(data stored in SCRATCH zone)

EMBL: BX640411

ID   BX640411; SV 1; linear; genomic DNA; STD; PRO; 346359 BP.
XX
AC   BX640411;
XX
DT   09-AUG-2003 (Rel. 76, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 8)
XX
DE   Bordetella pertussis strain Tohama I, complete genome; segment 1/12
XX
KW   complete genome.
XX
OS   Bordetella pertussis
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Alcaligenaceae; Bordetella.
XX
RN   [2]
RP   1-346359
RA   Sebaihia M.;
RT   ;
RL   Submitted (06-AUG-2003) to the INSDC.
RL   Submitted on behalf of the Pathogen Sequencing Unit, Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA, E-mail:
RL   ms5@sanger.ac.uk
XX
RN   [3]
RA   Parkhill J., Sebaihia M., Preston A., Murphy L.D., Thomson N., Harris D.E.,
RA   Holden M.T.G., Churcher C.M., Bentley S.D., Mungall K.L.,
RA   Cerdeno-Tarraga A.M., Temple L., James K., Harris B., Quail M.A.,
RA   Achtman M., Atkin R., Baker S., Basham D., Bason N., Cherevach I.,
RA   Chillingworth T., Collins M., Cronin A., Davis P., Doggett J., Feltwell T.,
RA   Goble A., Hamlin N., Hauser H., Holroyd S., Jagels K., Leather S.,
RA   Moule S., Norberczak H., O'Neil S., Ormond D., Price C., Rabbinowitsch E.,
RA   Rutter S., Sanders M., Saunders D., Seeger K., Sharp S., Simmonds M.,
RA   Skelton J., Squares R., Squares S., Stevens K., Unwin L., Whitehead S.,
RA   Barrell B.G., Maskell D.J.;
RT   "Comparative analysis of the genome sequences of Bordetella pertussis,
RT   Bordetella parapertussis and Bordetella bronchiseptica";
RL   Nat Genet 35(1):0(2003).
XX
DR   MD5; c0c3fe5f3c1e7331954c51f3ab6e5cab.
DR   ENA-CON; BX470248.
DR   BioSample; SAMEA1705933.
DR   EuropePMC; PMC3488263; 22965118.
DR   EuropePMC; PMC4296508; 25411007.
DR   GOA; O30444.
DR   InterPro; IPR005501; LamB/YcsF/PxpA-like.
DR   InterPro; IPR011330; Glyco_hydro/deAcase_b/a-brl.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00504; Glycine.
DR   StrainInfo; 494022; 0.
DR   UniProtKB/Swiss-Prot; O30444; PXPA_BORPE.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..346359
FT                   /organism="Bordetella pertussis"
FT                   /strain="Tohama I"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:520"
FT   CDS_pept        1..1920
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="BP0001"
FT                   /product="glucose inhibited division protein A"
FT                   /note="Similar to Escherichia coli glucose inhibited
FT                   division protein A GidA or B3741 SW:GIDA_ECOLI (P17112)
FT                   (629 aa) fasta scores: E(): 2.9e-164, 68.680% id in 629 aa"
FT                   /db_xref="GOA:Q7W0T0"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0T0"
FT                   /protein_id="CAE40381.1"
FT                   /translation="MDFPREFDVIVVGGGHAGTEAALAAARAGAQTLLLTHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMAIATDEAGIQFRILNSSKGPAVRATRAQADRVLY
FT                   RNAIRAQLENQPNLWLFQQAVDDLMVQGDQVVGAVTQIGLRFRARTVVLTAGTFLNGLI
FT                   HVGLQNYSGGRAGDPPANSLGQRLKELQLPQGRLKTGTPPRIDGRSINYSVLEEQPGDL
FT                   DPVPVFSFLGKASMHPRQLPCWITHTNARTHEIIRGGLDRSPMYSGVIEGVGPRYCPSI
FT                   EDKIHRFADKASHQVFLEPEGLNTHEIYPNGVSTSLPFDVQYELIHSLPGLENAHILRP
FT                   GYAIEYDYFDPRALKSTLETKAISGLFFAGQINGTTGYEEAAAQGLLAGANAALQAQGK
FT                   EPWVPRRDEAYLGVLVDDLVTRGVTEPYRMFTSRAEYRLSLREDNADLRLTEIGRRLGL
FT                   VDDVRWDAFSRKRDAVAQEVERLKSTWVNPRVLPAHAAEALLGKAIEREYSLSDLLKRP
FT                   NVSYEALMQARTDEGELLAGPGVLEDQVLAEQVETQVKYAGYIARQQDEVQKHLSHEQQ
FT                   PIPADIDYDAVTSLSFEVRQKLKTHRPETIGQAARVSGVTPAAISLLLIHLKRLHYGSR
FT                   KQAA"
FT   misc_feature    19..1893
FT                   /note="HMMPfam hit to PF01134, Glucose inhibited division
FT                   protein A"
FT   misc_feature    820..864
FT                   /note="ScanRegExp hit to PS01280, Glucose inhibited
FT                   division protein A family signature 1. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   misc_feature    1810..1875
FT                   /note="Predicted helix-turn-helix motif with score 1129
FT                   (+3.03 SD) at aa 604-625, sequence ETIGQAARVSGVTPAAISLLLI"
FT   CDS_pept        1917..2609
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="BP0002"
FT                   /product="glucose inhibited division protein B"
FT                   /note="Similar to Pseudomonas putida glucose inhibited
FT                   division protein B GidB SW:GIDB_PSEPU (P25757) (216 aa)
FT                   fasta scores: E(): 1e-24, 42.593% id in 216 aa, and to
FT                   Escherichia coli glucose inhibited division protein B GidB
FT                   or B3740 or Z5240 or Ecs4682 SW:GIDB_ECOLI (P17113) (207
FT                   aa) fasta scores: E(): 1.2e-12, 39.000% id in 200 aa"
FT                   /db_xref="GOA:Q7W0S9"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0S9"
FT                   /protein_id="CAE40382.1"
FT                   /translation="MSAVPDIPGGPAQRLAQACDALRLPADAGQQQKLLRYIEQMQRWN
FT                   RTYNLTAIRDPGQMLVQHLFDSLSVVAPLERGLPAAGSGARVKLFDVGSGGGLPGVVLA
FT                   IMRAHWDVTCVDAVEKKTAFVRQMAGALGLPNLQAAHTRIEQLEPAQCDVVISRAFASL
FT                   QDFAKLAGRHVREGGTLVAMKGKVPDDEIQALQQHGHWTVERIEPLVVPALDAQRCLIW
FT                   MRRSQGNI"
FT   misc_feature    1917..2135
FT                   /note="ScanRegExp hit to PS00430, TonB-dependent receptor
FT                   proteins signature 1."
FT   misc_feature    2004..2579
FT                   /note="HMMPfam hit to PF02527, Glucose inhibited division
FT                   protein"
FT   CDS_pept        2606..3403
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /gene_synonym="soj"
FT                   /locus_tag="BP0003"
FT                   /product="ParA family protein"
FT                   /note="Similar to Caulobacter crescentus chromosome
FT                   partitioning protein ParA or Cc3753 SW:PARA_CAUCR (O05189)
FT                   (267 aa) fasta scores: E(): 1.9e-46, 49.412% id in 255 aa,
FT                   and to Bacillus subtilis sporulation initiation inhibitor
FT                   protein Soj SW:SOJ_BACSU (P37522) (253 aa) fasta scores:
FT                   E(): 2.7e-44, 48.988% id in 247 aa"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0S8"
FT                   /protein_id="CAE40383.1"
FT                   /translation="MKNIPPSKSARVFCIANQKGGVGKTTTAINLAAGLATHKQRVLLV
FT                   DLDPQGNATMGSGIDKSTLESNLYQVLIGEAGIEQTRVRSESGGYDVLPANRELSGAEI
FT                   DLVQMDERERQLKAAIDKIAGEYDFVLIDCPPTLSLLTLNGLAAAHGVIIPMQCEYFAL
FT                   EGLSDLVNTIKRVHRNINNELRVIGLLRVMFDPRMTLQQQVSAQLESHFGDKVFTTVVP
FT                   RNVRLAEAPSYGMPGVVYDRASRGAQAYIAFGAEMIERVKELD"
FT   misc_feature    2879..3214
FT                   /note="HMMPfam hit to PF00991, ParA family ATPase"
FT   CDS_pept        3410..4171
FT                   /transl_table=11
FT                   /locus_tag="BP0004"
FT                   /product="Putative acetyltransferase, GnaT family"
FT                   /note="Similar to Caulobacter crescentus acetyltransferase,
FT                   GnaT family Cc2209 TR:Q9A685 (EMBL:AE005892) (207 aa) fasta
FT                   scores: E(): 1.8e-07, 34.653% id in 202 aa, and to
FT                   Rhizobium meliloti putative acetyltransferase protein
FT                   Smc02449 TR:CAC47203 (EMBL:AL591791) (308 aa) fasta scores:
FT                   E(): 6.1e-05, 31.818% id in 242 aa"
FT                   /db_xref="GOA:Q7W0S7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0S7"
FT                   /protein_id="CAE40384.1"
FT                   /translation="MPAVLAVPAAHPAPAAGGELARLEEAALNATTVREQMLYEGWLVR
FT                   WAPSRAKRARCVNVLGLSTRPLDERLAYCTRWYAGHGVPLIVRLTSIGPDFSLDAQLHE
FT                   RGFVAFDRTCVMAASVVPFTAQAPSGLVFERTTPGRFAQEAGRLQAAPLENLPLLVRDA
FT                   SGECIAAGLAAFDAELVGLFDIVTAPQRRRQGCGAAVLKYLLEQASHAGARQAYLQVEP
FT                   QNTAARALYARFGFVDRYTYWYRSMSEATPV"
FT   misc_feature    3884..4120
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family"
FT   CDS_pept        4215..5132
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="BP0005"
FT                   /product="probable chromosome partitioning protein ParB"
FT                   /note="Similar to Pseudomonas putida probable chromosome
FT                   partitioning protein ParB SW:PARB_PSEPU (P31857) (290 aa)
FT                   fasta scores: E(): 3.9e-40, 48.136% id in 295 aa"
FT                   /db_xref="GOA:Q7W0S6"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0S6"
FT                   /protein_id="CAE40385.1"
FT                   /translation="MVTKKPKGLGRGLDALLGADVPAIDNIGKAPAAAPEGPPATLPVS
FT                   KMRAGKYQPRTRMDEGALNELAESIRTQGIMQPILVRALGADAPGQYEIIVGERRFRAA
FT                   QLAGLKEVPVLVREVADENAAVMALIENIQREDLNPLEEAHGVRRLLDEFGLTHEQAAQ
FT                   AIGRSRSATSNLLRLLNLAAPVQTMLLAGDVDMGHARALLAVDAATQIQLANQVIAKRL
FT                   SVREAEKLVARAQKDVDAAPRKKGNGASRDVTRLEEALSDHLGTRVALKVGAREKGQIV
FT                   IDFHGWEHLNSLLERQGLSGVVDA"
FT   misc_feature    4332..4613
FT                   /note="HMMPfam hit to PF02195, ParB-like nuclease domain"
FT   misc_feature    4680..4745
FT                   /note="Predicted helix-turn-helix motif with score 1537
FT                   (+4.42 SD) at aa 156-177, sequence LTHEQAAQAIGRSRSATSNLLR"
FT   CDS_pept        join(5125..5907,5911..6126)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="ansB"
FT                   /locus_tag="BP0006"
FT                   /product="L-asparaginase II precursor (pseudogene)"
FT                   /EC_number="3.5.1.1"
FT                   /note="Pseudogene. Contains an in-frame stop codon. The
FT                   sequence has been checked and believed to be correct.
FT                   Similar to Escherichia coli L-asparaginase II precursor
FT                   AnsB or B2957 SW:ASG2_ECOLI (P00805) (348 aa) fasta scores:
FT                   E(): 2.7e-44, 46.224% id in 331 aa"
FT                   /db_xref="PSEUDO:CAE40386.1"
FT   misc_feature    5155..5181
FT                   /note="ScanRegExp hit to PS00144, Asparaginase /
FT                   glutaminase active site signature 1. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   misc_feature    join(5173..5907,5911..6108)
FT                   /note="HMMPfam hit to PF00710, Asparaginase"
FT   misc_feature    5389..5421
FT                   /note="ScanRegExp hit to PS00917, Asparaginase /
FT                   glutaminase active site signature 2. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   variation       5908..5910
FT                   /note="inframe TAG stop; CAG in parapertussis"
FT   tRNA            6236..6322
FT                   /note="tRNA Tyr anticodon GTA, Cove score 72.20"
FT   tRNA            6511..6584
FT                   /note="tRNA Gly anticodon TCC, Cove score 82.17"
FT   tRNA            6591..6665
FT                   /note="tRNA Thr anticodon GGT, Cove score 86.85"
FT   CDS_pept        6722..7912
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /gene_synonym="tuf"
FT                   /locus_tag="BP0007"
FT                   /product="elongation factor Tu"
FT                   /note="Similar to Burkholderia cepacia elongation factor Tu
FT                   Tuf SW:EFTU_BURCE (P33167) (396 aa) fasta scores: E():
FT                   2.4e-139, 92.658% id in 395 aa, and to Escherichia coli
FT                   elongation factor Tu TufA TR:AAA50993 (EMBL:J01690) (394
FT                   aa) fasta scores: E(): 3e-123, 81.519% id in 395 aa.
FT                   Identical to BP3611, 100.000% identity (100.000% ungapped)
FT                   in 396 aa overlap"
FT                   /db_xref="GOA:Q7TT91"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7TT91"
FT                   /protein_id="CAE40387.1"
FT                   /translation="MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSNKFGGEAR
FT                   GYDQIDAAPEEKARGITINTSHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIIVFLNKADMVDDAELLELVEMEVRELLSKYDF
FT                   PGDDTPIVKGSAKLALEGDKGELGEQAILSLAQALDTYIPTPERAVDGAFLMPVEDVFS
FT                   ISGRGTVVTGRIERGVVKVGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILL
FT                   RGTKREDVERGQVLAKPGSINPHTDFTAEVYILSKEEGGRHTPFFNGYRPQFYFRTTDV
FT                   TGTIDLPADKEMVLPGDNVSMTVKLLAPIAMEEGLRFAIREGGRTVGAGVVAKIIK"
FT   misc_feature    6749..7849
FT                   /note="HMMPfam hit to PF00009, Elongation factor Tu family"
FT   misc_feature    6776..6799
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    6872..6919
FT                   /note="ScanRegExp hit to PS00301, GTP-binding elongation
FT                   factors signature. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   tRNA            8023..8098
FT                   /note="tRNA Trp anticodon CCA, Cove score 85.26"
FT   CDS_pept        8151..8531
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /gene_synonym="prlG"
FT                   /locus_tag="BP0008"
FT                   /product="preprotein translocase SecE subunit"
FT                   /note="Similar to Escherichia coli preprotein translocase
FT                   SecE subunit SecE or PrlG or B3981 or Z5554 or Ecs4904
FT                   SW:SECE_ECOLI (P16920) (127 aa) fasta scores: E(): 7.6e-06,
FT                   32.000% id in 125 aa, and to Vibrio alginolyticus
FT                   preprotein translocase SecE subunit SecE SW:SECE_VIBAL
FT                   (Q9ZNE7) (126 aa) fasta scores: E(): 4.9e-08, 39.844% id in
FT                   128 aa"
FT                   /db_xref="GOA:Q7W0S5"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0S5"
FT                   /protein_id="CAE40388.1"
FT                   /translation="MSNTSIETVTSTADRIKLGLAVLVVIAGIVGFSMLDAQPMVARIG
FT                   VFVGGLVVAALLAWFSEPGRRTLSFAGESYNEVKRVSWPTRKETIQMTGIVFAFVAVMG
FT                   LLMWVLDKGIEWVLYGLLLGWK"
FT   misc_feature    join(8196..8255,8265..8333,8427..8480)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BP0008 by TMHMM2.0 at aa 16-35, 39-61 and 93-110"
FT   misc_feature    8346..8516
FT                   /note="HMMPfam hit to PF00584, SecE/Sec61-gamma subunits of
FT                   protein translocation complex"
FT   CDS_pept        8541..9074
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BP0009"
FT                   /product="transcription antitermination protein NusG"
FT                   /note="Similar to Escherichia coli transcription
FT                   antitermination protein NusG or B3982 or Z5555 or Ecs4905
FT                   SW:NUSG_ECOLI (P16921) (181 aa) fasta scores: E(): 1.2e-41,
FT                   60.345% id in 174 aa, and to Neisseria meningitidis
FT                   (serogroup A) transcription antitermination protein NusG or
FT                   Nma0147 or Nmb0126 TR:Q9JRD9 (EMBL:AL162752) (178 aa) fasta
FT                   scores: E(): 1.4e-46, 67.045% id in 176 aa"
FT                   /db_xref="GOA:Q7W0S4"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0S4"
FT                   /protein_id="CAE40389.1"
FT                   /translation="MSKRWYVVHVYSGMEKSVQKALNERIERAELQTSFGRILVPSEEV
FT                   VEVKGGQKSITERRIFPGYVLVEMDLTDETWHLVKNTNRVTGFLGGSGNRPTPISEREV
FT                   EKILNQMEEGVEKPRPKILFEVGEMVRVKEGPFADFNGNVEEVNYEKSKVRVSVTIFGR
FT                   ATPVELDFSQVEKT"
FT   misc_feature    8544..8675
FT                   /note="HMMPfam hit to PF02357, Transcription termination
FT                   factor nusG"
FT   misc_feature    9018..9047
FT                   /note="ScanRegExp hit to PS01014, Transcription termination
FT                   factor nusG signature. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   CDS_pept        9138..9569
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /gene_synonym="relC"
FT                   /locus_tag="BP0010"
FT                   /product="50S ribosomal protein L11"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein
FT                   L11 RplK or RelC or B3983 SW:RL11_ECOLI (P02409) (141 aa)
FT                   fasta scores: E(): 1.3e-34, 66.429% id in 140 aa, and to
FT                   Neisseria meningitidis 50S ribosomal protein L11 RplK or
FT                   Nma0146 TR:Q9JX02 (EMBL:AL162752) (144 aa) fasta scores:
FT                   E(): 1.3e-44, 85.211% id in 142 aa"
FT                   /db_xref="GOA:Q7W0S3"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0S3"
FT                   /protein_id="CAE40390.1"
FT                   /translation="MAKKIVGFIKLQVPAGKANPSPPIGPALGQRGLNIMEFCKAFNAK
FT                   TQGMELGLPIPVVITAFADKSFTFIMKTPPATVLIKKASGVQKGSAKPHTDKVGTLTRA
FT                   QAEEIAKTKQPDLTAADLDAAVRTIAGSARSMGITVEGG"
FT   misc_feature    9162..9560
FT                   /note="HMMPfam hit to PF00298, Ribosomal protein L11"
FT   misc_feature    9516..9563
FT                   /note="ScanRegExp hit to PS00359, Ribosomal protein L11
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        9572..10270
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BP0011"
FT                   /product="50S ribosomal protein L1"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein L1
FT                   RplA or B3984 SW:RL1_ECOLI (P02384) (233 aa) fasta scores:
FT                   E(): 1.1e-50, 65.801% id in 231 aa, and to Neisseria
FT                   meningitidis (serogroup A) 50S ribosomal protein L1 RplA or
FT                   Nma0145 or Nmb0128 TR:Q9JRJ1 (EMBL:AL162752) (231 aa) fasta
FT                   scores: E(): 1.3e-52, 68.261% id in 230 aa"
FT                   /db_xref="GOA:Q7W0S2"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0S2"
FT                   /protein_id="CAE40391.1"
FT                   /translation="MAKLSKRAAAIAQKIDRTKLYPVGEALNLVKETATAKFDESIDVA
FT                   VQLGIDPKKSDQLVRGSVVLPAGTGKTVRVAVFAQGEKADAARAAGADIVGLDDLAEQI
FT                   KAGQMDFDVVIASPDTMRVVGALGQVLGPRGLMPNPKVGTVTPDVATAVKNAKAGQIQY
FT                   RTDKAGIIHATIGRASFGVEQLQNNLAALVDALQKARPAAAKGIYLRKLAVSSTMGGGA
FT                   RVEIASLSAN"
FT   misc_feature    9614..10234
FT                   /note="HMMPfam hit to PF00687, Ribosomal protein L1p/L10e
FT                   family"
FT   misc_feature    9932..9988
FT                   /note="ScanRegExp hit to PS01199, Ribosomal protein L1
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        10513..11037
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BP0013"
FT                   /product="50S ribosomal protein L10"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein
FT                   L10 RplJ or B3985 or Z5558 or Ecs4908 SW:RL10_ECOLI
FT                   (P02408) (164 aa) fasta scores: E(): 4.4e-18, 43.429% id in
FT                   175 aa, and to Neisseria meningitidis (serogroups A and B)
FT                   50S ribosomal protein L10 RplJ or Nma0144 or Nmb0130
FT                   SW:RL10_NEIMA (Q9JQP7) (166 aa) fasta scores: E(): 6.6e-29,
FT                   55.233% id in 172 aa"
FT                   /db_xref="GOA:Q7W0S1"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0S1"
FT                   /protein_id="CAE40392.1"
FT                   /translation="MSLNRQEKAVVIEEVSAQVAKAQSIVIAEYRGLDVASVTVLRKTA
FT                   RESGVYLRVLKNTLVRRAVAGTAFEPLSEQLTGPLIYGISADPVAAAKVLAGFAKSNDK
FT                   LVIKAGSLPNSLLTQDGVKALATMPSREELLSKLLGTMQAPIAQFVRTLNEVPTKFARG
FT                   LAAVRDQKAAA"
FT   misc_feature    10519..10812
FT                   /note="HMMPfam hit to PF00466, Ribosomal protein L10"
FT   CDS_pept        11119..11502
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BP0014"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein
FT                   L7/L12 RplL or B3986 SW:RL7_ECOLI (P02392) (120 aa) fasta
FT                   scores: E(): 7.6e-19, 61.905% id in 126 aa, and to
FT                   Neisseria perflava 50S ribosomal protein L7/L12 RplL
FT                   SW:RL7_NEIPE (Q9F5M1) (123 aa) fasta scores: E(): 7.5e-22,
FT                   66.142% id in 127 aa"
FT                   /db_xref="GOA:Q7W0S0"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0S0"
FT                   /protein_id="CAE40393.1"
FT                   /translation="MALSKAEILDAIAGMSVLELSELIKEMEEKFGVSAAAAAVAVAAP
FT                   AAGGAGAAAAEEQTEFTVVLLEAGANKVSVIKAVRELTGLGLKEAKDLVDGAPKPVKEA
FT                   LPKADAEAAKKKLEEAGAKVEVK"
FT   misc_feature    11296..11499
FT                   /note="HMMPfam hit to PF00542, Ribosomal protein L7/L12
FT                   C-terminal domain"
FT   CDS_pept        11662..15774
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /gene_synonym="groN"
FT                   /gene_synonym="nitB"
FT                   /gene_synonym="rif"
FT                   /gene_synonym="ron"
FT                   /gene_synonym="stl"
FT                   /gene_synonym="stv"
FT                   /gene_synonym="tabD"
FT                   /locus_tag="BP0015"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Similar to Escherichia coli DNA-directed RNA
FT                   polymerase beta chain RpoB or GroN or NitB or Rif or Ron or
FT                   Stl or Stv or TabD or B3987 or Z5560 or ECS4910
FT                   SW:RPOB_ECOLI (P00575) (1342 aa) fasta scores: E(): 0,
FT                   64.260% id in 1371 aa, and to Pseudomonas aeruginosa
FT                   DNA-directed RNA polymerase beta chain RpoB or PA4270
FT                   SW:RPOB_PSEAE (Q51561) (1357 aa) fasta scores: E(): 0,
FT                   67.080% id in 1370 aa"
FT                   /db_xref="GOA:Q7W0R9"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0R9"
FT                   /protein_id="CAE40394.1"
FT                   /translation="MPYSYTEKKRIRKSFAKREDVQNVPFLLATQLQSYLTFLQADTAT
FT                   SDRVNEGLQAAFSSIFPIVSHNGMARLEFVSYALGEPVFDVKECQQRGLTYASPLRAKV
FT                   RLVLLDREVSKPTIKEVKEQEVYMGEIPLMTGTGSFVINGTERVIVSQLHRSPGVFFEH
FT                   DRGKTHSSGKLLFSARVIPYRGSWLDFEFDPKDVLFFRVDRRRKMPVTILLKAIGMTPE
FT                   SILAHFFDFDNFELKSEGGMMEFVAERWKGEMARFDIADRDGKVIVEKDKRINAKHLRD
FT                   LAAGGIQRVSVPEDFLYGRVLAKNIVDPDTGEVVAHANDEITESVLNAMRAANVRDIQT
FT                   LYTNDLDRGPYISQTLRADETADQMAARVAIYRMMRPGEPPTEEAVEALFQRLFYSEET
FT                   YDLSRVGRMKVNSRLGRGDDSTGPMTLTNEDILETIKVLVELRNGRGQIDDIDHLGNRR
FT                   VRCVGELAENQFRAGLVRVERAVKERLGQAETENLMPHDLINSKPISAAIKEFFGSSQL
FT                   SQFMDQTNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIG
FT                   LINSMALYARLNEYGFLETPYRKIIDGKVSDQIDYLSAIEESHYVIAQANAALDDEGRF
FT                   VDDLVACREAGETMLTAPGNVHYMDVAPSQIVSVAASLIPFLEHDDANRALMGANMQRQ
FT                   AVPCLRPEKPLVGTGVERTVAVDSGTTVQALRGGVVDHVDADRVVIRVNDEENVAGEVG
FT                   VDIYNLIKYTRSNQNTNINQRPIVARGDKVAKGDVLADGASTDLGELALGQNMLIAFMP
FT                   WNGYNFEDSILISERVVADDRYTSIHIEELTVVARDTKLGPEEITRDISNLAETQLNRL
FT                   DDSGIVYIGAEVSADDVLVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDTSLRVPSGM
FT                   TGTVIDVQVFTREGIVRDKRAQSIIDDELRRYRQDLNDQLRIVENDQFDRIEKMLVGKT
FT                   VNGGPRKLAKGATLTKAYLADLDRWQWFDIRLADEQHAVVLEQAKESLEQKRHQFDLAF
FT                   EEKRKKLTQGDELPPGVLKMIKVYLAVKRRLQPGDKMAGRHGNKGVVSRITPVEDMPHM
FT                   ADGTPADIVLNPLGVPSRMNVGQVLEVHLGWAAKGVGYRIADMLRDERTAQAKSVRGYL
FT                   EKVYNTTGSSAHIDSLTDEEVLELANNLKKGVPFATPVFDGATEEEIGKMLELAYPDDV
FT                   AARMRLTASRSQAWLYDGRTGEQFERPVTIGYMHYLKLHHLVDDKMHARSTGPYSLVTQ
FT                   QPLGGKAQFGGQRFGEMEVWALEAYGASYTLQEMLTVKSDDITGRTKVYENIVKGDHVI
FT                   DAGMPESFNVLVKEIRSLALDMDLERN"
FT   misc_feature    11905..15642
FT                   /note="HMMPfam hit to PF00562, RNA polymerase beta subunit"
FT   misc_feature    14905..14943
FT                   /note="ScanRegExp hit to PS01166, RNA polymerases beta
FT                   chain signature. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   CDS_pept        15774..20018
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /gene_synonym="tabB"
FT                   /locus_tag="BP0016"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Similar to Escherichia coli DNA-directed RNA
FT                   polymerase beta' chain RpoC or TabB or B3988 or Z5561 or
FT                   ECS4911 SW:RPOC_ECOLI (P00577) (1407 aa) fasta scores: E():
FT                   0, 66.405% id in 1399 aa, and to Neisseria meningitidis
FT                   DNA-directed RNA polymerase beta' chain RpoC or NMA0141
FT                   TR:Q9JX03 (EMBL:AL162752) (1391 aa) fasta scores: E(): 0,
FT                   77.095% id in 1384 aa"
FT                   /db_xref="GOA:Q7W0R8"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0R8"
FT                   /protein_id="CAE40395.1"
FT                   /translation="MKALLDLFKQVSQDEQFDAIKIGIASPEKIRSWSFGEVRKPETIN
FT                   YRTFKPERDGLFCAKIFGPIKDYECLCGKYKRLKHRGVICEKCGVEVTVAKVRRERMGH
FT                   IELASPVAHIWFLKSLPSRLGMVLDMTLRDIERVLYFEAWCVIEPGMTPLKRGQIMSDD
FT                   DFLAKTEEYGDDFRALMGAEAVRELLRTIDIDREVETLRGELKATSSEAKIKKISKRLK
FT                   VLEGFQKSGIKAEWMVMEVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLELKAPEIILRNEKRMLQEAVDSLLDNGRRGKAMTGANKRQLKSLADMIKGKSGRFRQ
FT                   NLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFIFNRLEMMGLATTIKAAKK
FT                   LVESQEPVVWDILEEVIREHPVMLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAFN
FT                   ADFDGDQMAVHVPLSLEAQLEARTLMLASNNVLFPANGEPSIVPSQDIVLGLYYTTRER
FT                   INGKGEGIFFADVSEVQRAYDNGEVELQTRITVRLTEYERDEQGEWQPVKHRHETTVGR
FT                   ALLSEILPKGLPFTVLNKALKKKEISRLINQSFRRCGLRDTVIFADKLMQSGFRLATRG
FT                   GISIAMEDMLIPKAKEGILAEASREVKEIDKQYSSGLVTSQERYNNVVDIWGKAGDKVG
FT                   KAMMEQLATEPVVNRHGEEVRQESFNSIYMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVTQDLVITED
FT                   DCGTSHGYAMKALVEGGEVIEPLRDRILGRVAAIDVVNPDTQETAIAAGTLLDEDLVDL
FT                   IDRLGVDEVKVRTPLTCETRHGLCAHCYGRDLGRGSHVNVGEAVGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRSALASAVETKSNGTVGFASTMRYVTNAKGERVAISRSGELAIFDDN
FT                   GRERERHKIPYGATVLVGDGEAVKAGTRLASWDPLTRPIVSEYSGAVRFENIEEGVTVA
FT                   KQVDEVTGLSTLVVITPKTRGGKIVMRPQIKLVNENGEDVKIAGTDHSVNISFPVGALI
FT                   TVRDGQQVAVGEVLARIPQESQKTRDITGGLPRVAELFEARSPKDAGMLAEVTGTVSFG
FT                   KDTKGKQRLVITDLEGVSHEFLILKEKQVLVHDGQVVNKGEMIVDGPADPHDILRLQGI
FT                   EKLATYIVDEVQDVYRLQGVKINDKHIEVIVRQMLRRVNIVDPGDTEFIPGEQVERSEL
FT                   LNENDRVVAEDKRPASYDNVLLGITKASLSTDSFISAASFQETTRVLTEAAIMGKRDDL
FT                   RGLKENVIVGRLIPAGTGLAYHIARKDKEALEAAEREAARQLANPFEDAPVTVGGEPEA
FT                   PAADTPSDDSAE"
FT   misc_feature    16476..18266
FT                   /note="HMMPfam hit to PF00623, RNA polymerase alpha
FT                   subunit"
FT   misc_feature    16755..16778
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    18429..19880
FT                   /note="HMMPfam hit to PF01854, RNA polymerase A/beta'/A''
FT                   subunit"
FT   CDS_pept        complement(20127..20531)
FT                   /transl_table=11
FT                   /locus_tag="BP0017"
FT                   /product="putative lipoprotein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0R7"
FT                   /protein_id="CAE40396.1"
FT                   /translation="MPIILRPFLPSLSLAVLALSGCANLSQPAAEAPATPAALQALAEV
FT                   RTEYGAGHYGEVIRRVARSDELAAAPKAVRIEAFKLQAFSYCVSNYTQLCEDAFVRILH
FT                   LDSSFTLAPNEAGHPAWGPVFRAAQSKAGT"
FT   CDS_pept        20772..21947
FT                   /transl_table=11
FT                   /locus_tag="BP0018"
FT                   /product="putative membrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="GOA:Q7W0R6"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0R6"
FT                   /protein_id="CAE40397.1"
FT                   /translation="MPLFAASQHPRSPFAGAAPLAHRPLSAIAATAAGGVPQARIKRLL
FT                   GELVPQLASVHEQGHICGDITVDSVGLDESGRAHLLALNGAAQGEAALPAPGYAPFELY
FT                   VEDPAWPRGPWTDIYALSAVAHSLITGRRPPAAPERSVNDGYQPLAQRDLPKYDNDFLR
FT                   AIDAGLAVRPHTFEAFVDSLKFPEPEPPAEAMAPLPSEPPPRDEVHDEEPVRQRPAVRS
FT                   ILFAILLALATLGVAVYWWQRLTGTPSGVITSSERVTTPGATATPSDSREAEPPAAGAA
FT                   SPQGGDAGSADTSGAAPPAQAQAGPDAAPAPDVAPEDAATDAQAESEAAATPAPAAARV
FT                   TVRINVQPWGEIWINGVRRGVSPPMKELRLVPGRYSVVVRNADLPPYRATL"
FT   misc_feature    21426..21494
FT                   /note="1 probable transmembrane helix predicted for BP0018
FT                   by TMHMM2.0 at aa 219-241"
FT   CDS_pept        complement(join(22008..22421,22420..24351))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0019"
FT                   /product="probable two-component sensor protein
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 644. The frameshift occurs within
FT                   a (GC)5 polymeric tract. The sequence has been checked and
FT                   believed to be correct. Similar to Pseudomonas aeruginosa
FT                   probable two-component sensor PA4036 TR:Q9HWZ1
FT                   (EMBL:AE004820) (766 aa) fasta scores: E(): 6.1e-47,
FT                   37.247% id in 792 aa, and to Caulobacter crescentus
FT                   putative sensory box histidine kinase CC3327 TR:Q9A377
FT                   (EMBL:AE005994) (761 aa) fasta scores: E(): 6.9e-39,
FT                   34.522% id in 785 aa"
FT                   /db_xref="PSEUDO:CAE40398.1"
FT   misc_feature    complement(22020..22370)
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, phytochrome-like ATPase"
FT   variation       complement(22419..22428)
FT                   /note="(GC)5 in pertussis; (GC)6 in parapertussis"
FT   misc_feature    complement(22498..22695)
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain"
FT   CDS_pept        complement(24353..25459)
FT                   /transl_table=11
FT                   /locus_tag="BP0020"
FT                   /product="putative peptidoglycan binding protein"
FT                   /note="Similar to Caulobacter crescentus peptidoglycan
FT                   binding domain protein CC3326 TR:Q9A378 (EMBL:AE005994)
FT                   (457 aa) fasta scores: E(): 3.3e-23, 33.711% id in 353 aa"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR016930"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0R5"
FT                   /protein_id="CAE40399.1"
FT                   /translation="MIRPFAPAFMLVCALVASAAVQAQPAGSLGENFLYRVRSGDTLIA
FT                   LASTYTGNESNWSILQTLNRVDDPQRLPIALELRIPLAMIPVQAAGAEVVHVSGNATAD
FT                   GQALRVGTQIVEGSTIRTASGSFVTLKLSDGSQVTIPENGTVAANRLRQFQRVPLTDSI
FT                   FQVQQGELESRVAPGGQGVGRFEIRTPVAVTGVRGTRFRVKSSPRGASSEVLEGSVRLQ
FT                   PHAPDAALATPVAVSSGYGANVGSDGAFSGVQALLPAPQLQAPARAASGGWTVPFAPVS
FT                   GASAYIVRVSRDAEGMHVVASDRFDTNDVRFRAPGAGTYYVAVRAVDASGLNGREAVQP
FT                   FEGANVLSTPYGLSVATGTGDLVLLSEF"
FT   misc_feature    complement(25217..25357)
FT                   /note="HMMPfam hit to PF01476, LysM domain"
FT   misc_feature    complement(25391..25459)
FT                   /note="Signal peptide predicted for BP0020 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.967 between residues 23 and 24"
FT   CDS_pept        complement(join(25477..25797,25800..26213))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0021"
FT                   /product="probable two-component response regulator
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 138. The frameshift occurs within
FT                   a (G)5 homopolymeric tract. The sequence has been checked
FT                   and believed to be correct. Similar to Caulobacter
FT                   crescentus DNA-binding response regulator CC3325 TR:Q9A379
FT                   (EMBL:AE005994) (236 aa) fasta scores: E(): 3.6e-38,
FT                   47.009% id in 234 aa, and to Pseudomonas aeruginosa
FT                   probable two-component response regulator PA4032 TR:Q9HWZ5
FT                   (EMBL:AE004820) (238 aa) fasta scores: E(): 9.7e-29,
FT                   41.277% id in 235 aa"
FT                   /db_xref="PSEUDO:CAE40400.1"
FT   misc_feature    complement(25585..25755)
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C terminal"
FT   variation       complement(25799..25803)
FT                   /note="(G)5 in pertussis, CGG in parapertussis"
FT   misc_feature    complement(25863..26201)
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain"
FT   CDS_pept        26471..27286
FT                   /transl_table=11
FT                   /locus_tag="BP0022"
FT                   /product="Two-component response regulator"
FT                   /note="Similar to Zymomonas mobilis aerobic respiration
FT                   control protein ArcA TR:Q9X3W0 (EMBL:AF088896) (241 aa)
FT                   fasta scores: E(): 2.5e-10, 30.638% id in 235 aa, and to
FT                   Rhodobacter sphaeroides DmsR TR:O32479 (EMBL:D89075) (232
FT                   aa) fasta scores: E(): 1.6e-10, 28.632% id in 234 aa."
