533234
FT                   /note="Predicted helix-turn-helix motif with score 975.000,
FT                   SD 2.51 at aa 209-230, sequence ASVASLAKFYGTSRQTIMRVRD"
FT   CDS_pept        complement(533314..534429)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0387"
FT                   /product="putative phage-related protein"
FT                   /note="Similar to Burkholderia thailandensis bacteriophage
FT                   phiE125 protein Gp31 SWALL:Q8VP95 (EMBL:AY063741) (363 aa)
FT                   fasta scores: E(): 2.3e-32, 36.74% id in 362 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37838"
FT                   /db_xref="InterPro:IPR021815"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NA9"
FT                   /protein_id="CAH37838.1"
FT                   /translation="MTNEEIEAWAKDPRRADTLPFGLYEPPYRKGITGAALVVRGVLYF
FT                   RNGFTPDVRQALVRCFKQYNAAIEEYQHALEVAAGQSPSKAGPLRWFYSEGEEPTQYDK
FT                   APGFESLARSVPANKTLAVAMTSAEHKLAAGFYEFTVFALSDWKAERKRGLDGLVFTVP
FT                   RAFIVQRPGVFEAMFRAFAEALPTVSGHGGLAVNMPPMERRPNEASEYFYARRFGPGID
FT                   VGDPMRSNVRKLYTKIKTVDWLNALDAELVRAVGGTSSLALPPNWFARQPLRDGGLIIQ
FT                   AGVAPMSGVSNGTGIPVAPPAAYVLLNHALRQIVADTLDTLQDGTLDSTAPLLNTVVAT
FT                   AAWLRRFNVPDDQINGYWVELHKTPKLSPST"
FT   CDS_pept        complement(534439..535173)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0388"
FT                   /product="putative phage-related protein"
FT                   /note="Similar to Burkholderia thailandensis bacteriophage
FT                   phiE125 protein Gp30 SWALL:Q8VP96 (EMBL:AY063741) (244 aa)
FT                   fasta scores: E(): 7.1e-27, 42.04% id in 245 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37839"
FT                   /db_xref="GOA:Q63NA8"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NA8"
FT                   /protein_id="CAH37839.1"
FT                   /translation="MSGGYAPGASPGGMSAGSGQTTQVGLSAARLSPKDREVLCHTFCE
FT                   CRRIGIATKAGTIQRQRCVQMRLGLPNEVSKMQTGVPTEYRPEQPYDMTTQPPEPIMDY
FT                   DDPLEPHSSIRQWIKDVWPDKGKKYQKGDVRRPDVVIVNDPSKPPVQSNIKTVVEMKFP
FT                   GDSYGPDQEDDYIEIAGSPSKFAHLGAADCGCGNDDGQKKTARSKQSARQSDLDELFGG
FT                   NSSAPGSPPLPPMPLPPLPAFP"
FT   CDS_pept        complement(535170..535697)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0389"
FT                   /product="putative phage-related protein"
FT                   /note="Similar to Burkholderia thailandensis bacteriophage
FT                   phiE125 protein Gp29 SWALL:Q8VP97 (EMBL:AY063741) (186 aa)
FT                   fasta scores: E(): 4.1e-35, 60.77% id in 181 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37840"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NA7"
FT                   /protein_id="CAH37840.1"
FT                   /translation="MGSALIREGDTTSHGGRVLAGTSTNIVYGKPLALEGDMVSCPKCG
FT                   GIYPIVGVRNRSMTFGDRPVATEGDKTACGATLIASQGTATVELTSGAGGPVSTRKSVV
FT                   PQPAAQGNEPYRGRFQLVDDKTREPIANHPYTVTSADGQTIQGTTDANGHTDWLSSHQA
FT                   SSLSFQQPGSDA"
FT   CDS_pept        535977..536156
FT                   /transl_table=11
FT                   /locus_tag="BPSS0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   r02039 or smc04441 SWALL:Q92K60 (EMBL:AL591789) (62 aa)
FT                   fasta scores: E(): 1.9e-11, 61.01% id in 59 aa, and to
FT                   Clostridium perfringens hypothetical protein pcp27
FT                   SWALL:Q93MC0 (EMBL:AP003515) (65 aa) fasta scores: E():
FT                   6.2e-11, 53.44% id in 58 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37841"
FT                   /db_xref="GOA:Q63NA6"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="PDB:4C26"
FT                   /db_xref="PDB:6G26"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NA6"
FT                   /protein_id="CAH37841.1"
FT                   /translation="MNSSKLIRMLEEDGWRLVRVTGSHHHFKHPKKPGLVTVPHPKKDL
FT                   PIGTVKSIQKSAGL"
FT   CDS_pept        536201..536617
FT                   /transl_table=11
FT                   /locus_tag="BPSS0391"
FT                   /product="putative phage-related hypothetical protein"
FT                   /note="Similar to Bacteriophage HP1 hypothetical 14.9 kDa
FT                   protein in rep-hol intergenic region SWALL:YO14_BPHP1
FT                   (SWALL:P51716) (133 aa) fasta scores: E(): 8.8e-14, 38.34%
FT                   id in 133 aa, and to Rhizobium loti hypothetical protein
FT                   mlr2150 SWALL:Q98J17 (EMBL:AP002999) (133 aa) fasta scores:
FT                   E(): 2.2e-11, 40.32% id in 124 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37842"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="PDB:6G1C"
FT                   /db_xref="PDB:6G1N"
FT                   /db_xref="PDB:6G26"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NA5"
FT                   /protein_id="CAH37842.1"
FT                   /translation="MEFPIAVHKDDGSVYGVTVPDIPGVHSWGETIDDAIKNTREAIVG
FT                   HVETLIELGEDVEFTCSTVEELVAKPEYAGAVWALVSVDLSQLDSKPERINVSIPRFVL
FT                   HKIDAYVASRHETRSGFLARAALEALNEGKVRHA"
FT   misc_feature    536201..536389
FT                   /note="Pfam match to entry PF03681 UPF0150, Uncharacterised
FT                   protein family (UPF0150) , score 52.0, E-value 8.4e-13"
FT   CDS_pept        complement(537046..537543)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0391A"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0391A"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37843"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NA4"
FT                   /protein_id="CAH37843.1"
FT                   /translation="MVDMYALTLPVLTHPWLEGESPLQLAPDSPRILLRSVERLAHYFK
FT                   REMYFDFVQSDATETKESKGFVPYQAYAFFAPARDRWQDDKPMPHRVFGACCFRDRDSS
FT                   SGAPSWSLDWVWMHPYFRHRGHLKEAWPMFEREYGEDFHVEEPVSLAMRSFMEKYASIR
FT                   AA"
FT   repeat_region   538105..538125
FT                   /note="Genomic island repeat, 3-prime tRNA Ser fragment"
FT   misc_feature    538126..549980
FT                   /note="Low G+C region, possible genomic island region"
FT   repeat_region   complement(538155..538565)
FT                   /note="PF0872"
FT   CDS_pept        complement(538161..538538)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPSS0392"
FT                   /product="IS element hypothetical protein (fragment)"
FT                   /note="Gene remnant. Similar to the C-terminal region of
FT                   Escherichia coli ORF5 protein or l7094 SWALL:O53006
FT                   (EMBL:Y07545) (225 aa) fasta scores: E(): 1.5e-19, 51.78%
FT                   id in 112 aa, and of Providencia rettgeri putative
FT                   transposase Tnp391A SWALL:Q8RL20 (EMBL:AY090559) (225 aa)
FT                   fasta scores: E(): 2.4e-19, 51.78% id in 112 aa"
FT                   /db_xref="PSEUDO:CAH37844.1"
FT   misc_feature    complement(538200..538538)
FT                   /note="Pfam match to entry PF00665 rve, Integrase core
FT                   domain , score 88.5, E-value 1.7e-25"
FT   CDS_pept        complement(538558..538797)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPSS0393"
FT                   /product="putative bacteriophage-related protein
FT                   (fragment)"
FT                   /note="Gene remnant. Similar to the N-terminal region of
FT                   Bacteriophage phiE125 Gp70 SWALL:Q8W6N0 (EMBL:AF447491)
FT                   (118 aa) fasta scores: E(): 1.5e-30, 89.87% id in 79 aa,
FT                   and of bacteriophage SFV hypothetical 13.1 kDa protein
FT                   ORF53 SWALL:Q8SBD7 (EMBL:U82619) (116 aa) fasta scores:
FT                   E(): 4e-12, 49.33% id in 75 aa"
FT                   /db_xref="PSEUDO:CAH37845.1"
FT   misc_feature    complement(538729..538752)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(539214..539498)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="C-terminus is similar to the C-terminal region of
FT                   Rhizobium meliloti hypothetical protein r00618 or smc04432
FT                   SWALL:Q92KN5 (EMBL:AL591784) (105 aa) fasta scores: E():
FT                   6.9e-07, 52.63% id in 57 aa. Similar to Yersinia pestis
FT                   hypothetical protein ypo1882 or y2427 SWALL:Q8ZF36
FT                   (EMBL:AJ414150) (96 aa) fasta scores: E(): 1e-06, 41.57% id
FT                   in 89 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37846"
FT                   /db_xref="InterPro:IPR025528"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NA3"
FT                   /protein_id="CAH37846.1"
FT                   /translation="MSSKRKIVMPTDEEDAAINRGIAADPDTFEVPAEDFAKMTRRGKR
FT                   GRPPLEAPKVQLTVRYDVDIVDAFKATGEGWQTRMNDALREWLREHQPA"
FT   misc_feature    complement(539397..539498)
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT   CDS_pept        complement(539482..539703)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0395"
FT                   /product="hypothetical protein"
FT                   /note="Low similarity in its C-termianl region to Xylella
FT                   fastidiosa hypothetical protein xf1562 SWALL:Q9PD18
FT                   (EMBL:AE003986) (88 aa) fasta scores: E(): 7.9e-07, 52.94%
FT                   id in 51 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37847"
FT                   /db_xref="InterPro:IPR007460"
FT                   /db_xref="InterPro:IPR038573"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NA2"
FT                   /protein_id="CAH37847.1"
FT                   /translation="MECRWRLQRNSTGQDVLSYVDDRRDYSEVREVGFGVIGDRLYCVV
FT                   FTQRGDSMHIISMRKANKREVKSYVEQA"
FT   CDS_pept        540323..540598
FT                   /transl_table=11
FT                   /locus_tag="BPSS0396"
FT                   /product="bacteriophage protein Gp49"
FT                   /note="Similar to Bacteriophage phiE125 Gp49 SWALL:Q8W6Q1
FT                   (EMBL:AF447491) (91 aa) fasta scores: E(): 3.7e-34, 95.6%
FT                   id in 91 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37848"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NA1"
FT                   /protein_id="CAH37848.1"
FT                   /translation="MRGSEDRDRVPSKGNPVESKRKLPTVSVEWLENAAADLEVSANAS
FT                   RETWAVLGLSHRYSENIGRAHAMRHAARLKLEYDRRLFLRSIGLKV"
FT   CDS_pept        540608..540739
FT                   /transl_table=11
FT                   /locus_tag="BPSS0397"
FT                   /product="bacteriophage protein Gp48"
FT                   /note="Similar to Bacteriophage phiE125 Gp48 SWALL:Q8W6Q2
FT                   (EMBL:AF447491) (43 aa) fasta scores: E(): 1.5e-15, 97.67%
FT                   id in 43 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37849"
FT                   /db_xref="UniProtKB/TrEMBL:Q63NA0"
FT                   /protein_id="CAH37849.1"
FT                   /translation="MSQAAKNLLELRRLPRGALVEHLLREVASDLIAQGIEDLRGGC"
FT   CDS_pept        540741..540848
FT                   /transl_table=11
FT                   /locus_tag="BPSS0397A"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0397A"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37850"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N99"
FT                   /protein_id="CAH37850.1"
FT                   /translation="MKHFVTGALALLILWLVVEVTRAMKHIGRDEHHMH"
FT   CDS_pept        540875..541096
FT                   /transl_table=11
FT                   /locus_tag="BPSS0398"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37851"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N98"
FT                   /protein_id="CAH37851.1"
FT                   /translation="MMDKQTVLEACNRVADVADLPFYAELVDALRGAMVALTASEPTMK
FT                   HYPEAVARHEKAIRDAKSCIKRIDQDAT"
FT   CDS_pept        complement(541081..541347)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0399"
FT                   /product="bacteriophage protein Gp46"
FT                   /note="Similar to Bacteriophage phiE125 Gp46 SWALL:Q8W6Q4
FT                   (EMBL:AF447491) (84 aa) fasta scores: E(): 2.9e-34, 95.23%
FT                   id in 84 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37852"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N97"
FT                   /protein_id="CAH37852.1"
FT                   /translation="MGRRGERLDRRIGCRLNALHGAGRHELDCVEAMSGEVVAIMAFDG
FT                   VLELGPCQRFTDVVFVICMDVKHRGPRWVVIARRAGAVGQVAS"
FT   CDS_pept        complement(541537..542235)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0400"
FT                   /product="putative bacteriophage protein"
FT                   /note="Low similarity in parts to Bacteriophage phiE125
FT                   Gp45 SWALL:Q8W6Q5 (EMBL:AF447491) (217 aa) fasta scores:
FT                   E(): 0.12, 34.78% id in 115 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37853"
FT                   /db_xref="GOA:Q63N96"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N96"
FT                   /protein_id="CAH37853.1"
FT                   /translation="MACVCHKSATRPERRNMRGYGVSRRARIRKNTSGDAMKKVWQCLE
FT                   VGFALCALGIVALFLVYAFKLHSNDAAGWVQAVGSIAGIFIAIWIAGSQHRADVARRAD
FT                   EDARSEYLLEAELAWLSTEVVGFLGQFRDIKAGFPIEDRFSEDDVRDLLDRLSWCRQRA
FT                   RHKTHLWMVGQLRSSLMGTVRAIRSKMAHTLMVLTDDDVKLINDLRLAAIEVSDLASRA
FT                   KAILGPSAGA"
FT   misc_feature    complement(order(541957..542016,542044..542100))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPSS0400 by TMHMM2.0 at aa 46-64 and 74-93"
FT   CDS_pept        542377..542526
FT                   /transl_table=11
FT                   /locus_tag="BPSS0401"
FT                   /product="bacteriophage protein Gp44"
FT                   /note="Identical to Bacteriophage phiE125 Gp44 SWALL:Q8W6Q6
FT                   (EMBL:AF447491) (49 aa) fasta scores: E(): 8.1e-19, 100% id
FT                   in 49 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37854"
FT                   /db_xref="GOA:Q63N95"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N95"
FT                   /protein_id="CAH37854.1"
FT                   /translation="MLFLVLLSIVTPWLVNQDSSITLLAVPFVWLAYAAAFVKFIPPHF
FT                   KETK"
FT   misc_feature    542434..542502
FT                   /note="1 probable transmembrane helix predicted for
FT                   BPSS0401 by TMHMM2.0 at aa 20-42"
FT   CDS_pept        542523..543698
FT                   /transl_table=11
FT                   /locus_tag="BPSS0402"
FT                   /product="bacteriophage/transposase fusion protein"
FT                   /note="Probable fusion protein. N-terminal region highly
FT                   similar to Bacteriophage phiE125 Gp43 SWALL:Q8W6Q7
FT                   (EMBL:AF447491) (270 aa) fasta scores: E(): 5e-90, 99.61%
FT                   id in 258 aa, and C-terminal region to Pseudomonas putida
FT                   transposase, ORFB pp4420 SWALL:AAN69997 (EMBL:AE016790)
FT                   (269 aa) fasta scores: E(): 1.3e-18, 48.07% id in 156 aa"
FT                   /note="N-terminal region highly similar to Bacteriophage
FT                   phiE125 Gp43 SWALL:Q8W6Q7 (EMBL:AF447491) (270 aa) fasta
FT                   scores: E(): 5e-90, 99.61% id in 258 aa, and C-terminal
FT                   region to Pseudomonas putida transposase, ORFB pp4420
FT                   SWALL:AAN69997 (EMBL:AE016790) (269 aa) fasta scores: E():
FT                   1.3e-18, 48.07% id in 156 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37855"
FT                   /db_xref="GOA:Q63N94"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N94"
FT                   /protein_id="CAH37855.1"
FT                   /translation="MKRLFLILILVPTMFLAAGCDNVPAGYVGVKVQRYGDDRGVNVEV
FT                   KGPGRYFNGPNVDMFIFPTFTQSYVWDKAGKSDESFTFQTVEGLSVNTDIGVSYAIPRE
FT                   NAPKVFQKYRRGVDEITGVYLRAIVRDALNLAGASMAVEDVYGRGKAALQQRVEDEVKA
FT                   NAAKVGISVEKVYFVNQMRLPEQVMNSINGKIAATQIAQQKENELRAAEADAAKQVAIA
FT                   KGEAEALEVKAKALRENSQILQQMAIEKWDGKLPQYARRAVGWAFSQHADTDLALKALR
FT                   RAYDHRRPPPGLMFHSDQGCQYTSTRFLAELRARGTIQSMSRRGNCWDNAVVERFFRSL
FT                   KNEWIGDQLYVDHRHAEQDITDYLVDFYNHRRLHSAAKGLRQTYRFGVQGQ"
FT   misc_feature    542523..542579
FT                   /note="Signal peptide predicted for BPSS0402 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.996) with cleavage site
FT                   probability 0.687 between residues 19 and 20"
FT   misc_feature    542577..543206
FT                   /note="Pfam match to entry PF01145 Band_7, SPFH domain /
FT                   Band 7 family , score -4.4, E-value 0.0002"
FT   misc_feature    543234..543665
FT                   /note="Pfam match to entry PF00665 rve, Integrase core
FT                   domain , score 82.7, E-value 4.8e-22"
FT   repeat_region   543293..543661
FT                   /note="PF0872"
FT   CDS_pept        543697..544086
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPSS0402A"
FT                   /product="transposase (fragment)"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Coxiella burnetii transposase for insertion
FT                   sequence element IS1111a SWALL:TRA1_COXBU (SWALL:Q45968)
FT                   (339 aa) fasta scores: E(): 4.9e-23, 54.54% id in 132 aa,
FT                   and to Edwardsiella ictaluri RmpB-like protein SWALL:Q6GUC9
FT                   (EMBL:AY641982) (358 aa) fasta scores: E(): 7.4e-29, 59.39%
FT                   id in 133 aa"
FT   CDS_pept        complement(544316..544432)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPSS0402B"
FT                   /product="transposase (fragment)"
FT                   /note="Probable gene remnant. Similar to the N-terminal
FT                   regions of Ralstonia solanacearum ISRso16-transposase OrfA
FT                   protein tisrso16A SWALL:Q8XSC1 (EMBL:AL646079) (88 aa)
FT                   fasta scores: E(): 6.6e-08, 79.48% id in 39 aa, and to
FT                   Xanthomonas campestris putative truncated transposase Tnp
FT                   SWALL:Q8RJP9 (EMBL:U33548) (88 aa) fasta scores: E():
FT                   9.8e-09, 75.61% id in 41 aa"
FT   CDS_pept        544679..546139
FT                   /transl_table=11
FT                   /locus_tag="BPSS0403"
FT                   /product="putative exported protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   transmembrane protein rsc2492 or rs01104 SWALL:Q8XWI2
FT                   (EMBL:AL646070) (502 aa) fasta scores: E(): 1.1e-131,
FT                   66.73% id in 490 aa, and N-terminal region to Wolbachia sp.
FT                   Wri phosphoprotein phosphatase SWALL:Q9RBM2 (EMBL:AJ012073)
FT                   (428 aa) fasta scores: E(): 7.3e-21, 29.89% id in 368 aa.
FT                   Note: Also similar to BPSS1331 (516 aa) fasta scores: E():
FT                   1.2e-154, 87.866% identity in 478 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37858"
FT                   /db_xref="GOA:Q63N93"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N93"
FT                   /protein_id="CAH37858.1"
FT                   /translation="MRRLSLRAVSACFASLAAIAALATVKHIDMPADPASATINVQAAW
FT                   VEIGDANQAIARVITNFIPASAGDPLCPQLVIDGKLSRMTLRVAAGTAAQRPTASDPAD
FT                   SKPSSFPVSVCETTLPANAKDVSVASRALPLPKAEPQRVAIVADTGCRMKKADNAFQAC
FT                   SDATVWPFATIAASIAKLNPDLVLHVGDYHYRENACPPDIAGCRNSPWGYGWDAWRADL
FT                   FEPAAPLLAKAPWVVVRGNHEECARAGQGWFRFLDPHPYSDARSCNDPANDGSANYSEP
FT                   YAVSLGSGSQVIVFDTAKVGRAALKTTDTQFQLYQKQFQTVAALASKPGMSTTIFTNHH
FT                   PILAFTPIAGSTPAPGNLALQSVMSSLNAQAYYPPGVHVALHGHVHDFQAINFASGHPA
FT                   TIVSGNGGDNVDVALPDPFPAALTPASGAVIDKLSHNNSFGFLMMERRPAPATGWVFRA
FT                   YSAAGKLLASCMQAGTTLACDKTGFIAP"
FT   misc_feature    544679..544747
FT                   /note="Signal peptide predicted for BPSS0403 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.890) with cleavage site
FT                   probability 0.506 between residues 15 and 16"
FT   misc_feature    545099..545842
FT                   /note="Pfam match to entry PF00149 Metallophos,
FT                   Calcineurin-like phosphoesterase , score 58.6, E-value
FT                   8.9e-15"
FT   misc_feature    545390..545407
FT                   /note="PS00125 Serine/threonine specific protein
FT                   phosphatases signature."
FT   CDS_pept        546190..547560
FT                   /transl_table=11
FT                   /locus_tag="BPSS0404"
FT                   /product="putative methylamine utilization protein"
FT                   /note="Similar to Paracoccus denitrificans methylamine
FT                   utilization protein precursor MauG SWALL:MAUG_PARDE
FT                   (SWALL:Q51658) (387 aa) fasta scores: E(): 4.3e-18, 34.41%
FT                   id in 369 aa, and to Rhizobium loti methylamine utilization
FT                   protein mlr1826 SWALL:Q98JQ7 (EMBL:AP002998) (437 aa) fasta
FT                   scores: E(): 1.8e-46, 40.57% id in 419 aa. Possible
FT                   alternative translational start site"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37859"
FT                   /db_xref="GOA:Q63N92"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N92"
FT                   /protein_id="CAH37859.1"
FT                   /translation="MSRAGRARRVTALALALAALAGAASLAVRAAPASTTMLLPGAPPA
FT                   RVVDTIGNGTPQVSSKIDASAARFVPDPTLVALGRRIFFDTRLSEPRGMSCAGCHDPGR
FT                   AFAPTLSAAALAGPGVPEGSRPGRFSRRNAPSLLYVRYVPRRHFYQDDDAPAPSPFGGL
FT                   FSDGRADTLAEQIRGPLFDPNEMNNRSPAALLRKVDATELAPALAARFGDGVRLDPAQL
FT                   VRALGASVEAYLQSDEMAPFTSRFDAYLRQRTPLDAQQMRGLALFKNPDKGNCMSCHTL
FT                   SDTSSRPKRSLFTDFGYDAIAVPRNRALPANRDPRHFDNGLCDTARRLRWPEPGQWCGY
FT                   LRTPSLRNVALKQTFMHNGVFTSLRDAVAFYNTRSTDPRHWYHGAATFDDVPPAYRGNI
FT                   NVNSTPMNRRPGTPPALTEAEIDDLVAFLGTLTDARYAAGVPPHLKIHDSQAFTIAP"
FT   misc_feature    546319..546957
FT                   /note="Pfam match to entry PF03150 CCP_MauG, Di-haem
FT                   cytochrome c peroxidase , score 37.0, E-value 4.1e-13"
FT   misc_feature    546475..546492
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    547012..547029
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   CDS_pept        547717..548649
FT                   /transl_table=11
FT                   /locus_tag="BPSS0405"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   family protein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   protein precursor rv2277c or mt2337 or mtcy339.33
FT                   SWALL:YM77_MYCTU (SWALL:Q50687) (301 aa) fasta scores: E():
FT                   2.3e-38, 40.53% id in 301 aa, and to Yersinia pestis
FT                   putative exported protein ypo3232 or y0958 SWALL:Q8ZBZ8
FT                   (EMBL:AJ414156) (315 aa) fasta scores: E(): 5.7e-29, 49.16%
FT                   id in 299 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37860"
FT                   /db_xref="GOA:Q63N91"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N91"
FT                   /protein_id="CAH37860.1"
FT                   /translation="MGQELKTRNILWRIVLLGIVSLSMVTMTSNVCVAAPGFPDIVAHR
FT                   GGTGDAPENTVYAISKALQNSADAVWITLQLSSDGVPVLYRPTDLKVLTSGSGPISALS
FT                   AAQLARLDAAYYYNPKDGYPLRGKGYGIPSLEEVLKTFKDTFFYLDIKSPDADPNRMAT
FT                   ALSQVLERTGALSRVRIYSTEAKYTAAVQAMPHFETRDETRTALANVTMNHTCQLSPKF
FT                   GSWYGYELRRDVTLIEETTLGVSPPSPSRLVWNLEAKTCFIDTGKGSILLIGVNSADDY
FT                   ATAASLGAAAVLVDSPAQARHWPTQVSMP"
FT   misc_feature    547762..547818
FT                   /note="Signal peptide predicted for BPSS0405 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.958) with cleavage site
FT                   probability 0.937 between residues 19 and 20"
FT   misc_feature    547846..548619
FT                   /note="Pfam match to entry PF03009 GDPD, Glycerophosphoryl
FT                   diester phosphodiesterase family , score 76.4, E-value
FT                   4e-20"
FT   CDS_pept        548847..549050
FT                   /transl_table=11
FT                   /locus_tag="BPSS0406"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches. Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37861"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N90"
FT                   /protein_id="CAH37861.1"
FT                   /translation="MLQKEQWMQIHVLKAQGVSEGARDHAAPGHFSQHGGRGTCRPRKC
FT                   RATNRVNRDQPGSERSRRTSGV"
FT   CDS_pept        549075..549788
FT                   /transl_table=11
FT                   /locus_tag="BPSS0407"
FT                   /product="insertion element hypothetical protein"
FT                   /note="Similar to Rhodobacter capsulatus putative insertion
FT                   element SWALL:O68064 (EMBL:AF010496) (191 aa) fasta scores:
FT                   E(): 4e-49, 68.68% id in 182 aa, and to Ralstonia
FT                   solanacearum ISrso14-transposase ORFB protein SWALL:Q8XF72
FT                   (EMBL:AL646083) (275 aa) fasta scores: E(): 1.7e-11, 34.18%
FT                   id in 234 aa. Note: Also similar in its N-terminal region
FT                   to BPSS0661 (276 aa) fasta scores: E(): 5.1e-52, 97.143%
FT                   identity in 140 aa overlap and in its C-terminal region to
FT                   BPSS0662 (59 aa) fasta scores: E(): 3.6e-18, 96.429%
FT                   identity in 56 aa overlap"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37862"
FT                   /db_xref="GOA:Q63N89"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N89"
FT                   /protein_id="CAH37862.1"
FT                   /translation="MRLYRSMYSPMERRALIEESPSFGYRTLAHLLGFNKNTVQRIFRL
FT                   MGWQVRMRPIGFRPRVQAMPSVATAPNERGSTDMCRVWAGRDGWVTLARVIDCHTRELL
FT                   GWHLSRSGRASTASSALEHARIARFGTLGRVPKPFLLRGDNGLVFTSRDYTALVRSYGL
FT                   RQAFITPHCPQQNGMVERVIRTLKEQCVHRHRFETLQHASRAIADWIQFYNHRRPHQAL
FT                   KMKMPAEAFALCRLT"
FT   repeat_region   549116..549811
FT                   /note="PF0872b"
FT   misc_feature    549141..549206
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1565.000, SD 4.52 at aa 23-44, sequence
FT                   FGYRTLAHLLGFNKNTVQRIFR"
FT   misc_feature    549273..549770
FT                   /note="Pfam match to entry PF00665 rve, Integrase core
FT                   domain , score 156.6, E-value 2.9e-44"
FT   misc_feature    549774..549785
FT                   /note="PS00294 Prenyl group binding site (CAAX box)."