FT                   /db_xref="GOA:Q7W0R4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0R4"
FT                   /protein_id="CAE40401.1"
FT                   /translation="MRNTAPHCLKCVQARAFPFERLKAGREPADWQGFVMKQLSTLIMT
FT                   PDDADRDRIIAAMLLAGISAKGCSTPLELFGLLSEDTYDAVVMDLSELGELGYALVARL
FT                   RGSPELGIIVIGGNLTLDARLRCLQSGADACVPLPADERELACVLLALARRLPAWQEDE
FT                   EAVAQRGTDDEGWELRDQDWTLVAPGGEELSLSANERQIVRLLLGAAGRAIGRAELASE
FT                   LAVDGPAVRSTGERSIDVIVSRLRRKAELAGLVLPIRTVYGSGYLFANS"
FT   misc_feature    26585..26917
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain"
FT   misc_feature    27041..27265
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C terminal"
FT   CDS_pept        complement(27283..28233)
FT                   /transl_table=11
FT                   /locus_tag="BP0023"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TT94"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TT94"
FT                   /protein_id="CAE40402.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDKYNLLTVHS"
FT   repeat_region   27283..27310
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(27283..28335)
FT   misc_feature    complement(27319..27852)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(27910..27975)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   repeat_region   complement(28304..28335)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(28315..28650)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0024"
FT                   /product="putative racemase (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. Similar to Rhodococcus spAD45 putative
FT                   racemase IsoG TR:Q9RBP6 (EMBL:AJ249207) (405 aa) fasta
FT                   scores: E(): 3.3e-16, 45.370% id in 108 aa, and to
FT                   Thermoplasma volcanium L-carnitine dehydratase TVG1215416
FT                   TR:BAB60328 (EMBL:AP000995) (399 aa) fasta scores: E():
FT                   1.7e-14, 41.509% id in 106 aa. Similar to N-terminal
FT                   regions of several CDSs including BP0416, BP3709, BP0253,
FT                   BP3318, BP0199"
FT                   /db_xref="PSEUDO:CAE40403.1"
FT   CDS_pept        complement(28675..29109)
FT                   /transl_table=11
FT                   /locus_tag="BP0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Methanothermobacter thermautotrophicus
FT                   conserved protein Mth1398 TR:O27449 (EMBL:AE000902) (133
FT                   aa) fasta scores: E(): 4.2e-06, 32.692% id in 104 aa, and
FT                   to Archaeoglobus fulgidus conserved hypothetical protein
FT                   Af0284 TR:O29957 (EMBL:AE001085) (165 aa) fasta scores:
FT                   E(): 3.7e-05, 22.936% id in 109 aa"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0R3"
FT                   /protein_id="CAE40404.1"
FT                   /translation="MEMTMEQEPLNGWPQPYRLLDAQPYWDALQDEKLTYQQCVACRQS
FT                   VWPAHSRCPHCSSDQLVWQASSGRATVYSFSTVTRGPTPVWASIVPYTVGFVEMDEGYF
FT                   LFTQIEGPPGSIGVGDKVQVRFVRRGAQILPVFVSADLPA"
FT   misc_feature    complement(28702..29052)
FT                   /note="HMMPfam hit to PF01796, Domain of unknown function
FT                   DUF35"
FT   CDS_pept        complement(29142..30368)
FT                   /transl_table=11
FT                   /locus_tag="BP0026"
FT                   /product="putative thiolase"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551
FT                   nonspecific lipid-transfer protein mt1663 TR:AAK45933
FT                   (EMBL:AE007030) (402 aa) fasta scores: E(): 5.1e-14,
FT                   27.229% id in 415 aa, and to Pseudomonas fluorescens PhlC
FT                   TR:Q51727 (EMBL:U41818) (398 aa) fasta scores: E():
FT                   5.2e-15, 27.188% id in 320 aa"
FT                   /db_xref="GOA:Q7W0R2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0R2"
FT                   /protein_id="CAE40405.1"
FT                   /translation="MKAMAMTPKPTAAIVGMGDAYASMQDRKDPIQLAVAATHKALADA
FT                   GITKDQVDAVFTGRSPWADKRSQWSNIFCSHMHMPVTITSEITMHGAGLNATVAMAAQM
FT                   IAAGRAQYVLCLQSDATELFVDAVAMGAEADADPQFEIPYGPTIPALYAQAACRYFHEF
FT                   GITEEDLADVAIANQSWAMHHPHAAKARFGSIDRAKVLSSPYVATPLRRWMCSTWGGGT
FT                   GGALVVTSVDNARTAQDPVYVMGYGSATTHEYLGDRMNMRRCRYPSLGAFPNLTHTATA
FT                   EAARQAYESSGLTPADIDMAQISVNFAHMGPLIMEDLGFAAKGRGMDLYRAGRTGVDGD
FT                   LPIDTNGGWLSFGQPGISCNMDSYAEAVRQLRGNALGRAPARRPRTVLVQGSGGMLAAG
FT                   SVTILASEL"
FT   CDS_pept        complement(30365..30862)
FT                   /transl_table=11
FT                   /locus_tag="BP0027"
FT                   /product="MaoC family protein"
FT                   /note="Similar to Archaeoglobus fulgidus MaoC protein
FT                   af2313 TR:O27971 (EMBL:AE000944) (151 aa) fasta scores:
FT                   E(): 3.3e-19, 46.154% id in 143 aa, and to Rhodococcus
FT                   spNCIMB 9784. fad-binding protein CampD TR:AAK50623
FT                   (EMBL:AF323755) (167 aa) fasta scores: E(): 2.4e-12,
FT                   33.562% id in 146 aa"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0R1"
FT                   /protein_id="CAE40406.1"
FT                   /translation="MARINNRIDQTFDEIEVGKVFRSGGRTITETDVVNFCALTGNWIE
FT                   IHSNVQYASKTRFGKRLVQGSLTYSIVTGLIQFGLGIQANYGIDNMRFLAPVSIGDTIY
FT                   AVCEVMRKKEKDEKYGVITFFMKAVNQDGTVVQKGEWSLLMLRRREDLDALVGASLPEV
FT                   AA"
FT   misc_feature    complement(30473..30832)
FT                   /note="HMMPfam hit to PF01575, MaoC like domain"
FT   misc_feature    complement(30611..30676)
FT                   /note="1 probable transmembrane helix predicted for BP0027
FT                   by TMHMM2.0 at aa 62-84"
FT   CDS_pept        complement(31070..31978)
FT                   /transl_table=11
FT                   /locus_tag="BP0028"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator pa0877 TR:Q9I568 (EMBL:AE004522)
FT                   (298 aa) fasta scores: E(): 1e-17, 27.985% id in 268 aa,
FT                   and to Rhizobium loti probable transcriptional regulator
FT                   mlr2195 TR:Q98IY2 (EMBL:AP002999) (397 aa) fasta scores:
FT                   E(): 3.5e-17, 29.825% id in 285 aa"
FT                   /db_xref="GOA:Q7W0R0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0R0"
FT                   /protein_id="CAE40407.1"
FT                   /translation="MRQVDFFTLRLFLSAVEEGQIGRAALRENIAPSAATKRIQELEDV
FT                   VGLRLLERTPKGVILSPAGEVLVRHIRQIFTNVDELRAELSAFSEGVRGEVSVASARSI
FT                   IAPYLAHEFGAYIRDYPLVDLIVREVENAAIVQAVAQGDADIGVFAAAPALDLSGVDVM
FT                   PYRQDRMVVVMSHGHRLAQRQSVTFEDLLSENLIVPAALHMALRTAADRLGREFEPKYG
FT                   VTSAGVAISLAQEGLGVTIQPECLLDLKVFEHAVGVELAESWANRSIHIATARGRAAGP
FT                   AANLLLKQLLDRPRALSSVSD"
FT   misc_feature    complement(31535..31963)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    complement(31829..31921)
FT                   /note="ScanRegExp hit to PS00044, Bacterial regulatory
FT                   proteins, lysR family signature."
FT   CDS_pept        32215..33006
FT                   /transl_table=11
FT                   /locus_tag="BP0029"
FT                   /product="putative enoyl-CoA hydratase"
FT                   /note="Similar to Deinococcus radiodurans enoyl-CoA
FT                   hydratase, putative DR0184 TR:Q9RXX1 (EMBL:AE001881) (273
FT                   aa) fasta scores: E(): 8e-50, 52.209% id in 249 aa, and to
FT                   Mycobacterium tuberculosis enoyl-CoA hydratase EchA15 or
FT                   RV2679 or MTV010.03 TR:O53232 (EMBL:AL021186) (276 aa)
FT                   fasta scores: E(): 6e-48, 49.621% id in 264 aa. Similar to
FT                   BP3304, 51.331% identity in 263 aa overlap."
FT                   /db_xref="GOA:Q7W0Q9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0Q9"
FT                   /protein_id="CAE40408.1"
FT                   /translation="MRYEDFEFLLCEPQDDGVMLVTLNRPDAMNATNDRMHWELTRIWG
FT                   VVNDDPGVKAVVVTGAGERAFSAGGDLSVVEAMSNSHETTMRVMKEASDIVYNMLACDK
FT                   PIISAINGTAVGAGLADVSVMAEDAKLTDGHARLGVSAGDHAAIIWPILCGMSKAKYYL
FT                   MTADFVDGKEAERIGLVTFCAPRAEVLPRSLAIAAKLARGSQTAIRATKKSLNNWMRTA
FT                   GPAFDNSLALEMLCFLGPDVKEGLAALRDKRAPDFPSARLP"
FT   misc_feature    32269..32769
FT                   /note="HMMPfam hit to PF00378, Enoyl-CoA
FT                   hydratase/isomerase family"
FT   CDS_pept        33049..34470
FT                   /transl_table=11
FT                   /locus_tag="BP0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Methanothermobacter thermautotrophicus
FT                   conserved protein mth965 TR:O27046 (EMBL:AE000870) (452 aa)
FT                   fasta scores: E(): 1.2e-26, 31.308% id in 428 aa, and to
FT                   Agrobacterium tumefaciens Agr_l_2924p agr_l_2924
FT                   TR:AAK90029 (EMBL:AE008346) (448 aa) fasta scores: E():
FT                   8.3e-24, 29.888% id in 445 aa"
FT                   /db_xref="GOA:Q7W0Q8"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0Q8"
FT                   /protein_id="CAE40409.1"
FT                   /translation="MNAAPSPSTPPGNCPPLEQAVVRFIQDLKYEHIDAAALAGVNRLM
FT                   RDQLALQVGISAMPWSRQLLDYALTQQRPGVSRVSASTLKMSAADAAFVNGSYGHGFEY
FT                   DDAHGPSYSHPGSCVIPAALAIGEELGSSLQDVITAMVAGYEVYTRIGLLAAPDLLRRG
FT                   YHPHCTLSNFGAAAVAAKLRGFDAETTLHALAIALSHTSGTTEYSSTGGSIKRIHAGLG
FT                   TRNGMMAADMARAGITGPRAFLSGNKGFFKTFLQRPAGEAPQQRFAPGEPFQVATVWLK
FT                   AYCACYCTHAYIDALRPYAERRGEIADIHLKITPHFNVVVGTANACAYAPTNIEHVQFS
FT                   LPIQAALAVQGLGNGYRIHRDYLDGRVDMAPVIAMARGIRITEDPGLETRHPGKFVADV
FT                   TVTFRDGSAEHVFVADPIGTDTNPMPEHEQDAKFMELTADALGQARARALLAALRKMDP
FT                   TMKAADLMALCEPAP"
FT   repeat_region   34524..34555
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   34524..35576
FT   CDS_pept        34626..35576
FT                   /transl_table=11
FT                   /locus_tag="BP0031"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTB9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTB9"
FT                   /protein_id="CAE40410.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIPPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHN"
FT   misc_feature    34884..34949
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    35007..35540
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(35545..35576)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(35573..36763)
FT                   /transl_table=11
FT                   /locus_tag="BP0032"
FT                   /product="probable transporter"
FT                   /note="Similar to Rhodococcus fascians chloramphenicol
FT                   resistance protein TR:Q52751 (EMBL:Z12001) (391 aa) fasta
FT                   scores: E(): 1.6e-10, 25.193% id in 389 aa, and to
FT                   Rhodococcus rhodochrous CmrA TR:O30679 (EMBL:AF015087) (391
FT                   aa) fasta scores: E(): 4.2e-12, 25.326% id in 383 aa"
FT                   /db_xref="GOA:Q7W0Q7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0Q7"
FT                   /protein_id="CAE40411.1"
FT                   /translation="MSDHDASFSLKDIAVPAFGPSILYGVSNGAILPVVALTARELGAS
FT                   LATSGLIVGLVGIGSLVSNIPAAMFTSRHGERRSMVGAAALSVVALLLCIFAGTLWMLA
FT                   TGVFMVGMASSVFLLARQGYMIDAVPAYMRARALSTLAGTMRIGVFAGPFAGAALIHFM
FT                   GLQGAYWVAAVAMTGAGLIAWFAPDMAPPRRRGEAAVARPRLLDVARAHRQVYLTLGLG
FT                   ILLVSAVRASRQVVIPLWADHLGVNPATTSLIYGLVAAIDMSVFYPAGMLMDRRGRLWV
FT                   AVPSTLLMGCALIGTSLTSGVAGFVIVAMMLGMGNGIGSGIVMTLGADAAPASGRTEFL
FT                   GLWRLMSDLGGSLGPVALSGITALVSLAAGVAAMGGVGLAAAAVFWHWLPRGQAPR"
FT   misc_feature    complement(join(35597..35662,35678..35743,35783..35848,
FT                   35861..35926,35948..36013,36053..36118,36206..36262,
FT                   36275..36340,36404..36505,36551..36616,36653..36718))
FT                   /note="11 probable transmembrane helices predicted for
FT                   BP0032 by TMHMM2.0 at aa 15-37, 49-71, 86-120, 141-163,
FT                   167-186, 215-237, 250-272, 279-301, 305-327, 340-362 and
FT                   367-389"
FT   misc_feature    complement(35600..36730)
FT                   /note="HMMPfam hit to PF00083, Sugar (and other)
FT                   transporter"
FT   misc_feature    complement(35726..35761)
FT                   /note="ScanRegExp hit to PS00213, Lipocalin signature."
FT   misc_feature    complement(35756..35836)
FT                   /note="ScanRegExp hit to PS01125, ROK family signature."
FT   CDS_pept        37013..37924
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /gene_synonym="glyS(a)"
FT                   /locus_tag="BP0033"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="Similar to Escherichia coli glycyl-tRNA synthetase
FT                   alpha chain GlyQ or GlyS(a) or B3560 SW:SYGA_ECOLI (P00960)
FT                   (303 aa) fasta scores: E(): 1.9e-90, 74.658% id in 292 aa,
FT                   and to Neisseria meningitidis (serogroups A and B)
FT                   glycyl-tRNA synthetase alpha chain GlyQ or nma0521 or
FT                   nmb1932 TR:Q9JRC6 (EMBL:AL162753) (301 aa) fasta scores:
FT                   E(): 2.7e-96, 75.748% id in 301 aa"
FT                   /db_xref="GOA:Q7W0Q6"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0Q6"
FT                   /protein_id="CAE40412.1"
FT                   /translation="MLTFQQIILTLQDYWDKQGCALLQPYDMEVGAGTSHTATFLRAIG
FT                   PEPWRAAYVQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPPEILDLYIGSLKALGIDP
FT                   TQHDIRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCTPTTGEITYGLE
FT                   RLAMYLQDVESVYDLVWTEGANGNRVYYRDVFHQNEVEQSTYNFEHASADMLFAHFNDY
FT                   EAEAKRLMDVPLALPAYEAALKAAHTFNMLDARGAISVTERAAYIGRIRNLSRAVAQAY
FT                   YDSRERLGFPMLAGRKAAGEAA"
FT   misc_feature    37022..37888
FT                   /note="HMMPfam hit to PF02091, Glycyl-tRNA synthetase alpha
FT                   subunit"
FT   misc_feature    37487..37516
FT                   /note="ScanRegExp hit to PS00339, Aminoacyl-transfer RNA
FT                   synthetases class-II signature 2."
FT   CDS_pept        37926..40064
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /gene_synonym="glyS(b)"
FT                   /locus_tag="BP0034"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="Similar to Escherichia coli glycyl-tRNA synthetase
FT                   beta chain GlyS or GlyS(b) or B3559 SW:SYGB_ECOLI (P00961)
FT                   (688 aa) fasta scores: E(): 3e-69, 40.056% id in 709 aa,
FT                   and to Pseudomonas aeruginosa glycyl-tRNA synthetase beta
FT                   chain GlyS or PA0008 TR:Q9I7B8 (EMBL:AE004440) (684 aa)
FT                   fasta scores: E(): 6.1e-70, 44.600% id in 713 aa"
FT                   /db_xref="GOA:Q7W0Q5"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0Q5"
FT                   /protein_id="CAE40413.1"
FT                   /translation="MTTDIRPLLIELFTEELPPKALQKLGQAFAEGVRATLARHHLLAD
FT                   GCAVEPFATPRRLAVRLSAVLAQAPEQAYAEKLMPVKVGLDANGQPTAALAKKLAAKGL
FT                   EGLDPATLERESDGKQEYLVARGTAAGAQLAVGLQEGLDAAIDGLPIPKVMRYQLADGQ
FT                   TTVKFVRPAHGLVALFGADIVPIAALGLQAGRATQGHRFQSNGAIELATAQGYEADLAE
FT                   RGRVIASFEARRAEISRLLDEHAQRLGATLGDDPEVTALLDEVTALVEHPTVYVGQFEE
FT                   QFLQVPQECLILTMRLNQKYFPLFDPASGKLTHRFLIVSNMQVADPANIVEGNQRVVRP
FT                   RLADAQFFFETDRKTPLAARVEQLGSIVYHNKLGTQLERVERVRAIARGIATALGGDAA
FT                   HCDRAALLAKADLGSNMVGEFPELQGIMGAYYAQGDGEPADVVTALRTQYRNRYDAPVD
FT                   AATLTAATLFIAERIETLVGIWSIGLAPTGERDPFGLRRAALGLISAFEQLAAGGWLKV
FT                   SEDGPLSLDGLLALAAQAFPDGKIGADTLAEVRAFIYERYRNQLIGEHDRNAVEAVIAL
FT                   APPLHQVAARVRAVAAFAQLPAAASLAAANKRIGNLLKKAEGEIGAVDAALLQDPAEKA
FT                   LAEAVAQLRPQARAQLQAGDFAASLATLAQAREPVDAFFADVMVMADDAALRANRLALL
FT                   GQLHGLMNQVADISRLAQ"
FT   misc_feature    37947..40055
FT                   /note="HMMPfam hit to PF02092, Glycyl-tRNA synthetase beta
FT                   subunit"
FT   CDS_pept        40061..40600
FT                   /transl_table=11
FT                   /locus_tag="BP0035"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /note="Similar to Pseudomonas fluorescens hisb-like protein
FT                   TR:Q9F729 (EMBL:AF286536) (213 aa) fasta scores: E():
FT                   3.1e-37, 57.062% id in 177 aa, and to Pseudomonas
FT                   aeruginosa hypothetical protein Pa0006 pa0006 TR:Q9I7C0
FT                   (EMBL:AE004440) (178 aa) fasta scores: E(): 8.4e-38,
FT                   58.286% id in 175 aa"
FT                   /db_xref="GOA:Q7W0Q4"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0Q4"
FT                   /protein_id="CAE40414.1"
FT                   /translation="MKLIILDRDGVVNQDSDAFVKSPDEWIALPGSLQAIARLTQADWT
FT                   VVLATNQSGLARGLFDTATLNAIHDKMHRALAQMGGVVDAIFMCPHGPDDGCACRKPLP
FT                   GMYRDIARRYDVDLAGVPAVGDSLRDLQAAAQAGCAPWLVQTGNGRKTLAQGGLPEGTR
FT                   VCEDLAAVAEQLLQEA"
FT   misc_feature    40061..40501
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase"
FT   CDS_pept        40604..41332
FT                   /transl_table=11
FT                   /locus_tag="BP0036"
FT                   /product="probable acyltransferase"
FT                   /note="Similar to Neisseria meningitidis lysophosphatidic
FT                   acid acyltransferase homolog NlaB or NMA0404 TR:Q9XDL6
FT                   (EMBL:AF036242) (247 aa) fasta scores: E(): 4.2e-32,
FT                   41.277% id in 235 aa, and to Pseudomonas aeruginosa
FT                   probable acyltransferase PA0005 TR:Q9I7C1 (EMBL:AE004440)
FT                   (257 aa) fasta scores: E(): 2.1e-37, 42.437% id in 238 aa"
FT                   /db_xref="GOA:Q7W0Q3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0Q3"
FT                   /protein_id="CAE40415.1"
FT                   /translation="MAWLRSALYALFLIVTVIPYAFACILWAPLPLHWRYRLTVGWPRL
FT                   AIWGARVICGIRWRIKGAENLPDGPAILLSKHQSAWETLFFPAHMPREVCFVYKKELHM
FT                   VPFFGWGLALLRMIPIDRAKGRDAFEQVVRQGQVRLDEGRWPLLFPEGTRVPPGKTGRF
FT                   KMGGALLASRTGARIIPVAHNAGECWRRNAFVKRPGLITVSIGPAIESQDVAPEVLNAK
FT                   VQAWIEGEMRVLNPERYGQA"
FT   misc_feature    40604..40672
FT                   /note="Signal peptide predicted for BP0036 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.995 between residues 23 and 24"
FT   misc_feature    40622..40690
FT                   /note="1 probable transmembrane helix predicted for BP0036
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    40790..41305
FT                   /note="HMMPfam hit to PF01553, Acyltransferase"
FT   CDS_pept        41319..42212
FT                   /transl_table=11
FT                   /locus_tag="BP0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium loti Mlr5068 protein TR:Q98CP0
FT                   (EMBL:AP003005) (252 aa) fasta scores: E(): 3.9e-08,
FT                   28.458% id in 253 aa, and to Rhizobium meliloti conserved
FT                   hypothetical protein smc02768 TR:CAC41413 (EMBL:AL591782)
FT                   (251 aa) fasta scores: E(): 5.6e-08, 25.306% id in 245 aa"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0Q2"
FT                   /protein_id="CAE40416.1"
FT                   /translation="MAKPDQLELLFDVAPPADPASAAPRKTPKARPAPPAPAAIATPCP
FT                   DPLPPGARWREVHTEQQPIGFVLLRSRRRSIGFVVADDGLRVTAPNWVTLEQIDDAVRE
FT                   KARWILAKLRDWHARKEQLAMAHTRWQAGGELPYLGKRIVLGLGAERRQACLSGDADAP
FT                   CDGDTLWLALPVDADQARIRDAAQAWLQQRAGAWFGARLAHFLQLTGLRIRRWRLSSAA
FT                   TRWGSCTSDGNIMLNWRLIHFAPAIIDYVIAHELAHLREMNHSQDFWTEVGHILPGFED
FT                   AKNVLRRHDPATLPQF"
FT   misc_feature    41511..42194
FT                   /note="HMMPfam hit to PF01863, Protein of unknown function
FT                   DUF45"
FT   CDS_pept        42283..42678
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="BP0038"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /note="Similar to Escherichia coli lactoylglutathione lyase
FT                   GloA or B1651 or Z2669 or ECS2360 SW:LGUL_ECOLI (Q59384)
FT                   (135 aa) fasta scores: E(): 5.1e-34, 67.939% id in 131 aa,
FT                   and to Neisseria meningitidis lactoylglutathione lyase GloA
FT                   or NMA2147 or NMB0340 SW:LGUL_NEIMA (O33393) (138 aa) fasta
FT                   scores: E(): 1.2e-42, 78.626% id in 131 aa"
FT                   /db_xref="GOA:Q7W0Q1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0Q1"
FT                   /protein_id="CAE40417.1"
FT                   /translation="MRLLHTMLRVGNLDKSIDFYTSVLGMRELRRKDYPDGRFTLAFVG
FT                   YQDESEAAAIELTHNWDTEKYDLGTGYGHIAIEVDNAYEACDKVKEKGGKVTREAGPMK
FT                   HGTTVIAFVEDPDGYKIEFIQKKGRND"
FT   misc_feature    42295..42360
FT                   /note="ScanRegExp hit to PS00934, Glyoxalase I signature
FT                   1."
FT   misc_feature    42307..42660
FT                   /note="HMMPfam hit to PF00903, Glyoxalase/Bleomycin
FT                   resistance protein/Dioxygenase superfamily"
FT   misc_feature    42487..42525
FT                   /note="ScanRegExp hit to PS00935, Glyoxalase I signature 2.
FT                   Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        42688..43218
FT                   /transl_table=11
FT                   /locus_tag="BP0039"
FT                   /product="peptide deformylase"
FT                   /note="Similar to Leptospira interrogans peptide
FT                   deformylase Pdf TR:AAK70806 (EMBL:AY040678) (178 aa) fasta
FT                   scores: E(): 2.1e-30, 50.000% id in 168 aa, and to
FT                   Pseudomonas aeruginosa probable peptide deformylase PA1122
FT                   TR:Q9I4L3 (EMBL:AE004542) (147 aa) fasta scores: E():
FT                   9.9e-34, 69.630% id in 135 aa. Also similar to BP0552,
FT                   40.881% identity (44.218% ungapped) in 159 aa overlap."
FT                   /db_xref="GOA:Q7W0Q0"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0Q0"
FT                   /protein_id="CAE40418.1"
FT                   /translation="MIHAILKMGDPRLLRVAAPVERYDTPELRALIDDMFETMAHAQGV
FT                   GLAAPQIGVDLQLVIFGFERNDRYPDAPAVPRTILCNPVIEPLSDEMEDGWEGCLSVPG
FT                   LRGLVPRYRHIRYSGYDPAGQRIEREAEGFHARVVQHECDHLIGRLYPTRIRDLTKFGY
FT                   TEVLFPEMDPNAD"
FT   misc_feature    42697..43140
FT                   /note="HMMPfam hit to PF01327, Polypeptide deformylase"
FT   CDS_pept        complement(43347..43559)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0040"
FT                   /product="C-terminal region of a putative oxidoreductase
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS is the C-terminal region of
FT                   BP3335 which was disrupted by the insertion of IS481
FT                   element."
FT   repeat_region   43562..43593
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   43562..44614
FT   CDS_pept        43664..44614
FT                   /transl_table=11
FT                   /locus_tag="BP0041"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA7"
FT                   /protein_id="CAE40420.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIPPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHR"
FT   misc_feature    43922..43987
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    44045..44578
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(44583..44614)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(join(44605..44922,44924..45163))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0042"
FT                   /product="putative lipase (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element following codon 183, and contains a
FT                   frameshift mutation following codon 80. The frameshift
FT                   occurs within a homopolymeric tract of (C)7. The sequence
FT                   has been checked and believed to be correct. Similar to
FT                   Homo sapiens monoglyceride lipase TR:CAC43316
FT                   (EMBL:AJ270950) (303 aa) fasta scores: E(): 2.3e-08,
FT                   36.709% id in 158 aa, and to Streptomyces coelicolor
FT                   putative lipase sc6f7.19C TR:Q9KZC3 (EMBL:AL353870) (269
FT                   aa) fasta scores: E(): 4.6e-11, 40.816% id in 147 aa"
FT                   /db_xref="PSEUDO:CAE40421.1"
FT   variation       complement(44924..44930)
FT                   /note="(C)7 in pertussis; (C)6 in parapertussis"
FT   CDS_pept        45201..45749
FT                   /transl_table=11
FT                   /locus_tag="BP0043"
FT                   /product="putative exported protein"
FT                   /note="Similar to the N-terminal region of Escherichia coli
FT                   resolvase rsvB TR:Q9S0Z7 (EMBL:AB024946) (269 aa) fasta
FT                   scores: E(): 5.2, 30.357% id in 112 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0P9"
FT                   /protein_id="CAE40422.1"
FT                   /translation="MISTLFRFMLKKRVRILWQAGCAALLLAACSPSYNWREIDVADGR
FT                   VRAAFPGRVQTDTRDLALAEVPLRFSLTSARVEQAVFAIGHAPLPPEVAADPARRRALG
FT                   EALARSLYANLGVQPPDPLPAPGADIEIHAPPGERDDWLLARVWATDDMLIEAVAAGTR
FT                   QTLPAERAREFIDAVELRR"
FT   misc_feature    45201..45305
FT                   /note="Signal peptide predicted for BP0043 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.989) with cleavage site
FT                   probability 0.621 between residues 35 and 36"
FT   misc_feature    45258..45290
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(45721..45957)
FT                   /transl_table=11
FT                   /locus_tag="BP0044"
FT                   /product="transcriptional regulator"
FT                   /note="Similar to the C-terminal regions of Vibrio
FT                   anguillarum transcriptional activator protein VanR
FT                   SW:VANR_VIBAN (P74946) (240 aa) fasta scores: E(): 6.7e-09,
FT                   48.611% id in 72 aa, and to Rhizobium loti transcriptional
FT                   regulator mlr5637 TR:Q98BC5 (EMBL:AP003007) (243 aa) fasta
FT                   scores: E(): 5.4e-08, 52.459% id in 61 aa"
FT                   /db_xref="GOA:Q7W0P8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0P8"
FT                   /protein_id="CAE40423.1"
FT                   /translation="MPQRTTLTPRELDCLHWSALGKTSWETARILGIAARTVDFHLANA
FT                   CAKLGVANRRAAVARAVQCGLLPALTAAAPPHR"
FT   misc_feature    complement(45751..45948)
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR family"
FT   misc_feature    complement(45829..45894)
FT                   /note="Predicted helix-turn-helix motif with score 1061
FT                   (+2.80 SD) at aa 51-72, sequence KTSWETARILGIAARTVDFHLA"
FT   CDS_pept        46085..46978
FT                   /transl_table=11
FT                   /locus_tag="BP0045"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa0188 TR:Q9I6U6 (EMBL:AE004456) (293 aa) fasta
FT                   scores: E(): 2e-25, 35.172% id in 290 aa, and to Vibrio
FT                   cholerae hypothetical protein Vc1229 vc1229 TR:Q9KSM7
FT                   (EMBL:AE004202) (291 aa) fasta scores: E(): 5.7e-15,
FT                   31.034% id in 290 aa"
FT                   /db_xref="GOA:Q7W0P7"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0P7"
FT                   /protein_id="CAE40424.1"
FT                   /translation="MLAVVQFYWSAVVLLLPLLACAGIGAYWAKRDYPFGGTFITMLVT
FT                   TVTTPALVFHTFVTTQLDDRALLAIAGASLLALLACALACAGLLRLFGLPVRTLLPTAF
FT                   VPNAGNLGLPVSQLAFGDAGLSAAVAFFAVNSFVTHTIAVRMLPGANTPGSWKSPVLLA
FT                   SVAAVTLRALDIPVPDWLVATSRMLGAVTVPLMLLSLGHALALIPANGMRAGAVVAALR
FT                   LAVGLAAGYAVVWLLGLPDLLAGALALQMAMPCAVVSYMYARRYTDVGDIAAGAVLVST
FT                   VVFLLLAPALLWFTRQ"
FT   misc_feature    46085..46171
FT                   /note="Signal peptide predicted for BP0045 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.771) with cleavage site
FT                   probability 0.411 between residues 29 and 30"
FT   misc_feature    join(46103..46171,46199..46258,46295..46363,46421..46489,
FT                   46643..46711,46724..46792,46811..46870,46898..46966)
FT                   /note="8 probable transmembrane helices predicted for
FT                   BP0045 by TMHMM2.0 at aa 7-29, 39-58, 71-93, 113-135,
FT                   187-209, 214-236, 243-262 and 272-294"
FT   CDS_pept        complement(join(46982..47479,47475..47984))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0046"
FT                   /product="probable malate/L-lactate dehydrogenase
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 169. The frameshift occurs within
FT                   a (GCCGC)2 tract. The sequence has been checked and
FT                   believed to be correct. Similar to Methanococcus jannaschii
FT                   malate dehydrogenase I Mdh or MJ1425 SW:MDH1_METJA (Q58820)
FT                   (344 aa) fasta scores: E(): 2.6e-26, 31.818% id in 330 aa,
FT                   and to Methanothermus fervidus malate dehydrogenase Mdh
FT                   SW:MDH_METFE (P16142) (339 aa) fasta scores: E(): 3.8e-26,
FT                   30.247% id in 324 aa"
FT                   /db_xref="PSEUDO:CAE40425.1"
FT   misc_feature    complement(join(46997..47479,47475..47981))
FT                   /note="HMMPfam hit to PF02615, Malate/L-lactate
FT                   dehydrogenase"
FT   variation       complement(47476..47485)
FT                   /note="(GCCGC)2 in pertussis; (GCCGC)3 in parapertussis"
FT   CDS_pept        48148..49395
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="BP0047"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="Similar to Pseudomonas putida
FT                   homoserine-ortho-acyltransferase MetX TR:AAK49778
FT                   (EMBL:AY028975) (358 aa) fasta scores: E(): 4.6e-66,
FT                   55.108% id in 323 aa, and to Neisseria meningitidis
FT                   homoserine O-acetyltransferase MetX or nmb0940
FT                   SW:METX_NEIMB (Q9JZQ5) (379 aa) fasta scores: E(): 1.7e-88,
FT                   58.839% id in 379 aa"
FT                   /db_xref="GOA:Q7W0P6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0P6"
FT                   /protein_id="CAE40426.1"
FT                   /translation="MTNPVLNPALPAMAAAPVAATPSAVGSAGIVAPVFLRFDEPLPLA
FT                   SGQTLNGYELAIETYGTLNAQRTNAVLVCHALNASHHVAGVSADNPKDVGWWDNMVGPG
FT                   KPVDTNRYFVIGVNNLGSCFGSTGPASINPATGRPWGAAFPVLTVEDWVRAQARVADHF
FT                   GIERFAAVMGGSLGGMQALSWAITCPQRVANCVVVASTPRLSAQNIGFNEVARRAIITD
FT                   PDFHGGDYYAHGTVPGRGLSVARMIGHITYLSDDDMAEKFGRTRREPAADGAYRYGYDV
FT                   EFEVESYLRYQGEKFSRYFDANTYLLITRALDYFDPARATGGDLARALAPATADFLLVS
FT                   FSTDWRFPPERSREMVRALLKNGSPVTYAEIDAPHGHDAFLLDDARYHAVVRGYYERIA
FT                   RELGLNGAVAPEGNSA"
FT   misc_feature    48148..48225
FT                   /note="Signal peptide predicted for BP0047 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.992) with cleavage site
FT                   probability 0.412 between residues 26 and 27"
FT   misc_feature    48481..49332
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold"
FT   CDS_pept        49392..50006
FT                   /transl_table=11
FT                   /locus_tag="BP0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Neisseria meningitidis hypothetical
FT                   protein Nmb0939 TR:Q9JZQ6 (EMBL:AE002445) (193 aa) fasta
FT                   scores: E(): 8.9e-38, 56.085% id in 189 aa, and to
FT                   Pseudomonas aeruginosa hypothetical protein Pa0389
FT                   TR:Q9I6A6 (EMBL:AE004476) (206 aa) fasta scores: E():
FT                   6.1e-35, 48.705% id in 193 aa"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0P5"
FT                   /protein_id="CAE40427.1"
FT                   /translation="MSPVSARFEPAALRPDLARIAGWIEPGSRVLDLGCGDGALLAYLR
FT                   DHRQVRGAGVEIDDNYVIACVQRGVEVIQQNLEDGLALFDDQQFDTVVLSQTLQSMHRT
FT                   EHILREMARVARHGVVSFPNFGYWPHGWSILRGRMPVTGQMPYQWYNTPNIHLCTLRDF
FT                   EDLAGTLGLRILQRATFNEGREVRVFPSWRSTLALYRFAAS"
FT   repeat_region   50040..50071
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   50040..51092
FT   CDS_pept        50142..51092
FT                   /transl_table=11
FT                   /locus_tag="BP0049"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA4"
FT                   /protein_id="CAE40428.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIPPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   misc_feature    50400..50465
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    50523..51056
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(51061..51092)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        51180..52391
FT                   /transl_table=11
FT                   /gene="ampG"
FT                   /locus_tag="BP0050"
FT                   /product="putative integral membrane signal transducer
FT                   protein"
FT                   /note="Similar to Escherichia coli AmpG protein or b0433 or
FT                   z0536 or ecs0487 SW:AMPG_ECOLI (P36670) (491 aa) fasta
FT                   scores: E(): 2.6e-88, 61.168% id in 394 aa, and to
FT                   Neisseria meningitidis putative integral membrane signal
FT                   transducer protein nma2127 TR:Q9JSU7 (EMBL:AL162758) (427
FT                   aa) fasta scores: E(): 1.9e-44, 42.711% id in 391 aa"
FT                   /db_xref="GOA:Q7W0P4"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0P4"
FT                   /protein_id="CAE40429.1"
FT                   /translation="MAPLLVLGFASGLPLALSSGTLQAWATVENVSLQSIGFLTLAGTA
FT                   YTLKFLWAPLIDRYVPPFLGRRRGWMLLTQVLLAAAIMVMGMLSPGSALLPLALVAVLV
FT                   AFLSASQDIAFDAYSTDVLRQEERGAGAAMRVMGYRLAMIVSGGLALIVADRWLGWGNT
FT                   YVLMGGLMLACALGTLWAPEPERPANPPRDLGAAVVEPFREFFSRRGAIDMLLLIVLYK
FT                   LGDAFAGALSTTFLLRGAGFSATEVGTVNKVLGLAATIVGALAGGSIMTRWGLYRSLMA
FT                   FGLLQAVSNLGYWLIAVSPKNLYLMGLAVGVENLCGGLGTASFVALLMAMCRQQFSATQ
FT                   FALLSALAAVGRTYLAGPLTPVLVEWLDWPGFFIVTVLIALPGLWLLRLRRNVIDELDA
FT                   QTAR"
FT   misc_feature    51180..51257
FT                   /note="Signal peptide predicted for BP0050 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.441 between residues 26 and 27"
FT   misc_feature    join(51192..51260,51288..51347,51384..51443,51456..51524,
FT                   51585..51641,51651..51719,51822..51890,51918..51986,
FT                   51999..52067,52095..52163,52200..52268,52278..52346)
FT                   /note="12 probable transmembrane helices predicted for
FT                   BP0050 by TMHMM2.0 at aa 5-27, 37-56, 69-88, 93-115,
FT                   136-154, 158-180, 215-237, 247-269, 274-296, 306-328,
FT                   341-363 and 367-389"
FT   CDS_pept        join(52503..53204,53206..53565)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0051"
FT                   /product="outer membrane porin protein precursor
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 234. The frameshift occurs within
FT                   a homopolymeric tract of (T)3. The sequence has been
FT                   checked and believed to be correct. Similar to Bordetella
FT                   pertussis outer membrane porin protein precursor
FT                   SW:OMP_BORPE (Q04064) (385 aa) fasta scores: E(): 1.2e-13,
FT                   31.726% id in 394 aa, and to Burkholderia cepacia porin
FT                   protein OpcP1 TR:Q45106 (EMBL:D63823) (361 aa) fasta
FT                   scores: E(): 1.3e-21, 33.073% id in 384 aa"
FT                   /db_xref="PSEUDO:CAE40430.1"
FT   misc_feature    52503..52562
FT                   /note="Signal peptide predicted for BP0051 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 20 and 41"
FT   misc_feature    52512..52580
FT                   /note="1 probable transmembrane helix predicted for BP0051
FT                   by TMHMM2.0 at aa 23-45"
FT   misc_feature    52656..52850
FT                   /note="HMMPfam hit to PF00267, Gram-negative porin"
FT   variation       53202..53204
FT                   /note="(T)3 in pertussis; TTCAT in parapertussis and
FT                   bronchiseptica"
FT   CDS_pept        complement(53623..54357)
FT                   /transl_table=11
FT                   /locus_tag="BP0053"
FT                   /product="putative aspartate/glutamate racemase"
FT                   /note="Similar to Desulfurococcus sp aspartate racemase
FT                   TR:P71164 (EMBL:D84067) (235 aa) fasta scores: E():
FT                   8.8e-20, 34.529% id in 223 aa, and to Pyrococcus abyssi
FT                   aspartate racemase RacD-1 or PAB0912 TR:Q9UYY1
FT                   (EMBL:AJ248287) (228 aa) fasta scores: E(): 2.3e-20,
FT                   32.479% id in 234 aa. Its C-terminus is similar to BP1272,
FT                   55.140% identity (55.140% ungapped) in 107 aa overlap."