FT   CDS_pept        complement(549815..550549)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0408"
FT                   /product="putative exported protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37863"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N88"
FT                   /protein_id="CAH37863.1"
FT                   /translation="MPLARRDRALCAFVAAPLLWGLLAGVAAAQALAQPAASTVSVCAA
FT                   VITGSSGTTVDVSYAGLPGNQPKLYGDFVALWQSSVVPWSIAPAARLGIPTDAELGTVV
FT                   MTGVSISATPYTVGYAVGPEVDDVCASALLAADGSTGVVDTVTLQLASVGATSLTFRYH
FT                   TLSGYLPATAGNWVGLWRGRASPYNAAASVARVKVAADVTDDSVVMEGVTLSPGEIYTA
FT                   IYFMGEPLTTAAVLLNFVAPAR"
FT   misc_feature    complement(550451..550549)
FT                   /note="Signal peptide predicted for BPSS0408 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.880 between residues 33 and 34"
FT   CDS_pept        complement(550540..562935)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0409"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37864"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N87"
FT                   /protein_id="CAH37864.1"
FT                   /translation="MAGLNDVIERLSQGTQNVLTVHLGARITKVRDYLNALDEIRVFTA
FT                   NSQNFGHQSSSVNILRNLIRMGAPGPYTFALSASNSADYADLEEKIRLLIPQFRQVGVT
FT                   FELGAGGRTADVTVVRLDKALAPAQFAISGGFDDLENKTPPYHLLNVTNYVQLQPYAWN
FT                   RGTNMVRIMPPGGTASEYNLDELNPTTLLARRAFYLADPELTQSDREAIAQTPYANKAR
FT                   VIERLLERREAGEITLFPVYGVTTKGSAYTSLYNAVTGALIAQNTHPTVKKTVMVQITT
FT                   LTASEWEAFLFLMRDPAGQMVNKIRTTPDFRGWNEENKVKDRVQDLGSPNSVPTVEQLD
FT                   EELSYLEDDQLLVVYIGKIPAPLFDALYASATLPPVLEGQNTAELMLNLGKPYFKITSN
FT                   NSREADARFSYATLPLSSTGAGTDATNSLDESFNGIYFTRPDNWYKDRPTYPPTQLPAM
FT                   INAYVQPAGNARATYFAAQRTFFHDELNDKLLRGLDLFVNLIGPAALEEHRLALAHAEL
FT                   DDANAPVHEAGAAARAPARIAHRKPPTRVAGGDANGASELLEAFYEDLTSHTVDGVLDF
FT                   LLAVTDGILNEFFRQVVIDVVFTITDTVTEINADKTEVTLTGKSKAFGAGNLTLAFSFT
FT                   DSGGTIAGKMSGAFTDTVWAFPGAQWLSVANPSLALAIDSNAAVPVTGTVGATFTAGIA
FT                   AKASLTLPSEPGRLLLQAEFLAPRPSITNIFQMLGGINIQALLPSQIQFFSDIEVQNLA
FT                   LRYSYANGVMEYIGVTLGTPENRSWQLVPGVTVTGLSFSALTDYPGDLQRRSTRYVIGG
FT                   RFDIAGGHAQLEARVPALRVTGGLIDGSPPITLAAIVTEYLGADFAAAIPASVSSTAIE
FT                   QLSFIVDQAQGAYSFSMDVSAQWPVPSAANALFTITGLNFAIDAVSRDINPPKADAGGN
FT                   NGAGGTQTEIEGSFGGSLIVLPNSESPIGLSTTATYKTAAKAWTFDAQQTSGVVSLGAL
FT                   LVYYLGNTWQAPQGQEYAIDGLGLTITSSPTDSTWAFTGKTADNWVVPFLDVSLAAKLR
FT                   MGDAGAKAEVPGKFGRLDLEVIWQNIDLTVWFDYNPKIKQYGITWGLLEGVVDGPDPTT
FT                   QDWTATLGFKQNTTLGSMIETMVSWATGSKFGLESPWSFLNAIPLSNLALKYTFNQTTP
FT                   SRNKVSFAVTIGPINLGFARIDSIDVGYQSTGEDRGVMVTLNGSFFWQSDPSTPLEWDA
FT                   SKPGTAPAPPGNGNKYLDLRLLAMGQHITLPCFATADTVQKAIACMATLPDPKPGQIPA
FT                   VRFDAQSAWLIGTDFGVLKIDSGQTGNNANALRVTNDGNSLAESSGYVLTLQAVFNDPH
FT                   LYGLRIALDGAAAKVFKGLDFQIMYRQVSDTVGVYQAEITLPDLMRHLTVGAYSLTLPV
FT                   FGIAVYTNGDFQVDIGFPWNENFSRSFTIEAIIPPGIPVLGSAGFYFGKLSSASTNRVP
FT                   ASSYGTFNPVLVFGFGMQVGFGKSIEYGILSAGFSVTVVGILEGILAKWNPYQLTHSGR
FT                   EPSTQLQGDYYFWLRGTVGIVGRVYGSVDFAIVKANVDITVKLLLQLTYESYVSITITV
FT                   IASVDVSVSVKINLGLFKISISFSFSMRLKETFTIDNRGAAPWLGDGRNVRGVLRLPVE
FT                   HRLSGFARAQARDSLLVSAPNWGNLRPDGVTDLSGYLVPGLTAARDEWTPQGEPANQLS
FT                   CWVALLLIESVPPAGQDAGASKLKAAGSAPDSSFEALAKMVLRWAIAAVQGPMTPDEVD
FT                   RCPVPATLLDWLADEVLVSTGDDPTPIPLDAVQAFLDTHFRFNLRVPPTDQDASADTAY
FT                   FPAPPQLRVMIPPYGNDYPGVQYTLGSYNALGENTLAELRAWFDQLAVQVEREQAANGA
FT                   AARAFVEEAPLSMAGWMFSDYFLLLARQMVKAAQDALRDFKYALDANETPDDVVSWVNT
FT                   TGQLNGLYTLNDVFGANALHALVAEKTLTIGVTSSISLAKTGQTFTSLAKAFDDALPAS
FT                   AIASANAADAALLQPGATITYPGFDPYTSVAGDTLVSIAAHYQAKLNDLLADSDVLDAA
FT                   GMLRIGASALMPYTAYTALATDTFASVAALPVYAGGFGAAALATANAGRSVLLEGVKIE
FT                   YPDKDAYTVQPRDTLGDVANAFGVTVSDLLATSAVLTQPGLLAPVASLTVPAFRYTTQQ
FT                   GDDLAQVAARFGVAVSVLADQPANGTVAGLFDTGDTLDLPHLPQFPLAELLAEAQRSGM
FT                   LQHLSGIASSYTMHGLRFPTSGPTGTGGQWSIVPNEMGMWVHDVNGTLKLPPQAGLYAL
FT                   TGQQFPLPALGADPFAATFDSVAGAGSSWLRFVDGNGGPTDHLTLSVTPGTPDATRIAQ
FT                   VTAAAKTRLVVPMDRLGAGKMYDTALATYPFTSALQWLSTNTVALPYGQPPAGVQSLRV
FT                   WQLPGALAALPDPATHAVNPRFALRVARYDDATGATETTGVDSYGWASTIGFTVRRIPP
FT                   VAGSPASVDTYEVVGASGAAIVVLEQLLSQVQADDSAYFGLSVGFAPDSATGGGEGVQT
FT                   GSAASVVFGIAQVNLSTETRPPAGAAFAALRETAGETPQLTLLNSPSEFMRLLWEASIT
FT                   RSGGFFLYYYDRAAGGGLPDRIFNDRNEASLTLIVLYAKPAAVDDQDRVTNYMNAVVTT
FT                   DALDTGNAVLFAEAAPVPATVTSGAGETLASLAAQWYSDEADIAEANANVELRAGALVR
FT                   VSEGVYQAPPGGIALAQVASRFGTTVQALNDANPLWGGLPDPLPFPAAIRVPDLTLTAG
FT                   TSAHTASLADIAGWYGEPVDALASHNARVAQLFAAGVPLVIPGGPRVRSAAVQPGVQAL
FT                   AALRPAPPQVDGTSPDYGTELLLNNFSLLNQQVYGNVDFRPSDPPGLPAGPTTKAPEEN
FT                   GNDKVRTVVPADQVEAWNFSQALPYARFAKHVPQAPRAAVALPPASASPYFGVGGILQI
FT                   SFAWQDYYGNVLSTPLSDPLAGDAAPYNDAPLLTGYTDPLVSLSQWPSIASNWQVLPGS
FT                   GGANPRLNIELSFDPSRYQGLLQASAATQTTITVVFTDALDAASVGELSRWQLVPGTVD
FT                   SASLAADGKTVTLTVPALEDNLRYTVIATDIKAQASDMRYSGQASFDWPDNPVTRSSTV
FT                   QQNASQDLHVYTQLYYQLTDPAGVDLSAQSSLLADAHGAPGSVAYAPAAVDKLMDWLFG
FT                   TAGAASSVYAFVLDRSKFQSVAVPPAAGLPLDVDVPPQQVNTAQIFPLWTSFTMTRAHG
FT                   PVLPGLETVAGIRSASTRVAPLQDALGATGGTLGLATFATGFEQALSTPGSVRLKVATG
FT                   VDRTAPPATGAASTVWAVRVGLAAGKAISYAIADAGNPAVFAPQPASNRLISRTQVPIY
FT                   DYTTGKGISSTPSRTTDFTDVDLDTWCAQVFAAVDDVLTPQFTAPMQIVGELKSADYLQ
FT                   SILDGKKGLATVAKLWMIPVFAGETSDPSAAREAFYQQLLVRLSAAYTTRAAVEFHANV
FT                   TADVIEPAADQPPRLFGPVTRNGPVFEAANVDGQALTTVFLLFSDPMDPVTAGNIENYA
FT                   LSSGAGVLTATVDRGTVTLTLATDVQPGQTTVTVSNLKDATGRAVRPPLTRTVTTGSAS
FT                   LPASTLAFSSPKLTLQAGDTRALTYLVNAPDSVRGAGGEIVSYVELDMTYQGSQIEHQI
FT                   GALPGIEDYQASTWLSFVVPDTDGPLAADLGNFAVPLVLRAFPASPAMTEQSGTPTHDL
FT                   DTASLPLLKQWDYAFTYSLPFHYPQDRIYGEVEFNLRTAPTLFASFPDAFAQLAEFITV
FT                   FPKVNADLQTILAGIDATVDPMTDQQKIDDASIALQSFIQLVDELVDAAGGNTQGNGER
FT                   RGGTGLTFQAPARLLTGDPSLTFAFYEEEGSAEVGDTEGALVVTLVGAVPAGMGQPVVE
FT                   IDPALYDAQPWQPPGDTQKAGDVFHYVYKRKAGPGPEGSYLSAANGQNIPGRTVRLPAL
FT                   DILQRQDAWSTVWVERNRELVPGKPSADAFVYTTPEVRFASPLYPTNDANAIIDVAAIP
FT                   SGTPVKRSLQEHFDALFAYLLAGDTLPQIVAQVEVTYGYALNAALDKIVLPVLMQAPLT
FT                   VDVAGTGAGTIAKMTADWTAAIETWFSTYEPTGGGTLWMDLTLMSNLTGQPMPLLRMRR
FT                   LMLSIAQVVPPLPCR"
FT   misc_feature    complement(554734..554793)
FT                   /note="Pfam match to entry PF01476 LysM, LysM domain ,
FT                   score 2.6, E-value 2.9"
FT   misc_feature    complement(554830..554952)
FT                   /note="Pfam match to entry PF01476 LysM, LysM domain ,
FT                   score 2.4, E-value 0.32"
FT   misc_feature    complement(556309..556443)
FT                   /note="Pfam match to entry PF01476 LysM, LysM domain ,
FT                   score 11.2, E-value 0.042"
FT   misc_feature    complement(556453..556587)
FT                   /note="Pfam match to entry PF01476 LysM, LysM domain ,
FT                   score 27.8, E-value 1.6e-05"
FT   misc_feature    complement(556747..556881)
FT                   /note="Pfam match to entry PF01476 LysM, LysM domain ,
FT                   score 1.6, E-value 0.38"
FT   misc_feature    complement(556894..557028)
FT                   /note="Pfam match to entry PF01476 LysM, LysM domain ,
FT                   score 8.2, E-value 0.084"
FT   CDS_pept        complement(562919..566497)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0410"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37865"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N86"
FT                   /protein_id="CAH37865.1"
FT                   /translation="MRGDLMSFFTQFEGSRLYIGPVASGDAGWLAYLLPRPSPSTEEID
FT                   LDLALKQLPGSFLFSFTAPLLSTTPLLDAFIGAVDQVIARSPADRGFLWLMDPTAPTIS
FT                   SVPLMGIAADGSYVSNALQAPIFETLSLNVRAGVTLQLDGDTLRLGTANGIFFSGASAP
FT                   GAPQASQIPAGTLPLSGAARGCIRFPVFLQRQFLHDGWNWGFQFQIPHDDPVRSAIGEW
FT                   LPLAFGHLPNPGDMLGFDASYDPSDPWNAHAIAADRSVLVFTGQNQDGTATVLSSCYAT
FT                   TYGELLTLAPVAGPLDMQPDAARFLFNAGAPDDKGNHDFQIAPEGDFVIHAHGPSDGGT
FT                   YDLICGLQGTEFVAFQPFVDGGYAGDRLRFTARSPAYAPRYPFTEVSPVGAPVDVNAPL
FT                   LDATYTSSWGTVARAPGAPGAAAYVAQPKGAALYGRDALIHSLGEKTLFGPMTPSVTLP
FT                   SSAFPMVPYAGASAGDGVTALTAERMADFERQVVSPTRRRRIADGGAGVASSKAHALKL
FT                   ADMATATPYNTTTPSGLLVTVDAAGQWSKILLGQNLSPTLRQMSFCNPGAELQQAFATS
FT                   DLFLVTANAAHLGAFSADGSGACGPSATFANRINVGDWSFEAAVGQNNRYDDYADVMIV
FT                   KGRRGPLWDPQNPAASLVASPDMWTQKDAFAAPSDLVPNPAPPPDETVAAPNPDELIAL
FT                   SYWLQRYFQDALDQAEPEYFAKFNTIAKDPAWTGILFLRMKISSIPDDLVGIVAGVQAP
FT                   ELFNAHHFGIEISQIANDPAAPDIALTTSSSMFGLIYYVDPAYIAPPPGIDPRPVPPTA
FT                   GTDYQFRVLTLKALFENTAVQRFQSYAQLTLNSLFDMPVVSMGEGGNPYATLVLRGSYQ
FT                   DNGGRAVYSLGTTATSTFYFDNNLFTKIEVDSAQMSTRDSGANGQIVSWFALSGFLDFA
FT                   VVQANDSSGAFDILSFGSHAGEDQLRRGLAYSNLGVRMTFPVADPATIAFAFSASEIRF
FT                   DMQTSTPRPDSLFVNFALGLQGLVQGSAQTSPEADGFLNVVTDATLTGVNGDRWYGLAY
FT                   QLNMGTPGNLAGTIGLTSGLLTAWAPVSADAGRYRASLGIQLPGTGGGANLISLQNVLR
FT                   LSIGQMWLTYDRDKRSFLLMLTEIALKFMGLLKIPPSGSTLFYLFGNPQSEGKASGLGW
FT                   YAMYNNTPASRSKSARLLGKARGWTE"
FT   CDS_pept        complement(566615..567391)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0411"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37866"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N85"
FT                   /protein_id="CAH37866.1"
FT                   /translation="MANERADRAARLAPALQNHRTTKTKEKSMAKELNAPSQQALVTSF
FT                   TIKPEDVTGTQITYRYDTMPGNQPNAYGNTVFIWQTSQVFIPVSTQPAHSQIVQNNQPN
FT                   GSSIFQGLSVSSESYLVAFAVGNSVKNIVAAVFVPSTDSNQPPYDPVQAPSILVTNKGS
FT                   TSVSFSYAMPAGMTPQADGDWVGLWQGQTEAVLYNMPATWFVQLGSNNNAGNFGINLSS
FT                   GNIQRGVTYTLGYFKGGYAQSNPKQTTLAASTTFVG"
FT   CDS_pept        complement(567424..567849)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0412"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37867"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N84"
FT                   /protein_id="CAH37867.1"
FT                   /translation="MRHRAGFKHHVKRGEHPTATASDREHYAEFGDKMSADDAKHVETE
FT                   SIEAAVFRKAVCAGFDHKRVALALMKRGGRSAANRRTPTCQSGMAADSRNIGEARCARR
FT                   LCSQSLLFPCPRGALETETLQGQSIVTNCAGGAYQFR"
FT   CDS_pept        568385..568792
FT                   /transl_table=11
FT                   /locus_tag="BPSS0413"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37868"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N83"
FT                   /protein_id="CAH37868.1"
FT                   /translation="MYPWIWLWAPNFYFPLSGGVDQTIQPDLFDAINSRAGNGEIERKA
FT                   FQVASYGRQLGLIIEVLLDMAKKQEALSPEAKQSMERLEAIQGEIEQIKREAPTSIAAD
FT                   LAARLLQLKTQNPAEFVRLRAQLLGIVKDGA"
FT   misc_feature    569025..569567
FT                   /note="Pfam match to entry PF02776 TPP_enzymes_N, Thiamine
FT                   pyrophosphate enzyme, N-terminal TPP binding domain , score
FT                   185.7, E-value 4.8e-53"
FT   CDS_pept        569031..570743
FT                   /transl_table=11
FT                   /locus_tag="BPSS0414"
FT                   /product="putative acetolactate synthase"
FT                   /note="Similar to Caulobacter crescentus acetolactate
FT                   synthase, large subunit cc2100 SWALL:Q9A6J3 (EMBL:AE005883)
FT                   (582 aa) fasta scores: E(): 3.3e-53, 36.34% id in 575 aa,
FT                   and to Bacillus subtilis acetolactate synthase large
FT                   subunit IlvB SWALL:ILVB_BACSU (SWALL:P37251) (573 aa) fasta
FT                   scores: E(): 7.6e-53, 33.74% id in 572 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37869"
FT                   /db_xref="GOA:Q63N82"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N82"
FT                   /protein_id="CAH37869.1"
FT                   /translation="MKASNAIARFLAAHDVRHCFELVGGMITHLLDSFAESGRFQIVSM
FT                   HHEQAAAFAAEGVARRYMGRKVAVALGTSGPGATNLITGIGSCWLDSVPCVFITGQVNT
FT                   HELKGERAIRQQGFQELDIVPMVRSITKHAVQVSDANELLPALHGALSAALSGRQGPVL
FT                   IDIPNDVQRAEIADAAVDRWLGEPLRIRDRCEPGDRDIDALRELCRSSSRPLVCFGGGA
FT                   RWAPSMPAWIAALEDARIPYVSTLMGHERVPAGAHYFNMIGAYGNREANWAVQHCDLLI
FT                   VIGARLDVRQTGADVGDFARHARVIQIDIDPAQLNNRIKVEQALCCDAESFFRRFAVRR
FT                   DTFAGIRPDWADQLATLRTAHARNEYPDWNISPGVVFARLNEAMAGKAVHYVCDVGNHQ
FT                   MWAAQGLRLGATQAVHYSGGMGAMGFALPTAIGIACSGDGGGKTVVITGDGSLQVNVQE
FT                   LDTLSRLQLDVAIVVMNNYSLGMVKNFQDMYFDGKNISTKQGYSCPSFVALARAYGIES
FT                   MTVAAPAELQRAIDRVAGSRRPLLVEIAMPEATECRPRLAFGRKLDDQYPKLD"
FT   misc_feature    569619..570092
FT                   /note="Pfam match to entry PF00205 TPP_enzymes, Thiamine
FT                   pyrophosphate enzyme, central domain , score 78.0, E-value
FT                   1.2e-20"
FT   misc_feature    570129..570662
FT                   /note="Pfam match to entry PF02775 TPP_enzymes_C, Thiamine
FT                   pyrophosphate enzyme, C-terminal TPP binding domain , score
FT                   158.4, E-value 7.9e-45"
FT   CDS_pept        complement(570903..573890)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0415"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Salmonella typhimurium putative outer
FT                   membrane lipoprotein YjbH or stm4225 SWALL:Q8ZKI1
FT                   (EMBL:AE008897) (698 aa) fasta scores: E(): 2.6e-34, 40.08%
FT                   id in 726 aa, and to Escherichia coli hypothetical
FT                   lipoprotein precursor YmcA or b0984 SWALL:YMCA_ECOLI
FT                   (SWALL:P75882) (698 aa) fasta scores: E(): 4.8e-33, 39.68%
FT                   id in 693 aa. Note: N-terminal region presents no
FT                   similarities to any database entries"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37870"
FT                   /db_xref="InterPro:IPR010344"
FT                   /db_xref="InterPro:IPR010425"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N81"
FT                   /protein_id="CAH37870.1"
FT                   /translation="MPKREATGRKRRGGTWLAVVLACARPFDAAAHVEETIAAPTHLGD
FT                   WLAAHQSTPAVGTPPSGAPSPYLGGLSWRSNREVAAQQASKRRLLAGIDALPALTPAAQ
FT                   AARARLSAMIAARAATGRVIVARSDARWLQANPAHDPYLEAGDVVTIPDRPSSVAVVRA
FT                   DGSICTVAHVQDVEALPYVLACAPDAAPDLAWIAQPDGTVSESKVAMWNRDVQDTPAPG
FT                   SWIWAPDRGSRWPPALSRALAEFMATQGVSGLADDGSPLPAPPIAPVHQTAFPSGAPGR
FT                   SAAFPVTGGDWGTAGILQTPTARMNDAGEASLSMSHVSPYTRLNFTLQPLDWLEIGFRY
FT                   TDVSNQPYGPVSLSGTQSYKDKSIDAKLRLWRESAYLPDVAVGFRDIAGSGLFSGEYLV
FT                   ASKRTGPFDWSVGLGWGYVGARGNLRNPLAVISRRFDDRTNSATPNGGELGYSSWFRGR
FT                   VSPFGGVQYQTPHERLILKAEYDGNDYRHEPFGQVLKARSPFNFGAVYRATRNIDLSLG
FT                   FERGARVMFGVSLHGNLKRASMPKLGNPPAPPVTQPAANAGPPPPAADPASGDAQAATA
FT                   PASRIGRASPSPFDRDWSGTVAQLQAQTHWHVRSIRALGMDLVVEFDDVDAFYLQDPLE
FT                   RIATILNRDAPLNVRTFHVVALVHGVPVADYQVQRTQWFASRTRALTPSEAAPDTALGR
FT                   PLTRQSIDMLPSLFEQRPKAFVASVGPGYRQTLGGPNGFLLYQISADAYGELRLPGGAW
FT                   LGGELNVGLVDNYGKFTYTADSKLPRVRTYLREYLTTSRVTLPLLQLTKMGRLGNDQFY
FT                   SVYGGLLESMFAGVGAEWLYRPADSRLAIGVDVNAVRQRGFRQDFSMRDYRTLTGHVTA
FT                   YWNTGWQGVQINLSVGQYLAKDKGATLDISRRFRNGVVIGAYATKTNISAAQFGEGSFD
FT                   KGIYLTIPFDAMMTRSSGSVANLRWNPVTRDGGAKLDRKYPLYDLTDMGERRSLWYAPP
FT                   DGALSP"
FT   misc_feature    complement(573798..573890)
FT                   /note="Signal peptide predicted for BPSS0415 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.887) with cleavage site
FT                   probability 0.492 between residues 31 and 32"
FT   misc_feature    complement(573822..573854)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(573892..574536)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0416"
FT                   /product="putative lipoprotein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37871"
FT                   /db_xref="InterPro:IPR021308"
FT                   /db_xref="InterPro:IPR023373"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N80"
FT                   /protein_id="CAH37871.1"
FT                   /translation="MPVRLLVSLWIIVLCGCSTSMQGLADVARVYWGGGNHQVARTALD
FT                   ARYRYLRISVRGRATLMILGYVDRDPLGPIEIWYSGHGKETLRLQNGRVVGGTGLPVEW
FT                   TSVQLSAQPAWRSLSGAATIERRRDVMPGYAYGLTDTLTVTPIPMPRGTAYFGQPDPGL
FT                   RWFVESSTGAAPLPPARYATRTVGNATTVVYGEQCLDKTFCLSWQRWPVNS"
FT   misc_feature    complement(574462..574536)
FT                   /note="Signal peptide predicted for BPSS0416 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.990) with cleavage site
FT                   probability 0.817 between residues 25 and 26"
FT   misc_feature    complement(574486..574518)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        574629..574985
FT                   /transl_table=11
FT                   /locus_tag="BPSS0416A"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0416A"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37872"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N79"
FT                   /protein_id="CAH37872.1"
FT                   /translation="MPVVPVLPLLPLPPELAATPIPTAAATPAPTAATVPTLTPPNVAA
FT                   PPAPAVPAVPVAPVASPAPVVPVVPAEPGMSVAPGVPGVPGVPGAPEPSFRMAPDARSA
FT                   GCSPAAGVAAAGAA"
FT   CDS_pept        575855..578407
FT                   /transl_table=11
FT                   /locus_tag="BPSS0417"
FT                   /product="hypothetical protein"
FT                   /note="C-terminus is weakly similar to the C-terinal region
FT                   of Escherichia coli polysialic acid transport protein
FT                   precursor KpsD SWALL:KSD1_ECOLI (SWALL:Q03961) (558 aa)
FT                   fasta scores: E(): 1.4e-09, 25.1% id in 458 aa, and to
FT                   Shewanella oneidensis polysaccharide biosynthesis protein
FT                   so3193 SWALL:AAN56193 (EMBL:AE015757) (921 aa) fasta
FT                   scores: E(): 5.3e-26, 26.41% id in 863 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37873"
FT                   /db_xref="GOA:Q63N78"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR010425"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N78"
FT                   /protein_id="CAH37873.1"
FT                   /translation="MNVKSPILRHPRTWAGFSFRDGLPFIRFASLRLLAWLLRCAVCLW
FT                   PCAFPVFAHAQIVPFVPSASAGADARSAVPLPPIDSLPAADGLSARQRDALQPPLPGAK
FT                   LTKDATTKDGLLKDGAALNEPPRPCGPLGCRGEAIDCPPSADGRPTSITRRADGTPELP
FT                   DPCGRPRAASQPALTDFQVFVQQSTGRALPLFGYNFFSTTTTYRSLDNVPVPDDYVLGP
FT                   GDEVLLHAWGGVAGDQRLVVDRNGQVSIPGVGVVTVAGARASELDSLLRGGLGRYFTDF
FT                   NVNAALGRLRSIPVYVVGKAMSPGSYTVPGTSTIIGALFASGGPAFNGSMRAVALYRNG
FT                   RQIAALDVYGFLTRGAVKDDVHLLPGDVIVIPPAGPRIALTGALDAPGIYELRKTSETL
FT                   RELLDDAGGVTALTSLDRVMIERVNPADGAAPRSVQEVRLDEAGLATVVKDGDIVTLSM
FT                   VSQKFSNAVTLRGNVAAALRYPYKPGMTLADLLPSPEAVLTPDYFTRKNILVEYAKSGG
FT                   ADRRPFDGIRNLVDEPNWHYAIIQRLDPVTLTENVIAFNLRAVMTKGSAEAGIALQPGD
FT                   VVTIFGKRDLRNPVDDNKSLVRVDGEVRAPGVYQLNAGESLRELLQRAGGLTSNAYVFG
FT                   LEFTRESTRSQQQQNLNAALDRATLQANSKLAAALANLPSGDTQYLQAQMAAAQQAQLA
FT                   RLRELKPTGRVSLELSTRASRIGDLPDLPLNDGDAIYVPPVPAFVTVYGAVDNQNAVIW
FT                   KLHRTVADTLRVAGVQRDIADLDAAFVLRADGSVASASSAGWFGSFGALELMPGDALVV
FT                   PEKLDRRTAMTKFLAGLKDWSQVLANFGLGAAAIKVLK"
FT   CDS_pept        578412..579629
FT                   /transl_table=11
FT                   /locus_tag="BPSS0418"
FT                   /product="putative transport-related membrane protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli O6
FT                   capsule polysaccharide export inner-membrane protein KpsE
FT                   or c3687 SWALL:KSE5_ECOLI (SWALL:P42214) (382 aa) fasta
FT                   scores: E(): 0.00055, 22.35% id in 340 aa, and to Ralstonia
FT                   solanacearum putative tyrosine-protein kinase EpsB
FT                   SWALL:EPB2_RALSO (SWALL:Q45409) (750 aa) fasta scores: E():
FT                   7.4e-06, 25.16% id in 302 aa. Note: The N-terminal region
FT                   does not seem to present any similarities with database
FT                   entries. Possible alternative translational start site"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37874"
FT                   /db_xref="GOA:Q63N77"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N77"
FT                   /protein_id="CAH37874.1"
FT                   /translation="MAELETGGDGPADVGQSAPVGPALSRADVLIALGHGKGLIARIVA
FT                   ATVLLGIALALVLPPIYQASTVLLPPDESRGLFGHSMSSLDVIAGAAMGIEMKTPGELY
FT                   VALLKSTSIEDGLIRQFDLRKRYRVDTMHAARKALQSRVNITIDKKSGLLTIAADDTDP
FT                   AVAAELANAHVAALAKLLERIAVTQAQQRRAFLEKEVAKARIALANAQDAYVKLQAKSG
FT                   IVSVDADTQLAIRHSAEIRSLLAAKQIELSSLGTYATAENPQVKRIEAEVSTLKAQLEK
FT                   IENGDAASLRGSDAGMATLRSYREMKYQESVVDVLSRQLELARVDEAKSGPLVQQVDVA
FT                   APPERKAKPSRLLILLASVAGGFVLAVTAVIGRAFGRQAVERARRSGDLARLRHAWTIT
FT                   FKRTRS"
FT   misc_feature    578496..578939
FT                   /note="Pfam match to entry PF02706 wzz, Chain length
FT                   determinant protein , score 40.0, E-value 3.4e-09"
FT   misc_feature    order(578529..578597,579468..579536)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPSS0418 by TMHMM2.0 at aa 12-34 and 325-347"
FT   CDS_pept        579626..580402
FT                   /transl_table=11
FT                   /gene="rfbF"
FT                   /locus_tag="BPSS0419"
FT                   /product="glucose-1-phosphate cytidylyltransferase
FT                   (O-antigen-related)"
FT                   /EC_number="2.7.7.33"
FT                   /note="Similar to Salmonella typhimurium
FT                   glucose-1-phosphate cytidylyltransferase RfbF or stm2092
FT                   SWALL:RFBF_SALTY (SWALL:P26396) (257 aa) fasta scores: E():
FT                   4e-73, 68.09% id in 257 aa, and to Yersinia enterocolitica
FT                   DdhA SWALL:Q56860 (EMBL:U46859) (261 aa) fasta scores: E():
FT                   9e-74, 66.14% id in 257 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37875"
FT                   /db_xref="GOA:Q63N76"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR013446"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N76"
FT                   /protein_id="CAH37875.1"
FT                   /translation="MKAVILAGGFGTRFTEETISRPKPMIEIGGKPILWHILKLYSHHG
FT                   INEFIICCGYRGYVIKEYFANYFLHMSDVTFDVQKNSMEVHYRYSEPWRVTLVDTGEMT
FT                   MTGGRIRRVRQYVEGDDMFCLTYGDGLCDVDLGRLIAFHREHGGKATLTAVHPPARFGV
FT                   LDIGADRQVIDFTEKPRIDGGMINGGFFVLSPSVIDLIDGDATVWEREPLERLARANEL
FT                   KAYPHDGFWQCMDTLRDKLLLDSMWATGTAPWKKWS"
FT   misc_feature    579629..580345
FT                   /note="Pfam match to entry PF00483 NTP_transferase,
FT                   Nucleotidyl transferase , score 15.5, E-value 2.5e-09"
FT   CDS_pept        580405..581478
FT                   /transl_table=11
FT                   /gene="rfbG"
FT                   /locus_tag="BPSS0420"
FT                   /product="CDP-glucose 4,6-dehydratase (O-antigen-related)"
FT                   /EC_number="4.2.1.45"
FT                   /note="Similar to Salmonella typhimurium CDP-glucose
FT                   4,6-dehydratase RfbG or stm2091 SWALL:RFBG_SALTY
FT                   (SWALL:P26397) (359 aa) fasta scores: E(): 2.3e-85, 55.55%
FT                   id in 351 aa, and to Yersinia pseudotuberculosis
FT                   CDP-D-glucose-4,6-dehydratase AscB or DdhB SWALL:Q57329
FT                   (EMBL:L33181) (357 aa) fasta scores: E(): 8.7e-88, 58.33%
FT                   id in 348 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37876"
FT                   /db_xref="GOA:Q63N75"
FT                   /db_xref="InterPro:IPR013445"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N75"
FT                   /protein_id="CAH37876.1"
FT                   /translation="MHAPDARFWQARRVLVTGHTGFKGSWLSLWLQSLGAQVHGLALEP
FT                   PSRPSLFETARVAQRMSSTIGDIRDYDVVRRTIADCRPEVVIHLAAQPLVRASYADPLS
FT                   TYGTNVMGTANLLEALRRAGCARAVVNVTTDKCYENRDWLWGYRENDVLGGHDPYSSSK
FT                   ACSELVSSAYRRSFFAQGATALASARAGNVIGGGDWAAERLVPDVLAAFASGRPAVIRH
FT                   PHAVRPWQHVLDSLSGYLRLAERLHADGQAWAEAWNFGPDDAQARTVEWVVSRMARIWG
FT                   GDARWHPDSADHPHEAAQLKLDSSKAKARLGWRPRWSLARALECTIAWHRAWLAREDMR
FT                   AVCIEQIAEFDTSPDPT"
FT   misc_feature    580444..581406
FT                   /note="Pfam match to entry PF01370 Epimerase, NAD dependent
FT                   epimerase/dehydratase family , score 4.3, E-value 1.1e-13"
FT   CDS_pept        581486..582838
FT                   /transl_table=11
FT                   /gene="rfbH"
FT                   /locus_tag="BPSS0421"
FT                   /product="lipopolysaccharide biosynthesis protein
FT                   (O-antigen-related)"
FT                   /note="Similar to Salmonella typhimurium lipopolysaccharide
FT                   biosynthesis protein RfbH or stm2090 SWALL:RFBH_SALTY
FT                   (SWALL:P26398) (437 aa) fasta scores: E(): 4.6e-120, 64.45%
FT                   id in 436 aa, and to Yersinia pseudotuberculosis, and
FT                   Yersinia pseudotuberculosis
FT                   CDP-4-keto-6-deoxy-D-glucose-3-dehydrase DdhC SWALL:Q05341
FT                   (EMBL:AF461770) (437 aa) fasta scores: E(): 1.3e-119,
FT                   65.13% id in 436 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37877"
FT                   /db_xref="GOA:Q63N74"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N74"
FT                   /protein_id="CAH37877.1"
FT                   /translation="MDIIRPTFAPDAARSPDAIRAEIAALVREYANATQARAPFVPGRT
FT                   PVPVSGKVIGAPELQHMVDASLDGWLTTGRFNTAFENRLARYLGVTHVITVNSGSSANL
FT                   VAFSTLTSDRLGERAIRPGDEVIGVAAGFPTTVNPILQFGAVPVFVDIELGTYNVDATK
FT                   LEAALSPRTRAIMLAHCLGNPFNVEAVTSLCRKYGLWLIEDCCDALGARYDGRLVGTFG
FT                   DIATLSFYPAHHITMGEGGAVFTNNDELARIAESFRDWGRDCYCAPGADNTCGKRFCWQ
FT                   LGELPRGYDHKYTYSHCGYNLKITDMQAACALAQMDRVDGFIERRRGNFAYLKERLSSC
FT                   DAFLHLPQATFNSNPSWFGFPLTLREDTGVARVDLLDYLSQGGVGTRLLFAGNLTRQPY
FT                   MRHRRYRVSGELAVTDAVMERTFWIGVFPGLDEAMLDYACTKIETFLGINF"
FT   misc_feature    581642..582814
FT                   /note="Pfam match to entry PF01041 DegT_DnrJ_EryC1,
FT                   DegT/DnrJ/EryC1/StrS aminotransferase family , score 490.0,
FT                   E-value 1.2e-144"
FT   CDS_pept        582864..584624
FT                   /transl_table=11
FT                   /locus_tag="BPSS0422"
FT                   /product="putative aminotransferase"
FT                   /note="C-terminal region similar to Escherichia coli, and
FT                   Escherichia coli O157:H7 perosamine synthetase Per or RfbE
FT                   or z3200 or ecs2841 SWALL:O07849 (EMBL:AF061251) (366 aa)
FT                   fasta scores: E(): 3.5e-50, 38.76% id in 356 aa and
FT                   N-terminal region similar to Agrobacterium tumefaciens
FT                   acetyltransferase atu2080 or agr_c_3768 SWALL:Q8UDP1
FT                   (EMBL:Q8UDP1) (177 aa) blastp scores: Score = 39.9 bits
FT                   (91), Expect = 0.14 Identities = 46/165 (27%), Positives =
FT                   70/165 (41%), Gaps = 18/165 (10%)"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37878"
FT                   /db_xref="GOA:Q63N73"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N73"
FT                   /protein_id="CAH37878.1"
FT                   /translation="MNVYKKALVANFRFLKASRDVREAYLRAIPVADAGFLVPIGESRL
FT                   DDADLLAKLTRWRNEHVHVYPTQFEATVDSTRAWLKERLLATDDRILFLVEDRHGRAVG