FT                   /db_xref="GOA:Q7W0P3"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0P3"
FT                   /protein_id="CAE40431.1"
FT                   /translation="MPSDDDKQFEGRFLGVLGGMGPMAGASFMQRLVALTEAACDQQHV
FT                   PAILWNDPRVPDRPAGQSGQGADPLPWMRHGIRRLEQAGATAIAIPCNTAHVWYPQLAQ
FT                   SASVPVLHIVEAVLDDLRRQGIHAGRVGLLATATTLRLGLYQHEMLAQGYEPVVPPVDL
FT                   IDGLCAQSIRLVKQNLLPQALPPALACIDSLRAMGVDAIVLGCTELPLALPHALRAELG
FT                   VAMTDSIDALALAGLGWYRRGG"
FT   misc_feature    complement(53644..54330)
FT                   /note="HMMPfam hit to PF01177, Asp/Glu/Hydontoin racemase"
FT   misc_feature    complement(54067..54093)
FT                   /note="ScanRegExp hit to PS00923, Aspartate and glutamate
FT                   racemases signature 1."
FT   CDS_pept        complement(54363..54953)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="gltL"
FT                   /locus_tag="BP0054"
FT                   /product="glutamate/aspartate transport ATP-binding protein
FT                   (pseudogene)"
FT                   /note="Pseudogene. Similar to Escherichia coli
FT                   glutamate/aspartate transport ATP-binding protein GltL or
FT                   b0652 or z0802 or ecs0691 SW:GLTL_ECOLI (P41076) (241 aa)
FT                   fasta scores: E(): 4e-26, 60.744% id in 242 aa, and to
FT                   Pseudomonas aeruginosa probable ATP-binding component of
FT                   ABC transporter pa1339 TR:Q9I405 (EMBL:AE004563) (244 aa)
FT                   fasta scores: E(): 3.5e-28, 61.066% id in 244 aa. This CDS
FT                   contains an internal deletion relative to its orthologues.
FT                   Similar to several B. pertussis CDSs: BP1181, P3828,
FT                   BP1534, BP1855, BP1575, BP1362, BP0768, and BP1510."
FT                   /db_xref="PSEUDO:CAE40432.1"
FT   misc_feature    complement(54462..54875)
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    complement(54645..54689)
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   misc_feature    complement(54831..54854)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        complement(54978..55667)
FT                   /transl_table=11
FT                   /gene="gltK"
FT                   /locus_tag="BP0055"
FT                   /product="glutamate/aspartate transport system permease
FT                   protein"
FT                   /note="Similar to Escherichia coli glutamate/aspartate
FT                   transport system permease protein GltK or b0653 or z0803 or
FT                   ecs0692 SW:GLTK_ECOLI (P41075) (224 aa) fasta scores: E():
FT                   1.9e-38, 51.339% id in 224 aa, and to Pseudomonas
FT                   aeruginosa probable permease of ABC transporter pa1340
FT                   TR:Q9I404 (EMBL:AE004563) (222 aa) fasta scores: E():
FT                   1.7e-37, 52.915% id in 223 aa. Similar to BP0767, 56.696%
FT                   identity in 224 aa overlap"
FT                   /db_xref="GOA:Q7W0P2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030205"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0P2"
FT                   /protein_id="CAE40433.1"
FT                   /translation="MNEFDFDVIGRSLGYLFRDGMVFTLKLTFLSTAMGLALGTLLAMC
FT                   RLSGIKPLSAVAAAYVNGLRALPLILVIFWFYFLVPYIGGWLTGAGRPLQVGGFTSALI
FT                   TFTLFEAAYFCEIMRAGIQSIPRGQTSAAYAIGLNYWQTMAYVVLPQALRNMAPVLLTQ
FT                   TIVLFQDTSLVYVLSLTDFLGAGINVAQRDNRLVEMYLFVAAVYFVMSFAASRFVHYLQ
FT                   QRNTMAA"
FT   misc_feature    complement(join(55014..55079,55101..55166,55212..55277,
FT                   55317..55382,55413..55478,55542..55607))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP0055 by TMHMM2.0 at aa 20-42, 63-85, 95-117, 130-152,
FT                   167-189 and 196-218"
FT   misc_feature    complement(55092..55307)
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   CDS_pept        complement(55664..56458)
FT                   /transl_table=11
FT                   /gene="gltJ"
FT                   /locus_tag="BP0056"
FT                   /product="glutamate/aspartate transport system permease
FT                   protein"
FT                   /note="Similar to Escherichia coli glutamate/aspartate
FT                   transport system permease protein GltJ or b0654
FT                   SW:GLTJ_ECOLI (P41074) (246 aa) fasta scores: E(): 1.6e-40,
FT                   42.623% id in 244 aa, and to Pseudomonas aeruginosa
FT                   probable permease of ABC transporter PA1341 TR:Q9I403
FT                   (EMBL:AE004563) (248 aa) fasta scores: E(): 6e-44, 47.737%
FT                   id in 243 aa. Similar to BP0766 57.759% identity (58.515%
FT                   ungapped) in 232 aa overlap"
FT                   /db_xref="GOA:Q7W0P1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030202"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0P1"
FT                   /protein_id="CAE40434.1"
FT                   /translation="MPSRLRSLDTTMNYNWNWHIFLEMSPTGGIYLGTLLTGMAWTLGT
FT                   AALAWILALGIGIVVGVARTTQSKWARILGATYVEFFRNIPLLVQMFLWYFVVPEILPV
FT                   QLGDAIKSIPPPWGIFIPAVLCLGFYTSSRVAEQVRAGIESRPARQRMAATALGMRPSQ
FT                   VYRYVLLPTSFRIILPPLTSELLNLIKNTSVAFTIGLLELVGAARSMQEFSFQVFEAFA
FT                   GATLCYFLLNLIVLRAMRYIETRLAVPGFIGPVSATTKLAPT"
FT   misc_feature    complement(join(55751..55807,55838..55903,56069..56119,
FT                   56165..56230,56270..56320,56333..56398))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP0056 by TMHMM2.0 at aa 20-42, 46-63, 76-98, 113-130,
FT                   185-207 and 217-236"
FT   misc_feature    complement(55802..56035)
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   misc_feature    complement(55952..56017)
FT                   /note="Predicted helix-turn-helix motif with score 1318
FT                   (+3.68 SD) at aa 148-169, sequence ARQRMAATALGMRPSQVYRYVL"
FT   CDS_pept        complement(56505..57404)
FT                   /transl_table=11
FT                   /locus_tag="BP0057"
FT                   /product="amino-acid ABC transporter binding protein
FT                   precursor"
FT                   /note="Similar to Escherichia coli amino-acid ABC
FT                   transporter binding protein precursor YbeJ or b0655
FT                   SW:YBEJ_ECOLI (P37902) (302 aa) fasta scores: E(): 2.3e-48,
FT                   45.263% id in 285 aa, and to Pseudomonas aeruginosa
FT                   probable binding protein component of ABC transporter
FT                   PA1342 TR:Q9I402 (EMBL:AE004563) (302 aa) fasta scores:
FT                   E(): 3.4e-51, 48.658% id in 298 aa. Similar to BP0765
FT                   51.325% identity (52.013% ungapped) in 302 aa overlap"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0P0"
FT                   /protein_id="CAE40435.1"
FT                   /translation="MKISTVFFAALVGVAASAPAHAEGRLDKIKSSGTITIGHRDASIP
FT                   FSYLDDKQKPIGYSMEICEKAVEAIKAKLGMAQIKVNLVPVTSSTRIPLVANGTVDLVC
FT                   GSATNTVERQQQVAFAPTTFVTATRFAAKKSSNLKKLDDMKGKTVVSTAGTSNIRWLTQ
FT                   ANEKDSLDMRIIPTKDHPAAMLTVANGRAAAFFMDDVLLAGLVATERKPDEWMISEDTY
FT                   TVEPYALILPKDDPAFKKVVDDTVTGMMRDGSLAKLYKKWFESPIPPRNVNLHLPMSAA
FT                   LQRVIANPTDSADPATYR"
FT   misc_feature    complement(56610..57302)
FT                   /note="HMMPfam hit to PF00497, Bacterial extracellular
FT                   solute-binding proteins, family 3"
FT   misc_feature    complement(57339..57404)
FT                   /note="Signal peptide predicted for BP0057 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 22 and 23"
FT   CDS_pept        complement(57498..58448)
FT                   /transl_table=11
FT                   /locus_tag="BP0058"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTC0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTC0"
FT                   /protein_id="CAE40436.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHN"
FT   repeat_region   57498..57529
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(57498..58550)
FT   misc_feature    complement(57534..58067)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(58125..58190)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   repeat_region   complement(58519..58550)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        join(58550..58981,58983..59102)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0059"
FT                   /product="regulatory protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. Similar to Thiobacillus denitrificans
FT                   regulatory protein CbbR TR:Q9APD4 (EMBL:AF307090) (316 aa)
FT                   fasta scores: E(): 0.00013, 28.148% id in 135 aa, and to
FT                   Streptomyces coelicolor putative LysR-family
FT                   transcriptional regulatory protein scm1.22C TR:Q9RD21
FT                   (EMBL:AL133422) (301 aa) fasta scores: E(): 0.00026,
FT                   29.448% id in 163 aa"
FT   CDS_pept        complement(59249..60475)
FT                   /transl_table=11
FT                   /locus_tag="BP0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Caulobacter crescentus hypothetical
FT                   protein Cc2770 TR:Q9A4R0 (EMBL:AE005942) (435 aa) fasta
FT                   scores: E(): 1.6e-10, 28.947% id in 418 aa, and to Erwinia
FT                   amylovora hypothetical 47.8 kDa protein TR:Q9F814
FT                   (EMBL:AF264948) (427 aa) fasta scores: E(): 2.6e-05,
FT                   28.453% id in 362 aa"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0N9"
FT                   /protein_id="CAE40438.1"
FT                   /translation="MATKSLRRQDLEVHLGSTGQVVGRLYLGSGKRSAFSYDERWLRDA
FT                   RFFTLSPDLLPVLSVQHPQEVFFRALEDTAPDSWGERVIRRAHARLRQQDGETPPLEPV
FT                   DFLMWVDDEARVGALRLFDPHAKVYLRSGATPGHVPPLVELDKVVQAARALEAGTETAR
FT                   DLQYLLGQGTSLGGARPKSSVRDTDGRLALGKFPSQADRRDVIRGEVLAMHLAAKAGIK
FT                   VAAARVELIGGTAVAIIRRFDRTDDGGRIPYVSAATMLQSDGRDTVHAYTELVDVLLRE
FT                   GADPIADIHQLWRRLVLNFLICNTDDHLRNTGFLYDSRNHGWRLSPAFDLNPMPGDRRE
FT                   SKTWLTEDSGPIESRDMLMEGAPYFRLAAEEAAAIWTEVAQAVGSWRVVARGLGMQGTD
FT                   LVDFEPAFA"
FT   CDS_pept        complement(60475..60894)
FT                   /transl_table=11
FT                   /locus_tag="BP0061"
FT                   /product="putative DNA-binding protein"
FT                   /note="Similar to Caulobacter crescentus transcriptional
FT                   regulator Cro/ci family cc2771 TR:Q9A4Q9 (EMBL:AE005942)
FT                   (119 aa) fasta scores: E(): 0.001, 36.458% id in 96 aa, and
FT                   to Bradyrhizobium japonicum Id619 TR:Q9AN22 (EMBL:AF322013)
FT                   (83 aa) fasta scores: E(): 0.11, 34.328% id in 67 aa"
FT                   /db_xref="GOA:Q7W0N8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0N8"
FT                   /protein_id="CAE40439.1"
FT                   /translation="MRMPTSEQRNCSPRVAMPRPVERALQRLGQDISTARRVRRLSQED
FT                   LAQRVGTSLSTVRRMEDGHPGTALHTFLRALHVLGRLDDVLRVMATENDVLGMELVREQ
FT                   LPQRVRTVRGSKPRVGHSAAVKEGASDDADELEGF"
FT   misc_feature    complement(60637..60801)
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix"
FT   misc_feature    complement(60709..60774)
FT                   /note="Predicted helix-turn-helix motif with score 2078
FT                   (+6.26 SD) at aa 41-62, sequence LSQEDLAQRVGTSLSTVRRMED"
FT   CDS_pept        complement(61078..62019)
FT                   /transl_table=11
FT                   /locus_tag="BP0062"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0N7"
FT                   /protein_id="CAE40440.1"
FT                   /translation="MDTELPSLEHADGGAVIGGAVPELTRAFRMPEAEFRCDFLWDSRL
FT                   VSRPRLLGAFRIRQIAALMLDWLSSEAEVLKRIVANRQALASTMYFALDSAFPYPEHAF
FT                   AQSVYVGINIPRAKLQLSPDQRPGDVDCLIVPFSDNEILLERTIAIEAKIVRPSISNPG
FT                   RNANTMGRAQVRGLLCYGFPFVGLVHISVPESMPSHMHWEVPEISDIAGSNGELIETGE
FT                   YFIFDPFPLASARRQEGRVLALGLPVEVGYRVIALTLSNNGERFCGFTIGEARAGARNP
FT                   VVSHRVLEAVRMLLTTEPHLFEVVHWFNEVGT"
FT   misc_feature    complement(61128..68983)
FT                   /note="low %GC region"
FT   CDS_pept        join(<62059..62328,62328..62411)
FT                   /transl_table=11
FT                   /locus_tag="BP0063A"
FT                   /product="putative transposase (partial)"
FT                   /note="Similar to the C-terminal regions of Desulfovibrio
FT                   vulgaris transposase OrfB SWALL:O31218 (EMBL:AF034211) (310
FT                   aa) fasta scores: E(): 6.6e-09, 51.47% id in 68 aa, and to
FT                   Yersinia enterocolitica is1400 transposase B Trp1400B
FT                   SWALL:Q9X9H9 (EMBL:AJ132945) (294 aa) fasta scores: E():
FT                   1.2e-08, 50% id in 68 aa"
FT                   /db_xref="GOA:Q7W0N6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0N6"
FT                   /protein_id="CAE40441.1"
FT                   /translation="KGIAIRYIQPGKPNQNAFIERFNRTYRTEVLDAHLFANLELVQAI
FT                   TDQWLVDYNQYPSAQIAGRPPADAIHAPVNPRSGRLSDNVYLTGGGLRQQTLMAHCLCL
FT                   DQGPFERPSWSLF"
FT   CDS_pept        complement(62443..63279)
FT                   /transl_table=11
FT                   /locus_tag="BP0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical 29.4
FT                   kDa protein TR:Q9RPF6 (EMBL:AF161263) (281 aa) fasta
FT                   scores: E(): 1.1e-29, 35.294% id in 272 aa, and to
FT                   Variovorax paradoxus 2,4-diphenoxyacetic acid gene cluster
FT                   TR:Q9RHQ7 (EMBL:AB028643) (337 aa) fasta scores: E():
FT                   3.4e-28, 34.572% id in 269 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0N5"
FT                   /protein_id="CAE40442.1"
FT                   /translation="MGRALAEQLGRELKQPVIVVNRSGAAGNIGAASVARADNDGYTLL
FT                   MTSAPFAIAPAIFPDLSFHPIKDFTAITQISMVPLLVVTRANSPLNSISDLVAAAKQNE
FT                   DSISFATFGVASPPHLAGQKIQELAGMKMLHIPYKGGSEAITELLSGQVSIGILDVISM
FT                   MPMVKDGKLKALAITGPVRAQALPDVPTLVEAGISYDDVGWFGLFAPAGLSPAITQILN
FT                   VAVNKILAKPEMQKLVVASSTVPITPSTSPGEWQALFNENVRAWGASATEALKEDE"
FT   CDS_pept        complement(63474..64055)
FT                   /transl_table=11
FT                   /locus_tag="BP0064"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein PA4336 TR:Q9HW65 (EMBL:AE004850) (194 aa) fasta
FT                   scores: E(): 5.5e-52, 66.492% id in 191 aa, and to
FT                   Agrobacterium tumefaciens Agr_l_853p agr_l_853 TR:AAK88998
FT                   (EMBL:AE008241) (188 aa) fasta scores: E(): 3.3e-49,
FT                   63.102% id in 187 aa. Also similar to BP1542, 65.104%
FT                   identity (65.104% ungapped) in 192 aa overlap."
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0N4"
FT                   /protein_id="CAE40443.1"
FT                   /translation="MARKLLMLVGDYVEDYEVMVPFQAFQALGYQVDAVCPDKAAGDYV
FT                   MTAVHDFEGAQTYSEKPGHRFTLNASFDQIEMEKYDGLVIPGGRAPEYLRLNSKLLALV
FT                   RYFFEAEKPVACICHGIQILSTAGVLEGYKCACYNTCAPEVTAAGGTYVDIPMDEAITD
FT                   RNLVTAFAWPSHPAWIAQFATLLGTKITHN"
FT   misc_feature    complement(63495..64049)
FT                   /note="HMMPfam hit to PF01965, ThiJ/PfpI family"
FT   CDS_pept        complement(64068..64370)
FT                   /transl_table=11
FT                   /locus_tag="BP0065"
FT                   /product="putative ferredoxin"
FT                   /note="Similar to Marinosulfonomonas methylotropha
FT                   ferredoxin TR:AAK84303 (EMBL:AF354805) (123 aa) fasta
FT                   scores: E(): 1.8e-07, 35.955% id in 89 aa, and to
FT                   Burkholderia cepacia Tbc2C monooxygenase TR:Q9EZN9
FT                   (EMBL:AF282898) (111 aa) fasta scores: E(): 3.6e-07,
FT                   34.694% id in 98 aa"
FT                   /db_xref="GOA:Q7W0N3"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0N3"
FT                   /protein_id="CAE40444.1"
FT                   /translation="MVKACEENEIREGDIVEKKINGLDIILMRNGEQFFAAQAICPHMD
FT                   EKLCNGLFKKTKLICTKHLWQWDLETGKPLGAAEKPIQIYKTTVKEGIVYVGVDN"
FT   misc_feature    complement(64137..64313)
FT                   /note="HMMPfam hit to PF00355, Rieske [2Fe-2S] domain"
FT   CDS_pept        complement(64489..65550)
FT                   /transl_table=11
FT                   /locus_tag="BP0066"
FT                   /product="oxidoreductase"
FT                   /note="Similar to Marinosulfonomonas methylotropha
FT                   reductase TR:AAK84310 (EMBL:AF360864) (364 aa) fasta
FT                   scores: E(): 3.5e-26, 29.830% id in 352 aa, and to
FT                   Alcaligenes faecalis ferredoxin reductase phnaA TR:Q9WXG6
FT                   (EMBL:AB024945) (342 aa) fasta scores: E(): 3.5e-20,
FT                   29.167% id in 336 aa"
FT                   /db_xref="GOA:Q7W0N2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0N2"
FT                   /protein_id="CAE40445.1"
FT                   /translation="MMQQEQRILFKNDVGDYAAVAAGEESVLQAGLRQSVPLNYHCASG
FT                   SCGSCKARLIQGALKVYTGTDFIQVSHSAGQACECPEVHLCQSHAVSDCVFEALYDKNV
FT                   PPDLAAPKHYAASLNDVRPLGSGLYRLLVDLDDSIRFLPGQYVMLATKAGGRARAYSVA
FT                   NFAQDSRQLEFILSCNPNGAMSPQLCDINNIGMQLQGYGPLGKAYIRPKKDNELVMLVG
FT                   GSGVSVALSTLEWAISSHYIDDRHLTIFWGVRDTSPIDLIGVFNRYAAVHSNLRVAVCS
FT                   DISPSVQDRGRFPYIEFFTGYPADHIVNDASISWEGKEVYISGPPPMVDHTIRQLMINT
FT                   EIDALDIECDSFV"
FT   misc_feature    complement(64546..64911)
FT                   /note="HMMPfam hit to PF00175, Oxidoreductase NAD-binding
FT                   domain"
FT   misc_feature    complement(65299..65532)
FT                   /note="HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster
FT                   binding domain"
FT   misc_feature    complement(65401..65427)
FT                   /note="ScanRegExp hit to PS00197, 2Fe-2S ferredoxins,
FT                   iron-sulfur binding region signature."
FT   CDS_pept        complement(65582..66775)
FT                   /transl_table=11
FT                   /locus_tag="BP0067"
FT                   /product="integral membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   C4-dicarboxylate transporter pa0886 TR:Q9I559
FT                   (EMBL:AE004523) (427 aa) fasta scores: E(): 2.3e-37,
FT                   32.812% id in 384 aa, and to Pseudomonas stutzeri probable
FT                   C4-dicarboxylate transporter DctM TR:CAC44173
FT                   (EMBL:AJ313422) (426 aa) fasta scores: E(): 1.3e-36,
FT                   32.041% id in 387 aa"
FT                   /db_xref="GOA:Q7W0N1"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0N1"
FT                   /protein_id="CAE40446.1"
FT                   /translation="MAATSYWVIDYPLMSMGLTSIDSLKNYTFLAVPLFIATGDLLTAG
FT                   GVSQQLIKFSRAVIRAVPGRTAATSVLASGMFCAISGSSAAAAATMGKLMAPEFKRAQI
FT                   PMRRGGATVAAGGILGGLIPPSTIIIIYSLTVNVSPVELNLAAILPGILILLFIFFVSI
FT                   MRTRQYEPASKSTDGYFKEVGTSVLGATPAFIAIALLFVGLYSGLFSPTEAAGVVTIYC
FT                   AVIGLYWSSQFGIRDIPKILMESASVTGIIGPIVVFSIQFQQILSVMEIPDLILVQLVE
FT                   LSSAYGATVTLAVMMGIVLLFGTFMEVIAVILILAPIFAPIATEIGMNGVHWGMIFIIG
FT                   ASIGFISPPHGLNLFITSMTMKIDYGELMAEIVRMIIPILVAWLIVAAFPYISLVFV"
FT   misc_feature    complement(join(65600..65665,65705..65770,65816..65881,
FT                   66083..66148,66161..66226,66287..66352,66383..66448,
FT                   66512..66577,66623..66688))
FT                   /note="9 probable transmembrane helices predicted for
FT                   BP0067 by TMHMM2.0 at aa 29-51, 66-88, 109-131, 141-163,
FT                   183-205, 209-231, 298-320, 335-357 and 370-392"
FT   CDS_pept        complement(join(66884..67270,67273..67422))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0068"
FT                   /product="putative membrane protein (pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 50. Similar to Caulobacter
FT                   crescentus hypothetical protein Cc1447 TR:Q9A8A7
FT                   (EMBL:AE005819) (139 aa) fasta scores: E(): 0.83, 28.155%
FT                   id in 103 aa, and to Bacillus halodurans C4-dicarboxylate
FT                   transport system bh2672 TR:Q9K9H5 (EMBL:AP001516) (183 aa)
FT                   fasta scores: E(): 0.25, 24.528% id in 106 aa"
FT                   /db_xref="PSEUDO:CAE40447.1"
FT   misc_feature    complement(join(66959..67015,67052..67117))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BP0068 by TMHMM2.0 at aa 45-67 and 79-98"
FT   variation       complement(67269..67272)
FT                   /note="(TG)2 in pertussis; (TG)1 in bronchiseptica and
FT                   parapertussis"
FT   CDS_pept        complement(67483..68664)
FT                   /transl_table=11
FT                   /locus_tag="BP0069"
FT                   /product="putative exported protein"
FT                   /note="Similar to Escherichia coli putative ABC transporter
FT                   periplasmic binding protein YiaO precursor or b3579
FT                   SW:YIAO_ECOLI (P37676) (328 aa) fasta scores: E(): 2.2e-08,
FT                   27.046% id in 281 aa, and to Rhizobium meliloti putative
FT                   C4-dicarboxylate transporter periplasmic solute-binding
FT                   protein precursor smb20981 TR:CAC49506 (EMBL:AL603646) (325
FT                   aa) fasta scores: E(): 4.9e-10, 26.761% id in 284 aa"
FT                   /db_xref="GOA:Q7W0N0"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0N0"
FT                   /protein_id="CAE40448.1"
FT                   /translation="MTHSNHNSMRRSTLRKLTGLGMGTILTAGAGAAAVLAPFNSFAKS
FT                   EAKAAYRFRFGTIYTPSAAEYTAPGIYDFVERVQRKSDGEIAIQLIDKAQACSEDQCAQ
FT                   RVMSGILHMGSSTFQNTGATMPYSVALDWPFLWKSRVAYHNFLLSKESNRLYRDVLRNK
FT                   YGVVPLYASGSMRNIMMGKKYSEAADITSPDALNGAKIRITNSEMISNFAKSMGMAPIP
FT                   LAWGELLEGLKSGLVDATETYPSAAAGFGMYSVLSQDIDVQFCPGYSMIFMAAKTFDKL
FT                   PERLQELIYESAYESMVEAYQTSIIAESTLVGIGPNPSPDSAYQRGKIRQIKLSHEQHA
FT                   AFKESGSVENNSQLYANLRKQLDDIAGIDVYGALSEYAKNTSSTELMAEKWWT"
FT   misc_feature    complement(68536..68664)
FT                   /note="Signal peptide predicted for BP0069 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.837 between residues 43 and 44"
FT   misc_feature    complement(68548..68613)
FT                   /note="1 probable transmembrane helix predicted for BP0069
FT                   by TMHMM2.0 at aa 17-39"
FT   CDS_pept        complement(68685..68984)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0070"
FT                   /product="putative hydroxylase beta subunit (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. Similar to Methylosulfonomonas
FT                   methylovora hydroxylase beta subunit MsmB TR:Q9X405
FT                   (EMBL:AF091716) (181 aa) fasta scores: E(): 2.4, 26.923% id
FT                   in 104 aa, and to Pseudomonas aeruginosa ortho-halobenzoate
FT                   1,2-dioxygenase beta-isp protein OhbA ohbA TR:Q9Z5W2
FT                   (EMBL:AF121970) (176 aa) fasta scores: E(): 0.017, 22.581%
FT                   id in 93 aa"
FT   repeat_region   68984..69015
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   68984..70036
FT   CDS_pept        69086..70036
FT                   /transl_table=11
FT                   /locus_tag="BP0071"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTC0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTC0"
FT                   /protein_id="CAE40450.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHN"
FT   misc_feature    69344..69409
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    69467..70000
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(70005..70036)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        70130..70444
FT                   /transl_table=11
FT                   /locus_tag="BP0072"
FT                   /product="transposase"
FT                   /note="Similar to Rhizobium meliloti transposase for
FT                   insertion sequence element IsrM1 TR:CAC47072
FT                   (EMBL:AL591790) (123 aa) fasta scores: E(): 1.1, 21.212% id
FT                   in 99 aa, and to Caulobacter crescentus ISCC3 transposase
FT                   OrfA cc2728 or cc0625 or cc2657 TR:Q99QI0 (EMBL:AE005939)
FT                   (125 aa) fasta scores: E(): 1.2, 27.523% id in 109 aa"
FT                   /db_xref="GOA:Q7W0M9"
FT                   /db_xref="InterPro:IPR009534"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0M9"
FT                   /protein_id="CAE40451.1"
FT                   /translation="MSMKMEEDIKRWTAKRKSALVLDIIQGKTTVAEASRQYDLSPSEV
FT                   EQWVDDGKRGMENALRANPQDVREQYERQLKDMQEAYGEAMLELRARKKLQSLLGEDEK
FT                   "
FT   misc_feature    70214..70279
FT                   /note="Predicted helix-turn-helix motif with score 1232
FT                   (+3.38 SD) at aa 29-50, sequence TTVAEASRQYDLSPSEVEQWVD"
FT   repeat_region   70337..70541
FT                   /note="This region is repeated between positions
FT                   3018982..3019523"
FT   CDS_pept        70441..71259
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0073"
FT                   /product="transposase (pseudogene)"
FT                   /note="Pseudogene. This CDS lacks a stop codon. Similar to
FT                   Erwinia herbicola pvgypsophilae OrfB TR:Q9AMM1
FT                   (EMBL:AF324174) (274 aa) fasta scores: E(): 5.3e-13,
FT                   28.295% id in 258 aa, and to Caulobacter crescentus
FT                   insertion sequence IS511 orfA and orfB genes, complete CDS
FT                   cc2742 or cc0515 or cc2290 or cc2690 TR:Q45993
FT                   (EMBL:U39501) (308 aa) fasta scores: E(): 2.8e-14, 31.579%
FT                   id in 266 aa. Note that this CDS is highly similar to the
FT                   3'end of BP2842"
FT   misc_feature    70753..71250
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   70961..71287
FT                   /note="This region is repeated between positions
FT                   3018982..3019523"
FT   tRNA            complement(71391..71475)
FT                   /note="tRNA Leu anticodon CAA, Cove score 75.82"
FT   CDS_pept        71637..73544
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="BP0074"
FT                   /product="heat shock protein"
FT                   /note="Similar to Escherichia coli heat shock protein HtpG
FT                   or b0473 or z0590 or ecs0526 SW:HTPG_ECOLI (P10413) (624
FT                   aa) fasta scores: E(): 9.1e-145, 59.840% id in 625 aa, and
FT                   to Pseudomonas aeruginosa heat shock protein HtpG or pa1596
FT                   TR:Q9I3C5 (EMBL:AE004587) (634 aa) fasta scores: E():
FT                   9.7e-144, 58.003% id in 631 aa"
FT                   /db_xref="GOA:Q7W0M8"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0M8"
FT                   /protein_id="CAE40453.1"
FT                   /translation="MSQTTTTSASETLGFQAEVKQLLHLMIHSLYSNKEIFLRELVSNA
FT                   SDACDKLRFEAIDQPGLLEGDGELAIRVGYDKAARTITISDNGIGLSRDEAVANLGTIA
FT                   RSGTREFFSQLTGDKQKDAQLIGQFGVGFYSSFIVADKVTVLSRRAGLAANEAIRWESD
FT                   GQGEFSIAPAEKAGRGTDVVLHLRADEDELLNGWKLREILRRYSDHISLPIRMAKEDWD
FT                   AEKGEQVKGDELETVNQANALWTRNKSDITDEQYREFYKTVSHDYDDPLAWTHNRVEGR
FT                   SEYTQLLYVPKHAPFDLWDRDARRGVKLYVKRVFIMDDAEQLLPSYLRFVRGVIDSADL
FT                   PLNVSREILQESRDVRAIREGSAKRVLSLLEDMAENKAEDYATFWTEFGQVLKEGTGED
FT                   AANRERIARLLRFASTHDGEQAQTVSFADYVGRMKDGQDKIYYVTADTFTAAANSPHLE
FT                   IFRKKGIEVLLLSDRVDEWMLSYLREFDGKSLVSVAKGGLDLAELADEEEKKRQSEVAE
FT                   TFKPLVERLQQALAEQVKEVRVTQRLVDSPACVVVGQNELSPHLLRMLKAAGQEAPEVK
FT                   PVLEINPDHALVARIRDASDAEFGDWAALLLDQALLAEGAQIADPAAFVKRLNGLLLKA
FT                   "
FT   misc_feature    71727..71756
FT                   /note="ScanRegExp hit to PS00298, Heat shock hsp90 proteins
FT                   family signature. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   misc_feature    71733..72206
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, phytochrome-like ATPase"
FT   misc_feature    72210..72293
FT                   /note="HMMPfam hit to PF00183, Hsp90 protein"
FT   misc_feature    72324..73532
FT                   /note="HMMPfam hit to PF00183, Hsp90 protein"
FT   CDS_pept        complement(73706..74326)
FT                   /transl_table=11
FT                   /locus_tag="BP0075"
FT                   /product="probable glutathione S-transferase"
FT                   /note="Similar to Rhodococcus spAD45 glutathione
FT                   S-transferase IsoJ TR:Q9RBP3 (EMBL:AJ249207) (233 aa) fasta
FT                   scores: E(): 2.2e-12, 30.732% id in 205 aa, and to
FT                   Pseudomonas aeruginosa probable glutathione S-transferase
FT                   pa2813 TR:Q9I030 (EMBL:AE004708) (206 aa) fasta scores:
FT                   E(): 4.6e-39, 48.058% id in 206 aa"
FT                   /db_xref="GOA:Q7W0M7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0M7"
FT                   /protein_id="CAE40454.1"
FT                   /translation="MLKIWGRLSSVNVQKVMWAVRELALPHTFIEAGGQFGGLDTPEYL
FT                   RMNPNRKVPLIDDGGFILWESNAIVRYLGARYGEGAISPADPCVRADADRWMDWQTTEW
FT                   QPSMLAAFMGLVRTAPEQRDAAAIEASARQAGKIALMLENALAGRDFIAGPQFSMGDIA
FT                   LGCAAHRWLGLPVERPATPHISAWYRRLMMRPATQGILTLPLT"
FT   misc_feature    complement(73742..74323)
FT                   /note="HMMPfam hit to PF00043, Glutathione S-transferase,
FT                   C-terminal domain"
FT   CDS_pept        complement(74358..74939)
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="BP0076"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /note="Similar to Escherichia coli AmpD protein or b0110
FT                   SW:AMPD_ECOLI (P13016) (183 aa) fasta scores: E(): 5e-35,
FT                   51.977% id in 177 aa, and to Pseudomonas aeruginosa
FT                   N-acetyl-anhydromuramyl-L-alanine amidase AmpD or pa4522
FT                   TR:Q9ZGA0 (EMBL:AF082575) (188 aa) fasta scores: E():
FT                   1.9e-37, 58.960% id in 173 aa"
FT                   /db_xref="GOA:Q7W0M6"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0M6"
FT                   /protein_id="CAE40455.1"
FT                   /translation="MQRLLLDRHGWLIPGPAVTRAPSPNVNARPAGTQISLLVIHNISL
FT                   PPSQFGGPYVADLFLNRLDYSADPWLERLRGLHVSAHFFIRRDGAVIQFAATEARAWHA
FT                   GVSRFRGRDNCNDFSIGIELEGTDILPYADAQYATLARLAQVLRARYPLADARGHEHIA
FT                   PGRKTDPGRAFNWVRFGRESGFPRRNLPPV"
FT   misc_feature    complement(74406..74777)
FT                   /note="HMMPfam hit to PF01510, N-acetylmuramoyl-L-alanine
FT                   amidase"
FT   CDS_pept        complement(75028..75279)
FT                   /transl_table=11
FT                   /locus_tag="BP0077"
FT                   /product="putative exported protein"
FT                   /note="Similar to Pseudomonas stutzeri hypothetical 9.0 kDa
FT                   protein TR:Q9RLD2 (EMBL:AJ249642) (77 aa) fasta scores:
FT                   E(): 0.021, 33.333% id in 81 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0M5"
FT                   /protein_id="CAE40456.1"
FT                   /translation="MGKLIFWFVVILAVLFIARLAGARAASKRAPRAEPPRPAQDAASQ
FT                   PMVRCAHCGVHLPRSEAVLLGGQTWCSSDHARRGAERG"
FT   misc_feature    complement(75211..75267)
FT                   /note="1 probable transmembrane helix predicted for BP0077
FT                   by TMHMM2.0 at aa 4-23"
FT   misc_feature    complement(75211..75279)
FT                   /note="Signal peptide predicted for BP0077 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.991) with cleavage site
FT                   probability 0.486 between residues 23 and 24"
FT   CDS_pept        complement(75281..76123)
FT                   /transl_table=11
FT                   /locus_tag="BP0078"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Neisseria meningitidis hypothetical inner
FT                   membrane protein nma2189 TR:Q9JSQ1 (EMBL:AL162758) (268 aa)
FT                   fasta scores: E(): 2.2e-25, 37.184% id in 277 aa, and to
FT                   Azospirillum brasilense hypothetical 28.8 kDa protein in
FT                   nifR3-like 5'region SW:YNR3_AZOBR (P45674) (271 aa) fasta
FT                   scores: E(): 1.6e-13, 31.707% id in 287 aa"
FT                   /db_xref="GOA:Q7W0M4"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0M4"
FT                   /protein_id="CAE40457.1"
FT                   /translation="MSSGIVFHAVAALAYAVLAGSLWRRLQGRGSVDQASKLTRTGLLG
FT                   ALALHGVALQQAMLGTQHLYIGWALALSAAVWLGLVVFWLESLLIRIDGLQLLLLPAAA
FT                   IVTAIAALFPQAQLVPHANNPWLRAHLLIALAAYGLITIAALHAMLMALLDRHLHRPLD
FT                   APAERSIVGRVLDAQPPLLVQERLLFRVIWIGFVVLTLAVGSGSVASITLTGKFLPFDH
FT                   KTIFTLLSWATFGVLLLGRHICGWRGRVALRWTLTGFAFLILAYTGSRFVLEVILHRG"
FT   misc_feature    complement(join(75308..75373,75395..75451,75482..75547,
FT                   75671..75736,75767..75832,75869..75934,75947..75997,
FT                   76061..76126))
FT                   /note="8 probable transmembrane helices predicted for
FT                   BP0078 by TMHMM2.0 at aa 26-48, 69-86, 90-112, 124-146,
FT                   156-178, 219-241, 251-270 and 277-299"
FT   CDS_pept        76229..77638
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="BP0079"
FT                   /product="signal recognition particle protein"
FT                   /note="Similar to Escherichia coli signal recognition
FT                   particle protein Ffh or b2610 or z3904 or ecs3473
FT                   SW:SR54_ECOLI (P07019) (453 aa) fasta scores: E(): 1.4e-68,
FT                   63.169% id in 467 aa, and to Neisseria meningitidis signal
FT                   recognition particle protein Ffh TR:Q9JPK6 (EMBL:AJ391261)
FT                   (456 aa) fasta scores: E(): 2.4e-71, 63.539% id in 469 aa"
FT                   /db_xref="GOA:Q7W0M3"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0M3"
FT                   /protein_id="CAE40458.1"
FT                   /translation="MLDNLTQRLSRVVKTLRGEARLTEANTQEMLREVRMALLEADVAL
FT                   PVVRDFVARVKEKALGEEVAGSLSPGQALVGVVHKELTSLMGGDLGEHAGELSLATQPP
FT                   AVILMAGLQGAGKTTTTGKLARWLSEGQHVQGGRKTGKKKVLVVSADVYRPAAIEQLKT
FT                   VAAQVGVDFLPSDVSQKPEDIARNAIDHARRHHYDVLIVDTAGRLGIDEAMMREIRALH
FT                   DLVKPIETLFVVDAMQGQDAVNTARAFGDALPLTGVVLTKLDGDARGGAALSVRHVTGK
FT                   PLKFVGVSEKLDGLEPFHPERMAQRVLGMGDIVSLVEQAQKNIDIAEAQKLASKIKSGN
FT                   KFDLNDFRDQLDQVKKLGDMGSLLEKLPAQLQQAAGQLQGGQAEKQLRRTEGILNSMTP
FT                   GERAKPELIKASRKRRIAAGAGVPVQEVNRLLSQFEQMQGMMKQMKKGGMAKMMRAMGG
FT                   MKGLGRFGGMR"
FT   misc_feature    76307..77152
FT                   /note="HMMPfam hit to PF00448, SRP54-type protein, GTPase
FT                   domain"
FT   misc_feature    76559..76582
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    76985..77002
FT                   /note="ScanRegExp hit to PS00343, Gram-positive cocci
FT                   surface proteins 'anchoring' hexapeptide."