FT                   HIGFNGCLNDERLFEIDNVVRGDAAGAKGLFSLALQALIEWARTTSNVEGFFLRVMDDN
FT                   PRAIAFYARNGFAEERRIPLVGERRGETLSYREARDGEAAHKHFVRMAYRRTHEAGRSM
FT                   ILTAGPSISAREAVYAHDAAAHGWNRNWSKYLTSFEAAFADYVGVKHAIATSSCTGALQ
FT                   ISLMALGIGAGDEVIVPDLTWVATANAVRYVGATPVFADIELDSWNLDARSLDALITPQ
FT                   TKAVIAVHMYGHPARMDAILEVAGRHGLKVIEDAAPAIGAEWRGRRCGSFGDFAAFSFQ
FT                   GAKLLVTGEGGMLATDDDALYEKALKIWDQGRNPSRTFWIDGDGVKFKMSNVQAAVGLG
FT                   QLERADELIEMKRRIFDWYDEGLAGAPGIALNREIPDARSIYWMTSLRLDESAPIGRDD
FT                   LMKALKARNVDTRPVFPAISRYPIWSRRQPPQPTASRVGQQAMNLPSGVCLSKDDVFYV
FT                   CRQVRDLLGA"
FT   misc_feature    583143..583391
FT                   /note="Pfam match to entry PF00583 Acetyltransf,
FT                   Acetyltransferase (GNAT) family , score 41.5, E-value
FT                   1.3e-09"
FT   misc_feature    583545..584606
FT                   /note="Pfam match to entry PF01041 DegT_DnrJ_EryC1,
FT                   DegT/DnrJ/EryC1/StrS aminotransferase family , score 503.3,
FT                   E-value 1.2e-148"
FT   CDS_pept        584873..586228
FT                   /transl_table=11
FT                   /locus_tag="BPSS0423"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Salmonella enterica hypothetical protein
FT                   with 12 predicted transmembrane segments which possibly
FT                   functions in export of O-antigen SWALL:Q00339 (EMBL:X61917)
FT                   (446 aa) fasta scores: E(): 2e-39, 30.15% id in 441 aa, and
FT                   to Sphingomonas sp. S88 hypothetical 47.3 kDa protein SpsS
FT                   SWALL:P74815 (EMBL:U51197) (452 aa) fasta scores: E():
FT                   1.5e-05, 26.01% id in 469 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37879"
FT                   /db_xref="GOA:Q63N72"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N72"
FT                   /protein_id="CAH37879.1"
FT                   /translation="MKAFAAALGRLWHLGGIDLPVAVTLLARTWAIASGLVTVLLIARC
FT                   LSPELQGYYYTFNSLVAMQIFAELGMNTVLVQCISHEMAELRIVGGRIAGERRTKARLK
FT                   SLLTFGVAWCGGAACVFVAILLPGGWLFFGASAPHAPDIALAWGLFVVLTGVMLVLNGL
FT                   LAFLEGCGQIGQVAAVRLAQAIGSSLGIWALLGARAQLLSFAGGLAIGCLIAAAALLAR
FT                   YRRLIVDLLRVNDAAGAVRWRTEIWPLQWRIAVSWASGYLIFNLFNPLLFATHGAVAAG
FT                   RFGMSLQIVTALNSVGMAWITTKVPQFCRLIARRQRARLDELFRTTLRQSLFFLAAGGV
FT                   LAVLVAALARPYAPWLGNRLVPVALFAALCVVCLANHVVFAEAAYLRAHKQEPFMIVSV
FT                   ANGLATALAAWALIPRWGAQGAVLAYAIGSVGVGFVGGTFVFVRKRAEFSAS"
FT   misc_feature    order(585188..585256,585299..585367,585401..585460,
FT                   585473..585541,585641..585709,585737..585805,
FT                   585866..585919,585947..586015,586052..586120,
FT                   586130..586198)
FT                   /note="10 probable transmembrane helices predicted for
FT                   BPSS0423 by TMHMM2.0 at aa 112-134, 149-171, 183-202,
FT                   207-229, 263-285, 295-317, 338-355, 365-387, 400-422 and
FT                   426-448"
FT   CDS_pept        586225..587286
FT                   /transl_table=11
FT                   /locus_tag="BPSS0424"
FT                   /product="putative glycosyl transferase"
FT                   /note="Similar to Salmonella enterica WbaR protein
FT                   SWALL:Q00337 (EMBL:X61917) (320 aa) fasta scores: E():
FT                   1.1e-15, 32.25% id in 248 aa, and low similarity to
FT                   Salmonella typhimurium O antigen biosynthesis
FT                   abequosyltransferase RfbV or stm2087 SWALL:RFBV_SALTY
FT                   (SWALL:P26401) (333 aa) fasta scores: E(): 0.00069, 26.54%
FT                   id in 275 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37880"
FT                   /db_xref="GOA:Q63N71"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N71"
FT                   /protein_id="CAH37880.1"
FT                   /translation="MTTGPAMLLTIAIPTYNRVSCLRLLVDSLLAQIAQAERRGDRVAI
FT                   LIADNASTDGTGEYLESLAASRFVTIHRHAHNRGAAANVVHCFRHAGSRYVWIIGDDDL
FT                   PLPGAVDAVLRHLACAAPDLFLLAAKWVPENLEAAARACGKPGRAKRVDRIDLSLKASV
FT                   MTTFISSWVVNREAYLHHYGDAGIDRFGDTLFPQLAWVFGLMRSGARFLSADGPWLLAR
FT                   AGNSGNYAVFDTFSHQYNRIVDQSFAEAGWLRDFHRQNILWNFIPGLVWSVRTERAGRF
FT                   EPFDAAAVEKVLSSAYAGSRFYARIVLPMITRRAGVAKWYWVLARILRRARVCWIFACA
FT                   STRRRLAMKSGVD"
FT   misc_feature    586252..586761
FT                   /note="Pfam match to entry PF00535 Glycos_transf_2,
FT                   Glycosyl transferase , score 93.9, E-value 2e-25"
FT   CDS_pept        587459..588715
FT                   /transl_table=11
FT                   /locus_tag="BPSS0425"
FT                   /product="putative heptosyltransferase (O-antigen related)"
FT                   /note="Similar to Escherichia coli lipopolysaccharide
FT                   heptosyltransferase-1 RfaC or WaaC or Rfa-2 or b3621
FT                   SWALL:RFAC_ECOLI (SWALL:P24173) (319 aa) fasta scores: E():
FT                   7.8e-07, 26.45% id in 310 aa, and to Rhizobium loti
FT                   ADP-heptose-LPS heptosyltransferase mlr2566 SWALL:Q98I51
FT                   (EMBL:AP003000) (335 aa) fasta scores: E(): 1.8e-15, 26.87%
FT                   id in 346 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37881"
FT                   /db_xref="GOA:Q63N70"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N70"
FT                   /protein_id="CAH37881.1"
FT                   /translation="MADERAAKRWPARGEDMKILFIKLSALGDVLASTPLFASTKAEHP
FT                   DWFVGHVVARPYAAATRNNAHVDAQFIVDSPLSGGAIRKIRVAARIWRYMMRERYDIAV
FT                   VLHRSFVLQLICRLASVRKTIGYESRFSFILSHSIPFSMQGNRSGLELRLLKSAGIIHD
FT                   EKKKLRFDIDFGNVDRNRLRALPAAFIAVNAGGGNADAQAANKLWPAERYGALIKRLPL
FT                   PVVMLGHGAADEDIRDRVAATGARFVDMVGKTNLDETAVILERSRLYVGNDSALLYLAA
FT                   SLGVTTIGIYGPTDPAAFSPLGANNLWLSGKTSCAPCYSSFDGIGGRMYTCTNNICMQA
FT                   VTVESVSERIHAALHQDQNLQAAGPDVVGSGQGRAASETRARADTDARADHQALGDGGF
FT                   AVPLSHRSATGARVPGRDD"
FT   misc_feature    587720..588445
FT                   /note="Pfam match to entry PF01075 Glyco_transf_9,
FT                   Glycosyltransferase family 9 (heptosyltransferase) , score
FT                   31.4, E-value 1.4e-08"
FT   CDS_pept        588621..589676
FT                   /transl_table=11
FT                   /locus_tag="BPSS0426"
FT                   /product="putative heptosyltransferase (O-antigen related)"
FT                   /note="Similar to Escherichia coli WaaQ SWALL:Q9R9D5
FT                   (EMBL:AF019746) (340 aa) fasta scores: E(): 4.7e-06, 22.68%
FT                   id in 335 aa, and to Neisseria gonorrhoeae ADP-heptose:LPS
FT                   heptosyltransferase II RfaF SWALL:Q51063 (EMBL:Z37141) (336
FT                   aa) fasta scores: E(): 5.8e-09, 24.92% id in 349 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37882"
FT                   /db_xref="GOA:Q63N69"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N69"
FT                   /protein_id="CAH37882.1"
FT                   /translation="MLIIKLSAMGDSLCLFPTVRQLALAFPGATIDWLTSNRSNPALFA
FT                   ELPFIRTIFVTPPSLVRALTYLGGWLFRARRYDLTIDYDQYYCISELIAGMSACSAGFR
FT                   TSLKGTTFSLSVEYDPLLNEKAMFRKLTERVFATYGVSIPDYRAELPELIERFVPSAQL
FT                   QTLRARLKAQGKPIVGIYPGSGANATFRRWGVGNYVALIERYKDRYAFVLLGGPDERDL
FT                   QADLKDIDGVFNLIDSMSFKEVAWFLKHTIDLLVGNDGGLLHVAESQAVATVGIFGPAL
FT                   YRKWGSSLERSIGVEKELPCRPCLKNYLGTVPSACCLGTTACLSAISTDDVAQAMHRAV
FT                   HRIHVVPIAHA"
FT   misc_feature    588810..589565
FT                   /note="Pfam match to entry PF01075 Glyco_transf_9,
FT                   Glycosyltransferase family 9 (heptosyltransferase) , score
FT                   -24.1, E-value 2.2e-05"
FT   CDS_pept        589669..590238
FT                   /transl_table=11
FT                   /locus_tag="BPSS0427"
FT                   /product="putative O-acetyl transferase
FT                   (O-antigen-related)"
FT                   /note="Similar to Escherichia coli putative
FT                   lipopolysaccharide biosynthesis O-acetyl transferase WbbJ
FT                   or b2033 SWALL:WBBJ_ECOLI (SWALL:P37750) (196 aa) fasta
FT                   scores: E(): 4.5e-09, 36.06% id in 122 aa, and to Aeromonas
FT                   hydrophila O-acetyl transferase SWALL:AAM74482
FT                   (EMBL:AF148126) (199 aa) fasta scores: E(): 2.2e-11, 31.6%
FT                   id in 174 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37883"
FT                   /db_xref="GOA:Q63N68"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N68"
FT                   /protein_id="CAH37883.1"
FT                   /translation="MLERLFFLFHRVGRVARARMWRIAGQPAFARRGRASKIFGWRAIR
FT                   VGKRATIGDACWIQAVERYGGQSFRPSISIGDDVHLSDAVHISAVSSIEIGNGCLLGSR
FT                   IYIGDHAHGDSADGAHRAMSPARRPLARVEPIRIGDDCWICDGAVILAGTRLAPGCIVA
FT                   ANAVVRLTADAACVIAGNPATIVKRL"
FT   misc_feature    589882..589935
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats) , score 6.8, E-value
FT                   6.5"
FT   misc_feature    589942..589995
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats) , score 14.1,
FT                   E-value 0.22"
FT   misc_feature    590071..590124
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats) , score 11.2,
FT                   E-value 1.6"
FT   misc_feature    590125..590178
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats) , score 3.9, E-value
FT                   15"
FT   CDS_pept        590250..591296
FT                   /transl_table=11
FT                   /locus_tag="BPSS0428"
FT                   /product="putative glycosyl transferase (O-antigen
FT                   related)"
FT                   /note="Similar to Salmonella enterica rhamnosyl transferase
FT                   SWALL:Q00482 (EMBL:X61917) (347 aa) fasta scores: E():
FT                   4.6e-25, 30.03% id in 323 aa, and to Salmonella typhimurium
FT                   O antigen biosynthesis abequosyltransferase RfbV or stm2087
FT                   SWALL:RFBV_SALTY (SWALL:P26401) (333 aa) fasta scores: E():
FT                   0.00046, 23.58% id in 229 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37884"
FT                   /db_xref="GOA:Q63N67"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N67"
FT                   /protein_id="CAH37884.1"
FT                   /translation="MPISITVGVPAYARPDELRELIESVLACDPPPDELLICEDASPQR
FT                   DAIRQIVYAQRLALARSGCRLRYVENERNLGYDGNLRMLIAQASGDYLMLLGDDDQLYS
FT                   NAIAETRRYVGAHPEVRFVSRTYRRFSGHRDRGVLNETWLAKSDAVFDRGNSSPALIFR
FT                   LCGFVGGLVVKTDWARELATSRYDGSLYYQYYLACHAYFGAGIGYIGKAIVAGRAQNPP
FT                   LFGHAAAEAGVHVPGAYRPAARARMWRGVLDISADVERALGVPLVGAVMREMAGRQSFH
FT                   IFEMMPAQGRRATLELFVELRKLGLVRSPLPWLLASFVLTFGAAAASGFRMLRRLQFAV
FT                   ERGLRIKC"
FT   misc_feature    590265..590795
FT                   /note="Pfam match to entry PF00535 Glycos_transf_2,
FT                   Glycosyl transferase , score 70.8, E-value 1.9e-18"
FT   misc_feature    591180..591248
FT                   /note="1 probable transmembrane helix predicted for
FT                   BPSS0428 by TMHMM2.0 at aa 311-333"
FT   CDS_pept        591300..592349
FT                   /transl_table=11
FT                   /locus_tag="BPSS0429"
FT                   /product="putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37885"
FT                   /db_xref="GOA:Q63N66"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N66"
FT                   /protein_id="CAH37885.1"
FT                   /translation="MFFCYVLFLIFYWSPAIVLQWGTYGMFDDAVPMWYKALRLIVPAY
FT                   GLVVLARQPYYTPAHLLYFVFGAWCVLVSGDLATSVNVLVFCATLVIMKGVRIDAAALR
FT                   RVILAALPFVYGMGLLEVFGVFVSAHTYGSELRVVSTFGGPNNAGIIFSSWALYFIIEF
FT                   RNARRLRDLGHAAACVSFVVLTGSLSAAVALAACAFVLNAYLIVPAVLVVVPTFLINDF
FT                   FMLKLSYLMATLNGQGETTGSFSDRVENVATIARVAGDNVVNLIVGSGLHSESDYLSVL
FT                   GQFGVVGLILFICVLLTLPRSLFMLLGLLQSLVTPFFFSFPSFPLIALLAAGEVAAEAR
FT                   KRAPRPAPG"
FT   misc_feature    order(591303..591371,591489..591557,591615..591683,
FT                   591711..591779,591813..591881,591891..591959,
FT                   592128..592196,592239..592307)
FT                   /note="8 probable transmembrane helices predicted for
FT                   BPSS0429 by TMHMM2.0 at aa 2-24, 64-86, 106-128, 138-160,
FT                   172-194, 198-220, 277-299 and 314-336"
FT   CDS_pept        complement(join(592791..592973,592978..592992,
FT                   592992..593036,593038..593187,593199..593306))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPSS0430"
FT                   /product="conserved hypothetical protein (pseudogene)"
FT                   /note="Pseudogene. Similar to Escherichia coli hypothetical
FT                   19.6 kDa protein SWALL:Q9L910 (EMBL:AF188737) (172 aa)
FT                   fasta scores: E(): 2.6e-19, 40.36% id in 166 aa, and to
FT                   Shewanella oneidensis conserved hypothetical protein so1764
FT                   SWALL:AAN54818 (EMBL:AE015620) (171 aa) fasta scores: E():
FT                   2.4e-10, 29.69% id in 165 aa. CDS contains several
FT                   frameshift mutations"
FT                   /db_xref="PSEUDO:CAH37886.1"
FT   CDS_pept        complement(593393..594292)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0431"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas putida transcriptional
FT                   regulator, LysR family pp3811 SWALL:AAN69405
FT                   (EMBL:AE016788) (294 aa) fasta scores: E(): 9.2e-52, 50% id
FT                   in 288 aa, and to Bradyrhizobium japonicum transcriptional
FT                   regulatory protein blr6553 SWALL:BAC51818 (EMBL:AP005959)
FT                   (323 aa) fasta scores: E(): 8.9e-39, 41.69% id in 295 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37887"
FT                   /db_xref="GOA:Q63N65"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N65"
FT                   /protein_id="CAH37887.1"
FT                   /translation="MQFDDLRIFVATVEAGSFTGAADKLLLSKQFVSRRVMALEASLGV
FT                   RLLVRNTRKLAVTELGHELHARATRILADIAETEEAMSARRGDLRGTLKISAPMSFGIA
FT                   HLSPLIAEFLVRHPAVRLHVELSDRHVDLIGEGFDLALRIGALPDSTLIARRLGELRMV
FT                   ACCSPAYRRKHGAPATPADLHGRACLLYGQEGRTGWEFMIDGARRTFEVQGALLANNGD
FT                   VVRDAAVAGLGIALLPHFIVAHALDAGRLVAVLEPFAQAPLPINAVYPQHRQDMAACRT
FT                   FLGFIEERLRERFAKPRR"
FT   misc_feature    complement(593420..594037)
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain , score 193.5, E-value 2.2e-55"
FT   misc_feature    complement(594107..594286)
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family , score
FT                   76.1, E-value 4.8e-20"
FT   misc_feature    complement(594152..594244)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(594182..594247)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1017.000, SD 2.65 at aa 42-63, sequence
FT                   GSFTGAADKLLLSKQFVSRRVM"
FT   CDS_pept        594422..595147
FT                   /transl_table=11
FT                   /locus_tag="BPSS0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli protein YhhW or b3439
FT                   SWALL:YHHW_ECOLI (SWALL:P46852) (231 aa) fasta scores: E():
FT                   2.7e-42, 49.57% id in 234 aa, and to Xanthomonas axonopodis
FT                   hypothetical protein xac1747 SWALL:AAM36613 (EMBL:AE011806)
FT                   (233 aa) fasta scores: E(): 2.7e-52, 58.44% id in 231 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37888"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N64"
FT                   /protein_id="CAH37888.1"
FT                   /translation="MIEVRAANQRGRAEHGWLSSRHTFSFAEYYDPAQVGFSDLLVIND
FT                   DRVAPGRGFGMHPHRDMEILSYVLEGALEHRDTMGTGSVIVPGDVQLMSAGKGIAHSEF
FT                   NHSADRPVHFLQIWIGPSVRGVEPRYQQASVSDDDKRGRLRLIVSPQGQDGSLKIRQDA
FT                   RVYAGLFDGDASERFALPPRRFAYLHVARGSVTVNGVELHEGDGARIRDEQALQIANGK
FT                   QAEVLLFDLRPIEVTAEWA"
FT   misc_feature    594422..595117
FT                   /note="Pfam match to entry PF02678 DUF209, Uncharacterized
FT                   BCR, YhhW family COG1741 , score 403.1, E-value 1.8e-118"
FT   CDS_pept        595429..596109
FT                   /transl_table=11
FT                   /locus_tag="BPSS0433"
FT                   /product="putative membrane protein"
FT                   /note="Highly similar in its N-terminal region to Rhizobium
FT                   loti hypothetical protein mlr1837 SWALL:Q98JQ1
FT                   (EMBL:AP002998) (143 aa) fasta scores: E(): 2.3e-30, 68.08%
FT                   id in 141 aa, and similar in its full length to Ralstonia
FT                   solanacearum putative permease transmembrane protein
FT                   rsc0238 or rs00670 SWALL:Q8Y2U4 (EMBL:AL646058) (236 aa)
FT                   fasta scores: E(): 6.9e-20, 39.42% id in 208 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37889"
FT                   /db_xref="GOA:Q63N63"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N63"
FT                   /protein_id="CAH37889.1"
FT                   /translation="MKPNLPSLLTFNGGYVDTAGFLALQGLFTAHVTGNFVTLGATLVA
FT                   GSTGAIAKLLALPVFCGVVLAAGVARRLMLRAHAPALKILLGVQWLLLVAGAALAIRLG
FT                   PFANGDAWPAIATGMALVMAMAIQNAVHRLHLPDALPTTLMTGTVTQLMLHLSERIAGD
FT                   AAPVRGSPARLANMAWTVVTFALGCAAAALAYLLGGAWAFALPPVLIAFALFLGDERKL
FT                   EHAL"
FT   misc_feature    order(595447..595515,595558..595626,595663..595731,
FT                   595759..595818,595948..596016,596026..596079)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPSS0433 by TMHMM2.0 at aa 7-29, 44-66, 79-101, 111-130,
FT                   174-196 and 200-217"
FT   CDS_pept        complement(596139..597170)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0434"
FT                   /product="hypothetical protein"
FT                   /note="Low similarity to Xanthomonas axonopodis thioredoxin
FT                   reductase TrxB or xac1182 SWALL:AAM36054 (EMBL:AE011747)
FT                   (365 aa) fasta scores: E(): 9.5e-05, 28.67% id in 286 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37890"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N62"
FT                   /protein_id="CAH37890.1"
FT                   /translation="MNHLRNLLGHLKHTDDFAAYRLPHDLIERACRYGSLVRVERGATL
FT                   CASGARSDALYVVLDGATRCLPHARLPLPCGIDHGPGTFTGELDLLNDVGCEVTVVASS
FT                   ACRLARIERATLRHLLRREPALRDVLVRVFLLRRIGALASGAADTPLRERGAEPAFDVA
FT                   IVGSGAAGMIAAAHAASLRLNTVVAEGRLPFGIDDEFASAAPPARRQFGPFLTLRDHTV
FT                   RLDCNAYPFRLVTRGGERLRAHAVVIASSLRPEYSPRRARVTLRANTEWLDGAVDVDDD
FT                   GFVRTGRAASGTTLAAAFESSQPGVFAIGAVRAGPRRSALGELTEGAVVVDAIRRFIRA
FT                   SAV"
FT   misc_feature    complement(596796..597074)
FT                   /note="Pfam match to entry PF00027 cNMP_binding, Cyclic
FT                   nucleotide-binding domain , score 22.0, E-value 0.00093"
FT   CDS_pept        597509..598435
FT                   /transl_table=11
FT                   /locus_tag="BPSS0435"
FT                   /product="putative AraC-family transcriptional regulator"
FT                   /note="C-terminus is similar to the C-terminal regions of
FT                   Rhizobium loti probable transcriptional regulator mll0489
FT                   SWALL:Q98MP6 (EMBL:AP002995) (313 aa) fasta scores: E():
FT                   5.7e-24, 36.29% id in 259 aa, and Pseudomonas aeruginosa
FT                   probable transcriptional regulator pa2696 SWALL:Q9I0E6
FT                   (EMBL:AE004697) (297 aa) fasta scores: E(): 5.5e-20, 34.07%
FT                   id in 226 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37891"
FT                   /db_xref="GOA:H7C758"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:H7C758"
FT                   /protein_id="CAH37891.1"
FT                   /translation="MNCTDLAPTSLREAFRGATIETIDARVEGHASVVLTRVRHAAHGF
FT                   GFVEFMPPADGYLVGMSLTPPAARAPRAAPDAAADADGDADAPHRAACVAVQILQDDEP
FT                   FRADLLQPFDMLFHALPRRTLAELAADLRMGGVRELASPAGGRDAVLQSLVGVLLAASA
FT                   GSSARSPLLAGHVARAMQIHIVQQYGVAAPSTPAKGGLAGWQLERAKAILTENIAGEVP
FT                   ISQVASACGLSRSYFIKAFRQTVGTTPHRWLLEHKIERVKRSLLSQSAPIADIAHQCGF
FT                   SDQAHLTRVFTSMIGTPPAAWRRVNRP"
FT   misc_feature    598121..598255
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT   misc_feature    598133..598270
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family , score
FT                   54.1, E-value 2e-13"
FT   misc_feature    598169..598234
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1416.000, SD 4.01 at aa 221-242, sequence
FT                   VPISQVASACGLSRSYFIKAFR"
FT   misc_feature    598277..598405
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT   misc_feature    598289..598420
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family , score
FT                   38.3, E-value 1.1e-08"
FT   CDS_pept        complement(598494..599396)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0436"
FT                   /product="putative AraC-family regulatory protein"
FT                   /note="Similar to Rhizobium leguminosarum putative
FT                   arac-like transcriptional regulator SWALL:Q93EA6
FT                   (EMBL:AF361470) (303 aa) fasta scores: E(): 1.6e-38, 38.92%
FT                   id in 298 aa, and to Rhizobium leguminosarum putative
FT                   arac-like transcriptional regulator SWALL:Q93EA7
FT                   (EMBL:AF361470) (306 aa) fasta scores: E(): 3.7e-14, 26.88%
FT                   id in 305 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37892"
FT                   /db_xref="GOA:Q63N60"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N60"
FT                   /protein_id="CAH37892.1"
FT                   /translation="MSSPARHSPPQTITKDSLGCTSSGFLTDIERETALLRFYRKHTTG
FT                   LRLEQVSTPASGRGVLIGISLSGGHRRKILRGRRSVTHDFRADSVYVRDFSEDYRADMM
FT                   SDFDFALVELSPSFIDGLAERGRPARIAGVAPTLAHDDRLLGELGRALALALQSGDAAD
FT                   AMLVDQLGIAIGTHAMHAYGGLRADETKQRRRLSAPLERRAKEMLAAGATSVDEIARAC
FT                   RVSRGYFINAFSATTGKTPHQWLIEQRIEAAKRLLAHGDWTLARIAEHCGFSSQSHFTQ
FT                   SFAKAIGLPPGAWRRRARA"
FT   misc_feature    complement(598509..598640)
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family , score
FT                   55.6, E-value 6.8e-14"
FT   misc_feature    complement(598524..598652)
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT   misc_feature    complement(598659..598787)
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family , score
FT                   38.2, E-value 1.2e-08"
FT   CDS_pept        complement(599746..600948)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0437"
FT                   /product="putative transporter protein"
FT                   /note="Similar to Rhizobium loti hypothetical protein
FT                   mll3464 SWALL:Q98G70 (EMBL:AP003002) (405 aa) fasta scores:
FT                   E(): 1.3e-54, 44.63% id in 401 aa, and to Xanthomonas
FT                   campestris MFS transporter xcc0495 SWALL:AAM39811
FT                   (EMBL:AE012146) (396 aa) fasta scores: E(): 3.3e-42, 39.23%
FT                   id in 390 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37893"
FT                   /db_xref="GOA:Q63N59"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N59"
FT                   /protein_id="CAH37893.1"
FT                   /translation="MNANLASSATAGPVPQMARGLILLFAFSCGAIVANLYYAQPIIAL
FT                   IAPDLHMSGGMASLIVSLTQIGYAAGLFFLVPLGDLVENKKLMVVTALTSIASLALAAT
FT                   VRAPGLFLAVSLIVGFSSVAVQLLIPLAAHLAPSESRGRVVGTIMSGLLLGILLSRPVA
FT                   SFIADHFGWRAVFAFGAATMAVVTVLLMLTVPSRRPAHQATYMQLIRSLGRLVATQPAL
FT                   RERSLYQGLMFGSFSLFWSAAPVELMHRHHLSQSAIALFSLVGAMGASSAPIAGRLADA
FT                   GHTGRATVVALGLAAASFAPALFVPGAGVAGLVATGILLDFAVQMNMVLGQREIYALDA
FT                   HSRNRLNSIYMTSIFVGGAIGSALASALYEHGGWTWIAIVGALFPLAALARFAFASRAA
FT                   R"
FT   misc_feature    complement(599752..600885)
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter , score -109.7, E-value 0.00055"
FT   misc_feature    complement(order(599764..599832,599845..599913,
FT                   599977..600045,600112..600180,600361..600429,
FT                   600457..600525,600544..600612,600622..600690,
FT                   600724..600792,600820..600888))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BPSS0437 by TMHMM2.0 at aa 21-43, 53-75, 87-109, 113-135,
FT                   142-164, 174-196, 257-279, 302-324, 346-368 and 373-395"
FT   CDS_pept        601354..602265
FT                   /transl_table=11
FT                   /locus_tag="BPSS0438"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   transcription regulator protein rsp0910 or rs01682
FT                   SWALL:Q8XRE4 (EMBL:AL646081) (309 aa) fasta scores: E():
FT                   5.5e-53, 49.5% id in 303 aa, and to Pseudomonas aeruginosa
FT                   probable transcriptional regulator pa0056 SWALL:Q9I776
FT                   (EMBL:AE004445) (306 aa) fasta scores: E(): 3.5e-30, 35.43%
FT                   id in 302 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37894"
FT                   /db_xref="GOA:Q63N58"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N58"
FT                   /protein_id="CAH37894.1"
FT                   /translation="MDKLLALQTFAVVADTGGFSKAARQLGTATSSVTRLMDALEASLG
FT                   VTLLTRTTRHVTLTDAGATYLEQVGALLSQLVEADESVADAGGEPVGTLRVSVPVTYAR
FT                   IVLGPHLSAFLDAYPRVSLDLAVSDAYLDLATDRIDVAVRIGEPSRDPGLVVRGLAPNR
FT                   RIVVASRDYLDRMGTPAAPGDLAAHRCLRFPYRQGRQSWTFSRDGHSEKIDVGGRLTAN
FT                   SLDILREGVLSGQGVALVPMWLVHDDIVAGRLLPLFESWCVTPPGGDAQVYAAYLPNRR
FT                   HSRKVQTFIAFLAQRMPGAPGR"
FT   misc_feature    601363..601542
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family , score
FT                   73.4, E-value 3.1e-19"
FT   misc_feature    601402..601467
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1147.000, SD 3.09 at aa 17-38, sequence
FT                   GGFSKAARQLGTATSSVTRLMD"
FT   misc_feature    601405..601497
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    601612..602247
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain , score 167.3, E-value 1.6e-47"
FT   CDS_pept        complement(602395..603081)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum putative hydrolase
FT                   protein rsc0242 or rs00674 SWALL:Q8Y2U0 (EMBL:AL646058)
FT                   (228 aa) fasta scores: E(): 2.4e-77, 85.9% id in 227 aa,
FT                   and to Rhizobium meliloti putative hydrolase ra0202 or
FT                   sma0376 SWALL:Q930J3 (EMBL:AE007213) (229 aa) fasta scores:
FT                   E(): 5.6e-68, 78.94% id in 228 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37895"
FT                   /db_xref="GOA:Q63N57"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N57"
FT                   /protein_id="CAH37895.1"
FT                   /translation="MSDPKLEVLTPHNSQLIFIDQQPQMAFGVQSIDRQTLKNNVVGLA
FT                   KAAKIFNVPTTITTVESESFSGFTYPELLDVYPDHKLLERSSMNSWDDQKVRDALKANG
FT                   RKKVVVSGLWTEVCNTTFALCAMAEGGYEIYMVADASGGTSKDAHDYAMQRMIQAGVVP
FT                   VTWQQVLLEWQRDWAHRDTYDAVMTLVKEHSGAYGMGVDYAYTMVHKAAQRTANAHDML
FT                   APVPAR"
FT   misc_feature    complement(602566..603057)
FT                   /note="Pfam match to entry PF00857 Isochorismatase,
FT                   Isochorismatase family , score -12.8, E-value 0.00011"
FT   CDS_pept        603608..603922
FT                   /transl_table=11
FT                   /locus_tag="BPSS0440"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Xanthomonas campestris hypothetical
FT                   protein xcc2052 SWALL:Q8P914 (EMBL:AE012311) (102 aa) fasta
FT                   scores: E(): 9.2e-19, 62.13% id in 103 aa, and to Rhizobium
FT                   leguminosarum hypothetical 10.3 kDa protein SWALL:Q93EB2
FT                   (EMBL:AF361470) (96 aa) fasta scores: E(): 7.9e-15, 56.38%