FT   misc_feature    77072..77113
FT                   /note="ScanRegExp hit to PS00300, SRP54-type proteins
FT                   GTP-binding domain signature."
FT   CDS_pept        complement(77635..78585)
FT                   /transl_table=11
FT                   /locus_tag="BP0080"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA3"
FT                   /protein_id="CAE40459.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   repeat_region   77635..77666
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(77635..78687)
FT   misc_feature    complement(77671..78204)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(78262..78327)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   repeat_region   complement(78656..78687)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        78687..79604
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0081"
FT                   /product="transposase for IS1002 (pseudogene)"
FT                   /note="transposase for IS1002. The N-terminal region of
FT                   this CDS has been deleted by the insertion of a IS481
FT                   element"
FT   repeat_region   78687..79604
FT                   /note="IS1002 element"
FT   misc_feature    78726..78791
FT                   /note="Predicted helix-turn-helix motif with score 1627
FT                   (+4.73 SD) at aa 6-27, sequence WTMRQASQAAGVSLRTGYKWLA"
FT   misc_feature    79032..79568
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(79579..79604)
FT                   /note="Inverted repeat for IS1002 element"
FT   CDS_pept        complement(79601..81475)
FT                   /transl_table=11
FT                   /gene="bplL"
FT                   /gene_synonym="wlbL"
FT                   /locus_tag="BP0082"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis DNA for lipopolysaccharide biosynthesis locus
FT                   BplL TR:Q45387 (EMBL:X90711) (624 aa) fasta scores: E(): 0,
FT                   100.000% id in 624 aa, and to Bordetella bronchiseptica
FT                   putative nucleotide sugar epimerase/dehydratase WlbL
FT                   TR:O87995 (EMBL:AJ007747) (624 aa) fasta scores: E(): 0,
FT                   99.679% id in 624 aa"
FT                   /db_xref="GOA:Q79H51"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H51"
FT                   /protein_id="CAE40461.1"
FT                   /translation="MTLPYAIRRLFVDLPRPFKQMLAIVLDAVILLGAFHLALWLRFEL
FT                   FFLTDQYLFLSLLACAGGIAALAAFGVYLYILRYMSERVLAAILGGIVVSVMVVTAGNT
FT                   FLQLATISRGVLVLYAALALVGLIGVRLIARKLLFPADHHMADPRTPVLIYGAGGAGSQ
FT                   LAMALRTGPHYRPVAMLDDDKRKHRLVVNGLRVYPPEQLPKLIDRHNIRQLLIAMPSAP
FT                   PKQIRSIVEAAEPYRLRIRLVPSMRELIDPTNGVRLRDVQVEDLLGRDPVAPIDTLLGR
FT                   CVTDRVVMVTGAGGSIGSELCRQILALRPRKLVLFEIAEPALYAIEQDLRQRIGERNIE
FT                   IAGVLGSVRDAAHCLAQLQEHGVQTIYHAAAYKHVPIVEHNVSEGIRTNAFGTLNMAET
FT                   AIQAGVLDFVLISTDKAVRPTNVMGASKRLAELILQAHAQIQDKTRFSMVRFGNVLGSS
FT                   GSVVPLFRRQILEGGPITLTHPEITRYFMTIPEAAQLVLQAGAMGESGSVFVLDMGEPV
FT                   LIRELAERMVRLYGLTVKNSDQPDGDIEIRITGLRPGEKLYEELLIGEDSRETLHPRIM
FT                   RATEYSLPYETLMGQLRMLDRSLQMCSPRQAAELLGQIVREYASVTYA"
FT   misc_feature    79605..94272
FT                   /note="Lipopolysaccharide biosynthesis locus"
FT   misc_feature    complement(79625..81211)
FT                   /note="HMMPfam hit to PF02719, Polysaccharide biosynthesis
FT                   protein"
FT   misc_feature    complement(79946..79981)
FT                   /note="ScanRegExp hit to PS00135, Serine proteases, trypsin
FT                   family, serine active site."
FT   misc_feature    complement(join(80963..81019,81080..81145,81158..81223,
FT                   81245..81310,81356..81412))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BP0082 by TMHMM2.0 at aa 21-40, 55-77, 84-106, 110-132 and
FT                   152-171"
FT   CDS_pept        complement(join(81524..82195,82198..82830))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="bplJ"
FT                   /gene_synonym="bplK"
FT                   /gene_synonym="wlbjK"
FT                   /locus_tag="BP0083"
FT                   /product="putative integral membrane protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 211. The frameshift occurs within
FT                   a (TG)2 polymeric tract. The sequence has been checked and
FT                   believed to be correct. Previously sequenced in Bordetella
FT                   pertussis as two separate CDSs, BplJ TR:Q45384
FT                   (EMBL:X90711) and bplK TR:Q45385 (EMBL:X90711). Similar to
FT                   Bordetella bronchiseptica putative integral membrane
FT                   protein WlbjK TR:O87996 (EMBL:AJ007747) (434 aa) fasta
FT                   scores: E(): 6e-171, 97.696% id in 434 aa"
FT                   /db_xref="PSEUDO:CAE40462.1"
FT   misc_feature    complement(join(81614..81679,81701..81766,81797..81853))
FT                   /note="3 probable transmembrane helices predicted for
FT                   BP0083 by TMHMM2.0 at aa 115-134, 144-166 and 173-195"
FT   misc_feature    complement(join(82171..82227,82297..82362,82408..82473,
FT                   82495..82560,82576..82632,82726..82791))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP0084 by TMHMM2.0 at aa 15-37, 68-87, 92-114, 121-143,
FT                   158-180 and 203-222"
FT   variation       complement(82196..82199)
FT                   /note="(TG)2 in pertussis; (TG)1 in parapertussis and
FT                   bronchiseptica"
FT   CDS_pept        complement(82823..83527)
FT                   /transl_table=11
FT                   /gene="bplI"
FT                   /gene_synonym="wlbI"
FT                   /locus_tag="BP0085"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis and Bordetella bronchiseptica DNA for
FT                   lipopolysaccharide biosynthesis locus BplI or WlbI
FT                   TR:Q45383 (EMBL:X90711) (233 aa) fasta scores: E():
FT                   6.6e-87, 100.000% id in 233 aa"
FT                   /db_xref="GOA:Q7W0M2"
FT                   /db_xref="InterPro:IPR021260"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0M2"
FT                   /protein_id="CAE40463.1"
FT                   /translation="MMTLLPLLVIASYSIIHLLEYLSYYARVAGRMAGKPVTGYAIQNA
FT                   TTTVTRFFYLALMPLLGFLVDKQVPTSLYLQMGLAAMFGAALLSLLGYWLRYSWIALLT
FT                   NAVRKRAGQPPLRVEEIRTALEAPASLPKKRIALLAAIVFLCYCLGVLLSYFFALVFHE
FT                   YRSTISQLSGLINGVATVLLTFVLEPRIAGIVDARPTHDVYHAIQAMLNGRLIAIGLLA
FT                   PALFFGVCIGFV"
FT   misc_feature    complement(join(82829..82894,82958..83023,83054..83119,
FT                   83228..83293,83333..83386,83450..83515))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP0085 by TMHMM2.0 at aa 4-26, 47-65, 78-100, 136-158,
FT                   168-190 and 211-233"
FT   CDS_pept        complement(83524..84696)
FT                   /transl_table=11
FT                   /gene="bplH"
FT                   /gene_synonym="wlbH"
FT                   /locus_tag="BP0086"
FT                   /product="putative glycosyl transferase"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   parapertussis putative glcnac transferase WlbH TR:O52848
FT                   (EMBL:AJ224768) (390 aa) fasta scores: E(): 1.1e-153,
FT                   99.487% id in 390 aa, and to Bordetella pertussis and B.
FT                   bronchiseptica hypothetical 42.8 kDa protein BplH or WlbH
FT                   TR:Q45386 (EMBL:X90711) (390 aa) fasta scores: E():
FT                   2.2e-154, 99.744% id in 390 aa"
FT                   /db_xref="GOA:Q79H50"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H50"
FT                   /protein_id="CAE40464.1"
FT                   /translation="MLSNVPSRQSPDFAQRTPARVALLGPARSIHTIRWANGLALRGLQ
FT                   VHLLSLETPDLSLYDERIVQYRLPWRAPLGYFLAAPRLRALLKRIDPDLLNVHYATGYG
FT                   LLARRARFSPVLLSAWGSDIYEFPNSSTWHKALLQRNLDHATALAATSHAMQREMRGLT
FT                   RRPIFVTPFGIDEALFQPAQSVQAPAADGPIVIGTVKALETHYGIDTLIQAFALLRQAL
FT                   AASQPGMAERLVLRIYGAGSQLQRLRAQAQAAHIANQVEFKGRIPHAEVPEALRALDVY
FT                   VALSRMDSFGVAILEACSCALPVVVSNADGPAEVVVDGKTGYIVAREDAHAAADRLQEL
FT                   VLNPELRQRLGAAGRARVLSEYTWSKSLDMMLDAYTETARLYRATQPASV"
FT   misc_feature    complement(83626..84162)
FT                   /note="HMMPfam hit to PF00534, Glycosyl transferases group
FT                   1"
FT   CDS_pept        complement(84892..85485)
FT                   /transl_table=11
FT                   /gene="bplG"
FT                   /gene_synonym="wlbG"
FT                   /locus_tag="BP0087"
FT                   /product="probable sugar transferase"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis DNA for lipopolysaccharide biosynthesis locus
FT                   BplG TR:Q45382 (EMBL:X90711) (197 aa) fasta scores: E():
FT                   2.6e-77, 100.000% id in 197 aa, and to Bordetella
FT                   bronchiseptica putative transferase WlbG TR:O87997
FT                   (EMBL:AJ007747) (197 aa) fasta scores: E(): 2.9e-76,
FT                   98.477% id in 197 aa"
FT                   /db_xref="GOA:Q79H49"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H49"
FT                   /protein_id="CAE40465.1"
FT                   /translation="MIKRLFDVVCSGLGLLALLPLLALIAIAIKLDSPGPVFFRQERVG
FT                   KDGVPFRIHKLRSMSVRQDPQAGQITVGADPRITRVGKWIRKWKLDELVQLIDVFTGSM
FT                   SLVGPRPEVPRYVVLYPDALRDLVLSVRPGITDPASIRFRNENEILGQSSDPERTYREI
FT                   ILPEKLRIQAEYVQTRTFLGDLKIIAHTLLAVAR"
FT   misc_feature    complement(84895..85479)
FT                   /note="HMMPfam hit to PF02397, Bacterial sugar transferase"
FT   misc_feature    complement(85399..85464)
FT                   /note="1 probable transmembrane helix predicted for BP0087
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    complement(85402..85485)
FT                   /note="Signal peptide predicted for BP0087 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.991) with cleavage site
FT                   probability 0.704 between residues 28 and 29"
FT   CDS_pept        complement(85482..86714)
FT                   /transl_table=11
FT                   /gene="bplF"
FT                   /gene_synonym="wlbF"
FT                   /locus_tag="BP0088"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis DNA for lipopolysaccharide biosynthesis locus
FT                   BplF TR:Q45381 (EMBL:X90711) (395 aa) fasta scores: E():
FT                   2.2e-156, 100.000% id in 395 aa, and to Bordetella
FT                   bronchiseptica putative amino-sugar biosynthesis protein
FT                   WlbF TR:O87998 (EMBL:AJ007747) (395 aa) fasta scores: E():
FT                   6.6e-154, 98.734% id in 395 aa"
FT                   /db_xref="GOA:Q7W0M1"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0M1"
FT                   /protein_id="CAE40466.1"
FT                   /translation="MPPAARLSLLQRSSTMSDFLPFALPDIGEAEIQAVTESMRSGWLT
FT                   TGPNAREFEREFAAYIGADVEAVAVNSATAGLHLALEAIGVGPGDEVITTTHTFTASAE
FT                   VARYLGAEPVLVDIDPATLCISPAAIERAITPRTRAIVPVHYGGLSCDMDSILEIARKH
FT                   GLKVIEDAAHALPASWQGRRIGSLESDLTVYSFYATKTLATGEGGMVVTRDPALAKRCR
FT                   VMRLHGIDRDAFDRFTSKKPAWYYEIVAPGFKYNMTDTAAAMGRVQLQRVQQMRDRRAQ
FT                   IAAAYDQAFADLPLTLPPGPGRTPGVERVAHRDDDEHSWHLYAIRIHPQAPLKCDDFIV
FT                   RMTENGIGCSVHYVPLHLQPYWRDRYGLTPDMYPHSQAAFEGMASLPIYSRMTDADVQR
FT                   VIASVRQLLRP"
FT   misc_feature    complement(85500..86642)
FT                   /note="HMMPfam hit to PF01041, DegT/DnrJ/EryC1/StrS family"
FT   CDS_pept        complement(86732..87991)
FT                   /transl_table=11
FT                   /gene="bplE"
FT                   /gene_synonym="wlbE"
FT                   /locus_tag="BP0089"
FT                   /product="probable glycosyl transferase"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis DNA for lipopolysaccharide biosynthesis locus
FT                   BplE TR:Q45380 (EMBL:X90711) (403 aa) fasta scores: E():
FT                   1.2e-163, 100.000% id in 403 aa, and to Bordetella
FT                   bronchiseptica putative transferase WlbE TR:O87999
FT                   (EMBL:AJ007747) (419 aa) fasta scores: E(): 6.7e-170,
FT                   99.523% id in 419 aa"
FT                   /db_xref="GOA:Q7W0M0"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0M0"
FT                   /protein_id="CAE40467.1"
FT                   /translation="MNILLINHYAGSPRYGMEFRPYYFGREWIGHGHQVKVAASTISHI
FT                   RARAPQAGGRLTRENVDGIEYLWYATLPYQGNGARRLLNMLQFSARLYGLRRDLGGWRP
FT                   DIVIASSTHPYDVLPAARLARQTGARLVFEVHDLWPLTPRLLGGFKAWHPMIASMQYAE
FT                   DYAYRHADLTVSMLPCALPYMRERGLDPRRYAHVPNGVPVTEYSSPDFDNPDYLRVRAQ
FT                   IRQLREQCDFVLAYAGTHGHANALDMLLQAMARLRDQPIGLLLLGDGPDKPELKRLAGQ
FT                   LGLRHIAFADPVPRPAVQAVMADIDAAYIGLRRSPLFQFGVSPNKLFDYMLSACPVVQS
FT                   IESGNDIVADARCGLSVPAEDPAALAAALHGLRTLPAAERQAMGRRGRDYVLARHDYPV
FT                   LAQQFLDAVQSVTPRRAASR"
FT   misc_feature    complement(86822..87256)
FT                   /note="HMMPfam hit to PF00534, Glycosyl transferases group
FT                   1"
FT   CDS_pept        complement(88015..89103)
FT                   /transl_table=11
FT                   /gene="bplD"
FT                   /gene_synonym="wlbD"
FT                   /locus_tag="BP0090"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis DNA for lipopolysaccharide biosynthesis locus
FT                   BplD TR:Q45379 (EMBL:X90711) (362 aa) fasta scores: E():
FT                   1.8e-139, 100.000% id in 362 aa, and to Bordetella
FT                   bronchiseptica putative UDP-N-acetylglucosamine 2-epimerase
FT                   WlbD TR:O88000 (EMBL:AJ007747) (362 aa) fasta scores: E():
FT                   2.3e-138, 99.724% id in 362 aa"
FT                   /db_xref="GOA:Q79H48"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H48"
FT                   /protein_id="CAE40468.1"
FT                   /translation="MPKKILTVLGARPQFIKASVVSAAIAQHPELTEVVVHTGQHFDAN
FT                   MSDVFFDELGMQTPAHQLDIHGGGHGDMTGRMLVALEQVMQAEKPDVVLVYGDTNSTLA
FT                   GALAAVKLHIPVAHVEAGLRSFNLRMPEEVNRILTDRISRWLFTPTDSATRHLAAEGQS
FT                   GEKVVQVGDVMYDVALHHGARVTAEGRALAAHGLKPGGYVLATIHRAENTDDAQRLTTI
FT                   VRALQALAAERQVVWPLHPRTWGILARLGLLDELASTVTLLEPVGYLDMVQLEKYAALI
FT                   ATDSGGVQKEAFFHRIPCVTLRDETEWTELVDAGWNRLAPPVSSAVVAQAVQDALREQP
FT                   RDVQPYGDGQAARRIVDALAAH"
FT   misc_feature    complement(88024..88968)
FT                   /note="HMMPfam hit to PF02350, UDP-N-acetylglucosamine
FT                   2-epimerase"
FT   misc_feature    complement(89035..89103)
FT                   /note="Signal peptide predicted for BP0090 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.817) with cleavage site
FT                   probability 0.795 between residues 23 and 24"
FT   CDS_pept        complement(89111..90211)
FT                   /transl_table=11
FT                   /gene="bplC"
FT                   /gene_synonym="wlbC"
FT                   /locus_tag="BP0091"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis DNA for lipopolysaccharide biosynthesis locus
FT                   BplC TR:Q45378 (EMBL:X90711) (366 aa) fasta scores: E():
FT                   6.7e-144, 100.000% id in 366 aa, and to Bordetella
FT                   bronchiseptica putative amino-sugar biosynthesis protein
FT                   WlbC TR:O88001 (EMBL:AJ007747) (366 aa) fasta scores: E():
FT                   2.5e-143, 99.454% id in 366 aa"
FT                   /db_xref="GOA:Q79H47"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H47"
FT                   /protein_id="CAE40469.1"
FT                   /translation="MQFIDLKTQYQALRDTINPRIQAVLDHGQFIMGPEVKELEAALCA
FT                   YTGAKHCITVASGTEALLISLMALGVKAGDEVITTSFTFVATAEVIALLGAKPVFVDVE
FT                   PDTCNIKVSEIEAKITPRTKAIIPVSLYGQCGDMDEVNAVAARHGLPVIEDAAQSFGAT
FT                   YKGRKSCNLSTIGCTSFFPSKPLGCYGDGGALFTNDDELAQAMREIRVHGQSGRYYHAR
FT                   IGVGGRMDTLQCAVVLGKLERFDWEIAQRIKIGARYQQLLADLPGGACTVTVRPDRDSV
FT                   WAQFTVMVPNREAVIAQLKEAGIPTAVHYPRPIHAQPAYEQYAEGAGATPVSDDLAARV
FT                   MSLPMHPDLDEATQDKIVAALRQALN"
FT   misc_feature    complement(89126..90181)
FT                   /note="HMMPfam hit to PF01041, DegT/DnrJ/EryC1/StrS family"
FT   CDS_pept        complement(90215..90790)
FT                   /transl_table=11
FT                   /gene="bplB"
FT                   /gene_synonym="wlbB"
FT                   /locus_tag="BP0092"
FT                   /product="probable acetyltransferase"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis and Bordetella bronchiseptica DNA for
FT                   lipopolysaccharide biosynthesis locus BplB or WlbB
FT                   TR:Q45377 (EMBL:X90711) (191 aa) fasta scores: E():
FT                   4.3e-79, 100.000% id in 191 aa, and to Pseudomonas
FT                   aeruginosa probable acetyltransferase WbpD TR:P72135
FT                   (EMBL:U50396) (163 aa) fasta scores: E(): 4.2e-48, 77.483%
FT                   id in 151 aa"
FT                   /db_xref="GOA:Q79H46"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H46"
FT                   /protein_id="CAE40470.1"
FT                   /translation="MTTIHPTAIVDEGARIGANSRIWHWVHICGGAEIGAGCSLGQNVF
FT                   VGNRVRIGDRVKIQNNVSVYDNVFLEDDVFCGPSMVFTNVYNPRAAIERKNEYRDTLVR
FT                   QGATLGANCTIVCGATVGRYAFVGAGAVVNKDVPDFALVVGVPARQIGWMSRHGEQLDL
FT                   PLAGNGQARCPHTGDLYILENGVCRLGE"
FT   misc_feature    complement(90230..90256)
FT                   /note="ScanRegExp hit to PS00572, Glycosyl hydrolases
FT                   family 1 active site."
FT   misc_feature    complement(90422..90475)
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats)"
FT   misc_feature    complement(90593..90646)
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats)"
FT   misc_feature    complement(90647..90700)
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats)"
FT   misc_feature    complement(90701..90754)
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats)"
FT   CDS_pept        complement(90794..91846)
FT                   /transl_table=11
FT                   /gene="bplA"
FT                   /gene_synonym="wlbA"
FT                   /locus_tag="BP0093"
FT                   /product="probable oxidoreductase"
FT                   /note="Identical to Bordetella pertussis and Bordetella
FT                   bronchiseptica DNA for lipopolysaccharide biosynthesis
FT                   locus BplA or WlbA TR:Q45376 (EMBL:X90711) (350 aa) fasta
FT                   scores: E(): 1.2e-144, 100.000% id in 350 aa, and similar
FT                   to Vibrio anguillarum putative dehydrogenase TR:Q9XBT9
FT                   (EMBL:AF156256) (318 aa) fasta scores: E(): 3.8e-83,
FT                   63.722% id in 317 aa"
FT                   /db_xref="GOA:Q79H45"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:3Q2K"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H45"
FT                   /protein_id="CAE40471.1"
FT                   /translation="MSSLPITDRKIRFGLVGCGRISKNHIGAIAQHGDRAELVEICDTN
FT                   PEALQAAEAATGARPFSSLSDMLAQGNADALVLATPSGLHPWQAIEVAQAGRHVVSEKP
FT                   MATRWEDGKRMVKACDEAGVRLFVVKQNRRNATLQLVKKAIEQGRFGRIYMVTVNVFWT
FT                   RPQEYYDAARWRGKWEWDGGAFMNQASHYVDLLDWLVGPVESVYAYTATLARRIEAEDT
FT                   GVAALRWRHGAMGSINVTMLTYPQNLEGSITILGEKGTVRVGGVAVNRIDEWKFAEPHP
FT                   DDDKIREANYETTSVYGFGHPLYYDNVINCLRGDCEPETDGREGLQSLALLTAIYRSAR
FT                   DGVRIPLPLD"
FT   misc_feature    complement(91076..91816)
FT                   /note="HMMPfam hit to PF01408, Oxidoreductase family,
FT                   NAD-binding Rossmann fold"
FT   CDS_pept        91977..92984
FT                   /transl_table=11
FT                   /gene="rfaC"
FT                   /gene_synonym="waaC"
FT                   /locus_tag="BP0094"
FT                   /product="probable heptosyltransferase"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis DNA for lipopolysaccharide biosynthesis locus
FT                   RfaC TR:Q45375 (EMBL:X90711) (335 aa) fasta scores: E():
FT                   6.2e-133, 100.000% id in 335 aa, and to Bordetella
FT                   bronchiseptica putative heptosyltransferase WaaC TR:O88002
FT                   (EMBL:AJ007747) (335 aa) fasta scores: E(): 1.3e-132,
FT                   99.701% id in 335 aa, and Similar to Escherichia coli
FT                   lipopolysaccharide heptosyltransferase-1 RfaC or WaaC or
FT                   Rfa-2 or B3621 SW:RFAC_ECOLI (P24173) (319 aa) fasta
FT                   scores: E(): 7.6e-31, 48.485% id in 297 aa"
FT                   /db_xref="GOA:Q79H44"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H44"
FT                   /protein_id="CAE40472.1"
FT                   /translation="MPNRILIVRTSSLGDLVHMLPAISDIARYVPDTQIDWVAEEAFAD
FT                   IPKWHPAVNEVIKVAHRRWRKAWWSEPVRQERRALAERLRSVSYDVVLDMQGLLKSAWL
FT                   VRQTRGVRHGLDWRSAREPLVSLFYNVRHRVEFWQPAVVRQRKLAALTFGYNYAGSPDF
FT                   GLQAFGRAAQADDAPADPGRRMLHLAADRGYAVIMPSASRDDKLWPEDDWRAVFRRLQD
FT                   AGCALRLLAGNEQEAERARVLVAGMEGVEVLPRMDLTSVAQVLAGARLMVGLDSGLTHL
FT                   SAALGRPTIGIYRASTPVRTPLVGPSYTASLGDRGASPSREAVLASVEQALAAA"
FT   misc_feature    92205..92963
FT                   /note="HMMPfam hit to PF01075, Glycosyltransferase family 9
FT                   (heptosyltransferase)"
FT   CDS_pept        92986..94272
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /gene_synonym="waaA"
FT                   /locus_tag="BP0095"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis DNA for lipopolysaccharide biosynthesis locus
FT                   KdtA TR:Q45374 (EMBL:X90711) (428 aa) fasta scores: E():
FT                   2.9e-167, 100.000% id in 428 aa, and to Bordetella
FT                   bronchiseptica putative 3-deoxy-D-manno-octulosonic-acid
FT                   transferase WaaA TR:O88003 (EMBL:AJ007747) (428 aa) fasta
FT                   scores: E(): 2.1e-166, 99.533% id in 428 aa, and similar to
FT                   Escherichia coli 3-deoxy-D-manno-octulosonic-acid
FT                   transferase KdtA or WaaA or B3633 or Z5057 or ECS4508
FT                   SW:KDTA_ECOLI (P23282) (425 aa) fasta scores: E(): 8.9e-46,
FT                   39.450% id in 436 aa"
FT                   /db_xref="GOA:Q79H43"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H43"
FT                   /protein_id="CAE40473.1"
FT                   /translation="MGRGVYTLALRGLAPLIWLWMWRRARRAGGQWELFAPARFGRAGA
FT                   RAPAPLAAPVWVHAVSLGETRAAQPLVQALLERGLPVLLTHTTATGRAEGERLFGAAIG
FT                   RGQLQQAWLPYDFPGATRRFLARHAPRCGLLMEREVWPNLLAAARAQGVPMALVSARFS
FT                   ASSLRQAGWLGQALREALAGLDRVLAQTDEDGARLCQAGANAYTVTGSLKFDVALPEAQ
FT                   LRVGHAWAGATGRPVIALASTREGEDAMFIEAIGALQAHRAATPRPLILLIPRHPQRFD
FT                   EAAAQLQAAGLAYARRSAGSGEPGPHIDVLLGDTLGEMPFYYAAADVAIVGGSFARLGG
FT                   QNLIEACAAGTPVIVGPHTFNFKDAARDAIAAGAALRAPDARTALDWALQLLAEPARRQ
FT                   AMSEAARAWTAAHAGATRRTLDALEDWLG"
FT   misc_feature    93937..94209
FT                   /note="HMMPfam hit to PF00534, Glycosyl transferases group
FT                   1"
FT   CDS_pept        complement(94289..94444)
FT                   /transl_table=11
FT                   /locus_tag="BP0096"
FT                   /product="putative exported protein"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   bronchiseptica putative secreted protein Bblps1.35C
FT                   TR:O88004 (EMBL:AJ007747) (51 aa) fasta scores: E():
FT                   2.6e-20, 100.000% id in 51 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0L7"
FT                   /protein_id="CAE40474.1"
FT                   /translation="MRILFLLIVAANLWVYALGQGWLGLRPADEGRDAARLNQEMKADQ
FT                   VKVLRP"
FT   misc_feature    complement(94370..94435)
FT                   /note="1 probable transmembrane helix predicted for BP0096
FT                   by TMHMM2.0 at aa 3-25"
FT   misc_feature    complement(94388..94444)
FT                   /note="Signal peptide predicted for BP0096 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.879) with cleavage site
FT                   probability 0.698 between residues 19 and 20"
FT   CDS_pept        complement(94469..95272)
FT                   /transl_table=11
FT                   /gene="baf"
FT                   /locus_tag="BP0097"
FT                   /product="Bvg accessory factor"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis Bvg accessory factor Baf SW:BAF_BORPE (Q45338)
FT                   (267 aa) fasta scores: E(): 4.3e-103, 100.000% id in 267
FT                   aa, and to Bordetella bronchiseptica Bvg accessory factor
FT                   Baf or Bblps1.36C SW:BAF_BORBR (O88005) (54 aa) fasta
FT                   scores: E(): 2.6e-14, 96.296% id in 54 aa"
FT                   /db_xref="GOA:Q45338"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45338"
FT                   /protein_id="CAE40475.1"
FT                   /translation="MIILIDSGNSRLKVGWFDPDAPQAAREPAPVAFDNLDLDALGRWL
FT                   ATLPRRPQRALGVNVAGLARGEAIAATLRAGGCDIRWLRAQPLAMGLRNGYRNPDQLGA
FT                   DRWACMVGVLARQPSVHPPLLVASFGTATTLDTIGPDNVFPGGLILPGPAMMRGALAYG
FT                   TAHLPLADGLVADYPIDTHQAIASGIAAAQAGAIVRQWLAGRQRYGQAPEIYVAGGGWP
FT                   EVRQEAERLLAVTGAAFGATPQPTYLDSPVLDGLAALAAQGAPTA"
FT   CDS_pept        complement(95269..96135)
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="BP0098"
FT                   /product="putative biotin protein ligase"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis putative biotin protein ligase BirA TR:Q9ZIU6
FT                   (EMBL:AF016461) (288 aa) fasta scores: E(): 1.2e-110,
FT                   100.000% id in 288 aa, and Similar to Escherichia coli BirA
FT                   bifunctional protein [includes: biotin operon repressor;
FT                   biotin--[acetyl-coa-carboxylase] synthetase BirA or BioR or
FT                   DhbB or B3973 SW:BIRA_ECOLI (P06709) (321 aa) fasta scores:
FT                   E(): 9.5e-13, 32.130% id in 277 aa"
FT                   /db_xref="GOA:Q79H42"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H42"
FT                   /protein_id="CAE40476.1"
FT                   /translation="MGAITIAPMSAEVRSLSLPEPAALARAIAARLPAFRDISWVGSTG
FT                   STNADLLARARAGGGARPCLLGAHLQETGRGRAGRPWQNRVGAALMFSCAFDVDLPPSQ
FT                   LPALSPLAGMAACEALRQLVGQPAGLLVKWPNDVQWHDAKLAGVLVESVRNPAGTGHAV
FT                   VIGMGLNLHGGDALSQALQRSVADWNDVAGPGEKGPDAAADLVAAVARAWQDAAHTLQQ
FT                   EGFGAFGARFARVDALAGRPVNVIDRGEILYTGAASGVDDHGRLLVQAADGMRPVSVGE
FT                   ISIRPQA"
FT   misc_feature    complement(95281..95424)
FT                   /note="HMMPfam hit to PF02237, Biotin protein ligase C
FT                   terminal domain"
FT   misc_feature    complement(95497..96021)
FT                   /note="HMMPfam hit to PF01317, Biotin protein ligase
FT                   catalytic domain"
FT   CDS_pept        96210..97340
FT                   /transl_table=11
FT                   /locus_tag="BP0099"
FT                   /product="putative integral membrane protein"
FT                   /note="Similar to Caulobacter crescentus putative ABC
FT                   transporter, permease protein, Cc2318 TR:Q9A5X9
FT                   (EMBL:AE005902) (371 aa) fasta scores: E(): 2.2e-35,
FT                   35.925% id in 373 aa, and to Campylobacter jejuni putative
FT                   ABC transport system permease protein iamb or cj1646
FT                   TR:Q9PM30 (EMBL:AL139079) (369 aa) fasta scores: E():
FT                   3.2e-31, 34.451% id in 328 aa"
FT                   /db_xref="GOA:Q7W0L6"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0L6"
FT                   /protein_id="CAE40477.1"
FT                   /translation="MPSLPSTAGAATLSLTLDHGVCHVSGDWSMQALAAPGEVERRRAA
FT                   LARVDPDQRWDLRGVERLDTIGAHLLWGAWGQQLPERVRWSDGQREVFQTLQRNRGEAL
FT                   PAPAPADRWGWLRAIGDAVFDAGRNGRALVIMFGQLVLDLGAFLRRPSRGPWREISAQV
FT                   YRTGAQALGITALVGFLIGVVLSYLSAQQLQMFGADRFIVRLLGVSIVRELGPVLAAIL
FT                   VAGRSGSAITAQIGVMRVTQELDAMLVMGISHGQRLILPRVIALAITMPLLVVWTDAMA
FT                   LLGGMLAAQMQLGVSAQWFLTSLPDAISLTNYWIGMFKGVSFGILIALVACHFGLCIQP
FT                   NTESLGRGTTTSVVTSITGVILVDALYAVIFSSIGI"
FT   misc_feature    96210..96311
FT                   /note="Signal peptide predicted for BP0099 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.932) with cleavage site
FT                   probability 0.911 between residues 34 and 35"
FT   misc_feature    96585..97325
FT                   /note="HMMPfam hit to PF02405, Domain of unknown function
FT                   DUF140"
FT   misc_feature    join(96711..96779,97023..97091,97149..97217,97254..97322)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BP0099 by TMHMM2.0 at aa 168-190, 272-294, 314-336 and
FT                   349-371"
FT   CDS_pept        97340..98179
FT                   /transl_table=11
FT                   /locus_tag="BP0100"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   ATP-binding component of ABC transporter Pa3212 TR:Q9HZ28
FT                   (EMBL:AE004744) (264 aa) fasta scores: E(): 1.3e-42,
FT                   54.251% id in 247 aa, and to Caulobacter crescentus ABC
FT                   transporter, ATP-binding protein cc2319 TR:Q9A5X8
FT                   (EMBL:AE005902) (278 aa) fasta scores: E(): 2e-42, 54.032%
FT                   id in 248 aa"
FT                   /db_xref="GOA:Q7W0L5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0L5"
FT                   /protein_id="CAE40478.1"
FT                   /translation="MGSVAQQNLFSATDLAVAPVIAVRGLRTAFGDHVVHDNLDLSVYP
FT                   GEILALVGGSGTGKTVLLRQIIGLERPAAGTIEVLGRRVQELEPAERRRLSHRWGMLFQ
FT                   AGALFSSLSVFDNVALPLRELRTVPEDLVCDVVMCRLAMVGLTSKDADKRPADLSGGMV
FT                   KRVALARALSLDPELLFLDEPTAGLDPLRSDEFVDLVRSLHRQLGFTVVMVTHDLDTLL
FT                   ALATRVAVLADKRVIVCDTVREVLKVDHPFIRSFFLGERGRRALGDLAPKETGNGKP"
FT   misc_feature    97475..98041
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    97496..97519
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    97556..97609
FT                   /note="ScanRegExp hit to PS00216, Sugar transport proteins
FT                   signature 1."
FT   CDS_pept        join(98166..98852,98854..99111)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0101"
FT                   /product="putative exported protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 229. The sequence has been checked
FT                   and believed to be correct. Similar to Pseudomonas
FT                   aeruginosa hypothetical protein Pa3213 TR:Q9HZ27
FT                   (EMBL:AE004744) (312 aa) fasta scores: E(): 2.3e-13,
FT                   28.115% id in 313 aa, and to Campylobacter jejuni possible
FT                   ABC transport system periplasmic substrate-binding protein
FT                   Cj1648 TR:Q9PM28 (EMBL:AL139079) (296 aa) fasta scores:
FT                   E(): 3.8e-11, 28.634% id in 227 aa"
FT                   /db_xref="PSEUDO:CAE40479.1"
FT   misc_feature    98166..98240
FT                   /note="Signal peptide predicted for BP0101 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.352 between residues 25 and 26"
FT   misc_feature    98193..98597
FT                   /note="HMMPfam hit to PF02470, mce related protein"
FT   variation       98850..98851
FT                   /note="CA in pertussis; CA(GG) in parapertussis and
FT                   bronchiseptica"
FT   CDS_pept        99112..99714
FT                   /transl_table=11
FT                   /locus_tag="BP0101A"
FT                   /product="putative exported protein"
FT                   /note="Similar to Agrobacterium tumefaciens Agr_c_3031p
FT                   TR:AAK87420 (EMBL:AE008086) (201 aa) fasta scores: E():
FT                   2.5e-05, 31.551% id in 187 aa, and to Rhizobium meliloti
FT                   hypothetical protein Smc00177 TR:CAC46409 (EMBL:AL591788)
FT                   (204 aa) fasta scores: E(): 0.00019, 28.042% id in 189 aa"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0L4"
FT                   /protein_id="CAE40480.1"
FT                   /translation="MDMKKAIIVLSALLLAGCGAGRMAAPPALFDLGADVAATPALPAR
FT                   QPIVLAFEAVPYLSDTGVIWRVGDSASPHAYARSRWASAPAELVRQRLVERLSHQGPVL
FT                   GAGMGAGLAQVQVTLTFEQVFAADGQASVGHVAMQAVLLQDRQVVGQVRIAREAPAATQ
FT                   DAAGGVQALRQATDAAADELAGWLAGRVAAAGARAGS"
FT   misc_feature    99112..99183
FT                   /note="Signal peptide predicted for BP0101 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.988 between residues 24 and 25"
FT   misc_feature    99133..99165
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        99744..100397
FT                   /transl_table=11
FT                   /locus_tag="BP0101B"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Neisseria meningitidis hypothetical
FT                   protein Nmb0868 TR:Q9JZW7 (EMBL:AE002439) (213 aa) fasta
FT                   scores: E(): 4.5e-24, 43.578% id in 218 aa, and to
FT                   Pseudomonas aeruginosa hypothetical protein Pa4440
FT                   TR:Q9HVX5 (EMBL:AE004858) (209 aa) fasta scores: E():
FT                   2.9e-19, 40.909% id in 220 aa"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0L3"
FT                   /protein_id="CAE40481.1"
FT                   /translation="MSARTETQVFTGAAGSIDCAIDWPAHAPRGWALVLHPHSLQGGAR
FT                   DNKVVTTVARACVQHGLAAVRPNFRGVGESAGEFDKSIGETEDMLALVAQVRERYPEFA
FT                   ASPWVLGGFSFGTAVAAQTYAALAASGDPSLPRALMLMGPAVNRFERSATEVPADTLLV
FT                   HGEVDDVVPLAEALEWARPRSLPVVVVPGASHFFHGKLLVLRQLVQDRLRIALD"
FT   CDS_pept        100530..101786
FT                   /transl_table=11
FT                   /locus_tag="BP0102"
FT                   /product="putative penicillin-binding protein precursor"
FT                   /EC_number="3.4.16.4"
FT                   /note="Similar to Escherichia coli penicillin-binding
FT                   protein 6 precursor DacC or B0839 SW:DACC_ECOLI (P08506)
FT                   (400 aa) fasta scores: E(): 3.9e-51, 46.703% id in 364 aa,
FT                   and to Pseudomonas aeruginosa penicillin-binding protein 5
FT                   precursor DacA or DacC or PA3999 TR:Q9X6V7 (EMBL:AF147448)
FT                   (386 aa) fasta scores: E(): 1.3e-54, 45.528% id in 369 aa"
FT                   /db_xref="GOA:Q7W0L2"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0L2"
FT                   /protein_id="CAE40482.1"
FT                   /translation="MKTLPDTAIAPVVLSRRVLASAVLAAMLAAAAPAGAQQQAAPATP
FT                   VAAAAPAAGGAVGAVGDLAAVPVPTIAAKAWITVDVNSGQVLAASNADMKVEPASLTKI
FT                   MTAYVVFNALQEKRLTLEQQVPVSEHAWRTGGSRMFIEPRKPVTVDELNQGMIVQSGND
FT                   ASVALAEAVGGSESAFAALMNQEAQRLGMRNTHFMNSTGLPDPQHVTTARDLATLAAHL
FT                   ISDYPDYYHYYKQKSYTYNKITQPNRNRLLWADPSVDGMKTGHTDSAGYCLVSTAMRGD
FT                   RRILTVLVGADSEATRAEESLKLLNWSFQNFDTVKLYDQSQPGLDARVWEGKVENVKLG
FT                   PPNPVWLAVPRGKAAEIKPVAQRTDPLVAPLTKGQQVGTLQLTLDGKTLRVEPLVVQED
FT                   VERAGFFGRMADTVKRWFQ"
FT   misc_feature    100530..100637
FT                   /note="Signal peptide predicted for BP0102 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.908 between residues 36 and 37"
FT   misc_feature    100704..101471
FT                   /note="HMMPfam hit to PF00768, D-alanyl-D-alanine
FT                   carboxypeptidase"
FT   CDS_pept        101834..102733
FT                   /transl_table=11
FT                   /locus_tag="BP0103"
FT                   /product="probable class IV aminotransferase"
FT                   /note="Similar to Staphylococcus aureus D-alanine
FT                   aminotransferase TR:Q9KWZ6 (EMBL:Y14816) (282 aa) fasta
FT                   scores: E(): 3.7e-37, 38.849% id in 278 aa, and to
FT                   Staphylococcus haemolyticus D-alanine aminotransferase Dat
FT                   SW:DAAA_STAHA (P54694) (282 aa) fasta scores: E(): 1.1e-38,
FT                   38.989% id in 277 aa"
FT                   /db_xref="GOA:Q7W0L1"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0L1"
FT                   /protein_id="CAE40483.1"
FT                   /translation="MPAPILSKELPMIPGMPGDSQVYLNGEFTRLDEAKISVLDRGFIF
FT                   GDGIYEVVPVYDGKVFRMTEHLNRLDRSLAALRIAAPMDRAGWESVIAGLIARSAQPTC
FT                   IIYLQVTRGVCKRDHAFPTEPITPTVFGMAAAFSPPGAAQRTQGLSAIAIDDERWLHCE
FT                   IKSVSLLGNVLAKQQAVDAGVDEVVQFRDGWLTEGSSTNIWVVSGGKLLAPPKNNLILE
FT                   GIRYGLMGELAEAAGLPFEARRISREEVLAADELMLTSATKEVLPIVRLDGKAVGAGKP
FT                   GPVYEQLRAGYDARIAAL"
FT   misc_feature    101906..102712
FT                   /note="HMMPfam hit to PF01063, Aminotransferase class IV"
FT   CDS_pept        102809..103084
FT                   /transl_table=11
FT                   /locus_tag="BP0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Neisseria meningitidis hypothetical
FT                   protein Nma1380 or Nmb1218 TR:Q9JRI4 (EMBL:AL162755) (91
FT                   aa) fasta scores: E(): 4.4e-11, 46.988% id in 83 aa, and to
FT                   Escherichia coli hypothetical protein YbeD or B0631 or
FT                   Z0776 or ECS0669 SW:YBED_ECOLI (P30977) (87 aa) fasta
FT                   scores: E(): 4.4e-06, 38.554% id in 83 aa"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0L0"
FT                   /protein_id="CAE40484.1"
FT                   /translation="MHNIPPEESLIEYPSDFPIKVMGKQHPEFAQTLTEVVLQFDPGFD
FT                   PASVEMRPSKGGNYLGLTFTVRATSREQLDSLYRALHGHPMVSIVL"
FT   CDS_pept        103092..103754
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="BP0105"
FT                   /product="lipoate-protein ligase B"
FT                   /EC_number="6.-.-.-"
FT                   /note="Similar to Escherichia coli lipoate-protein ligase B
FT                   LipB or B0630 SW:LIPB_ECOLI (P30976) (213 aa) fasta scores:
FT                   E(): 3.3e-32, 54.386% id in 171 aa, and to Vibrio cholerae
FT                   lipoate-protein ligase B LipB or VC0944 SW:LIPB_VIBCH
FT                   (Q9KTF8) (219 aa) fasta scores: E(): 2.1e-34, 50.500% id in
FT                   200 aa"
FT                   /db_xref="GOA:Q7W0K9"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0K9"
FT                   /protein_id="CAE40485.1"
FT                   /translation="MIKWLARPADYASVWDAMKTFTAARGPGTADEIWLCEHAPVYTLG
FT                   QVGRPEHLLNPGLIPVVHCDRGGQVTYHGPGQVLAYTLFDLRRAGLYVREYVDMLEQAT
FT                   LATLRELGLEQACRKPGAPGIYVPQPGGELAKIAALGVKVRNGYAYHGLALNIDMDLSP
FT                   FLGINPCGYEGLRTVDLAACGVRTSVERAGELLAAQLARAHGQAVQQRAAALAGVPG"
FT   misc_feature    103158..103604
FT                   /note="HMMPfam hit to PF02111, Lipoate-protein ligase B"
FT   misc_feature    103287..103334
FT                   /note="ScanRegExp hit to PS01313, Lipoate-protein ligase B
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        103816..104817
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /gene_synonym="lip"
FT                   /locus_tag="BP0106"
FT                   /product="lipoic acid synthetase"
FT                   /note="Similar to Escherichia coli lipoic acid synthetase
FT                   LipA or Lip or B0628 SW:LIPA_ECOLI (P25845) (321 aa) fasta
FT                   scores: E(): 5.8e-77, 63.091% id in 317 aa, and to
FT                   Burkholderia pseudomallei lipoate synthetase TR:Q9EYP3
FT                   (EMBL:AF317284) (288 aa) fasta scores: E(): 9.7e-90,
FT                   83.333% id in 282 aa"
FT                   /db_xref="GOA:Q7W0K8"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0K8"
FT                   /protein_id="CAE40486.1"
FT                   /translation="MSTLVESPVPSNDSQAAAPAAYDPTQKQKSQAKTARIPIKVVAAE
FT                   KLKKPEWIRVRAAAPGSRFYDIKRILREHNLHTVCEEASCPNIGECFGKGTATFMIMGD
FT                   KCTRRCPFCDVGHGRPDPLDTQEPENLARTIAALKLSYVVITSVDRDDLRDGGAAHFVE
FT                   CIAKVREYSPDTRIEVLVPDFRGRLDRALHILNSGPPDVMNHNLETVPRLYKQARPGSD
FT                   YAHSLKLLAEFKKLHPEVPTKSGLMLGLGETDEEILQVMRDMREHNVDMLTIGQYLQPS
FT                   EHHLPVLRYVHPDTFAMFEREAYAMGFTHAAVGAMVRSSYHADQQAHAAGVN"
FT   misc_feature    104026..104793
FT                   /note="HMMPfam hit to PF02546, Lipoate synthase"
FT   CDS_pept        complement(104832..105380)
FT                   /transl_table=11
FT                   /gene="rfbC"
FT                   /gene_synonym="rmlC"
FT                   /locus_tag="BP0107"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="Similar to Escherichia coli dTDP-4-dehydrorhamnose
FT                   3,5-epimerase RfbC or RmlC or B2038 SW:RFBC_ECOLI (P37745)
FT                   (185 aa) fasta scores: E(): 8.2e-34, 52.326% id in 172 aa,
FT                   and to Pseudomonas aeruginosa dTDP-4-dehydrorhamnose
FT                   3,5-epimerase RmlC or PA5164 TR:Q9HU21 (EMBL:AE004929) (181
FT                   aa) fasta scores: E(): 4.6e-49, 64.641% id in 181 aa"
FT                   /db_xref="GOA:Q7W0K7"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0K7"
FT                   /protein_id="CAE40487.1"
FT                   /translation="MKLTPLAIADVVLIEPQVFGDERGCFFESFNQDRLDAQLGRRIRF
FT                   VQDNHSCSRAGVLRGLHYQILHPQAKLVRVVAGEAYDVAVDLRRGSPTFGRWTGAYLSA
FT                   RNRHQLWIPEGFAHGFLALSDDTECLYKATDYYAPEHERCVRWDDPQLKVDWPLQGQAP
FT                   ILSVKDRQGVALARADTYA"
FT   misc_feature    complement(104847..105374)
FT                   /note="HMMPfam hit to PF00908, dTDP-4-dehydrorhamnose
FT                   3,5-epimerase"
FT   CDS_pept        complement(105438..106334)
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /gene_synonym="rmlD"
FT                   /locus_tag="BP0108"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="Similar to Escherichia coli dTDP-4-dehydrorhamnose
FT                   reductase RfbD or RmlD or B2040 SW:RBD1_ECOLI (P37760) (299
FT                   aa) fasta scores: E(): 2.6e-40, 44.444% id in 297 aa, and
FT                   to Pseudomonas aeruginosa dTDP-4-dehydrorhamnose reductase
FT                   RmlD or PA5162 TR:Q9HU23 (EMBL:AE004929) (302 aa) fasta
FT                   scores: E(): 7.8e-44, 47.651% id in 298 aa"
FT                   /db_xref="GOA:Q7W0K6"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0K6"
FT                   /protein_id="CAE40488.1"
FT                   /translation="MNILLLGRTGQIGDALLAHPPAWARLAALDRRQADLRDLGRLAAV
FT                   LDAYAPRILINAAAYTEVDRAEAEPELALRINAQAVAVMADYARRNNALLVHYSTDYVF
FT                   DGKRARAYRETDAAHPLNAYGRSKLAGEQAIAASGCPHLILRTSWVYASHGANFVKTIL
FT                   RLARTRAELSVVADQHGAPIWAGRIAAVTWQAIDAHRRRRLPDGLWHLSAGGHVSWHGL
FT                   ACHIVARARRAGLALSLDPAHIRPVTAAQYPLPAPRPANSRLDCGALRDALEPELPDWQ
FT                   VDLDAVVDALAARAHTL"
FT   CDS_pept        complement(106331..107392)
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /gene_synonym="rmlB"
FT                   /locus_tag="BP0109"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="Similar to Escherichia coli dTDP-glucose
FT                   4,6-dehydratase RfbB or RmlB or B2041 SW:RBB1_ECOLI
FT                   (P37759) (361 aa) fasta scores: E(): 4.6e-73, 52.925% id in
FT                   359 aa, and to Pseudomonas aeruginosa dTDP-D-glucose
FT                   4,6-dehydratase RmlB or PA5161 TR:Q9HU24 (EMBL:AE004929)
FT                   (352 aa) fasta scores: E(): 4e-92, 64.672% id in 351 aa"
FT                   /db_xref="GOA:Q7W0K5"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0K5"
FT                   /protein_id="CAE40489.1"
FT                   /translation="MSILVTGGAGFIGSNFVLGWLASGDEPVINLDLLTYAGNAANLAA
FT                   LRDDPRHLLVHGDIADAPLVRRLLREHRPRAIVNFAAESHVDRAIRAPDAFVQTNVVGT
FT                   FTLLEAARAYCTEQDAAAAAAFRFLHVSTDEVYGSLAPQAAPFTETHPYQPNNPYSASK
FT                   AASDHMVRSYRHTYGLPAITTHCCNNYGPRQFPEKLIPLVIHHALAGRALPLYGDGMHV
FT                   RDWLYVVDHCAALECVLRDGQPGQTYNIGAHCERTNLEVVHAVCALLDQWRARPDGQPH
FT                   AGGIAFIPERPGHDRRYAIDAGKIQRELGWRAATSFEAGLRETVRWYLDHPQWVADIAS
FT                   GAYRHWLDTHYGT"
FT   misc_feature    complement(106397..107386)
FT                   /note="HMMPfam hit to PF01370, NAD dependent
FT                   epimerase/dehydratase family"
FT   misc_feature    complement(106871..106957)
FT                   /note="ScanRegExp hit to PS00061, Short-chain
FT                   dehydrogenases/reductases family signature."
FT   CDS_pept        complement(107428..108378)
FT                   /transl_table=11
FT                   /locus_tag="BP0110"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7W0K4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0K4"
FT                   /protein_id="CAE40490.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDKYNLLTVHN"
FT   repeat_region   107428..107455
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(107428..108480)
FT   misc_feature    complement(107464..107997)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(108055..108120)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   repeat_region   complement(108449..108480)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(join(108477..109043,109045..109104))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0111"
FT                   /product="putative membrane protein (pseudogene)"
FT                   /note="Similar to Bacillus halodurans hypothetical protein
FT                   Bh0429 SWALL:Q9KFP9 (EMBL:AP001508) (207 aa) fasta scores:
FT                   E(): 7.9e-30, 46.5% id in 200 aa."
FT                   /db_xref="PSEUDO:CAE40491.1"
FT   misc_feature    complement(join(108486..108542,108579..108644,
FT                   108690..108755,108840..108905,108936..109001))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BP0111 by TMHMM2.0 at aa 7-29, 39-61, 89-111, 126-148 and
FT                   160-179"
FT   misc_feature    complement(108567..108896)
FT                   /note="HMMPfam hit to PF01810, LysE type translocator"
FT   misc_feature    complement(108903..109022)
FT                   /note="Signal peptide predicted for BP0111 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.944) with cleavage site
FT                   probability 0.242 between residues 40 and 41"
FT   CDS_pept        109278..110471
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="BP0112"
FT                   /product="cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /note="Similar to Bordetella avium cystathionine beta-lyase
FT                   MetC SW:METC_BORAV (Q07703) (395 aa) fasta scores: E():
FT                   1.1e-130, 79.747% id in 395 aa, and to Escherichia coli
FT                   cystathionine beta-lyase MetC or B3008 SW:METC_ECOLI
FT                   (P06721) (395 aa) fasta scores: E(): 5.5e-48, 36.567% id in
FT                   402 aa. Also similar to BP0815, 42.784% identity in 388 aa
FT                   overlap"
FT                   /db_xref="GOA:Q7W0K3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0K3"
FT                   /protein_id="CAE40492.1"
FT                   /translation="MTDESRHIDTLLQHLGTAPFDPDTGAAPVNLPSMRASTVRFRDLA
FT                   ALEQAQRRKAGGDRAVTYGRMGMDTHAALEHVFKELEAGTHCYLASSGMGAVTMAFLSL
FT                   LSAGEHALVADCVYGPVYELDNAVLKRMGIELTFFAPGDDLQALVRPNTRLLYVESPGS
FT                   LLFQMLDLPALAEFARRNQLVLATDNTWGSGYIYRPLELGAQVSVIAGTKYVGGHSDLM
FT                   LGAVVTNDEAVAQRLNRTQYAMGYSVSADDAWLALRGVRTLPIRMAQHARHAQRVCEFL
FT                   QGRPEVARIYHPAWPQDPGHALWLRDCSGSNGMLTVELRLSQPAARVFVESLQLFDIGF
FT                   SWGGFESLVQLVTPGELARHRYWQGGGNALVRLHIGLESPEDVIADLTQALARAASA"
FT   misc_feature    109302..110453
FT                   /note="HMMPfam hit to PF01053, Cys/Met metabolism
FT                   PLP-dependent enzyme"
FT   misc_feature    109890..109934
FT                   /note="ScanRegExp hit to PS00868, Cys/Met metabolism
FT                   enzymes pyridoxal-phosphate attachment site. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   CDS_pept        complement(110553..111182)
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="BP0113"
FT                   /product="thiol:disulfide interchange protein DsbA
FT                   precursor"
FT                   /note="Similar to Burkholderia cepacia thiol:disulfide
FT                   interchange protein DsbA precursor SW:DSBA_BURCE (Q9RHV8)
FT                   (212 aa) fasta scores: E(): 1e-22, 36.620% id in 213 aa,
FT                   and to Azotobacter vinelandii thiol:disulfide interchange
FT                   protein DsbA precursor SW:DSBA_AZOVI (Q44504) (214 aa)
FT                   fasta scores: E(): 2.5e-22, 37.619% id in 210 aa"
FT                   /db_xref="GOA:Q7W0K2"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0K2"
FT                   /protein_id="CAE40493.1"
FT                   /translation="MQSTTFTRLLAAAALGATTLFAPATQAQGAQQYVNINPPMPSDTP
FT                   GKIEVLEFFAYTCPHCAAIEPMVEDWAKTAPQDVVLKQVPIAFNAGMKPLQQLYYTLQA
FT                   LERPDLHPKVFTAIHTERKRLFDKKAMGEWAASQGVDRAKFDSVFDSFSVQTQVQHASQ
FT                   LAEAAHIDGTPAFAVGGRYMTSPVLAGNDYAGALKVVDQLIVQSRK"
FT   misc_feature    complement(110562..111167)
FT                   /note="HMMPfam hit to PF01323, DSBA oxidoreductase"
FT   misc_feature    complement(110979..111035)
FT                   /note="ScanRegExp hit to PS00194, Thioredoxin family active
FT                   site."
FT   misc_feature    complement(111102..111182)
FT                   /note="Signal peptide predicted for BP0113 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.862 between residues 27 and 28"
FT   CDS_pept        complement(111244..111927)
FT                   /transl_table=11
FT                   /locus_tag="BP0114"
FT                   /product="putative exported protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa5052 TR:Q9HUC7 (EMBL:AE004918) (231 aa) fasta
FT                   scores: E(): 0.001, 28.807% id in 243 aa, and to Xylella
FT                   fastidiosa hypothetical protein Xf0146 TR:Q9PH00
FT                   (EMBL:AE003868) (252 aa) fasta scores: E(): 6.8e-05,
FT                   29.167% id in 192 aa"
FT                   /db_xref="GOA:Q7W0K1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0K1"
FT                   /protein_id="CAE40494.1"
FT                   /translation="MATKRKSTRRSKERGSTMYGVLAGLLIGLIVAAAVAFYVTKAPMP
FT                   FVDRATRQPDQGKLPDPRNAPDPNQGLYGRDGAAGTPPTGPTATAPSPLPGVTPGAPSR
FT                   QPDDLGALIATLPNLDRAPAPAATPAPAAKSAKPAAPAASATPAAPASGTYFLQAGAYR
FT                   VLEDAEALRARIILLGLPVVMQRAEVNGVQVNRVRVGPFGRLDDMNRARSRLGENDIKS
FT                   AVVRQ"
FT   misc_feature    complement(111805..111927)
FT                   /note="Signal peptide predicted for BP0114 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.460 between residues 41 and 42"
FT   CDS_pept        complement(111937..113724)
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="BP0115"
FT                   /product="arginyl-tRNA synthetase"
FT                   /note="Similar to Xylella fastidiosa arginyl-tRNA
FT                   synthetase Xf0147 TR:Q9PGZ9 (EMBL:AE003868) (586 aa) fasta
FT                   scores: E(): 4e-103, 52.700% id in 537 aa, and to
FT                   Staphylococcus aureus subspaureus N315. arginyl-tRNA
FT                   synthetase ArgS or Sa0564 TR:Q99W05 (EMBL:AP003131) (553
FT                   aa) fasta scores: E(): 9.9e-65, 40.603% id in 564 aa"
FT                   /db_xref="GOA:Q7W0K0"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0K0"
FT                   /protein_id="CAE40495.1"
FT                   /translation="MRGHLRQTPGRPPGGSARPAARQTCRRHLPFCRLPMLLEQQKQLI
FT                   SLIQAAVAQCLPEAQAQVQLERPKVAAHGDIATNVAMQLAKPARRNPRELAQGIVDALM
FT                   AQPQARELIQDAEIAGPGFINFRLTPAARQAVVQAVASQADAYGRAPRNGEKVLVEFVS
FT                   ANPTGPLHVGHARQAALGDAICRLYDASGWDVTREFYYNDAGNQIDNLAISVQARGRGI
FT                   APDAPDYPADGYKGDYIVEIARDFAARKSVQASDGQPVTATGDLDSLDDIRAFAVAYLR
FT                   REQDLDLQAFGLAFDNYFLESSLYASGRVQETVDTLVAKGHTYEEGGALWLRTTELGTG
FT                   DDKDRVMRKSEGGYTYFVPDVAYHKVKWERGFHHAVNIQGSDHHGTVARVRAGLQGLAG
FT                   IPKDFPAYVLHKMVKVMRGGEEVKISKRAGSYVTMRDLIDWVGRDAVRYFLIQRRADTE
FT                   FVFDIDLALSKSDENPVYYIQYAHARICTMIGNSGASAAEIAQADTALLTAPSEYALLQ
FT                   RLAEFPQVVALAAQELAPHHVAFWLRDCASDFHAWYNAERVLVDEPALKLARLRLAATT
FT                   RQVLANGLALLGVSAPDRM"
FT   misc_feature    complement(111940..113601)
FT                   /note="HMMPfam hit to PF00750, tRNA synthetases class I
FT                   (R)"
FT   misc_feature    complement(113200..113229)
FT                   /note="ScanRegExp hit to PS00178, Aminoacyl-transfer RNA
FT                   synthetases class-I signature. Confirmed by InterPro eMOTIF
FT                   pattern match."
FT   CDS_pept        113874..114254
FT                   /transl_table=11
FT                   /locus_tag="BP0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein Rsc0288 or Rs03255 SWALL:Q8Y2P7 (EMBL:AL646058)
FT                   (105 aa) fasta scores: E(): 0.0019, 32.74% id in 113 aa"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0J9"
FT                   /protein_id="CAE40496.1"
FT                   /translation="MYEIIRMGVRNMLITFHSKVAAEVLMRTDDAAPLLRAAGKSFRDA
FT                   IPERGVFTADQLQSAITGLERAIAAADRSPPDDDEPHPDKEPVHPIELAVGLHQRAFPL
FT                   LDMMRKTAAAGADLTWEVSRGW"
FT   CDS_pept        114303..114662
FT                   /transl_table=11
FT                   /locus_tag="BP0117"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0J8"
FT                   /protein_id="CAE40497.1"
FT                   /translation="MRRDAPAPPPGDPSMRSEVTVVFDARRTVDLSVDVEPSVQAAAAA
FT                   RDWFDSAWEMLGCEPLRPSGKVLLLDKILGVADALGYDTLSGDAKESREFAEQAALALG
FT                   KARIVVDLPGLMVGH"
FT   repeat_region   114760..115984
FT                   /note="Insertion sequence"
FT   CDS_pept        114945..115961
FT                   /transl_table=11
FT                   /locus_tag="BP0118"
FT                   /product="transposase for IS1663"
FT                   /note="Similar to Neisseria meningitidis putative
FT                   invertase/transposase nma1800 TR:Q9JTF3 (EMBL:AL162757)
FT                   (318 aa) fasta scores: E(): 2e-17, 28.48% id in 316 aa and
FT                   Acinetobacter spSE19. pilin inverting protein chnY
FT                   TR:Q9F7E1 (EMBL:AF282240) (324 aa) fasta scores: E():
FT                   8.2e-50, 47.516% id in 322 aa"
FT                   /db_xref="GOA:Q7TTN4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTN4"
FT                   /protein_id="CAE40498.1"
FT                   /translation="MADSSLLSAGGQVHVFIGIDVSKAKLDCTLLTAEADKCKTKVVVN
FT                   TAAGVQALLAWCAKHGAQPAQLHAILEPTGLYHEQAATALPQVRVSLVNPAQARDFAKA
FT                   LALRSKNDALDSYVLARYGQTLSPALWHPAPLHARQLRALLTRREALSKDLLRELNRKE
FT                   KSQFSPSAPLVDGSIDKAIAFLREQIKQIERAIDQHIDNHPDLKQDCELLNSIPAIGPQ
FT                   AGNAILAVMHNRHIDSAQSLAAYLGVVPVQRQSGSSLNSCARLSKAGPSQVRATLYMAA
FT                   LVGTRHNPHIRALYQRLLKAGKSKKAALGAAMRKLVHLCFGVLKNRIPYQPNYAMNG"
FT   misc_feature    115197..115484
FT                   /note="HMMPfam hit to PF01548, Transposase"
FT   misc_feature    115497..115829
FT                   /note="HMMPfam hit to PF02371, Transposase
FT                   IS116/IS110/IS902 family"
FT   CDS_pept        complement(116037..116837)
FT                   /transl_table=11
FT                   /locus_tag="BP0119"
FT                   /product="inner membrane component of
FT                   binding-protein-dependent transport system"
FT                   /note="Similar to Thermotoga maritima sugar ABC
FT                   transporter, permease protein Tm0598 TR:Q9WZ67
FT                   (EMBL:AE001734) (277 aa) fasta scores: E(): 3.9e-36,
FT                   43.860% id in 228 aa, and to Rhizobium meliloti putative
FT                   sugar ABC transporter permease protein Smb20233 TR:CAC48624
FT                   (EMBL:AL603642) (282 aa) fasta scores: E(): 2.5e-30,
FT                   34.717% id in 265 aa"
FT                   /db_xref="GOA:Q7W0J7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0J7"
FT                   /protein_id="CAE40499.1"
FT                   /translation="MNRTLDTLGAWLLGLLWILPLAYAAWAAFHPPAYATRFDLLAPLT
FT                   LENFARAWNAAPFPRYFLNTFLLVTMVLAAQLVLSTLAGYAFARFEFRGRDFVFMLVLL
FT                   QLMVMPDVLLVENYRSMSLLGVRDTVFAVGLPYFASAFGIFLLRQTFKTVPRELEEAAR
FT                   VEGASPWQVLMKVYVPLARPIYVAYGLVSVSHHWNNFLWPLIITNSVESRPLTVGLQVF
FT                   SSTDQGIDWSVITAATLLSAAPLLVGFLLFQRQFVQSFMRAGIR"
FT   misc_feature    complement(join(116079..116144,116220..116285,
FT                   116397..116447,116493..116546,116574..116639,
FT                   116751..116816))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP0119 by TMHMM2.0 at aa 7-29, 66-88, 97-115, 130-147,
FT                   184-206 and 231-253"
FT   misc_feature    complement(116160..116390)
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   misc_feature    complement(116301..116387)
FT                   /note="ScanRegExp hit to PS00402, Binding-protein-dependent
FT                   transport systems inner membrane comp. sign. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   misc_feature    complement(116766..116837)
FT                   /note="Signal peptide predicted for BP0119 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.983) with cleavage site
FT                   probability 0.879 between residues 24 and 25"
FT   CDS_pept        complement(116834..117709)
FT                   /transl_table=11
FT                   /locus_tag="BP0120"
FT                   /product="inner membrane component of
FT                   binding-protein-dependent transport system"
FT                   /note="Similar to Erwinia chrysanthemi inner membrane
FT                   protein togM TR:CAC44118 (EMBL:AJ305144) (296 aa) fasta
FT                   scores: E(): 9.7e-31, 37.091% id in 275 aa, and to
FT                   Rhizobium loti permease protein of sugar ABC transporter
FT                   mll1715 TR:Q98JZ2 (EMBL:AP002998) (307 aa) fasta scores:
FT                   E(): 6.2e-41, 40.569% id in 281 aa"
FT                   /db_xref="GOA:Q7W0J6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0J6"
FT                   /protein_id="CAE40500.1"
FT                   /translation="MSRTTQAVYGWLLLLPAVVLLAAFTHYPALATLWHSFFSTPKGSR
FT                   PARFVGLENYALLRDDPVFWQSLWNNLWFALGTIPTSIAIALAMALWVNGKLHGRGFLR
FT                   MAYFTPTVLPMVAVANIWLFFYTPQYGLIAQVMQWFGLAGPNWLGSRDTALPALMMVTV
FT                   WKESGFFMIFYLAALQTVSPSLREAAMLEGASRWQYFRRVLWPLLMPTTLFVLVNALIN
FT                   AFRLVDHVVVMTRGGPDNASTLLLFYIYQVGFSFWDTAYAATLTVVLLAVLAATALIKF
FT                   RWLDRRTHYQ"
FT   misc_feature    complement(join(116867..116932,117047..117112,
FT                   117176..117241,117341..117406,117428..117493,
FT                   117623..117688))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP0120 by TMHMM2.0 at aa 7-29, 72-94, 101-123, 156-178,
FT                   199-221 and 259-281"
FT   misc_feature    complement(116957..117181)
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   misc_feature    complement(117644..117709)
FT                   /note="Signal peptide predicted for BP0120 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.912) with cleavage site
FT                   probability 0.365 between residues 22 and 23"
FT   CDS_pept        complement(117720..119012)
FT                   /transl_table=11
FT                   /locus_tag="BP0121"
FT                   /product="probable extracellular solute-binding protein"
FT                   /note="Similar to Escherichia coli
FT                   glycerol-3-phosphate-binding periplasmic protein precursor
FT                   UgpB or B3453 SW:UGPB_ECOLI (P10904) (438 aa) fasta scores:
FT                   E(): 1.1e-30, 29.120% id in 443 aa, and to Thermotoga
FT                   maritima glycerol-3-phosphate ABC transporter, periplasmic
FT                   glycerol-3- phosphate-binding protein Tm1120 TR:Q9X0K4
FT                   (EMBL:AE001770) (436 aa) fasta scores: E(): 3.1e-35,
FT                   31.829% id in 421 aa"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0J5"
FT                   /protein_id="CAE40501.1"
FT                   /translation="MRRIVLKTLAAGLAGAFLALPAQAQQPVEVEFYYPVAVGGPITKI
FT                   VDDMVADFHKENPDIRIKPIYAGTYQDSIAKALTALKGGTPPQLAVLLSTDMFTLIDED
FT                   AIVPVDGLAKSDADKKWLGGFYDAFMQNSRTGGHVWGVPFQRSTIVMYYNKDLFKEAGL
FT                   DPERAPATWDELVEYGKKLTKKDANGNVSQWGIKIPSGGAFAYWLFQALTTPNDAILMN
FT                   EEGSQVYLDKPAVVEAAQFWQDLSVKHGVMPKGTIDWGTTPKDFLEKKAAIVWTTTGNL
FT                   TNIRKNADFPFGVAMMPKKKRGGSPTGGGNFYIFKSGTPAQQQAALKFAQWATTPERAA
FT                   DWSIATGYVAVTPAAWQTERMKKYAQEVPAATMARDQLEVSVAEFSTHENQRVTKVLND
FT                   ALQAALTGSKTPQQALTDAQREADRVLRSYK"
FT   misc_feature    complement(117741..118607)
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding protein"
FT   misc_feature    complement(118941..119012)
FT                   /note="Signal peptide predicted for BP0121 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 24 and 25"
FT   CDS_pept        complement(119055..120095)
FT                   /transl_table=11
FT                   /locus_tag="BP0122"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /note="Similar to Thermococcus litoralis trehalose/maltose
FT                   transport ATP-hydrolyzing subunit MalK TR:Q9V306
FT                   (EMBL:AF126010) (372 aa) fasta scores: E(): 7.4e-44,
FT                   45.205% id in 365 aa, and to Rhizobium meliloti probable
FT                   glycerol-3-phosphate ABC transporter ATP-binding protein
FT                   TR:CAC48805 (EMBL:AL603643) (349 aa) fasta scores: E():
FT                   2.1e-49, 50.000% id in 352 aa"
FT                   /db_xref="GOA:Q7W0J4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0J4"
FT                   /protein_id="CAE40502.1"
FT                   /translation="MSHLVLDDLTKQYGEAAAISGVSFTAPAGSFTVLLGPSGCGKSTT
FT                   LRMIAGLDTPTSGRIRIGDRDVTDLPPAKRRISMVFQSYALFPHLSVRENILFGLKVRK
FT                   EPARDYERRLARVAGLLGLQALLDRKPAQLSGGQQQRVALGRAVISEAPVCLMDEPLSN
FT                   LDAQLRHDMRREIRALQQELGITMVYVTHDQTEAMSMADQVVLMRGGRIEQLDTPDGLY
FT                   ARPATEFAARFIGTPPMNLIALDTHDGRPVVAGTQGPALANAPAGAVTLGLRPEHIRID
FT                   ADGMPAVIESVEYFGADSVAVCRLGSCGGVAVRVNGHLRSAPGTAVGLAWPDERQHFFA
FT                   ADAAVL"
FT   misc_feature    complement(119466..120011)
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    complement(119652..119696)
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   misc_feature    complement(119967..119990)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        complement(120201..121022)
FT                   /transl_table=11
FT                   /locus_tag="BP0123"
FT                   /product="putative cAMP phosphodiesterase"
FT                   /note="Similar to Escherichia coli Icc protein or B3032 or
FT                   Z4389 or ECS3920 SW:ICC_ECOLI (P36650) (275 aa) fasta
FT                   scores: E(): 1.7e-14, 27.509% id in 269 aa, and to
FT                   Rhizobium loti 3',5'-cyclic-nucleotide phosphodiesterase
FT                   CpdA or Mll3631 TR:Q98FT1 (EMBL:AP003002) (305 aa) fasta
FT                   scores: E(): 7.1e-25, 36.078% id in 255 aa"
FT                   /db_xref="GOA:Q7W0J3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR042281"
FT                   /db_xref="InterPro:IPR042283"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0J3"
FT                   /protein_id="CAE40503.1"
FT                   /translation="MLIAQISDLHIRMPGQKAYRVVETDRYLPPAVAALNRLEPAPDLV
FT                   IVSGDLTDFGRPQEYAHLKQMLDALRVPYHVLPGNHDDRVQLAATFADHPYLREAGEFV
FT                   QYTIEDQPLRFIVLDTVVPQQSHGALCERRLQWLAQRLAEQPGRPTVIVMHHPPFRTGI
FT                   AHMDAIGLLAGAPELEALVARHSNVERIMCGHLHRTIFQRFGGTIASTCPSPAHQVALD
FT                   LRPDGPSAFVMEPPGFHLHEWRDGALVTHHAYIESYPGPYPFHEGGELIDE"
FT   CDS_pept        complement(join(121045..121122,122175..123077))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0125"
FT                   /product="probable ABC transporter, ATP-binding protein
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. The IS insertion occurred near the
FT                   C-terminal end (following codon 301). As a consequence, the
FT                   protein is lacking 26 aa at its C-terminal end. Whether the
FT                   protein is still functional remains to be elucidated.