FT                   id in 94 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37896"
FT                   /db_xref="InterPro:IPR009872"
FT                   /db_xref="InterPro:IPR020017"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N56"
FT                   /protein_id="CAH37896.1"
FT                   /translation="MKVYVLSLAMGLLVGVIYGVFNVRSPAPPVIALVGLLGILAGEQV
FT                   PPLVKRLAGRAETSTTWFQHQVKPHMFGQLPSCPKAPDAPAQVAAARPPASRSGDTHHG
FT                   "
FT   misc_feature    join(603608..603652,603695..603754)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPSS0440 by TMHMM2.0 at aa 13-35 and 50-69"
FT   CDS_pept        603915..605813
FT                   /transl_table=11
FT                   /locus_tag="BPSS0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Agrobacterium tumefaciens hypothetical
FT                   protein atu3982 or agr_l_1745 SWALL:Q8U8V6 (EMBL:AE009329)
FT                   (625 aa) fasta scores: E(): 1.1e-204, 79.32% id in 624 aa,
FT                   and to Ralstonia solanacearum hypothetical protein rsc0239
FT                   or rs00671 SWALL:Q8Y2U3 (EMBL:AL646058) (612 aa) fasta
FT                   scores: E(): 7e-154, 65.59% id in 625 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37897"
FT                   /db_xref="GOA:Q63N55"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N55"
FT                   /protein_id="CAH37897.1"
FT                   /translation="MADTAARPTPDLILHRGRFTTLDRAHPLASAVAIKDGRFVAVGGD
FT                   EILASAGPATRIVDLQGKGVLPGLIDNHLHIIRGGLNFNMELRWDGVRSLADAMAMLRR
FT                   QVAVTPAPQWVRVVGGFTEHQFAEKRLPTIDELNAAAPDTPVFILHLYDRALLNGAALR
FT                   AVGYTKDTPEPPGGQIVRDAAGNPTGLLLARPNAAILYATLAKGPKLPFDYQLNSTRHF
FT                   MRELNRLGVTGAIDAGGGFQNYPDDYAVIERLAKDGQLTIRLAYNLFTQKPKEEKQDFL
FT                   NWTASSTYHDGTDYFRHNGAGEMLVFSAADFEDFREPRPDLPAQMEGELEAVVRVLAQN
FT                   RWPWRLHATYDETIRRALDVFERVNRDIPLAGLNWFFDHAETISDESIDRIAALGGGIA
FT                   VQHRMAYQGEYFVERYGAAAAEATPPVARMLERGVNVSAGTDATRVASYNPWVSLAWLV
FT                   TGKTVGGMSLYPRANCIDRETALRMWTEHVTWFSNEVGKKGRIQVGQLADLIVPDRDFF
FT                   ACPESDIADTTSLLTVVGGKVVYGAGPFADLDEGAPPPAMPDWSPARTFGGYAGWADRE
FT                   GGAPLQQVVRQAAQSCACANSCGVHAHRHASAWGSSLPVADLKSFWGALGCSCWAV"
FT   misc_feature    605277..605300
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        605992..607227
FT                   /transl_table=11
FT                   /locus_tag="BPSS0442"
FT                   /product="hypothetical protein"
FT                   /note="C-terminal region similar to C-terminal region of
FT                   Xanthomonas campestris hypothetical protein xcc2051
FT                   SWALL:Q8P915 (EMBL:AE012311) (403 aa) fasta scores: E():
FT                   4e-61, 63.57% id in 280 aa, and similar in its C-terminal
FT                   region to the full length of Bradyrhizobium japonicum
FT                   protein blr4261 SWALL:BAC49526 (EMBL:AP005950) (310 aa)
FT                   fasta scores: E(): 1.4e-60, 59.04% id in 293 aa, N-terminal
FT                   region similar to Streptomyces coelicolor hypothetical
FT                   protein sco0467 or scf76.07 SWALL:Q9RJG7 (EMBL:Q9RJG7)
FT                   blastp scores: Score = 49.2 bits (115), Expect = 1e-04
FT                   Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps =
FT                   1/55 (1%)"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37898"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N54"
FT                   /protein_id="CAH37898.1"
FT                   /translation="MHARDAIVRACPRDPGFNERLLEAYALGIAHRPQTMFRTLGADVL
FT                   DRRAPNDRRLNLADSCPAPAGFTGRTERGTERRARAARVGPACRTLFTLIGSSMQTRRL
FT                   AVRSALWGAALMFGLAQAPAAFADAAAEAAAPARAAASAPAVSVGPQYDTTHVYVAASD
FT                   LDAFVDSFVATFGGKASPRVTLTVTPTPSETLSQYVQTPVGMLSVFGFKTPVPYPFGAE
FT                   RTGYLVTDLDAAVKAARAAGADLVVDSFDDPIGRDAVVRWPGGVMMQLYWHRKAPSYAP
FT                   LATVPDNRVYLSPYEADRFVTSWMRFSHGKVVADDRRGDGGAIGRPGTDVRRIVIESGF
FT                   GRVVAFVTDGKLPYPYGRETTGYAVADLDAVLDKAKAAGVEVLAQPYRTRAGRTAMLAF
FT                   PGGYLAEVHDAK"
FT   misc_feature    606679..606828
FT                   /note="Pfam match to entry PF00903 Glyoxalase,
FT                   Glyoxalase/Bleomycin resistance protein/Dioxygenase
FT                   superfamily , score 9.9, E-value 0.01"
FT   CDS_pept        607554..608903
FT                   /transl_table=11
FT                   /locus_tag="BPSS0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Xanthomonas campestris hypothetical
FT                   protein xcc2050 SWALL:AAM41339 (EMBL:AE012311) (463 aa)
FT                   fasta scores: E(): 4.3e-106, 57.7% id in 435 aa, and to
FT                   Zymomonas mobilis hypothetical 54.0 kDa protein
FT                   SWALL:Q9RQC9 (EMBL:AF117351) (483 aa) fasta scores: E():
FT                   1.2e-07, 24.41% id in 340 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37899"
FT                   /db_xref="InterPro:IPR025388"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N53"
FT                   /protein_id="CAH37899.1"
FT                   /translation="MQPGVRPGASCAKTRPAILFNRWQEDWSALADPCVPRRPLDALKY
FT                   VPLFGRVDSYLSLGAGLRERLEVNDAPLFGLGRARGDTYVLQRVQVHADLRIAGHVQAF
FT                   VQLEDARPFGKDNVGPVDRNRVDLRQAFVTYVDAIGSGAFKARVGRQEMAFDLQRFVSV
FT                   RDGPNVRQAFDGIWADWEQGPWRLIGYATQPVQYRDDGAFDDVSNRNLTFSGVRIERQR
FT                   VGPGDLSAYYSRYNRTQAQFLDGAGGEHRDVFDVRYAGKRRNVDWDIEGMYQTGRVGAQ
FT                   RIEAWAVGSLAGYTFAGVGWMPRIGLQVDAASGDRRPRDGRIETFNPLFPNGYYFALAG
FT                   YTGYTNLIHVKPSLTLKPSSALTLLAAVGLQWRATTADAVYAQGATPVPGTAGRGGNWT
FT                   GFYTQLRADWAVTANLAAALEVVHFQIGDALRAAGGRNADYVGAELKFGW"
FT   CDS_pept        609469..610290
FT                   /transl_table=11
FT                   /gene="cpo"
FT                   /gene_synonym="cpoF"
FT                   /locus_tag="BPSS0444"
FT                   /product="non-heme chloroperoxidase"
FT                   /EC_number="1.11.1.10"
FT                   /note="Similar to Pseudomonas fluorescens non-heme
FT                   chloroperoxidase Cpo or CpoF SWALL:PRXC_PSEFL
FT                   (SWALL:O31158) (273 aa) fasta scores: E(): 2.3e-73, 67.77%
FT                   id in 270 aa, and to Burkholderia cepacia chloride
FT                   peroxidase SWALL:Q8VT61 (EMBL:AF335493) (273 aa) fasta
FT                   scores: E(): 1.2e-86, 78.59% id in 271 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37900"
FT                   /db_xref="GOA:Q63N52"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N52"
FT                   /protein_id="CAH37900.1"
FT                   /translation="MDTITTKDGTRIFYKDWGAGRPVVFSHGWPLNADAWDAQMLFLAQ
FT                   RGYRAIAHDRRGHGRSGQPATGNDMDTYADDLAALLDALDLREATLVGHSTGGGEVARY
FT                   IGRHGSKRVAKAVLIGAVPPIMLQTEANPGGLPMEAFDGIRRGVAGNRSQFYRDVALPF
FT                   FGFNRPDAQVSQATIDAFWAQGMTGGILGQYACIREFSEVDYTADLKKIDVPTLILHGD
FT                   DDQMVPIDASARLSAKLVAGATLKVYPGGSHGICVTHADEVNADLLAFLAS"
FT   misc_feature    609610..610281
FT                   /note="Pfam match to entry PF00561 abhydrolase, alpha/beta
FT                   hydrolase fold , score 152.3, E-value 5.6e-43"
FT   CDS_pept        join(610317..610337,610340..610729,610737..610859)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPSS0445"
FT                   /product="putative LysR-family transcriptional regulator
FT                   (fragment)"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Ralstonia solanacearum probable transcription
FT                   regulator protein rsp1110 or rs02618 SWALL:Q8XQV8
FT                   (EMBL:AL646082) (315 aa) fasta scores: E(): 4.7e-25, 46.59%
FT                   id in 176 aa, and of Burkholderia cepacia putative
FT                   transcriptional regulator CeoR SWALL:Q8VL17 (EMBL:AY008288)
FT                   (334 aa) fasta scores: E(): 7.6e-25, 48.53% id in 171 aa.
FT                   CDS contains frameshift mutations after codons 7 and 138.
FT                   Note, feature lacks a translational start codon"
FT   misc_feature    610358..610708
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain , score 43.5, E-value 7.8e-12"
FT   misc_feature    610631..610654
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        611180..611809
FT                   /transl_table=11
FT                   /locus_tag="BPSS0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Xanthomonas axonopodis hypothetical
FT                   protein xac0432 SWALL:Q8PQ96 (EMBL:AE011670) (226 aa) fasta
FT                   scores: E(): 1.2e-40, 57.61% id in 210 aa, and to
FT                   Pseudomonas aeruginosa hypothetical protein pa4017
FT                   SWALL:Q9HX10 (EMBL:AE004818) (213 aa) fasta scores: E():
FT                   4.1e-21, 42.1% id in 209 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37902"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N51"
FT                   /protein_id="CAH37902.1"
FT                   /translation="MKLLLVGSTGLVGRHVLELALADPRVDGVTALARRALPAHPKLHA
FT                   LRVDFDRLPEDAPWWRADAAICTLGTTMRAAGSRPAFRRVDHDYPLEVARIARRHGTPT
FT                   YVLNSALGADPSSRFFYNRVKGELERDLAGLGFASFTAVRPGLIGGQRDAFRAGERAAV
FT                   LALTLFGPLLPRGWRLNPAQRIAGALLDAALNPAPGLHVVASDQLV"
FT   CDS_pept        612507..613112
FT                   /transl_table=11
FT                   /locus_tag="BPSS0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YddH or b1462 SWALL:YDDH_ECOLI (SWALL:P76121) (189 aa)
FT                   fasta scores: E(): 2.5e-22, 38.42% id in 190 aa, and to
FT                   Xanthomonas campestris hypothetical protein xcc3203
FT                   SWALL:AAM42473 (EMBL:AE012437) (193 aa) fasta scores: E():
FT                   6.4e-08, 28.49% id in 179 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37903"
FT                   /db_xref="GOA:Q63N50"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N50"
FT                   /protein_id="CAH37903.1"
FT                   /translation="MNSHIAAVDLKKAYRLINHGPTVLVSAHHDGVDNVMAAAWACALD
FT                   FSPPKLTVVLDKAAKTRELIEQSGRFVIQVPTAAQLQLTQEVGSHSLASRPDKLRRAGV
FT                   ELFSIDGHDAPFVAGCSAWLACTLVREPHNQQAYDLFIGEVDAAWSDTRAFKNGRWQFE
FT                   QADPAWRSLHHVAGGHFYAIGEALSAREADRHDAEAAL"
FT   misc_feature    612546..612998
FT                   /note="Pfam match to entry PF01613 Flavin_Reduct, Flavin
FT                   reductase like domain , score 16.5, E-value 1.3e-06"
FT   CDS_pept        complement(613249..613701)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0448"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37904"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N49"
FT                   /protein_id="CAH37904.1"
FT                   /translation="MPHASRGGIRETAHAIRSEEPKECTMSSDILYTDSEISSSPSAFS
FT                   TRFAYDSDWVAANNSINTSLIFKHNLKCIPYPLCLFFSPDQEAVYPLIWNYYGPNAGNP
FT                   VSIKLDQTKVTLSIGSGIPLHGYFDPQTGGWTYWRSGFFRVTIPSQ"
FT   CDS_pept        complement(613963..615297)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0449"
FT                   /product="putative GntR-family regulatory protein"
FT                   /note="Similar to Rhodobacter sphaeroides hypothetical
FT                   transcriptional regulator in rdxA 3'region SWALL:YRDX_RHOSH
FT                   (SWALL:Q01856) (456 aa) fasta scores: E(): 1.1e-45, 37.81%
FT                   id in 439 aa, and to Pseudomonas aeruginosa probable
FT                   transcriptional regulator pa2100 SWALL:Q9I215
FT                   (EMBL:AE004637) (477 aa) fasta scores: E(): 6.5e-43, 35.46%
FT                   id in 423 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37905"
FT                   /db_xref="GOA:Q63N48"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N48"
FT                   /protein_id="CAH37905.1"
FT                   /translation="MAHARYKRLVDTLAADIRSGRLPPGARLPTHRKLAAAEGLALVTA
FT                   TRVYAELEAMGLVSGETGRGTFVRETALPRGLGVDQHASAAGVVDLAFNYPSLPEQAEL
FT                   LRGALRQLASSGDLDALLRYQPHGGRWHERASVARHLARRGLSVDAQRVAIVNGAQHGL
FT                   AVTAMALLRPGDVVAVDALTYPGFKVVADAQHLELAPLPASGQGPDPDALERLCRTRRV
FT                   RAVYTMPTLHNPLGWVTSAHRRRRLVAIARRHGLLIIEDGAYAFLADDPPEPIAALAPE
FT                   ATVYVSGLSKNVATGLRVGFVAAPEPWAPAIERAIRGTTWNTPGVMTAIACGWLDDGTV
FT                   ERLEADKRRDAAARQAIASEAFAGLRCIRHPASYFVWLPLADDARADRVAMTLMRERVA
FT                   VSTAEPFATSAHAPHAIRVALGSVDPPTLRDALGKVRRAIDAHSY"
FT   misc_feature    complement(613981..614880)
FT                   /note="Pfam match to entry PF00155 aminotran_1_2,
FT                   Aminotransferase class I and II , score 24.7, E-value
FT                   5.1e-08"
FT   misc_feature    complement(615094..615273)
FT                   /note="Pfam match to entry PF00392 gntR, Bacterial
FT                   regulatory proteins, gntR family , score 53.0, E-value
FT                   4.2e-13"
FT   CDS_pept        615386..616003
FT                   /transl_table=11
FT                   /locus_tag="BPSS0450"
FT                   /product="DJ-1/PfpI family protein"
FT                   /note="Similar to Methanosarcina mazei transcriptional
FT                   regulator, AraC family mm3310 SWALL:AAM33006
FT                   (EMBL:AE013592) (209 aa) fasta scores: E(): 6.8e-05, 26.92%
FT                   id in 208 aa, and to parts of Xanthomonas campestris
FT                   thiJ/pfpI family protein xcc3565 SWALL:AAM42835
FT                   (EMBL:AE012477) (257 aa) fasta scores: E(): 5.9e-07, 29.37%
FT                   id in 177 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37906"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N47"
FT                   /protein_id="CAH37906.1"
FT                   /translation="MHIAILTFEGFNELDSLIALGVLNCVKKPGWRVSIASPTPRVCSM
FT                   NGVAIDAQASLREANDADAVLVGSGMRTREIIADAALLAQLRLDASRQLLGAQCSGTLV
FT                   LAKLGLLDGVPACTDLTTKPWVQEAGVDVLNRPFYANGNVATAGGCLASHYLAAWVIAR
FT                   LEGRQAAERALHYVAPVGEKEAYVSRAMAHVTPYLAVSATAA"
FT   misc_feature    615386..615880
FT                   /note="Pfam match to entry PF01965 DJ-1_PfpI, DJ-1/PfpI
FT                   family , score 15.5, E-value 6.2e-05"