FT                   Similar to Rhizobium loti ABC transporter, ATP-binding
FT                   protein Mlr7387 TR:Q986F1 (EMBL:AP003011) (361 aa) fasta
FT                   scores: E(): 2e-39, 49.822% id in 281 aa, and to
FT                   Caulobacter crescentus spermidine/putrescine ABC
FT                   transporter, ATP-binding protein cc3134 TR:Q9A3R8
FT                   (EMBL:AE005977) (381 aa) fasta scores: E(): 2.4e-39,
FT                   53.184% id in 267 aa"
FT                   /db_xref="PSEUDO:CAE40504.1"
FT   CDS_pept        complement(121123..122073)
FT                   /transl_table=11
FT                   /locus_tag="BP0124"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA3"
FT                   /protein_id="CAE40505.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   repeat_region   121123..121154
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(121123..122175)
FT   misc_feature    complement(121159..121692)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(121750..121815)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   repeat_region   complement(122144..122175)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   misc_feature    complement(122433..122981)
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    complement(122619..122663)
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   misc_feature    complement(122937..122960)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        complement(123074..123922)
FT                   /transl_table=11
FT                   /locus_tag="BP0126"
FT                   /product="ABC transporter, permease protein"
FT                   /note="Similar to Rhizobium loti ABC transporter, permease
FT                   Mlr9016 TR:Q982L0 (EMBL:AP003015) (278 aa) fasta scores:
FT                   E(): 9.8e-17, 31.395% id in 258 aa, and to Treponema
FT                   pallidum spermidine/putrescine ABC transporter, permease
FT                   protein Tp0654 TR:O83660 (EMBL:AE001240) (272 aa) fasta
FT                   scores: E(): 5.7e-13, 28.077% id in 260 aa"
FT                   /db_xref="GOA:Q7W0J2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0J2"
FT                   /protein_id="CAE40506.1"
FT                   /translation="MREAGMSAMYSKTDARLGLTVTLAVAAFLIGPVVLSVLAGLTRNY
FT                   FVGLESGLTLRWVIEVWDLYADTIWRSFAVALLTLLVCTLTGVPAAWVLTLHHGRMARA
FT                   LEELLTLPVAVPGLASALALIVSWGTVSGLRGSIWFIVIGHVLFTLPFMVRATRASMAG
FT                   ADLATLDEAAATLGASRLRRFLTVVVPNAAPGIVTGALTVLTLSIGEFNLTWLLHTPLT
FT                   KTLPVGLADSYASMRLEIASAYTLVFLLMLMPLLVGLQWLAARGERNAANAPITNEKTA
FT                   T"
FT   misc_feature    complement(join(123137..123202,123296..123361,
FT                   123461..123514,123530..123595,123635..123700,
FT                   123806..123871))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP0126 by TMHMM2.0 at aa 17-39, 74-96, 109-131, 136-154,
FT                   187-209 and 240-262"
FT   misc_feature    complement(123221..123445)
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   CDS_pept        complement(join(123919..124107,124107..124742))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0127"
FT                   /product="probable Binding-protein-dependent transport
FT                   system, permease protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 212. The frameshift occurs within
FT                   a homopolymeric tract of 4G. The sequenced has been checked
FT                   and believed to be correct. Similar to Escherichia coli
FT                   molybdenum transport system permease protein ModB or ChlJ
FT                   or B0764 SW:MODB_ECOLI (P09834) (229 aa) fasta scores: E():
FT                   6.4e-16, 34.583% id in 240 aa, and to Pyrococcus furiosus
FT                   putative sulfate transport system permease protein
FT                   TR:Q9HH30 (EMBL:AF307052) (322 aa) fasta scores: E():
FT                   2e-14, 29.278% id in 263 aa"
FT                   /db_xref="PSEUDO:CAE40507.1"
FT   misc_feature    complement(join(124036..124107,124107..124253))
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   variation       complement(124107..124110)
FT                   /note="(G)4 in pertussis; (G)5 in parapertussis"
FT   CDS_pept        complement(124744..125754)
FT                   /transl_table=11
FT                   /locus_tag="BP0128"
FT                   /product="probable periplasmic solute-binding protein"
FT                   /note="Similar to Campylobacter jejuni putative periplasmic
FT                   solute-binding protein Cj0727 TR:Q9PPI0 (EMBL:AL139076)
FT                   (348 aa) fasta scores: E(): 1.5e-26, 32.333% id in 300 aa,
FT                   and to Rhizobium loti ABC transporter, periplasmic binding
FT                   protein Mll3069 TR:Q98H18 (EMBL:AP003001) (368 aa) fasta
FT                   scores: E(): 2.8e-24, 33.981% id in 309 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0J1"
FT                   /protein_id="CAE40508.1"
FT                   /translation="MKRIIQAALRGTLLALAIGAGAAQAQNAICYNCPPEWADWATQLK
FT                   AIKEATGITVPGDNKNSGQALASIAAEKANPVADVVYYGVTFGIQADKDGLVQSYKPAH
FT                   WDAIPDGMKDPDGKWFAIHSGTLGFMVNVDALRGKPVPKSWADLQKPEYRGMVGYLDPA
FT                   SAFVGYVGAVALNRALGGTLDNFDPAIDWFKKMRANRPIVPKQTAYARVLSGEIPILID
FT                   YDFNAYRAKYKDEANVDFVIPAEGTIAVPYVMSLVANAPHADNGRKVLDFTLSERGQAI
FT                   WANAFLRPVRAEAISAEAQKKFLPASEYARAGTVDYVKMSVAQRGFSERYAKEVN"
FT   misc_feature    complement(125680..125754)
FT                   /note="Signal peptide predicted for BP0128 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.996 between residues 25 and 26"
FT   CDS_pept        complement(join(125751..126170,126169..126723,
FT                   126722..126766))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0129"
FT                   /product="probable LacI-family transcriptional regulator
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 198. The frameshift occurs within
FT                   a polymeric tract of 4(GC). The sequenced has been checked
FT                   and believed to be correct. Similar to Escherichia coli
FT                   transcriptional repressor CytR or B3934 or Z5481 or ECS4861
FT                   SW:CYTR_ECOLI (P06964) (341 aa) fasta scores: E(): 2.8e-23,
FT                   30.861% id in 337 aa, and to Streptomyces coelicolor
FT                   probable LacI-family transcriptional regulator Scc57a.16
FT                   TR:Q9RDI2 (EMBL:AL136519) (347 aa) fasta scores: E():
FT                   2.1e-26, 32.523% id in 329 aa."
FT                   /db_xref="PSEUDO:CAE40509.1"
FT   misc_feature    complement(join(125877..126170,126169..126594))
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar binding domain of the LacI family."
FT   variation       complement(126169..126176)
FT                   /note="(GC)4 in pertussis; (GC)5 in parapertussis"
FT   CDS_pept        127034..128287
FT                   /transl_table=11
FT                   /locus_tag="BP0130"
FT                   /product="amidase"
FT                   /note="Similar to Pseudomonas putida amidase SW:AMID_PSEPU
FT                   (O69768) (466 aa) fasta scores: E(): 6.3e-24, 35.526% id in
FT                   380 aa, and to Bradyrhizobium japonicum malonamidase E2
FT                   TR:Q9ZIV5 (EMBL:AF012735) (432 aa) fasta scores: E():
FT                   2.5e-34, 39.012% id in 405 aa. Also similar to BP3713
FT                   (45.679% identity in 405 aa overlap)"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0J0"
FT                   /protein_id="CAE40510.1"
FT                   /translation="MNLNRISASEAARLLNRRDLTAEQLARACLARIEQREPEVQAWTA
FT                   LRPDAVLAAARELDRGPIRGVLHGLPLGVKDMFDTADLPTAYGSGIYQSHQPRADAAAV
FT                   ALCRDAGALVLGKTATTEFATYHPGPTRNPRNTAYTPGGSSSGSAAAVADDMVPLALGT
FT                   QTAGSVIRPAAYCGVVGYKPSFGRISRAGLKSLAETLDTVGMFARSVDDVALLASALMR
FT                   DARLRELRYDGTPRVAMFRSPQWRHTLPETRPAFERAARALSQAGAVVEELAPPPNEDC
FT                   GLAQLHSDVMAYEAAQALAFERIHYPSQLSTKLAAMLEAGAALTAEQYLAHLAQAGQAR
FT                   AKVAEWLQRYDVLLAPSATGDPLFCRAWTLFGVPCVHLPFAQGPQGLPVGLQVVGGFRD
FT                   DQRLLAIARWMNGVLAAD"
FT   misc_feature    127103..128107
FT                   /note="HMMPfam hit to PF01425, Amidase"
FT   misc_feature    127364..127387
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        complement(128378..130078)
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="BP0131"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="Similar to Rhizobium meliloti 2-isopropylmalate
FT                   synthase LeuA SW:LEU1_RHIME (Q9X7L2) (569 aa) fasta scores:
FT                   E(): 5e-105, 49.374% id in 559 aa, and to Pseudomonas
FT                   aeruginosa 2-isopropylmalate synthase LeuA or PA3792
FT                   TR:Q9HXK5 (EMBL:AE004798) (592 aa) fasta scores: E():
FT                   7.9e-135, 58.803% id in 568 aa. The N-terminal region of
FT                   this CDS is similar to BP0287, 68.598% identity (68.598%
FT                   ungapped) in 328 aa overlap"
FT                   /db_xref="GOA:Q7W0I9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0I9"
FT                   /protein_id="CAE40511.1"
FT                   /translation="MMLANPATKYVPFQPFARDFAERTWPSRRITQPPIWMSTDLRDGN
FT                   QSLIEPMSVERKVRFFEQLVKIGFKEIEVGFPSASQTDFDFVRKLIDEKRIPDDVTIIV
FT                   LTQSREDLISRTVEAAAGARQAMIHLYNACAPAFRKIVFNMSRDEIKNIAVTGTRMVKQ
FT                   YMAKYPQTQWRYEYSPEVFSTTEPEFALDVSNAVADEWDATPQRKMVLNLPATIEATSP
FT                   NMYADQIEWMHKNLARRDSIVLSVHPHNDRGTAVAAAEFAVMAGADRIEGCLFGSGERT
FT                   GNVDLVTLALNLYTQGVHPGLDFSDIDEVRRCAEYCNQLPVHPRHPYAGDLVFTAFSGS
FT                   HQDAIKKGFAQQQADAPWEVPYLPIDPADLGRSYDAVIRVNSQSGKGGVSYLLEQEHGL
FT                   VLPRRLQIEFSRAIQRVTDETGREVSSDDVYTIFDSEYLAQQQPWQLVRHRIDGDPSAG
FT                   EGKHFSIEAELSFNGERRIVKGSGDGAISAFVAALDVPVRIMDYHEHAIGTDTRAACYV
FT                   EVRVGDSPTGFGVGIDRDIVTASFKAVLGAVNRHHVAATQATETEAVAA"
FT   misc_feature    complement(128783..128833)
FT                   /note="ScanRegExp hit to PS00283, Soybean trypsin inhibitor
FT                   (Kunitz) protease inhibitors family signature."
FT   misc_feature    complement(129089..129961)
FT                   /note="HMMPfam hit to PF00682, HMGL-like"
FT   misc_feature    complement(129308..129349)
FT                   /note="ScanRegExp hit to PS00816, Alpha-isopropylmalate and
FT                   homocitrate synthases signature 2."
FT   misc_feature    complement(129908..129958)
FT                   /note="ScanRegExp hit to PS00815, Alpha-isopropylmalate and
FT                   homocitrate synthases signature 1. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   CDS_pept        complement(130505..131152)
FT                   /transl_table=11
FT                   /locus_tag="BP0132"
FT                   /product="putative membrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="GOA:Q7W0I8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0I8"
FT                   /protein_id="CAE40512.1"
FT                   /translation="MMNPTSPERIRQDGRLIGQALLKLALPRLIFRVVVVAIAAVIWLL
FT                   VAAWLLAFGKSLSFEGMHALGQQAVDMLTRVNPYFWWGVVAIWSLIVFFSIRAWLGSSI
FT                   AAGRAAVVPTDVLSDLAPRLSPEVLDVLRWVWGEREEPLTVGDLQRAHTELRHNHIGKI
FT                   ALVREQSGILDAPAHRPGPDERHCAARHAEPRITEPRAVEPRLAEPHIGPAR"
FT   misc_feature    complement(join(130850..130915,131000..131065))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BP0132 by TMHMM2.0 at aa 29-51 and 79-101"
FT   CDS_pept        131169..132590
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /gene_synonym="glnF"
FT                   /gene_synonym="ntrA"
FT                   /locus_tag="BP0133"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /note="Similar to Escherichia coli RNA polymerase sigma-54
FT                   factor RpoN or GlnF or NtrA or B3202 SW:RP54_ECOLI (P24255)
FT                   (477 aa) fasta scores: E(): 2.1e-63, 42.946% id in 482 aa,
FT                   and to Alcaligenes eutrophus RNA polymerase sigma-54 factor
FT                   TR:Q9EX69 (EMBL:AJ131690) (492 aa) fasta scores: E():
FT                   9.5e-66, 49.600% id in 500 aa"
FT                   /db_xref="GOA:Q7W0I7"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0I7"
FT                   /protein_id="CAE40513.1"
FT                   /translation="MTRPALELRPGQHLTLTPQLQQSIRLLQLSSLELEAELSQALAEN
FT                   PLLERDEDPAREEQADPEREASVEADEAPDTELRLDEMPGSGGVLPDDDSDLPQAARPD
FT                   TLREHLLGQLALTRAAPRDAALCGLLIDELDENGYLDSPLEEILTWLPAEVQADLDELR
FT                   AALALLQSFDPAGIGARDMAECLQLQLRQPDPARLPEAADAEVLACARRICAQHLPLLA
FT                   TGNVARVREAVQCDEAVVRAAHALIPRLEPRPGRAWTVPAADYAIPDVIVRRTRQGWQA
FT                   VLNSAVVPRLHVNAVYAQVLGGQRQGGNAGLQAQLQQARWMIRNVEQRFDTILRVAQAI
FT                   VAHQQAFFTQGPAAMRPLILKDIAGELDLHESTISRATTQKYMLTPFGTLELKRFFGAG
FT                   VSTDGGDATSATAVQAVIRQMVADEDRAKPLSDSQIMQRLADQGIVIARRTVAKYREAL
FT                   RIAPATLRKAHAAGR"
FT   misc_feature    131169..132572
FT                   /note="HMMPfam hit to PF00309, Sigma-54 factors family"
FT   misc_feature    132237..132296
FT                   /note="ScanRegExp hit to PS00717, Sigma-54 factors family
FT                   signature 1. Confirmed by InterPro eMOTIF pattern match."
FT   misc_feature    132240..132305
FT                   /note="Predicted helix-turn-helix motif with score 1473
FT                   (+4.20 SD) at aa 358-379, sequence LILKDIAGELDLHESTISRATT"
FT   misc_feature    132510..132533
FT                   /note="ScanRegExp hit to PS00718, Sigma-54 factors family
FT                   signature 2. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        132683..132985
FT                   /transl_table=11
FT                   /locus_tag="BP0134"
FT                   /product="putative bacterioferritin-associated ferredoxin"
FT                   /note="Similar to Azotobacter vinelandii
FT                   bacterioferritin-associated ferredoxin Bfd TR:Q9Z5W9
FT                   (EMBL:AF121138) (73 aa) fasta scores: E(): 0.004, 40.426%
FT                   id in 47 aa, and to Neisseria meningitidis putative
FT                   ferredoxin Nma0965 or Nmb0752 TR:Q9JQR7 (EMBL:AL162754) (66
FT                   aa) fasta scores: E(): 4.5e-08, 53.704% id in 54 aa"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0I6"
FT                   /protein_id="CAE40514.1"
FT                   /translation="MPIIVLMYICICNAVTERQVRACVDAGAATLGDLQFELGVATCCG
FT                   CCAATATEYLPGGRASSVCEVRSVAVPVNPPAALEPVGTPQPAANGFPIPLVAVA"
FT   CDS_pept        complement(133013..133933)
FT                   /transl_table=11
FT                   /locus_tag="BP0135"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="Similar to Escherichia coli probable transcriptional
FT                   regulator LrhA or GenR or B2289 SW:LRHA_ECOLI (P36771) (312
FT                   aa) fasta scores: E(): 5.4e-21, 33.212% id in 274 aa, and
FT                   to Rhizobium meliloti putative LysR-family transcriptional
FT                   regulator Sma1979 TR:AAK65745 (EMBL:AE007294) (290 aa)
FT                   fasta scores: E(): 6.7e-40, 49.810% id in 263 aa"
FT                   /db_xref="GOA:Q7W0I5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0I5"
FT                   /protein_id="CAE40515.1"
FT                   /translation="MTNSLFGSKVFEKPMHFPERTAVDLDLLHSFVSVVDAGGFTRAGE
FT                   RVHRTQSTVSQQIRKLEDALGCALFIREGRGVRLTEDGERLLGYARRMLALSNEIREVV
FT                   SGERRLEVVRLGLPDDLAVTRLTHMVADFARRHPQVRLSMRCDLSANLHRAQARGELDL
FT                   VLLKREPGAGPSRAAWPERLHWLCAAGGPATLPDPIALVAFPQGCQYRNRAIHALESAG
FT                   RRWRIAYESPNLSGLQAAVEGGLGVALLEQRCQTPAMARCDALLPRPAPSELALCMSDT
FT                   GSRAVHELARLIMDFCGDDKLRQAA"
FT   misc_feature    complement(133241..133294)
FT                   /note="ScanRegExp hit to PS00216, Sugar transport proteins
FT                   signature 1."
FT   misc_feature    complement(133439..133861)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    complement(133727..133819)
FT                   /note="ScanRegExp hit to PS00044, Bacterial regulatory
FT                   proteins, lysR family signature."
FT   misc_feature    complement(133757..133822)
FT                   /note="Predicted helix-turn-helix motif with score 1647
FT                   (+4.80 SD) at aa 38-59, sequence GGFTRAGERVHRTQSTVSQQIR"
FT   CDS_pept        join(134083..134547,134547..134927)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0136"
FT                   /product="putative integral membrane protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 155. The sequenced has been
FT                   checked and believed to be correct. Similar to Pseudomonas
FT                   aeruginosa hypothetical protein Pa3358 TR:Q9HYN8
FT                   (EMBL:AE004758) (292 aa) fasta scores: E(): 1e-19, 34.164%
FT                   id in 281 aa, and to Agrobacterium tumefaciens Agr_c_4246p
FT                   TR:AAK88080 (EMBL:AE008149) (354 aa) fasta scores: E():
FT                   8.2e-19, 29.965% id in 287 aa"
FT                   /db_xref="PSEUDO:CAE40516.1"
FT   misc_feature    134092..134466
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6"
FT   misc_feature    join(134527..134547,134547..134906)
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6"
FT   variation       134547..134548
FT                   /note="GT in pertussis; G(C)T in parapertussis"
FT   CDS_pept        complement(135158..136108)
FT                   /transl_table=11
FT                   /locus_tag="BP0137"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA3"
FT                   /protein_id="CAE40517.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   repeat_region   135158..135189
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(135158..136210)
FT   misc_feature    complement(135194..135727)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(135785..135850)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   CDS_pept        136210..136479
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0138"
FT                   /product="C-terminal region of an outer membrane porin
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS is the C-terminal region of
FT                   BP0267 which was disrupted by the insertion of IS481
FT                   element. Similar to C-terminal region of the previously
FT                   sequenced Bordetella pertussis outer membrane porin protein
FT                   precursor SW:OMP_BORPE (Q04064) (385 aa) fasta scores: E():
FT                   2e-21, 66.667% id in 90 aa, and to Bordetella pertussis
FT                   OmpQ TR:Q45342 (EMBL:U16266) (364 aa) fasta scores: E():
FT                   0.014, 32.292% id in 96 aa. Also similar to N-terminus of
FT                   BP2851 (65.909% identity in 88 aa overlap), and BP0840
FT                   (66.667% identity in 90 aa overlap)."
FT   misc_feature    136348..136476
FT                   /note="HMMPfam hit to PF00267, Gram-negative porin"
FT   CDS_pept        complement(136527..138035)
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="BP0139"
FT                   /product="threonine dehydratase biosynthetic"
FT                   /EC_number="4.3.1.19"
FT                   /note="Similar to Escherichia coli threonine dehydratase
FT                   biosynthetic IlvA or B3772 SW:THD1_ECOLI (P04968) (514 aa)
FT                   fasta scores: E(): 8.9e-98, 52.200% id in 500 aa, and to
FT                   Burkholderia cepacia threonine dehydratase biosynthetic
FT                   IlvA SW:THD1_BURCE (P53607) (507 aa) fasta scores: E():
FT                   6.2e-134, 69.444% id in 504 aa"
FT                   /db_xref="GOA:Q7W0I4"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0I4"
FT                   /protein_id="CAE40519.1"
FT                   /translation="MSTDYLKRILTSKVYDVAVESPLERAPLLSQRIANNVLLKREDTQ
FT                   AVFSFKLRGAYNKMANLTPAARSRGVIAASAGNHAQGVALAATRLGCRAVIVMPTTSPQ
FT                   VKVDAVRRLGGEVVLAGDSFTDAYEHAQQLEKREKLTFVHPFDDPDVIAGQGTIGMEIL
FT                   RQHPGEIEAIFVAIGGGGLIAGVAAYIKQLRPEIKIIGVQTEDSDAMVRSVRAGRRVQL
FT                   SDVGLFSDGTAVKLVGAETFRLARQYVDDFVVVNTDAICAAIKDVFQDTRSVLEPAGAM
FT                   AVAGAKQYAAEHKLKGKTLVAVACGANMNFDRLRFVAERAEVGEMREAVFAVTMPEQRG
FT                   SFRRFCELVGNRSVTEFNYRISDAERAHVFVGVQVSTPAEPEKIAANFRRHGFDTLDLT
FT                   HDELAKTHLRHMVGGHSALARNELLYRFEFPERPGALMRFLNAMNPDWNISLFHYRNQG
FT                   ADYGNILIGIQVPPTDKKLFKTFVAELGYPHWNETDNPAYRLFL"
FT   misc_feature    complement(136530..136799)
FT                   /note="HMMPfam hit to PF00585, C-terminal domain of
FT                   Threonine dehydratase"
FT   misc_feature    complement(136812..137081)
FT                   /note="HMMPfam hit to PF00585, C-terminal domain of
FT                   Threonine dehydratase"
FT   misc_feature    complement(137115..137996)
FT                   /note="HMMPfam hit to PF00291, Pyridoxal-phosphate
FT                   dependent enzyme"
FT   misc_feature    complement(137361..137408)
FT                   /note="ScanRegExp hit to PS00063, Aldo/keto reductase
FT                   family putative active site signature."
FT   misc_feature    complement(137871..137912)
FT                   /note="ScanRegExp hit to PS00165, Serine/threonine
FT                   dehydratases pyridoxal-phosphate attachment site. Confirmed
FT                   by InterPro eMOTIF pattern match."
FT   CDS_pept        join(138122..138409,138413..138658)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0140"
FT                   /product="conserved hypothetical protein (pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have an in-frame TAG
FT                   stop codon. The sequence has been checked and believed to
FT                   be correct. Similar to Escherichia coli hypothetical 15.6
FT                   kDa protein in gshA-csrA intergenic region YqaA or B2689
FT                   SW:YQAA_ECOLI (P76631) (142 aa) fasta scores: E(): 3.5e-09,
FT                   35.256% id in 156 aa, and to Vibrio cholerae hypothetical
FT                   protein Vc0553 TR:Q9KUG8 (EMBL:AE004141) (153 aa) fasta
FT                   scores: E(): 9.2e-09, 44.578% id in 166 aa"
FT                   /db_xref="PSEUDO:CAE40520.1"
FT   variation       138410..138412
FT                   /note="TAG stop in pertussis; CAG in parapertussis"
FT   CDS_pept        138845..142744
FT                   /transl_table=11
FT                   /locus_tag="BP0141"
FT                   /product="probable iron-sulfur binding oxidase"
FT                   /note="Similar to Neisseria meningitidis oxidoreductase,
FT                   putative nmb0998 TR:Q9JZL6 (EMBL:AE002451) (1277 aa) fasta
FT                   scores: E(): 3e-169, 61.515% id in 1307 aa"
FT                   /db_xref="GOA:Q7W0I3"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021817"
FT                   /db_xref="InterPro:IPR022153"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0I3"
FT                   /protein_id="CAE40521.1"
FT                   /translation="MREIPYNYTSFSDREIVSRLLGEDAWQLVSDLRGERRTGRSARML
FT                   YEVLGDIWVVRRNPYLQDDLLDNPKRRKLLIEALHHRLGEIDKRREPAAVTEAGHDPRR
FT                   DAKVVELLARARSAVAAFEGQFDQTAQLRRQAQRVLGRITARDNIKFDGLSRVSHVTDA
FT                   TDWRVEYPFVVLTPDAEDEIAALVRACIELGLTIVPRGGGTGYTGGAIPLTWKSAVINT
FT                   EKFEALGEVESCVLPGMTEPAAVIRAGAGVVTKRVAEAAERAGFVFAVDPTSAEASCVG
FT                   GNIAMNAGGKKAVLWGTALDNLAWWRMVDPDGNWLEVTRLAHNLGKIHDVDVASFELKW
FT                   FDGAGKPGEKLLRTERLDIEGRKFRKAGLGKDVTDKFLAGLPGVQKEGCDGLITSARWV
FT                   LHRMPRHTRTVCMEFFGQARDAIPSIVEVKGYLDGEGKARGAILAGLEHLDERYLRAVG
FT                   YATKSKRGMLPKMVLIGDIVGDDEDAVATAASEVVRLANTRHGEGFVAVSAEARKKFWL
FT                   DRSRTAAIARHTNAFKINEDVVIPLDRMGEYTDHIERINIELSTRNKLRLLDELDAYLA
FT                   EPLPMGKVEDAEDVALTRAEVLAERTRQAIEHLARTRRRWQWLLDNLDLPLAQALPELD
FT                   GLDMAAQREALAERVQAQPQARVFDVVQDHTVRISWKTEVLPALQGVFSGNAGKLILEG
FT                   LVAVHARVLKSRVFVALHMHAGDGNVHTNIPVNSDDYGMLREANQAVERIMQIARDLDG
FT                   VISGEHGIGLTKYEFLTEAELAPFQEYKRRVDPNGHFNAGKLMPGADLRHAWTPSFNLM
FT                   GHESLIMQQSDIGAIADSVKDCLRCGKCKPVCSTHVPRANLLYSPRNKILATSLLVEAF
FT                   LYEEQTRRGISLKHWEEFEDVADHCTVCHKCYTPCPVDIDFGDVSMNMRALLRRMGRKS
FT                   FNPGTAAAMFFLNAKDPAAINATRKAMVGVGYKVQRAAHDLLASVSRKQAAHPPATVGR
FT                   APLREQVVHFVNRKMPGGLPKQTARKLLDIEDANYVPIIRDPKTTTADTEAVFYFPGCG
FT                   SERLFSQVGLATQAMLWHAGVQTVLPPGYLCCGYPQRGNGMTDKAEQIITDNRVLFHRV
FT                   SNTLNYLDIKTVVVSCGTCYDQLAGYEFEKIFPGCRLIDIHEYLLEKGIKLDGVQGVRY
FT                   MYHDPCHTPMKLQDPMKTVRSLVGEGAQKSDRCCGESGTLAVSRPDVSTQVRFRKQEEL
FT                   DQGQAAMRADGFSGDVKVLTSCPSCLQGLSRYEGETGMDADYIVVEMARHILGETWMED
FT                   YVRRANTGGIEHVLV"
FT   misc_feature    138845..138856
FT                   /note="ScanRegExp hit to PS00228, Tubulin-beta mRNA
FT                   autoregulation signal."
FT   misc_feature    139256..140029
FT                   /note="HMMPfam hit to PF01565, FAD binding domain"
FT   misc_feature    141323..141394
FT                   /note="HMMPfam hit to PF00037, 4Fe-4S binding domain"
FT   misc_feature    141530..141547
FT                   /note="ScanRegExp hit to PS00190, Cytochrome c family
FT                   heme-binding site signature."
FT   misc_feature    141530..141565
FT                   /note="ScanRegExp hit to PS00198, 4Fe-4S ferredoxins,
FT                   iron-sulfur binding region signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   CDS_pept        142797..143579
FT                   /transl_table=11
FT                   /locus_tag="BP0142"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="Similar to Deinococcus radiodurans transcriptional
FT                   regulator, GntR family Dr0815 TR:Q9RW54 (EMBL:AE001936)
FT                   (267 aa) fasta scores: E(): 1.7e-09, 30.041% id in 243 aa,
FT                   and to Bacillus subtilis hypothetical transcriptional
FT                   regulator YdhC SW:YDHC_BACSU (O05494) (224 aa) fasta
FT                   scores: E(): 3e-10, 29.469% id in 207 aa"
FT                   /db_xref="GOA:Q7W0I2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0I2"
FT                   /protein_id="CAE40522.1"
FT                   /translation="MRYLCFNVYLVLSYICKLRRPAAKEFILDVKAPATIPYFLKEQIR
FT                   ELIVDGTFRPGQPLREQDLEQRFGTSRSPIREALRLLERGGLVVHLQRKGFRIRRYSQT
FT                   EIRQVYMLYAELEAYSIMQLSEAADSPLLDDLRRHEARIAQAQADADVRGYIGALRDFY
FT                   LASARFTGNVPLADTLSRLYEQVEPLRYNLVRRTLAATPADQYHRGIVPALAQRDLAGA
FT                   ARQAHVLVREMLPRILSAYEQWAGDAGDEPGDDRLRVA"
FT   misc_feature    142914..143090
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family"
FT   misc_feature    142968..143042
FT                   /note="ScanRegExp hit to PS00043, Bacterial regulatory
FT                   proteins, gntR family signature."
FT   misc_feature    142971..143036
FT                   /note="Predicted helix-turn-helix motif with score 1190
FT                   (+3.24 SD) at aa 59-80, sequence LREQDLEQRFGTSRSPIREALR"
FT   CDS_pept        complement(143667..144890)
FT                   /transl_table=11
FT                   /locus_tag="BP0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identical to the N-terminal region of Bordetella
FT                   pertussis hypothetical 29.3 kDa protein TR:O30450
FT                   (EMBL:AF006000) (273 aa) fasta scores: E(): 9.8e-105,
FT                   100.000% id in 273 aa, and similar to Pseudomonas
FT                   aeruginosa hypothetical protein PA0446 TR:Q9I672
FT                   (EMBL:AE004482) (407 aa) fasta scores: E(): 2.7e-92,
FT                   57.248% id in 407 aa. Also similar to BP1779 (68.059%
FT                   identity in 407 aa overlap), and BP3309 (57.143% identity
FT                   in 399 aa overlap)."
FT                   /db_xref="GOA:Q7W0I1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0I1"
FT                   /protein_id="CAE40523.1"
FT                   /translation="MKQALEHIKVVDLTRVLAGPWATQILADMGARVIKIERPGAGDDL
FT                   RGWGPPFLKNAHGEETTDAAYFLSTNRGKESVTLDISSAEGQEIVRQLAKDADVLVENY
FT                   KVGTLARFGLDYESLRKINPRLVYCSVTGFGQTGPHAHLPGYDYIFQGMGGLMSITGLP
FT                   DAEPGGGPLKTGIPITDVVTGIYASTAILGALEHRNLSGEGQAIDISLLDCLVNVTGCA
FT                   VMNYFLSGRIPQRLGNTHSNMVPYQVFRCKEGDVIVAVGNDTQFVTFAGLIGMPQLATD
FT                   SRFSTMAQRSRNRETLIPIIAQAMQARTMQEWVSLLEAANVPCGPINNLQQVFEDPQVQ
FT                   HRGLKLSLPHGSGVDAPGVASPIRYSATPIAYGRAAPCLGEHTDDVLQSELGMAPAAIG
FT                   ALRARGIV"
FT   misc_feature    complement(144081..144662)
FT                   /note="HMMPfam hit to PF02515, CAIB/BAIF family"
FT   CDS_pept        complement(144874..145806)
FT                   /transl_table=11
FT                   /locus_tag="BP0144"
FT                   /product="putative lipase"
FT                   /note="This CDS start with an isoleucine, whereas
FT                   parapertussis and bronchiseptica start with a methionine.
FT                   The sequence has been checked and believed to be correct.
FT                   Identical to the previously sequenced Bordetella pertussis
FT                   hypothetical 34.3 kDa protein TR:O30449 (EMBL:AF006000)
FT                   (324 aa) fasta scores: E(): 2.8e-116, 100.000% id in 303
FT                   aa, and to Acinetobacter spSE19. acetyl-hydrolase chnC
FT                   TR:Q9F7D7 (EMBL:AF282240) (300 aa) fasta scores: E():
FT                   1.8e-28, 34.507% id in 284 aa. Also similar to BP2097,
FT                   39.583% identity in 288 aa overlap"
FT                   /db_xref="GOA:Q7W0I0"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0I0"
FT                   /protein_id="CAE40524.1"
FT                   /translation="MASAQLATLSAQVRQLYAGWDPNTDIARIRRDWDAFFGAVRLPAR
FT                   VTPVDAGGVPCHWIEAPASTRDRVVVFIHGGGYQIGSHRSHHNLMARLSAWSGRAVLSI
FT                   GYRLAPQARCPAALEDVDAAHAWLAGQGWSARQTALCGDSAGGALAVLLLARLRARGAA
FT                   LPAACAVMSPWIDLQARGESYTANAASDPIANRATVLRMARAYLGRDGDPEAPAVSAQH
FT                   ADLRGLPPLLVQAGSAEALLDDARALAARAAASGVAVRLSVWQDMPHVFQLFAARLDAA
FT                   DAAIAELADFINHPLRAPTGAEPRHETST"
FT   misc_feature    complement(145549..145599)
FT                   /note="ScanRegExp hit to PS01173, Lipolytic enzymes
FT                   'G-D-X-G' family, putative histidine active site. Confirmed
FT                   by InterPro eMOTIF pattern match."
FT   variation       complement(145804..145806)
FT                   /note="AT(A) (isoleucine) in pertussis; AT(G) (a methionine
FT                   start codon)in parapertussis and bronchiseptica"
FT   CDS_pept        complement(145812..146624)
FT                   /transl_table=11
FT                   /locus_tag="BP0145"
FT                   /product="putative enoyl-CoA hydratase/isomerase"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis hypothetical 29.5 kDa protein TR:O30448
FT                   (EMBL:AF006000) (270 aa) fasta scores: E(): 3e-109,
FT                   100.000% id in 270 aa, and similar to Escherichia coli
FT                   naphthoate synthase MenB or B2262 SW:MENB_ECOLI (P27290)
FT                   (285 aa) fasta scores: E(): 3.5e-20, 33.969% id in 262 aa"
FT                   /db_xref="GOA:Q79H39"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H39"
FT                   /protein_id="CAE40525.1"
FT                   /translation="MNKSDSFELIEYQAADGIARIAHNRPQARNAESQGLLEELDQALG
FT                   LAVRDASVKAIVISGKGDHFSAGHDLKEAAAKRSNFTVEQRWEFEQRYYLGYAMHIYDC
FT                   PKPTIAQVSGACIAGGFMVANMCDLIVASDDAFFSDPVCQTLATAAVEVMIHPWVMGAR
FT                   KAKEFLFLGERMSAREALAIGMVNKVVARAELQAETERMAQRIAACDPFALRLVKRSIN
FT                   RGLEMQGLRSAIDAHFDTHQLSHLSEGFNRARAQGLGNAIQAAAAGSR"
FT   misc_feature    complement(146052..146570)
FT                   /note="HMMPfam hit to PF00378, Enoyl-CoA
FT                   hydratase/isomerase family"
FT   CDS_pept        complement(join(146645..147106,147110..147865))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0146"
FT                   /product="putative hydroxylase (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have an in-frame
FT                   stop codon. The sequence has been checked and believed to
FT                   be correct. Identical to the previously sequenced
FT                   Bordetella pertussis hypothetical 45.1 kDa protein
FT                   TR:O30447 (EMBL:AF006000) (406 aa) fasta scores: E():
FT                   1.4e-164, 99.754% id in 406 aa, and similar to Streptomyces
FT                   coelicolor putative salicylate hydroxylase Sce29.14C
FT                   TR:Q9Z4Y6 (EMBL:AL035707) (420 aa) fasta scores: E():
FT                   2.6e-41, 39.692% id in 325 aa"
FT                   /db_xref="PSEUDO:CAE40526.1"
FT   variation       complement(147107..147109)
FT                   /note="In-frame TAG stop codon in pertussis; CAG in
FT                   parapertussis and bronchiseptica"
FT   misc_feature    complement(147812..147865)
FT                   /note="Signal peptide predicted for BP0147 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.926) with cleavage site
FT                   probability 0.464 between residues 18 and 19"
FT   CDS_pept        complement(147937..148908)
FT                   /transl_table=11
FT                   /locus_tag="BP0148"
FT                   /product="putative exported protein"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis hypothetical 34.9 kDa protein in brg1 3'region
FT                   precursor SW:YBR5_BORPE (O30446) (323 aa) fasta scores:
FT                   E(): 6.7e-122, 100.000% id in 323 aa, and similar to
FT                   Comamonas testosteroni OrfJ protein TR:Q9RHM9
FT                   (EMBL:AB029044) (326 aa) fasta scores: E(): 8.9e-35,
FT                   35.220% id in 318 aa"
FT                   /db_xref="GOA:O30446"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/Swiss-Prot:O30446"
FT                   /protein_id="CAE40527.1"
FT                   /translation="MKPFSLLRRIATIALLMAASSAHADTFPSRPIRLIVPFGPGGITD
FT                   LIARQAALGMAEKLGQPVIIENKPSAGHIVAMQTVAQATPDGYTILLGSNTGFTVAPHM
FT                   YKNLPFRIDTLQPIAPINTAPTVLLARPDFPANNLTELIQYIKDNPGKLNYGSFGIGTS
FT                   AHLGMEIMKSDLGLNIMHIPYRGDAQGLLALKAKEVDIAYITLFSAQARIRAGEFKALG
FT                   VLQNDRLTAFPDIQTTVEVGSKNSGMPVWIAFFAPPGTPDAVMRKLESATRSASTAPAF
FT                   VEFLHNNGVEPWNPSNQDLMRFIQDQLNRSGPIIQEIGLQPQ"
FT   misc_feature    complement(148837..148908)
FT                   /note="Signal peptide predicted for BP0148 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 24 and 25"
FT   CDS_pept        149027..149809
FT                   /transl_table=11
FT                   /locus_tag="BP0149"
FT                   /product="probable transcriptional regulator"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis hypothetical 29.0 kDa protein TR:O30445
FT                   (EMBL:AF006000) (260 aa) fasta scores: E(): 2.1e-107,
FT                   100.000% id in 260 aa, and similar to Pseudomonas
FT                   aeruginosa probable transcriptional regulator pa1630
FT                   TR:Q9I392 (EMBL:AE004590) (288 aa) fasta scores: E():
FT                   3e-31, 40.329% id in 243 aa"
FT                   /db_xref="GOA:Q79H38"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H38"
FT                   /protein_id="CAE40528.1"
FT                   /translation="MSAPKASRPARDRQFASTLAHGLQLLRCFTPEAAVLSNRQLSELS
FT                   GLSKPTVSRYTYTLIELGYLKVDPVSGKFQLGNAVLTLSYPLLANIALRQVVRSPMREL
FT                   AERLGCSVSLCMRERLSMVYVETSRSRSLRAQRYSDIGMSHPIIATSNGRAYLAACSAD
FT                   ERNTLFNQIRVKTPEHWERWGESALDMIQFWGRHGFCYSHGEYRPDVATVGVPYRPSSG
FT                   GELYVFNCVLGSQFVKPGQLENEVGPALLEMTSVLPYA"
FT   misc_feature    149132..149197
FT                   /note="Predicted helix-turn-helix motif with score 1696
FT                   (+4.96 SD) at aa 36-57, sequence LSNRQLSELSGLSKPTVSRYTY"
FT   misc_feature    149246..149806
FT                   /note="HMMPfam hit to PF01614, Bacterial transcriptional
FT                   regulator"
FT   CDS_pept        complement(join(149820..149906,149908..150579))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0150"
FT                   /product="conserved hypothetical protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 224. The frameshift occurs within
FT                   a homopolymeric tract of (C)3. The sequence has been
FT                   checked and believed to be correct. Identical to the
FT                   previously sequenced Bordetella pertussis hypothetical 26.3
FT                   kDa protein TR:O30444 (EMBL:AF006000) (252 aa) fasta
FT                   scores: E(): 4.5e-92, 100.000% id in 252 aa, and similar to
FT                   Staphylococcus aureus subspaureus Mu50. conserved
FT                   hypothetical protein Sav1605 TR:BAB57767 (EMBL:AP003362)
FT                   (250 aa) fasta scores: E(): 8.6e-46, 52.227% id in 247 aa"
FT                   /db_xref="PSEUDO:CAE40529.1"
FT   variation       complement(149906..149908)
FT                   /note="(C)3 in pertussis; (C)2 in parapertussis"
FT   CDS_pept        complement(150576..151556)
FT                   /transl_table=11
FT                   /locus_tag="BP0151"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis hypothetical 59.5 kDa protein TR:O30443
FT                   (EMBL:AF006000) (568 aa) fasta scores: E(): 2.8e-122,
FT                   100.000% id in 326 aa, and similar to Bacillus halodurans
FT                   Bh1818 protein TR:Q9KBV6 (EMBL:AP001513) (331 aa) fasta
FT                   scores: E(): 2.6e-41, 43.344% id in 323 aa"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0H9"
FT                   /protein_id="CAE40530.1"
FT                   /translation="MSLAVIKPGMLSTFQDGGRHGYQHQGIPVAGAMDPRAHRLANLLA
FT                   GNAADTATLEITVAGPTLRFEAPACVALGGADLGATLGGLPAPVLRPLVARAGDVLSFA
FT                   RPGQGARAYLAVHGGYDLPMVMGNQSTYLRSAFGGYHGRALAKGDQVGLRRPLADDAAR
FT                   LDALAQQLWQLRFYLAATLSSPPRDVLRILPGPHWAAFDAASRQALLDQAFRIGAQSDR
FT                   MGYRLEGPRLRLSEPREMLSEATCFGTVQVPADGAPIVLMADRQTTGGYPKLAQAMPGQ
FT                   ALRFALIELAQAQRLDAAREAAFAQLTGQLDALRGLLRDFQEPTP"
FT   misc_feature    complement(150648..151487)
FT                   /note="HMMPfam hit to PF02626, Uncharacterized ACR,
FT                   COG1984"
FT   CDS_pept        complement(151553..152281)
FT                   /transl_table=11
FT                   /locus_tag="BP0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis hypothetical 59.5 kDa protein TR:O30443
FT                   (EMBL:AF006000) (568 aa) fasta scores: E(): 3.9e-82,
FT                   99.103% id in 223 aa, and similar to Bacillus halodurans
FT                   Bh1817 protein TR:Q9KBV7 (EMBL:AP001513) (225 aa) fasta
FT                   scores: E(): 2.6e-26, 44.144% id in 222 aa"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0H8"
FT                   /protein_id="CAE40531.1"
FT                   /translation="MTASPSPPSSAPAGWRILPQGDRCLIVWFGAQIDAGVGRACLAAA
FT                   GLLRAAGLAGVTDVVPSFAAVAVHYRPGPDGAPDYATLAAQVERLLAGGIPVDDSAGRE
FT                   MEIPVCYGGEHGPDLEEAARAAGLTPEALVALHGAPGSMVYMLGFAPGHSYIGVHDARL
FT                   DLPRRATPRTAVPAGSVAIANRQTVIYPARLPGGWNIIGATPLNLFDPGREPAALLQPG
FT                   DRIRFVPIDAAEFDRLREAQ"
FT   misc_feature    complement(151625..152239)
FT                   /note="HMMPfam hit to PF02682, Uncharacterized ACR,
FT                   COG2049"
FT   CDS_pept        complement(152306..152737)
FT                   /transl_table=11
FT                   /locus_tag="BP0153"
FT                   /product="probable dioxygenase"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis hypothetical 15.6 kDa protein TR:O30442
FT                   (EMBL:AF006000) (143 aa) fasta scores: E(): 6.4e-60,
FT                   100.000% id in 143 aa, and similar to Pseudomonas
FT                   aeruginosa probable ring-cleaving dioxygenase Pa0817
FT                   TR:Q9I5C2 (EMBL:AE004517) (141 aa) fasta scores: E():
FT                   6.1e-33, 60.584% id in 137 aa"
FT                   /db_xref="GOA:Q79H37"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H37"
FT                   /protein_id="CAE40532.1"
FT                   /translation="MSTPSPIPPFHLAFPVRDLAEARDFYGALLGCPEGRSSPEWIDFN
FT                   FYGHQIVAHLAPQACGSAATNAVDAHNVPVRHFGAVLSMDQWEALAGKLTDAGTEFVIE
FT                   PYIRFKGEVGEQATMFFLDPSGNALEFKAFKNIESLFAK"
FT   misc_feature    complement(152336..152695)
FT                   /note="HMMPfam hit to PF00903, Glyoxalase/Bleomycin
FT                   resistance protein/Dioxygenase superfamily"
FT   CDS_pept        152839..153714
FT                   /transl_table=11
FT                   /gene="brg1"
FT                   /locus_tag="BP0154"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis Brg1 TR:O30441 (EMBL:AF006000) (291 aa) fasta
FT                   scores: E(): 6.6e-108, 99.656% id in 291 aa, and similar to
FT                   Pseudomonas aeruginosa probable transcriptional regulator
FT                   pa0816 TR:Q9I5C3 (EMBL:AE004516) (294 aa) fasta scores:
FT                   E(): 1.9e-38, 46.259% id in 294 aa"
FT                   /db_xref="GOA:Q79H36"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H36"
FT                   /protein_id="CAE40533.1"
FT                   /translation="MIREFKTFIAVARGGTFTGAGRRLGLTQSAVSAQIKRLEEHLGVA
FT                   LFERTGKSAALNHHGRSLLPQAEVLVAMADRVVGMAGAGRISGLLRVGAIASVQQDLLV
FT                   RALAALRAEHPDVRVRIVPGVSLTLLGHVDAGEVDLAVLIRPPFALPPELEWQPLLHEP
FT                   MVLAVPEAAPEGPWRELLAGQPFIRYDRASFGGRLVDMFLKRHRLDVREAIELDEIDAI
FT                   ANLVRHGLGVALLPHTRHLDARGLRLLELDDQVRFAREIGLIVRQPLGQSPLAQRLAQC
FT                   LRAAVSFGEA"
FT   misc_feature    152842..153264
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    152881..152946
FT                   /note="Predicted helix-turn-helix motif with score 1732
FT                   (+5.09 SD) at aa 15-36, sequence GTFTGAGRRLGLTQSAVSAQIK"
FT   misc_feature    152884..152976
FT                   /note="ScanRegExp hit to PS00044, Bacterial regulatory
FT                   proteins, lysR family signature."
FT   CDS_pept        complement(153767..154987)
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="BP0155"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis D-3-phosphoglycerate dehydrogenase homolog SerA
FT                   TR:O30440 (EMBL:AF006000) (399 aa) fasta scores: E():
FT                   4.9e-146, 99.749% id in 399 aa, and similar to Escherichia
FT                   coli D-3-phosphoglycerate dehydrogenase SerA or B2913
FT                   SW:SERA_ECOLI (P08328) (409 aa) fasta scores: E(): 1.6e-81,
FT                   56.500% id in 400 aa"
FT                   /db_xref="GOA:Q7W0H7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0H7"
FT                   /protein_id="CAE40534.1"
FT                   /translation="MLYRQPNMAQIVLFENIHPSARAVFSAAGYTDIVAHAAALPSGEL
FT                   REALRGAEVVGIRSRTHLDADLLAANPDLRVVGCFCIGTNQVDLDAAMMRGVPVFNAPF
FT                   SNTRSVAELVLGEAILLLRRIPEKNARVHLGHWDKSAAGAYEARGKTLGIVGYGNIGSQ
FT                   ISTLAEAIGMRVVFFDVEAKLPLGNARAAGSLAELLEQADVVTLHVPGGKSTQNIVNAD
FT                   TLARMKRGAILINASRGTVVDIQALHDALASGHLAGAALDVFPTEPKSADEPLASPLIG
FT                   MPNVVLTPHIGGSTQESQENIGREVAEKLVRFLQAGTTKSAVNFPELSYQAPVGGSRII
FT                   HVHRNAPGALGALDNLMAQHGLNIVSQSLQTKGQIGYAVTDVDGEVSDTVLADLRSHPV
FT                   TVRCEKL"
FT   misc_feature    complement(153770..153979)
FT                   /note="HMMPfam hit to PF01842, ACT domain"
FT   misc_feature    complement(154118..154741)
FT                   /note="HMMPfam hit to PF00389, D-isomer specific
FT                   2-hydroxyacid dehydrogenase, catalytic domain"
FT   misc_feature    complement(154259..154309)
FT                   /note="ScanRegExp hit to PS00671, D-isomer specific
FT                   2-hydroxyacid dehydrogenases signature 3. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   misc_feature    complement(154328..154396)
FT                   /note="ScanRegExp hit to PS00670, D-isomer specific
FT                   2-hydroxyacid dehydrogenases signature 2. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   misc_feature    complement(154451..154534)
FT                   /note="ScanRegExp hit to PS00065, D-isomer specific
FT                   2-hydroxyacid dehydrogenases NAD-binding signature.
FT                   Confirmed by InterPro eMOTIF pattern match."
FT   misc_feature    complement(154535..154558)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        complement(155071..155532)
FT                   /transl_table=11
FT                   /locus_tag="BP0156"
FT                   /product="putative exported protein"
FT                   /note="Similar to Pasteurella multocida hypothetical
FT                   protein Pm1939 TR:Q9CJQ5 (EMBL:AE006230) (151 aa) fasta
FT                   scores: E(): 1.5e-25, 51.370% id in 146 aa, and to
FT                   Pseudomonas aeruginosa hypothetical protein Pa4714
FT                   TR:Q9HV84 (EMBL:AE004885) (149 aa) fasta scores: E():
FT                   8.1e-21, 46.853% id in 143 aa"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0H6"
FT                   /protein_id="CAE40535.1"
FT                   /translation="MSHVSTLRRALLGALLLAPAAALANTPIPIDVWRTPTCGCCEDWL
FT                   QHLRSNGFEVRAHMVEDTAPVRSQAGMPARYGSCHTARVQGYTVEGHVPAADIRRLLRD
FT                   KPRAVGLTAPGMPIGSPGMDGPAYGGRRDAYDVLLVQPDGSVRVFQAYR"
FT   misc_feature    complement(155461..155532)
FT                   /note="Signal peptide predicted for BP0156 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 24 and 25"
FT   CDS_pept        complement(155638..157035)
FT                   /transl_table=11
FT                   /locus_tag="BP0157"
FT                   /product="two-component sensor kinase"
FT                   /note="Similar to Escherichia coli sensor kinase CusS or
FT                   B0570 SW:CUSS_ECOLI (P77485) (480 aa) fasta scores: E():
FT                   3e-34, 33.124% id in 477 aa, and to Pseudomonas aeruginosa
FT                   probable two-component sensor pa1438 TR:Q9I3Q9
FT                   (EMBL:AE004573) (481 aa) fasta scores: E(): 1e-37, 35.177%
FT                   id in 452 aa"
FT                   /db_xref="GOA:Q7W0H5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0H5"
FT                   /protein_id="CAE40536.1"
FT                   /translation="MRLRTPSMQRRLTLWLGVIALLASSLAGALLFWTLKQEVQRQEIT
FT                   EARGKAELIEHLVGMQSHTSRALSDMLDGIQAGHGHLGIWITSPDGTLRYGNATPEVLS
FT                   VTDDDEVLLRNADDTRMRGVRLTLPGPPEAGATLTVAVNTLANARFLYAYGTALLLICA
FT                   LWIGATVVLAAWAVRRTLAPVRRLSGQAASIQPEHLDVRLPVVGIDRELSDLVASFNRT
FT                   LDRLQEAYQKMEGFNADVAHELRTPLATLINGAQVTLSSPRSAEELREALTSNLEELED
FT                   LKTLVNDMLFLARADRGEQAADLAPARLEQEALRVAEYFEATLEAQALHVAVQGSATCA
FT                   ANPGLVRRALANLLANAIRATPRGATITVRCAALPDGAARLTVHNPGPPIPAADLPRIF
FT                   DRFFRSGGARPPRGEGHGLGLAIVRAIARMHNGGVTAASGPAGTEIGFSLGARPAQDDK
FT                   RVIRATD"
FT   misc_feature    complement(155677..156015)
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, phytochrome-like ATPase"
FT   misc_feature    complement(156142..156342)
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain"
FT   misc_feature    complement(156352..156564)
FT                   /note="HMMPfam hit to PF00672, HAMP domain"
FT   misc_feature    complement(join(156505..156570,156934..156999))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BP0157 by TMHMM2.0 at aa 12-34 and 155-177"
FT   misc_feature    complement(156949..157035)
FT                   /note="Signal peptide predicted for BP0157 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.685 between residues 29 and 30"
FT   CDS_pept        complement(157032..157709)
FT                   /transl_table=11
FT                   /locus_tag="BP0158"
FT                   /product="two-component response regulator"
FT                   /note="Similar to Escherichia coli transcriptional
FT                   regulatory protein PcoR SW:PCOR_ECOLI (Q47456) (226 aa)
FT                   fasta scores: E(): 4.7e-46, 53.846% id in 221 aa, and to
FT                   Pseudomonas aeruginosa probable two-component response
FT                   regulator Pa1437 TR:Q9I3R0 (EMBL:AE004573) (229 aa) fasta
FT                   scores: E(): 9.4e-56, 63.393% id in 224 aa"
FT                   /db_xref="GOA:Q7W0H4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0H4"
FT                   /protein_id="CAE40537.1"
FT                   /translation="MCILVIEDEPKLADYLHKGLSEQSHIVDVARDGVNGRHLALEGDY
FT                   ELVILDVMLPDIDGFAVLAALRAAARNTPVLMLTARDRVEDRVRGLEGGADDYLVKPFA
FT                   FSELLARVHALQRRGRSQESTLLRLADLELDLASRKAQRGGRRLDLTAKEFSLLALLLR
FT                   RQGQILSRTTLAEQVWDMNFDSDTNVIDVAIRRLRGKLDDPYDAKLLHTVRGMGYVLES
FT                   RPS"
FT   misc_feature    complement(157059..157274)
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C terminal"
FT   misc_feature    complement(157374..157709)
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain"
FT   CDS_pept        complement(157765..159075)
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /gene_synonym="nmpB"
FT                   /locus_tag="BP0159"
FT                   /product="phosphate regulon sensor protein"
FT                   /note="Similar to Escherichia coli phosphate regulon sensor
FT                   protein PhoR or NmpB or B0400 SW:PHOR_ECOLI (P08400) (431
FT                   aa) fasta scores: E(): 1e-55, 41.458% id in 439 aa, and to
FT                   Klebsiella pneumoniae phosphate regulon sensor protein PhoR
FT                   SW:PHOR_KLEPN (P45608) (431 aa) fasta scores: E(): 3.2e-55,
FT                   40.961% id in 437 aa"
FT                   /db_xref="GOA:Q7W0H3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0H3"
FT                   /protein_id="CAE40538.1"
FT                   /translation="MIWLRTLFMIAFWAVMALLAQWLIGDPAGWLLFGAATAAMLLWRS
FT                   WRLHLVSRWAHDPESAPPAAVGPWDDILAPLYRYTRARARELAETRETMQSMLAAAQAL
FT                   PDGVVTLNEDFQIDWANRMARRHLGLRLPADRGHNLLNLLRAPEFVAYAHRGHWPEPIL
FT                   VRLSLNGQERVMMIHLAGYASNQRLLISRDVTQIERLETTRRDFVANVSHELRTPLTVL
FT                   AGFLETLRELPAEALPAEQRDQYMAMMHEQARRMQAIVEDLLTLSTLESSPEADPLAVD
FT                   VGALLRTARQQVEALSNGRHVFEWQIEEGLDVLGSGTELASALSNLLTNAVRYTPDGGR
FT                   IIVRWRRGADGEALYSVQDTGIGIPARHLPRLTERFYRVDRGRSRAAGGTGLGLAITKH
FT                   IAMRHDADLLIDSELGKGSTFTLRFPAERVTGEDPDR"
FT   misc_feature    complement(157792..158133)
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, phytochrome-like ATPase"
FT   misc_feature    complement(158260..158469)
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain"
FT   misc_feature    complement(159004..159069)
FT                   /note="1 probable transmembrane helix predicted for BP0159
FT                   by TMHMM2.0 at aa 2-24"
FT   misc_feature    complement(159016..159075)
FT                   /note="Signal peptide predicted for BP0159 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.993) with cleavage site
FT                   probability 0.600 between residues 20 and 21"
FT   CDS_pept        complement(159087..159785)
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="BP0160"
FT                   /product="phosphate regulon transcriptional regulatory
FT                   protein"
FT                   /note="Similar to Escherichia coli phosphate regulon
FT                   transcriptional regulatory protein PhoB or B0399 or Z0497
FT                   or ECS0449 SW:PHOB_ECOLI (P08402) (229 aa) fasta scores:
FT                   E(): 2.6e-52, 59.211% id in 228 aa, and to Vibrio cholerae
FT                   DNA-binding response regulator PhoB or VC0719 TR:Q9KU11
FT                   (EMBL:AE004158) (229 aa) fasta scores: E(): 1.3e-54,
FT                   60.526% id in 228 aa"
FT                   /db_xref="GOA:Q7W0H2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0H2"
FT                   /protein_id="CAE40539.1"
FT                   /translation="MSSTILVVEDEPAIQELIAVNLSFAGHKVLRAFDAEQAQTLIRAE
FT                   LPDLILLDWMLPGASGLSLARKLRDEERTRAVPVIMLTAKGAEQDKVDGLEAGADDYIT
FT                   KPFSPKELMARIKAVLRRRAPQLTDDIIDVAGLKLDPVTHRLSGHSQSLSIGPTEFRLL
FT                   HFFMTHPERVFSRSQLLDQVWGDHVFVEERTVDVHIRRLRKALEPSGHDAHVETVRGSG
FT                   YRFTAQVPAR"
FT   misc_feature    complement(159120..159335)
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C terminal"
FT   misc_feature    complement(159438..159779)
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain"
FT   CDS_pept        159949..160725
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="BP0161"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Similar to Escherichia coli ubiquinone/menaquinone
FT                   biosynthesis methyltransferase UbiE or B3833 SW:UBIE_ECOLI
FT                   (P27851) (251 aa) fasta scores: E(): 4.6e-54, 58.871% id in
FT                   248 aa, and to Neisseria meningitidis
FT                   ubiquinone/menaquinone biosynthesis methlytransferase UbiE
FT                   or Nmb0743 TR:Q9K075 (EMBL:AE002429) (245 aa) fasta scores:
FT                   E(): 3e-64, 68.033% id in 244 aa"
FT                   /db_xref="GOA:Q7W0H1"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0H1"
FT                   /protein_id="CAE40540.1"
FT                   /translation="MQTPHSQPESAPQGEQSTHFGFQSVPEADKARKVAEVFHSVASRY
FT                   DVMNDLMSAGLHRVWKAFTIGRAAVRPGMKVLDIAGGTGDLARAFAKRAGPSGEVWLTD
FT                   INESMLRVGRDRLTDSGLLVPTAVCDAERLPFPSQYFDRVSVAFGLRNMTHKDRALAEM
FT                   TRVLKPGGKLLVLEFSRVAKPLAPAYDWYSFNVLPWMGKKVANDEASYRYLAESIRMHP
FT                   DQETLAGMLRDAGLDRVQYFNLTAGVAALHEGVRLG"
FT   misc_feature    160015..160716
FT                   /note="HMMPfam hit to PF01209, ubiE/COQ5 methyltransferase
FT                   family"
FT   misc_feature    160081..160128
FT                   /note="ScanRegExp hit to PS01183, ubiE/COQ5
FT                   methyltransferase family signature 1."
FT   misc_feature    160441..160485
FT                   /note="ScanRegExp hit to PS01184, ubiE/COQ5
FT                   methyltransferase family signature 2. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   CDS_pept        160891..161913
FT                   /transl_table=11
FT                   /locus_tag="BP0162"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa5528 TR:Q9HT45 (EMBL:AE004965) (284 aa) fasta
FT                   scores: E(): 1.7e-05, 35.294% id in 323 aa, and to
FT                   Agrobacterium tumefaciens Agr_l_2266p agr_l_2266
FT                   TR:AAK89700 (EMBL:AE008313) (378 aa) fasta scores: E():
FT                   2.7e-05, 28.075% id in 374 aa"
FT                   /db_xref="GOA:Q7W0H0"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0H0"
FT                   /protein_id="CAE40541.1"
FT                   /translation="MSRSRFSRFCAMALVAVAGTAMVGASFDAEARRMGGGSSFGRQST
FT                   NITQQRQAVTPPAAGAGSTAGATSAARPATAAAGTAAAGTAAKSGMSRWLGPIAGIAAG
FT                   LGLAALLSHLGLSGAFAEFMASMLLIALVVFAVIFIVRRLRGGAPRQAMQGAYGAAGGN
FT                   RPGQPSQQPMWRESLNPAPAQQPAAAPVAAAAPAAAAAALPKAGDDGNWFIPGDFDTPR
FT                   FLQQAKDQFVRIQGIWDSGEVESLRDFLTDDLISELKPQLEARGAAANKTEVVLLNAEL
FT                   LGIETVSDGHLASVRFSGMLREAPGTEAFRFEEVWNLFKPADGGWLLAGIQQIPVEHAS
FT                   "
FT   misc_feature    160891..160959
FT                   /note="Signal peptide predicted for BP0162 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.602 between residues 23 and 24"
FT   misc_feature    join(160903..160971,161170..161238,161248..161316)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BP0162 by TMHMM2.0 at aa 5-27, 94-116 and 120-142"
FT   CDS_pept        162091..162777
FT                   /transl_table=11
FT                   /locus_tag="BP0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical 22.2 kDa
FT                   protein in ubiE-rfaH intergenic region YigP or B3834
FT                   SW:YIGP_ECOLI (P27852) (201 aa) fasta scores: E(): 0.0058,
FT                   27.397% id in 219 aa, and to Vibrio cholerae hypothetical
FT                   protein Vc0084 TR:Q9KVQ5 (EMBL:AE004099) (207 aa) fasta
FT                   scores: E(): 0.00021, 24.413% id in 213 aa"
FT                   /db_xref="GOA:Q7W0G9"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0G9"
FT                   /protein_id="CAE40542.1"
FT                   /translation="MSLLLRTPRGWSAPVDSMLPFAALPTLPRIAARALNALLERESWA
FT                   RDRLARHAGKTVRFALGGFALSLTIDSEGRVQEADSAVVPNVTLSAAESSSLARLLPGD
FT                   GRADFADLTHISGDAALAQVVADLARDLRWDAEDELARVVGDIPAARLLGGARALAGGA
FT                   REAGGRLARNVSEYLAEESAVLVGRPQWEQWRLDLARFGADSDALARSAAALEARLARL
FT                   DARRGA"
FT   CDS_pept        162774..164336
FT                   /transl_table=11
FT                   /gene="ubiB"
FT                   /gene_synonym="aarF"
FT                   /locus_tag="BP0164"
FT                   /product="probable ubiquinone biosynthesis protein"
FT                   /note="Similar to Escherichia coli probable ubiquinone
FT                   biosynthesis protein UbiB or AarF or B3835 or Z5357 or
FT                   ECS4765 SW:UBIB_ECOLI (P27854) (546 aa) fasta scores: E():
FT                   8e-94, 52.165% id in 485 aa, and to Neisseria meningitidis
FT                   probable ubiquinone biosynthesis protein UbiB or Nmb0559
FT                   SW:UBIB_NEIMB (Q9K0N0) (503 aa) fasta scores: E():
FT                   2.7e-107, 58.400% id in 500 aa"
FT                   /db_xref="GOA:Q7W0G8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0G8"
FT                   /protein_id="CAE40543.1"
FT                   /translation="MNAMLTFLRLLRILLVSLRYGLDELVLSSLNHPLATCLLRIMRLG
FT                   TRPRAPRGARLRMALESLGPIFVKFGQVLSTRRDLIPADIANELALLQDRVPPFPSAQA
FT                   AACIEAALGAPPAQLFAQFDVDPVASASIAQVHFAVLHDGREVAVKVLRPGMLNVIEKD
FT                   LALLRVVAGVIERLGADGRRLKPREVVAEFDKYLHDELDLVREASNCSQLRRNFGPESG
FT                   RGEMLIVPEVVWEYTASTVFTMQRMYGIPVGQVDRLRAAGIDIPTLARSGVEIFFTQVF
FT                   TDGFFHADMHPGNIYVSDAPQTLGRYIALDFGIVGSLSEFDKNYLAQNFLAFFHRDYRR
FT                   VAQLHIESGWVPPETREEELEGAVRAVCEPYFDRPLAEISLGQVLLRLFQTSRRFNVEI
FT                   QPQLVLLQKTLLNVEGLGRQLDPNLDLWKTAKPYLEHWMRQRIGLTGLRQSLAKEAGQW
FT                   SQMLPSLPRLVHEHFSRPNLTPHLLAEMNRLRRAQEQGNRLTAALTAVLAVAVAVALWA
FT                   LSR"
FT   misc_feature    164268..164327
FT                   /note="1 probable transmembrane helix predicted for BP0164
FT                   by TMHMM2.0 at aa 499-518"
FT   CDS_pept        164511..164915
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0165"
FT                   /product="conserved hypothetical protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. Similar to The N-terminal region of
FT                   Burkholderia cepacia hypothetical 33.4 kDa protein
FT                   TR:Q9ZGQ4 (EMBL:AF076477) (283 aa) fasta scores: E():
FT                   6e-45, 81.538% id in 130 aa"
FT                   /db_xref="PSEUDO:CAE40544.1"
FT   CDS_pept        complement(164895..165845)
FT                   /transl_table=11
FT                   /locus_tag="BP0166"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTB4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTB4"
FT                   /protein_id="CAE40545.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHI"
FT   repeat_region   164895..164926
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(164895..165947)
FT   misc_feature    complement(164931..165464)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(165522..165587)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   CDS_pept        join(165948..167273,167273..167281)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0167"
FT                   /product="C-terminal region of a probable ABC transporter,
FT                   ATP-binding protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS is the C-terminal region of
FT                   BP3805 which was disrupted by the insertion of IS481
FT                   element. In addition, this CDS appears to have a frameshift
FT                   mutation following codon 442. Similar to Vibrio cholerae
FT                   peptide ABC transporter, ATP-binding protein vc0170
FT                   TR:Q9KVH6 (EMBL:AE004107) (571 aa) fasta scores: E():
FT                   2.9e-105, 64.944% id in 445 aa, and to Rhizobium loti ABC
FT                   transporter ATP-binding protein mlr6287 TR:Q989T5
FT                   (EMBL:AP003008) (616 aa) fasta scores: E(): 2.5e-68,
FT                   46.991% id in 432 aa"
FT   misc_feature    165948..166250
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    166020..166064
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   misc_feature    166581..167159
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    166602..166625
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    166929..166973
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   variation       167273
FT                   /note="(G)1 in pertussis; (G)2 in parapertussis"
FT   CDS_pept        complement(167287..168189)
FT                   /transl_table=11
FT                   /locus_tag="BP0168"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa1451 TR:Q9I3Q0 (EMBL:AE004574) (447 aa) fasta
FT                   scores: E(): 4.6e-21, 48.387% id in 217 aa, and to
FT                   Rhizobium loti Mll4127 protein Mll4127 TR:Q98EQ9
FT                   (EMBL:AP003003) (294 aa) fasta scores: E(): 3.1e-18,
FT                   37.011% id in 281 aa"
FT                   /db_xref="GOA:Q7W0G7"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0G7"
FT                   /protein_id="CAE40547.1"
FT                   /translation="MPHVRPSNAWRFLRTLWLGAWLAGWALLAQAQQLAPVPEFGARVV
FT                   DQSGVLDAAQRQRLEAQLAALEQRKGAQVAVLIVPSTAPETIEQYATRAFEKWKIGRDK
FT                   VDDGVLLLMASDDRALRIEVGYGLEGAIPDSAAGRIINEYIVPRLRAGDWPGAVQAGVT
FT                   ALERRIEGEELPPPAASGRDEGSRLAGIRGWLGENGIAALVVLLILPGPIAAALAGVGV
FT                   AIYMQSISAGLAMALLVLGIKVIIKALPSGGGGGGGGGGGSGGGGFGGWRGGSGSGGFG
FT                   GFRGGGGGRSGGGGASGRW"
FT   misc_feature    complement(join(167437..167502,167524..167589))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BP0168 by TMHMM2.0 at aa 200-222 and 229-251"
FT   misc_feature    complement(168097..168189)
FT                   /note="Signal peptide predicted for BP0168 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.971 between residues 31 and 32"
FT   CDS_pept        complement(168167..168796)
FT                   /transl_table=11
FT                   /locus_tag="BP0169"
FT                   /product="putative exported protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa0537 TR:Q9I5Z9 (EMBL:AE004490) (202 aa) fasta
FT                   scores: E(): 8.8e-51, 71.981% id in 207 aa, and to
FT                   Rhizobium loti Mll4130 protein TR:Q98EQ7 (EMBL:AP003003)
FT                   (212 aa) fasta scores: E(): 2.3e-29, 48.205% id in 195 aa"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0G6"
FT                   /protein_id="CAE40548.1"
FT                   /translation="MTITRWLGAGLLALLTTLLSGCGYNAIQAADEQVKASWSQVLNQY
FT                   QRRADLVPRLVKVVDAYMTHERQVLVEVTEARAKVGRVQLTADQLDDPAAVQRFQQAQG
FT                   ELSSALSRLLVVTENYPQLKAEGLFRDLQTELAGTENRLAVERERYVRSVQAYNVLVRQ
FT                   FPEVITAKVFGYAPKANFGVDNEAEITRAPEVKFSNEGGSAPRPAQ"
FT   misc_feature    complement(168710..168775)
FT                   /note="1 probable transmembrane helix predicted for BP0169
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    complement(168710..168796)
FT                   /note="Signal peptide predicted for BP0169 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.770 between residues 29 and 30"
FT   misc_feature    complement(168731..168763)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        169079..170509
FT                   /transl_table=11
FT                   /gene="rhlE"
FT                   /locus_tag="BP0170"
FT                   /product="putative ATP-dependent RNA helicase"
FT                   /note="Similar to Escherichia coli putative ATP-dependent
FT                   RNA helicase RhlE or B0797 SW:RHLE_ECOLI (P25888) (454 aa)
FT                   fasta scores: E(): 9.3e-80, 58.658% id in 462 aa, and to
FT                   Anabaena variabilis dead box RNA helicase homolog CrhA
FT                   TR:Q9ZI52 (EMBL:AF040045) (425 aa) fasta scores: E():
FT                   4e-74, 59.953% id in 422 aa. Also similar to BP3395
FT                   (50.740% identity in 473 aa overlap), and to BP3057
FT                   (41.314% identity in 472 aa overlap)."