FT   CDS_pept        complement(616361..617449)
FT                   /transl_table=11
FT                   /locus_tag="BPSS0451"
FT                   /product="family S11 unassigned peptidase"
FT                   /note="C-terminal region is similar to Escherichia coli,
FT                   and Shigella flexneri penicillin-binding protein 7
FT                   precursor PbpG or b2134 or sf2219 or s2348 SWALL:PBP7_ECOLI
FT                   (SWALL:P33364) (313 aa) fasta scores: E(): 2.9e-36, 46.69%
FT                   id in 272 aa. Full length CDS is similar to Ralstonia
FT                   solanacearum putative D-alanyl-D-alanine-endopeptidase
FT                   rsc1609 or rs03972 SWALL:Q8XYZ7 (EMBL:AL646065) (375 aa)
FT                   fasta scores: E(): 1.2e-51, 47.82% id in 345 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37907"
FT                   /db_xref="GOA:Q63N46"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N46"
FT                   /protein_id="CAH37907.1"
FT                   /translation="MCEFVLRTSKRTVLPIVLASALAVPSFGAQARSSVSKRHAAAAAS
FT                   IRTASFHPQSGHTPLARHALASRHLKAGRYRLAGGMRRVAFSPRAPLGGRAFEPRDASQ
FT                   SFGLRSNIVYMVDQHTGETLFDRNSRSVVPIASVTKLMTAMVVLDSNAPLDERIEVTDD
FT                   DRDQDKFTGSRLAIGSALSRDDMLHIALMASENRAAAALSRYYPGGREAFVDAMNRKAR
FT                   SLGMVDTYFENPTGLSKHNVSSARDLAKMVEAAYQYPLIRQYSTDLKYDVDTGLRTLYY
FT                   HSTNVLLRDNAWNIGVQKTGYIKESGICLVMQTTIDGRDVVMVLLDSAGRHSDFFDAAR
FT                   LRTMLTSGAAHVTEANSATSGN"
FT   misc_feature    complement(616391..617203)
FT                   /note="Pfam match to entry PF00768 Peptidase_S11,
FT                   D-alanyl-D-alanine carboxypeptidase , score 194.4, E-value
FT                   1.2e-55"
FT   CDS_pept        618584..620524
FT                   /transl_table=11
FT                   /locus_tag="BPSS0452"
FT                   /product="putative phosphoesterase"
FT                   /note="Similar in its N-terminal region to
FT                   Thermoanaerobacter tengcongensis DNA polymerase IV Pol4 or
FT                   tte2516 SWALL:Q8R7A2 (EMBL:AE013193) (570 aa) fasta scores:
FT                   E(): 3.1e-74, 43.36% id in 565 aa, and to Bacillus
FT                   halodurans DNA-dependent DNA polymerase beta chain bh3107
FT                   SWALL:Q9K899 (EMBL:AP001517) (571 aa) fasta scores: E():
FT                   5.3e-63, 38.21% id in 581 aa. Note: This CDS presents no
FT                   similarity to any of the database matches in its C-terminal
FT                   region (from approx. residue 577 onwards)"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37908"
FT                   /db_xref="GOA:Q63N45"
FT                   /db_xref="InterPro:IPR002008"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N45"
FT                   /protein_id="CAH37908.1"
FT                   /translation="MPIHNADFAAVFAEIADLLEIQGANPFRVRAYRNAARTIGGLGRD
FT                   IGALIAAGRSLDDIPTIGADLAGKLREIATTGTCALQRQLRGALPAAIVELLGVPGLGA
FT                   KRVRALHDALGVETLEQLKTAAEHGKIRGLPGFGEKTEAHIAEAIGARLRRKSQRFLLS
FT                   FATQYLTPLLTYLRETPGVSEAVAAGSFRRRRESVGDLDIVVTSGDPAKVSARFVEYGE
FT                   VARVLASGDTRSSVVLRCGIQADLRVVSPAALGAALVYFTGSKAHNIAMRRIAQARDLK
FT                   INEYGVFDGERRIAGATEESVYASIGLAWVPPELRENRGEIEAAREGRLPALVERKHLR
FT                   GDLHAHTNATDGRDSLRDMALEARKRGLDYLAITDHACGPGVAHGLDAERLARQIDEID
FT                   RLNETLDGIVLLKGIEVDILEDGSLDLPDGVLARLDLVVGAVHGHFDLSRAAQTERVLR
FT                   AMDHPYFSILAHPSGRLLGERDACDIDLARVIEHARARGCHLELNAQPQRLDLADVWCR
FT                   HAAEAGVLVSIDSDAHRREDLGHLGIGVDQARRGWLTKAQVLNTRTLAQLRPLLARTMG
FT                   GGAMSVSASEPAPVPAPVSASKSASASTSTSTSTSASTGASRKRSSGKRDTAGSAEGGA
FT                   RRTKKTRRPPA"
FT   misc_feature    619604..619837
FT                   /note="Pfam match to entry PF02231 PHP_N, PHP domain
FT                   N-terminal region , score 91.6, E-value 1e-24"
FT   misc_feature    619901..620200
FT                   /note="Pfam match to entry PF02811 PHP_C, PHP domain
FT                   C-terminal region , score 29.4, E-value 5.4e-06"
FT   CDS_pept        620793..621200
FT                   /transl_table=11
FT                   /locus_tag="BPSS0453"
FT                   /product="putative exported protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37909"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N44"
FT                   /protein_id="CAH37909.1"
FT                   /translation="MSYWRKLFVIVLLVLSLPVQTLAAVSMNCDPAPADDGGAPAHAWL
FT                   QASAENGHGMHDAAAADDGHRHDGRGGAHHDHAHACPTCLSCCVGAGLPAASVAAASFD
FT                   AARPRLFLPRDTRAVSFLTGGIERPPRTSLV"
FT   misc_feature    620793..620861
FT                   /note="Signal peptide predicted for BPSS0453 by SignalP 2.0
FT                   HMM (Signal peptide probability 0.984) with cleavage site
FT                   probability 0.835 between residues 29 and 30"
FT   CDS_pept        621293..621589
FT                   /transl_table=11
FT                   /locus_tag="BPSS0454"
FT                   /product="putative exported protein"
FT                   /note="No significant database matches"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37910"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N43"
FT                   /protein_id="CAH37910.1"
FT                   /translation="MRKISAALLGASAAWPALVHATTAFADPADAAASVPAIVAPSALD
FT                   DYRRYRDDDGPNWPQLNREVAPRPRKAAAAPAGADGGAAAGAHGHGAMHGGAE"
FT   misc_feature    621293..621370
FT                   /note="Signal peptide predicted for BPSS0454 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.789 between residues 26 and 27"
FT   CDS_pept        621586..623250
FT                   /transl_table=11
FT                   /locus_tag="BPSS0455"
FT                   /product="putative copper resistance-related lipoprotein"
FT                   /note="Similar to Agrobacterium tumefaciens copper
FT                   tolerance protein CopB or atu3992 or agr_l_1720 WALL:Q8U8U6
FT                   (EMBL:AE009330) (492 aa) fasta scores: E(): 1.1e-42, 40.04%
FT                   id in 482 aa, and to Rhizobium meliloti hypothetical
FT                   protein ra0562 or sma1037 SWALL:Q92ZC8 (EMBL:AE007246) (488
FT                   aa) fasta scores: E(): 3.4e-42, 39.17% id in 485 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37911"
FT                   /db_xref="GOA:Q63N42"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N42"
FT                   /protein_id="CAH37911.1"
FT                   /translation="MTARFVSLRIGAAAAVLAFAAGCTTFSRDGGFGAVSSAAAERLGQ
FT                   DAVLVKTDADRDAVARRTQALLSKPLGIDDAVQIALLNNRGLQASYAELGLSEADLVQA
FT                   GRLPNPGFTFSRTHSSNDLSIGRTFSMSVLSMLTLPLATKIEGRRFEQTKLETADAMLK
FT                   VAADTRRAYVEAVAAAQAATYAEQVKDSADAGAELALRMRRAGNFSRLDYAREQAFYAD
FT                   AVAQLANARLRAVAAREKLTRAMGLWGASAGYELPERLPELPAERPRLDDVERFAMDHR
FT                   LDIRAAKLRTQGVASSLGLTQATRFVNALELGYLDNYETDKGHEHGYEISVEIPLFDWG
FT                   GAKVARAKAAYLQSANRLAQTAIDARSEVRESYAAYVTRYDIAKHYRDEVVPLRKTISD
FT                   EMLLRYNGMLVSVFELLADARDQIGAVNAYIDALKDYWLAQADLQQAVGGRLPRGAQAA
FT                   SEPPAATPASAAAAGARAAAVASGAAAPASEATSVSSSASVSTSASASMPATTPASTAA
FT                   SAPALASPRAIATAVSSHAHEPASLSGAVPLTNSKGQ"
FT   misc_feature    621586..621702
FT                   /note="Signal peptide predicted for BPSS0455 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.627 between residues 39 and 40"
FT   misc_feature    621622..621654
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    621802..622356
FT                   /note="Pfam match to entry PF02321 OEP, Outer membrane
FT                   efflux protein , score 30.9, E-value 1.9e-06"
FT   misc_feature    622393..622962
FT                   /note="Pfam match to entry PF02321 OEP, Outer membrane
FT                   efflux protein , score 36.9, E-value 3e-08"
FT   misc_feature    623247..623330
FT                   /note="Signal peptide predicted for BPSS0456 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.919 between residues 28 and 29"
FT   CDS_pept        623253..624548
FT                   /transl_table=11
FT                   /locus_tag="BPSS0456"
FT                   /product="putative exported copper oxidase"
FT                   /note="Similar to Bradyrhizobium japonicum multicopper
FT                   oxidase CopA or bll2210 SWALL:BAC47475 (EMBL:AP005942) (445
FT                   aa) fasta scores: E(): 5.9e-124, 70.99% id in 424 aa, and
FT                   low to the plasmid-borne Escherichia coli copper resistance
FT                   protein A precursor PcoA SWALL:PCOA_ECOLI (SWALL:Q47452)
FT                   (605 aa) fasta scores: E(): 2e-12, 26.94% id in 386 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37912"
FT                   /db_xref="GOA:Q63N41"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N41"
FT                   /protein_id="CAH37912.1"
FT                   /translation="MVSRRTFLGGSGAALLGAALVSKAGAASLPEAPTMAKAATQPPLA
FT                   PPNGRPYTPVVTLNGWTLPWRMKNGWKEFHLIAEPVVRELAPGMNAHLWGYNGQTPGPT
FT                   IEAVEGEKVRVFVTNRLPEHTTVHWHGMLLPCGMDGVGGLTQPHIPPGKTFVYEFQLEK
FT                   AGTFMYHPHADEMVQMAMGMMGTFIVHPKDRGAMPADRDFVFLMSAYDIDPGSFTPRVN
FT                   EMTDFNMWTWNARVFPGIDPLPVRAGDRVRIRFGNLTMTNHPIHLHGYAFEVAGTDGGW
FT                   IAPAARWPEVTVDVAVGQMRAIEFTANRPGDWAFHCHKSHHTMNAMGHQVPNLIGVPQQ
FT                   DLAKRINKLVPDYMAMGSTGGAMGTMEMPLPENTLPMMTGTGPFGPLEMGGMFTVVKVR
FT                   QGLGRNDYRDPGWFRHPKGTVAYEYAGALPDD"
FT   misc_feature    623838..624281
FT                   /note="Pfam match to entry PF00394 Cu-oxidase, Multicopper
FT                   oxidase , score 31.7, E-value 1.1e-06"
FT   misc_feature    624198..624233
FT                   /note="PS00080 Multicopper oxidases signature 2."
FT   CDS_pept        624667..625023
FT                   /transl_table=11
FT                   /locus_tag="BPSS0457"
FT                   /product="putative exported protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   signal peptide protein rsp0929 or rs05404 SWALL:Q8XRC9
FT                   (EMBL:AL646081) (114 aa) fasta scores: E(): 2.3e-10, 45.76%
FT                   id in 118 aa, and to Rhizobium meliloti hypothetical signal
FT                   peptide protein r00588 or smc02284 SWALL:Q92S41
FT                   (EMBL:AL591784) (94 aa) fasta scores: E(): 8.3e-08, 52% id
FT                   in 75 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37913"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N40"
FT                   /protein_id="CAH37913.1"
FT                   /translation="MKNVLATIAIGCALAVSNAAHAAGEMSGMSGMDMQGGAPQAGAAH
FT                   VGMSHGEVKKVDTAAGKLTIKHGPLENLGMGAMTMVFKVKDPAMLSQVKAGDTIDFVAD
FT                   EVDGALTVVKLQKP"
FT   misc_feature    624667..624732
FT                   /note="Signal peptide predicted for BPSS0457 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.999 between residues 22 and 23"
FT   CDS_pept        625073..625453
FT                   /transl_table=11
FT                   /locus_tag="BPSS0458"
FT                   /product="putative copper-resistance exported protein"
FT                   /note="Similar to Yersinia pestis putative copper
FT                   resistance protein ypo1784 SWALL:Q8ZFD0 (EMBL:AJ414150)
FT                   (128 aa) fasta scores: E(): 5e-10, 40.51% id in 116 aa, and
FT                   to Escherichia coli copper resistance protein C precursor
FT                   PcoC SWALL:PCOC_ECOLI (SWALL:Q47454) (126 aa) fasta scores:
FT                   E(): 6.1e-05, 34.86% id in 109 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37914"
FT                   /db_xref="GOA:Q63N39"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N39"
FT                   /protein_id="CAH37914.1"
FT                   /translation="MKRIAHPKRAGLAALVAACAAIASAAAFAHGKLESAVPAPGGTVD
FT                   TAPDALRLTFNESLESAFSTVKIADAGGAPVAAPKAKVDAANPRVLTLAVPKLAPGAYT
FT                   VQWTVMTADAHKTKGSYAFKVK"
FT   misc_feature    625073..625159
FT                   /note="Signal peptide predicted for BPSS0458 by SignalP 2.0
FT                   HMM (Signal peptide probability 1.000) with cleavage site
FT                   probability 0.698 between residues 32 and 33"
FT   misc_feature    625112..625153
FT                   /note="PS00099 Thiolases active site."
FT   CDS_pept        625453..626397
FT                   /transl_table=11
FT                   /locus_tag="BPSS0459"
FT                   /product="putative copper-resistance membrane protein"
FT                   /note="Similar to Ralstonia solanacearum probable copper
FT                   resistance D transmembrane protein CopD or rsp0659 or
FT                   rs01790 SWALL:Q8XS22 (EMBL:AL646080) (309 aa) fasta scores:
FT                   E(): 2.3e-08, 30.88% id in 327 aa, and to Pseudomonas
FT                   syringae copper resistance protein D copD SWALL:COPD_PSESF
FT                   (SWALL:Q9KWM8) (311 aa) fasta scores: E(): 2.6e-08, 31.29%
FT                   id in 262 aa"
FT                   /db_xref="EnsemblGenomes-Gn:BPSS0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAH37915"
FT                   /db_xref="GOA:Q63N38"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:Q63N38"
FT                   /protein_id="CAH37915.1"
FT                   /translation="MNDGFLGMVRLAGVALQSVCFAIAVGVLLGDQWLARAASPWQAQV
FT                   GRRLARTLRLAALGMLLSSMLAFWVHCALMSETALWDAWPAVRSMLAGTGYGRAWLAGA
FT                   ALMLAVVGLSFARSGGDARVPFALWLALAGVALARSNGGHPVDAGLFSAPVWIDWLHLL
FT                   AISAWVGLVIVATYVVVPRLADARGGERRNGAAFVQSLSDAATFALVVLLSTGAYNGWR
FT                   GVGAPANLIGSAYGQVLLLKLGLVAFAAALGGHNRFFEMPALLAAFKAPPDARAFVRSL
FT                   RRFGVVLQVESVVLLGVIAAAAVLASSPLPGTL"
FT   misc_feature    order(625477..625545,625606..625674,625738..625797,
FT                   625816..625869,625927..625995,626032..626100,
FT                   626143..626211,626302..626370)
FT                   /note="8 probable transmembrane helices predicted for
FT                   BPSS0459 by TMHMM2.0 at aa 10-32, 53-75, 97-116, 123-140,
FT                   160-182, 195-217, 232-254 and 285-307"
FT