FT                   /db_xref="GOA:Q7W0G5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0G5"
FT                   /protein_id="CAE40549.1"
FT                   /translation="MTTSISFADLGLADSLLRAIADTGYTAPTPIQAQAIPLVLQGGDL
FT                   LAAAQTGTGKTAGFTLPILHRLMQTKPAARKPGRPRCLILTPTRELTAQVAESVQTYGK
FT                   YASLSSMVMFGGVNINPQISALKKPLDILVATPGRLLDHAGQKTVDLSGVEILVLDEAD
FT                   RMLDMGFIRDIRKVLALLPKQRQNLLFSATFSDEIRSLARGVLNDPGEVSVTPRNTATE
FT                   LVTQTVHLVEQHHKRDLVSHLIRESGWHQVLVFTRTKHGANRLAEKLVKDGLSAVAIHG
FT                   NKSQSARTRALSGFKDGSVAVLVATDIAARGLDIDQLPQVVNFELPNVPEDYVHRIGRT
FT                   GRAGATGAAVSLVDDSEIKLLKAIERLIKKPIERRAVDGWTPPAGGPTAEDRADRGQRA
FT                   GGDNRAPQARDGQRRATGAHPQGSAPRNAAGPRADAKRNDAGRPQGRAPGETGATRAPA
FT                   PARNRPVGNGTRGVLLGK"
FT   misc_feature    169130..169780
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase"
FT   misc_feature    169223..169246
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    169550..169576
FT                   /note="ScanRegExp hit to PS00039, DEAD-box subfamily
FT                   ATP-dependent helicases signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   misc_feature    169865..170110
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain"
FT   CDS_pept        170543..171172
FT                   /transl_table=11
FT                   /locus_tag="BP0171"
FT                   /product="LysE family efflux protein"
FT                   /note="Similar to Escherichia coli homoserine/homoserine
FT                   lactone efflux protein RhtB or B3824 SW:RHTB_ECOLI (P27847)
FT                   (206 aa) fasta scores: E(): 2e-23, 37.198% id in 207 aa,
FT                   and to Pseudomonas aeruginosa hypothetical protein Pa5249
FT                   TR:Q9HTU5 (EMBL:AE004937) (209 aa) fasta scores: E():
FT                   4.7e-39, 54.106% id in 207 aa. Also similar to BP0568,
FT                   42.654% identity in 211 aa overlap"
FT                   /db_xref="GOA:Q7W0G4"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0G4"
FT                   /protein_id="CAE40550.1"
FT                   /translation="MTLSTWLTFFVASWAISFSPGAGAISAMSSGLKYGFARGYWNTAG
FT                   LILGILFQFLIVAVGLGAVLATSELAFTLVKYAGVVYLIYLGMRQIRTDAAPVTVDAGD
FT                   PHRASIRELVGRGFLINTMNPKGTVFLLAVVPQFVDPAQPLTQQYLALAGTLAFTDLVA
FT                   MDVYTLLAAKVLRMLRKAHHIRWMNRVFGSLFILAGVFLATFRRHS"
FT   misc_feature    170543..170614
FT                   /note="Signal peptide predicted for BP0171 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.990) with cleavage site
FT                   probability 0.432 between residues 24 and 25"
FT   misc_feature    join(170570..170638,170672..170740,170750..170803,
FT                   170891..170959,170987..171055,171092..171160)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP0171 by TMHMM2.0 at aa 10-32, 44-66, 70-87, 117-139,
FT                   149-171 and 184-206"
FT   misc_feature    170747..171067
FT                   /note="HMMPfam hit to PF01810, LysE type translocator"
FT   CDS_pept        171197..172828
FT                   /transl_table=11
FT                   /gene="prfC"
FT                   /gene_synonym="tos"
FT                   /gene_synonym="miaD"
FT                   /locus_tag="BP0172"
FT                   /product="peptide chain release factor 3"
FT                   /note="Similar to Escherichia coli peptide chain release
FT                   factor 3 PrfC or Tos or MiaD or B4375 SW:RF3_ECOLI (P33998)
FT                   (528 aa) fasta scores: E(): 2e-108, 53.537% id in 523 aa,
FT                   and to Neisseria meningitidis peptide chain release factor
FT                   3 Nmb0626 TR:Q9K0H6 (EMBL:AE002418) (531 aa) fasta scores:
FT                   E(): 5.3e-121, 59.699% id in 531 aa"
FT                   /db_xref="GOA:Q7W0G3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0G3"
FT                   /protein_id="CAE40551.1"
FT                   /translation="MRQYNPPAMNIPQEVARRRTFAIISHPDAGKTTLTEKLLLFAGAI
FT                   QIAGSVKARKASRHASSDWMEIEKQRGISVASSVMQMEYRDCVINLLDTPGHQDFSEDT
FT                   YRVLTAVDAALMVIDAANGVEPQTIRLLQVCRARNTPIITFINKLDREVREPLELLSEI
FT                   EGHLGMDTVPFSWPVGMGKAFGGVFDIRRNRMRIFRAGQERRGEDDEFIDGLDNPEIPR
FT                   RFGAAFAQASGEIELINEAAPAFDREAFLAGKQTPVFFGSAINNFGVQEVLDALVDQAP
FT                   APGPRQALEREVRPDEPKFTGVVFKVQANMDPAHRDRVAFVRVSSGRFERGMRLKVART
FT                   GKEMRPNNVVSFLSQRRELLDEAYAGDVIGIPNHGVLQLGDVLTEGESLRFTGLPFFAP
FT                   ELFQAVEVKDPLRTKQLRVGLTQLGEEGAIQVFRPEAAGGALLLGAVGQLQFEVVAHRL
FT                   KTEYGVDARMMPSRYTSARWITSDDPRALRKFMDANAAHIAYDVVDAAAFLITSPAQLR
FT                   VAEDLYPNVKFHALREHGGKVFGDKA"
FT   misc_feature    171242..172621
FT                   /note="HMMPfam hit to PF00009, Elongation factor Tu family"
FT   misc_feature    171383..171430
FT                   /note="ScanRegExp hit to PS00301, GTP-binding elongation
FT                   factors signature. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   CDS_pept        172853..173536
FT                   /transl_table=11
FT                   /locus_tag="BP0173"
FT                   /product="putative exported protein"
FT                   /note="Similar to Mycobacterium leprae hypothetical proline
FT                   rich protein Ml1505 TR:Q9CBW9 (EMBL:AL583922) (182 aa)
FT                   fasta scores: E(): 7, 23.977% id in 171 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0G2"
FT                   /protein_id="CAE40552.1"
FT                   /translation="MRVAMSWRLLIATLLVALGAAAWGGIQLGDWLVAHAPQAAPAPGQ
FT                   EGDASQQPVLDANGRSYVAQPPQPRVDGTLGVPDQPASRDWAVNTVSLFDTTGDPAVQI
FT                   SRDSITMDRAREIAANSDVPLPSGNSDITTLDLQALGGQAPIVPQEAIPASGMQQNPAA
FT                   VAQVAPQTNRAGGGNWQDALRRELAHCATQGFFERPSCSWAARNKYCAPNRAWGTMAEC
FT                   PRRPD"
FT   misc_feature    172853..172924
FT                   /note="Signal peptide predicted for BP0173 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.746 between residues 24 and 25"
FT   misc_feature    172871..172930
FT                   /note="1 probable transmembrane helix predicted for BP0173
FT                   by TMHMM2.0 at aa 7-26"
FT   CDS_pept        complement(173618..174094)
FT                   /transl_table=11
FT                   /gene="bfr"
FT                   /locus_tag="BP0174"
FT                   /product="bacterioferritin"
FT                   /note="Similar to Escherichia coli bacterioferritin Bfr or
FT                   B3336 SW:BFR_ECOLI (P11056) (158 aa) fasta scores: E():
FT                   7.8e-33, 60.759% id in 158 aa, and to Pseudomonas
FT                   aeruginosa bacterioferritin BfrB or Pa3531 TR:Q9HY79
FT                   (EMBL:AE004773) (158 aa) fasta scores: E(): 5.6e-39,
FT                   68.790% id in 157 aa"
FT                   /db_xref="GOA:Q7W0G1"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0G1"
FT                   /protein_id="CAE40553.1"
FT                   /translation="MKGDKTVIQFLNKQLTNELTAINQYFLHARMLRHWGFNKLGKHEY
FT                   EESIGEMKHADRLIERIFMLDGLPNLQDLHKLLIGEDVPELLACDLKLEQAAQATVKEA
FT                   IAHCESVRDYVSRDLFQDILDDTEEHIDYLETQIGLVDQVGLQNYLQSQMEVDG"
FT   misc_feature    complement(173633..174094)
FT                   /note="HMMPfam hit to PF01334, Bacterioferritin"
FT   repeat_region   174199..174230
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   174199..175251
FT   CDS_pept        174301..175251
FT                   /transl_table=11
FT                   /locus_tag="BP0175"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA3"
FT                   /protein_id="CAE40554.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   misc_feature    174559..174624
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    174682..175215
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(175220..175251)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(join(175248..175760,175759..176109))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0176"
FT                   /product="two-component response regulator (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 117. The sequence has been checked
FT                   and believed to be correct. Similar to Pseudomonas
FT                   aeruginosa two-component response regulator OmpR or Pa5200
FT                   TR:Q9HTY9 (EMBL:AE004933) (247 aa) fasta scores: E():
FT                   0.0013, 31.250% id in 256 aa, and to Vibrio cholerae
FT                   response regulator homolog OmpR TR:Q9X2S6 (EMBL:AF051157)
FT                   (240 aa) fasta scores: E(): 0.0022, 29.020% id in 255 aa"
FT                   /db_xref="PSEUDO:CAE40555.1"
FT   variation       complement(175759)
FT                   /note="G in pertussis; G(TG) in parapertussis"
FT   CDS_pept        176367..176894
FT                   /transl_table=11
FT                   /locus_tag="BP0177"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Synechocystis sp hypothetical 31.6 kDa
FT                   protein Slr0841 TR:Q55426 (EMBL:D64003) (291 aa) fasta
FT                   scores: E(): 3.1e-05, 31.081% id in 148 aa, and to
FT                   Escherichia coli heat shock protein HslJ or B1379
FT                   SW:HSLJ_ECOLI (P52644) (140 aa) fasta scores: E(): 0.38,
FT                   28.571% id in 84 aa. Also similar to the N-terminal region
FT                   of the adjacent CDS, BP0178, 44.643% identity (46.584%
FT                   ungapped) in 168 aa overlap"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0G0"
FT                   /protein_id="CAE40556.1"
FT                   /translation="MPIRPFTRACLVAALGAVLAGCASNTGQAQAEGAAAANAATSADS
FT                   FAQTTWELVRWTKADGGYRVISHGDNGEPIFLTFFAQGKQYRVSGFAGCNRYTGAYRLR
FT                   DGKLQITAPASTRMACPQPERARLEADYLRALAQIRSFTLDSGGAPRHLTFNVQGGDVL
FT                   DFMRRQDPPTPE"
FT   misc_feature    176367..176459
FT                   /note="Signal peptide predicted for BP0177 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.0.807 between residues 31 and 32"
FT   misc_feature    176400..176432
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        176986..177801
FT                   /transl_table=11
FT                   /locus_tag="BP0178"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Synechocystis sp hypothetical 31.6 kDa
FT                   protein slr0841 TR:Q55426 (EMBL:D64003) (291 aa) fasta
FT                   scores: E(): 0.00023, 33.775% id in 151 aa. Its N-terminal
FT                   region is similar to the adjacent CDS, BP0177, 44.643%
FT                   identity (46.584% ungapped) in 168 aa overlap"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR025485"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0F9"
FT                   /protein_id="CAE40557.1"
FT                   /translation="MSAISPGRVALSFSLLLALAACAADPAGGGASRAQAPERHSDMLA
FT                   QTNWELARWTRPGGALRPVPHGGAGKTAPITLSFTHQRGAARLAGFAGCNNYSGQYTIA
FT                   NGLLIVTAPPVSTRMACANADLARLEQDYLAGLTAVTASRLDHDTRPQRLTLALRSGDV
FT                   LDFARRADPLAGGQPGAAKLVYVASSKAPCSAGAGRAQCYQVRDSASQPWLLWYGDITG
FT                   FAFQPGIEYRLRVVEVRDPNPPADASGVRWVLDSVVEQRVAAPRPAPAP"
FT   CDS_pept        177862..178596
FT                   /transl_table=11
FT                   /locus_tag="BP0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Xylella fastidiosa hypothetical protein
FT                   Xf2609 TR:Q9PAA9 (EMBL:AE004068) (299 aa) fasta scores:
FT                   E(): 9.9e-46, 55.230% id in 239 aa, and to Pseudomonas
FT                   aeruginosa hypothetical protein Pa0858 TR:Q9I583
FT                   (EMBL:AE004520) (312 aa) fasta scores: E(): 1.2e-32,
FT                   42.017% id in 238 aa"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0F8"
FT                   /protein_id="CAE40558.1"
FT                   /translation="MTAVVNIAAYKFVSIANPADLREPMLEQAGQRQLKGTVLLAPEGI
FT                   NLFLAGAADAIEGFLRWLRADARFADLQAKYSESARMPFRKLLVKVKREIIRMDHPAIR
FT                   PEAGRAPAVDAATLRRWLAQGRDDQGRELVMLDTRNAFEVEVGTFRGALDWRIERFTQF
FT                   PQAVRDNQAALAGKTVVSFCTGGIRCEKAAIYMAEAGIEHVYQLEGGILKYFEETDGAG
FT                   FDGACFVFDERVALDAALAPQA"
FT   CDS_pept        complement(178634..180712)
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="BP0180"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="Similar to Escherichia coli methionyl-tRNA
FT                   synthetase MetG or B2114 SW:SYM_ECOLI (P00959) (676 aa)
FT                   fasta scores: E(): 2.1e-45, 51.783% id in 701 aa, and to
FT                   Neisseria meningitidis methionyl-tRNA synthetase Nmb0030
FT                   TR:Q9K1Q0 (EMBL:AE002361) (685 aa) fasta scores: E():
FT                   1.8e-143, 52.857% id in 700 aa"
FT                   /db_xref="GOA:Q7W0F7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0F7"
FT                   /protein_id="CAE40559.1"
FT                   /translation="MSRTLFVTTALPYANGSFHIGHIMEYIQADIWVRSMRMAGHTVHF
FT                   VGADDAHGAPIMLKAEKEGITPQALVARYAAERPRYLDGFHIRFDHWHSTDTPENVALS
FT                   QEIYRALKSEGLIETRSIEQFYDPVKGMFLADRYIKGECPRCHAKDQYGDSCEVCGAVY
FT                   APTELINPYSALTGAAPVLKSSDHFFFKLSDPRCVEFLQQWTTGANRQGVKHLQAEVQA
FT                   KTREWLVGDDGEAKLGDWDISRDAPYFGIEIPDAPGKYFYVWLDAPVGYLASLKSYCAA
FT                   KGLDFDALLDPAGPTEQVHFIGKDIIYFHALFWPAMLKFAGRKTPDQLNVHGFITVSGE
FT                   KMSKSRGTGISPLRYLEIGMDAEWLRYYMAAKLNARVEDMDFNPEDFVARVNSDLVGKY
FT                   VNIASRAAAFITRHFDGELAYDGDTDALAAEFAQQAESIRAAFEAREYNRAVREIMAHA
FT                   DRINQAFDAAQPWVMAKGIGAADAATRARLQDICSRALAGFKALSVMLAPVLPALASRV
FT                   ARELFGANADFAWGDAQQLPQRVAPFKHLMQRVDPKLLDDLFEPPAAEASAPAALPGGE
FT                   ALADTITIDDFAKIDLRIARIVNCEEVEGSTKLLRLTLDVGEGRHRNVFSGIKSAYQPQ
FT                   DLVGKLTVLVANLAPRKMKFGVSEGMVLAASHADEKAEPGIYVLEPWPGAQPGMRVR"
FT   misc_feature    complement(178643..178939)
FT                   /note="HMMPfam hit to PF01588, Putative tRNA binding
FT                   domain"
FT   misc_feature    complement(179369..180709)
FT                   /note="HMMPfam hit to PF00133, tRNA synthetases class I (I,
FT                   L, M and V)"
FT   misc_feature    complement(180644..180679)
FT                   /note="ScanRegExp hit to PS00178, Aminoacyl-transfer RNA
FT                   synthetases class-I signature."
FT   CDS_pept        complement(180962..181234)
FT                   /transl_table=11
FT                   /locus_tag="BP0181"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical/unknown
FT                   transmembrane protein Smc03794 TR:CAC47756 (EMBL:AL591793)
FT                   (83 aa) fasta scores: E(): 4.5, 30.488% id in 82 aa"
FT                   /db_xref="GOA:Q7W0F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0F6"
FT                   /protein_id="CAE40560.1"
FT                   /translation="MVNTLFRFFSAALFALLGLIGMMMALVFMASTAIAVGVLYLVAKV
FT                   RGKPFGVRAYWSQRQAARPGPFQAASAPFGQPRGDVIDVEAREVR"
FT   misc_feature    complement(181109..181174)
FT                   /note="1 probable transmembrane helix predicted for BP0181
FT                   by TMHMM2.0 at aa 20-42"
FT   misc_feature    complement(181130..181234)
FT                   /note="Signal peptide predicted for BP0181 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.867 between residues 35 and 36"
FT   CDS_pept        181333..182421
FT                   /transl_table=11
FT                   /locus_tag="BP0182"
FT                   /product="putative iron sulfur binding protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa3481 TR:Q9HYC8 (EMBL:AE004769) (364 aa) fasta
FT                   scores: E(): 6.1e-63, 54.270% id in 363 aa, and to Xylella
FT                   fastidiosa polysaccharide export protein Xf2301 TR:Q9PB44
FT                   (EMBL:AE004041) (303 aa) fasta scores: E(): 3.8e-62,
FT                   67.424% id in 264 aa. Also similar to BP1467, 60.000%
FT                   identity (60.167% ungapped) in 360 aa overlap."
FT                   /db_xref="GOA:Q7W0F5"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0F5"
FT                   /protein_id="CAE40561.1"
FT                   /translation="MMSITIEQIRGALAGVADPQTGLELNVCVKDRDIHLAADPAALTI
FT                   ELGYPAGGVADSVRALAGAALAAAGLGAVRVAVTWNIIAHAVQPGLKPLPQVRNIIAVA
FT                   SGKGGVGKSTTAVNLALALAAEGARAGLLDADIYGPSVPAMLGLAGRPESRDNKTMEPL
FT                   VGHGLQANSIGLLIDADAPAIWRGPMVTQALEQLLRQTNWRDLDYLVVDMPPGTGDIAL
FT                   TLAQKVPVAGAVIVTTPQDIALLDARKGLRMFQKVHVPILGVVENMAVHICPQCGHAEH
FT                   IFGAGGGRRVAEQYEVPWLGSLPLQRAIREQTDAGNPTVAAEPESEVAGIYRDIARRVA
FT                   ARIAGLPRDMAGKLPAVVVRPA"
FT   misc_feature    181627..181719
FT                   /note="HMMPfam hit to PF00142, 4Fe-4S iron sulfur cluster
FT                   binding proteins, NifH/frxC family"
FT   misc_feature    181648..181671
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    181939..181989
FT                   /note="ScanRegExp hit to PS01215, Mrp family signature.
FT                   Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        182425..184329
FT                   /transl_table=11
FT                   /locus_tag="BP0183"
FT                   /product="putative exported protein"
FT                   /note="Similar to Xanthomonas oryzae pvoryzae putative
FT                   outer membrane protein TR:Q9EY32 (EMBL:AY010120) (593 aa)
FT                   fasta scores: E(): 8.2e-16, 24.540% id in 652 aa, and to
FT                   Pseudomonas aeruginosa hypothetical protein Pa2543
FT                   TR:Q9I0U1 (EMBL:AE004682) (579 aa) fasta scores: E():
FT                   9.1e-13, 24.342% id in 608 aa"
FT                   /db_xref="GOA:Q7W0F4"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0F4"
FT                   /protein_id="CAE40562.1"
FT                   /translation="MRRILRVCPALLFALAAGQVHAKLPEVIVDPGGVPPAALQAINSA
FT                   VDAIARLSEDQDGGEIDRLRRRARDATLAALATQGYFTPTVTLTPGTDVGGETWDIAIE
FT                   PGPRARVASVDLKFTGRVARPEYAARIQKWRDDWALKAGQPFINGDWNKAKSGLLDAVS
FT                   TRDFLLAHMTHSLAEVDAETAQVRLSVEIDSGPAVRMGALQTDGLQRVPESLVRRYVKY
FT                   SEGAAYDQDKLDQWQQELQSTAFFRGAFVTLDQGARGGQDDVKVTAPGASARAPGSSGL
FT                   ASVAPAGDAEVAGGPTAAAPVLDSQGEITLPVDVRVVEAPPKRLAVSLGVDDEAGVRFE
FT                   TIYRQNVVFGQPVTMETGLGVDRLRQRAYLDFNLPPDERGRKDSFGLLFDHSDVQELDV
FT                   TRYALGVTRLQERKGAGDSRVEYETRWGGLLAHDHVKIDGGDEYDLPTATLTAEWLRRD
FT                   VNSKYDPREGNLIAVGGGVGATLDDGQPYMRLRLRGQKWWPIGKLDVLTLRGEVGRLWS
FT                   NGRTRVPDDFGFRTGGARSIRGYRYQSIGVEQDDAIVGAPTLAVASVEYDHYFNERWGI
FT                   GVFVDAGDAAESFGDMDIAVGYGVGARVRTPAGPLFLDVAYGQRERDLRLHFSLGIAF"
FT   misc_feature    182425..182490
FT                   /note="Signal peptide predicted for BP0183 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 22 and 23"
FT   misc_feature    182986..183006
FT                   /note="ScanRegExp hit to PS00307, Legume lectins beta-chain
FT                   signature."
FT   CDS_pept        184326..188024
FT                   /transl_table=11
FT                   /locus_tag="BP0184"
FT                   /product="putative exported protein"
FT                   /note="Similar to Neisseria meningitidis putative
FT                   periplasmic protein Nma0295 TR:Q9JWM6 (EMBL:AL162752) (1371
FT                   aa) fasta scores: E(): 1.4e-18, 23.644% id in 1383 aa, and
FT                   to Pseudomonas aeruginosa hypothetical protein Pa2542
FT                   TR:Q9I0U2 (EMBL:AE004682) (1221 aa) fasta scores: E():
FT                   7.2e-14, 27.344% id in 1280 aa"
FT                   /db_xref="GOA:Q7W0F3"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0F3"
FT                   /protein_id="CAE40563.1"
FT                   /translation="MSKIWGVVRHILVWWVPGVAMLAALACGFVFWTVASQNGTRLLLD
FT                   TVARQLDGEIAGVRGSVLRGLRVDRIRLSVADVDVAVDDLRLDVAWRALGQRLLHVREL
FT                   AATRVEVGLHTPATPPPDSDEPFALRLPVELALDRLSLGEFVLRQDGEPLPVSAGELQA
FT                   SLAAGRHGARLTLDSLRVTHAVGTLRAQGRLDVASLAQPWPLTASLDLQAQGSGPESPL
FT                   CLAPLLDARDKTAKDKAAKDKGKDKGKDKGKDKGKDKGKDKGKDKGKDKGKDKGKDDAG
FT                   EKPDEPADPCGLALQVQAQGTLEQLEAELTGAGQGLALEARAGLLPQAPFPLRTASLKL
FT                   TREDKSSLAATLDWQPQPGQPGRDRVVATFEAERLDLQRLAGEAIPPAMLSARGGLDAE
FT                   VDDLSSLHRATLTLDVTKGSSWNRHPLAGKVAASVSALGDPPGAFATAAPAQPHALPGG
FT                   LWVDQLDVDLQLGPNRVRAQGKLDERAGALKLDAQAPRLDAFWPGIPGAASVKAALDGA
FT                   LARHRGRIEAAYTPADARARVLGRARAQAQLEFSGGWGAGPAAEGAAAGWRGSVSRLTA
FT                   DSAGFALALERPVTLAYVPEALAPQWQWQVGATTLALTFPDKQRVALAHAASRGGAGRW
FT                   ETAGRADALVITAAMVRQILVALDPEAVARAERDSGSPVNAPVPAAQRRISLDASWDLK
FT                   FAGALAGKVRVARRDGDLRIPGDPPIPLGLRTLVLEANATPTGGQASRLDARLDMATAR
FT                   MGAINGTASATLGGLALDPRQPIRVALDADVTDLAWLGLFVGDTLEVGGMLKANVRAQG
FT                   SLDGKWNASGTVNGDKLRVVRIDDGVRLIDGMLRARLQDDRVILDSLRFPASLRVMPAE
FT                   WRTREWVSTNPDAKGGYLEATGQWELSAARGQVRLQLHRFPALQRSDRYGMVSGVVTLD
FT                   AALPRISINGDITADAGWVSLEILQGVPTLDDDVKVVRAGQKNAQGDGPPLQIDMNLKV
FT                   DMGPRFYITGMGLDAGLLGSIQIRLQEGRLTGYGALRTRGGGIEAYGQKLRLRRGTLTF
FT                   QGRLDNPLLDIEALRTGEQVEAGVRVAGTAQRPRIDLVSYPDVSDVEKLSWLVLGRGPD
FT                   ASGGDTALLLSVGTALLGGGQPFYKQFGLDDVSVRSGAIGSSGSLLPDRTVAAGVNRDS
FT                   DADLATQFLVASKRFANGITLSVEQALAGSETVGRASYRLARGLSLDLKAGSVNGIALV
FT                   YRILLDD"
FT   misc_feature    184326..184403
FT                   /note="Signal peptide predicted for BP0184 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.928) with cleavage site
FT                   probability 0.359 between residues 26 and 27"
FT   misc_feature    184359..184427
FT                   /note="1 probable transmembrane helix predicted for BP0184
FT                   by TMHMM2.0 at aa 12-34"
FT   misc_feature    184374..184406
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        188085..188648
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /gene_synonym="dus"
FT                   /gene_synonym="paxA"
FT                   /locus_tag="BP0185"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="Similar to Escherichia coli deoxycytidine
FT                   triphosphate deaminase Dcd or Dus or PaxA or B2065
FT                   SW:DCD_ECOLI (P28248) (193 aa) fasta scores: E(): 8.4e-05,
FT                   27.389% id in 157 aa, and to Xylella fastidiosa
FT                   deoxycytidine triphosphate deaminase Xf0762 TR:Q9PFB6
FT                   (EMBL:AE003917) (191 aa) fasta scores: E(): 1.4e-64,
FT                   81.675% id in 191 aa"
FT                   /db_xref="GOA:Q7W0F2"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0F2"
FT                   /protein_id="CAE40564.1"
FT                   /translation="MSIKSDRWIRRAAEAGMIEPFEPGQVRTAGGNRIVSYGTSSYGYD
FT                   VRCADEFKIFTNINSTIVDPKQFDEKSFVDFKGDVCIIPPNSFALARTVEYFRIPRSVL
FT                   TICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSNTTPLPAKVYAGEGCAQMLFLESDE
FT                   VCETSYRDRGGKYQGQRGVTLPRT"
FT   misc_feature    188256..188642
FT                   /note="HMMPfam hit to PF00692, dUTPase"
FT   CDS_pept        complement(188656..189078)
FT                   /transl_table=11
FT                   /locus_tag="BP0186"
FT                   /product="conseved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa0803 TR:Q9I5D5 (EMBL:AE004515) (146 aa) fasta
FT                   scores: E(): 1.4e-32, 61.111% id in 144 aa, and to
FT                   Rhizobium loti Mlr1197 protein TR:Q98L34 (EMBL:AP002996)
FT                   (137 aa) fasta scores: E(): 3.1e-19, 44.203% id in 138 aa"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0F1"
FT                   /protein_id="CAE40565.1"
FT                   /translation="MPAPATVASPVVTCLRYRNASAAIEWLVHAFGFEAQRIVPGPADT
FT                   IVHAQLTLGSGMIMLASVTDTPFSRYMKQPDEVGGVETQSVYLVVADPDQAYRDAQAAG
FT                   AEILIDIADADYGGRGFSCRDPEGHIWSVGSYDPWQ"
FT   misc_feature    complement(188671..189033)
FT                   /note="HMMPfam hit to PF00903, Glyoxalase/Bleomycin
FT                   resistance protein/Dioxygenase superfamily"
FT   CDS_pept        complement(189106..189525)
FT                   /transl_table=11
FT                   /locus_tag="BP0187"
FT                   /product="putative lyase"
FT                   /note="Similar to Streptomyces coelicolor putative lyase
FT                   Sci7.11C TR:Q9X9X9 (EMBL:AL096743) (130 aa) fasta scores:
FT                   E(): 0.0041, 33.846% id in 130 aa, and to Streptomyces sp
FT                   daunomycin C-14 hydroxylase TR:Q55078 (EMBL:U50973) (275
FT                   aa) fasta scores: E(): 0.015, 29.851% id in 134 aa"
FT                   /db_xref="GOA:Q7W0F0"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0F0"
FT                   /protein_id="CAE40566.1"
FT                   /translation="MQAQVLINIDVPDAARAALFYERAFGLRPQRRLGPQAIEMAGAAV
FT                   PIYLLEKATGSQAATGTSQGRDYARHWTPVHLDFVVDDCDRAVATAVAAGAMLEDPPHS
FT                   HAWGRIAHLSDPYGNGVCILQFLGEGYDALAAAAP"
FT   misc_feature    complement(189148..189498)
FT                   /note="HMMPfam hit to PF00903, Glyoxalase/Bleomycin
FT                   resistance protein/Dioxygenase superfamily"
FT   CDS_pept        complement(join(189554..190024,190027..190074))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0188"
FT                   /product="putative acetyltransferase (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 16. The frameshift occurs within a
FT                   homopolymeric tract of (T)5. The sequence has been checked
FT                   and believed to be correct. Similar to Rhizobium meliloti
FT                   putative acetyltransferase protein Smb21153 TR:CAC49219
FT                   (EMBL:AL603645) (166 aa) fasta scores: E(): 4.4e-12,
FT                   34.731% id in 167 aa, and to Agrobacterium tumefaciens
FT                   Agr_c_4257p TR:AAK88086 (EMBL:AE008149) (171 aa) fasta
FT                   scores: E(): 1.4e-12, 36.364% id in 165 aa"
FT                   /db_xref="PSEUDO:CAE40567.1"
FT   misc_feature    complement(189641..189895)
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family"
FT   variation       complement(190022..190026)
FT                   /note="(T)5 in pertussis; (T)3 in parapertussis"
FT   CDS_pept        190127..190624
FT                   /transl_table=11
FT                   /locus_tag="BP0189"
FT                   /product="hypothetical protein"
FT                   /note="Similar to the C-terminal regions of Deinococcus
FT                   radiodurans conserved hypothetical protein Dr0535 TR:Q9RWY0
FT                   (EMBL:AE001911) (825 aa) fasta scores: E(): 1.1, 29.762% id
FT                   in 168 aa, and to Neisseria meningitidis alanyl-tRNA
FT                   synthetase Nmb1595 TR:Q9JYG6 (EMBL:AE002510) (874 aa) fasta
FT                   scores: E(): 1.2, 27.273% id in 154 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0E9"
FT                   /protein_id="CAE40568.1"
FT                   /translation="MKIREKRGCFAAQEPQMFGFRRKDTQQYDQEAQDAFVERVAAAAR
FT                   DFVAAVPAGAGLDYSPASIAALDAVLEQAHLGALALDPVQRVGAAAYLYEVARRRHGGL
FT                   YEVCDDDDPVVLVTGEPEFDVCLCAIAKVERRIDAGPQEDLRPFFGRYEQAVAARRPDI
FT                   IR"
FT   CDS_pept        190779..193049
FT                   /transl_table=11
FT                   /locus_tag="BP0190"
FT                   /product="probable orn/arg/lys decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="Similar to Escherichia coli biodegradative arginine
FT                   decarboxylase AdiA or Adi or B4117 SW:ADIA_ECOLI (P28629)
FT                   (755 aa) fasta scores: E(): 4.9e-69, 38.070% id in 767 aa,
FT                   and to Pseudomonas aeruginosa probable orn/arg/lys
FT                   decarboxylase Pa1818 TR:Q9I2S7 (EMBL:AE004608) (751 aa)
FT                   fasta scores: E(): 3.1e-150, 49.340% id in 758 aa"
FT                   /db_xref="GOA:Q7W0E8"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0E8"
FT                   /protein_id="CAE40569.1"
FT                   /translation="MKFRFPIFIIDEDYRSENASGLGIRALASAIEAEGVEVIGVTSYG
FT                   DLSSFAQQQSRASAFILSIDDEEFDVDSPEDVAGAIKNLRTFIGELRFRNADIPIYLYG
FT                   ETRTSEHIPNDILRELHGFIHMFEDTPEFVARHIIREARSYVDGLPPPFFRELVKYAQD
FT                   GSYSWHCPGHSGGVAFLKSPVGQMFHQFFGENMLRADVCNAVDELGQLLDHTGPVAESE
FT                   LNAARIFHADHCFFVTNGTSTSNKVVWHANVAAGDVVVVDRNCHKSILHAITMTGAIPV
FT                   FLRPTRNHLGIIGPIPLDEFDPENIRRKIEANPFAREALNKKPRILTLTQSTYDGVIYN
FT                   VEMIKEKLGTYVDTLHFDEAWLPHAAFHEYYRDMHAIGPDRPRSQDAMVFATHSTHKLL
FT                   AGISQASQIIVQESESRKLDRNLFNEAYLMHTSTSPQYAIIASCDVAAAMMEPPGGTAL
FT                   VEESIREAMDFRRAMRKVASEFGKDDWWFKVWGPNRLAPEGIGHRDDWVLESGDHWHGF
FT                   GDLAPGFNMLDPIKATIITPGLDMSGSFGESGIPAALVSKYLAEHGVVVEKTGLYSFFI
FT                   LFTIGITKGRWNTLLTALQQFKDDYDRNQPLWRILPEFCRGHRRYERMGLRDLCQQIHE
FT                   AYRERDVARLTTEMYLSDMVPALKPSDAFARMAHREVERVEIDQLEGRVTGVLLTPYPP
FT                   GIPLLIPGERFNRTIVQYLQFAREFNERFPGFETYIHGLADEEGPDGAKRYYVDCLKDA
FT                   GEQ"
FT   misc_feature    191223..193013
FT                   /note="HMMPfam hit to PF01276, Orn/Lys/Arg decarboxylase"
FT   misc_feature    191952..191996
FT                   /note="ScanRegExp hit to PS00703, Orn/Lys/Arg
FT                   decarboxylases family 1 pyridoxal-P attachment site."
FT   CDS_pept        193098..194330
FT                   /transl_table=11
FT                   /locus_tag="BP0191"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti conserved hypothetical
FT                   protein Smc00763 TR:CAC45279 (EMBL:AL591784) (394 aa) fasta
FT                   scores: E(): 4.8e-59, 57.431% id in 397 aa, and to
FT                   Haemophilus influenzae hypothetical protein Hi0933
FT                   SW:YHIN_HAEIN (P44941) (401 aa) fasta scores: E(): 5.7e-65,
FT                   44.444% id in 396 aa"
FT                   /db_xref="GOA:Q7W0E7"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0E7"
FT                   /protein_id="CAE40570.1"
FT                   /translation="MSSREYPVSMFDVAVIGAGAAGMMCAAVAGQRGLRMVLIDHAAKL
FT                   AEKIRISGGGRCNFTNLGAGPANFLSDNPHFCRSALAGYTPQDFLGLLRRHRVHWHEKH
FT                   RGQLFCDDSSETIIEVLRAECGQGGVAWRMPCRVDEIARREGGGFTLRTSTGAIDARAV
FT                   VVATGGMAIPQLGATDYALKVARQFGLKVVEPRPALVPLTFDPAQWQPFAALSGVALEV
FT                   TLSTGQGKGRAAFLEDLLFTHRGLSGPAILQISSYWKPGEPIVLDLAPGRDLAAELIGA
FT                   KPGNRQQLHTVLAGLWPRRLADTWLDVAGRAVGADLAAARLADVPDRTLRALAALIHDW
FT                   RLVPSGTAGYKKAEVMRGGVDTRALDQKSMQARGVPGLYFIGEAVDVTGWLGGYNFQWA
FT                   WASGYACGNAL"
FT   misc_feature    193098..193184
FT                   /note="Signal peptide predicted for BP0191 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.778) with cleavage site
FT                   probability 0.686 between residues 29 and 30"
FT   misc_feature    193134..193187
FT                   /note="1 probable transmembrane helix predicted for BP0191
FT                   by TMHMM2.0 at aa 13-30"
FT   repeat_region   194327..194358
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   194327..195379
FT   CDS_pept        194429..195379
FT                   /transl_table=11
FT                   /locus_tag="BP0192"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA3"
FT                   /protein_id="CAE40571.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   misc_feature    194687..194752
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    194810..195343
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(195348..195379)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        195482..196117
FT                   /transl_table=11
FT                   /gene="sodA"
FT                   /locus_tag="BP0193"
FT                   /product="superoxide dismutase [Mn]"
FT                   /EC_number="1.15.1.1"
FT                   /note="Previously sequenced as Bordetella pertussis
FT                   superoxide dismutase [Mn] SodA SW:SODM_BORPE (P53642) (211
FT                   aa) fasta scores: E(): 1.1e-85, 100.000% id in 211 aa, and
FT                   similar to Pseudomonas putida superoxide dismutase [Mn]
FT                   SodA SW:SODM_PSEPU (P77929) (203 aa) fasta scores: E():
FT                   1.4e-58, 73.399% id in 203 aa. Also similar to BP2761,
FT                   40.201% identity (41.885% ungapped) in 199 aa overlap."
FT                   /db_xref="GOA:P53642"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53642"
FT                   /protein_id="CAE40572.1"
FT                   /translation="MPYVLPALSYAYDALEPHIDARTMEIHHTRHHQTYVNGLNAALEG
FT                   AGLDSEEPVEQLLRRIPALPPGIHGAVRNHGGGHANHSLLWTVMSPSGGGRPDGRLAAD
FT                   IQAQLGGHDAFQAAFTQAALGRFGSGWAWLTVTPAGRLRVDSSANQDSPLMEGNTPILG
FT                   LDVWEHAYYLQYQNRRPEYIEAFYRVVDWAEVARRYEIALAELGREAA"
FT   misc_feature    195485..196093
FT                   /note="HMMPfam hit to PF00081, Iron/manganese superoxide
FT                   dismutases, alpha-hairpin domain"
FT   misc_feature    195974..195997
FT                   /note="ScanRegExp hit to PS00088, Manganese and iron
FT                   superoxide dismutases signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   CDS_pept        196114..197007
FT                   /transl_table=11
FT                   /locus_tag="BP0194"
FT                   /product="probable metal transporter"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa4467 TR:Q9HVV1 (EMBL:AE004860) (310 aa) fasta
FT                   scores: E(): 2.5e-41, 54.864% id in 257 aa, and to
FT                   Myxococcus xanthus GufA protein SW:GUFA_MYXXA (Q06916) (254
FT                   aa) fasta scores: E(): 2.1e-36, 49.412% id in 255 aa. Also
FT                   similar to BP2140, 47.458% identity (47.782% ungapped) in
FT                   295 aa overlap."
FT                   /db_xref="GOA:Q7W0E6"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0E6"
FT                   /protein_id="CAE40573.1"
FT                   /translation="MNTHSRHRVRPALTSVSAMTLAVLVACLACYQLWEFLDRRWPHVA
FT                   LAMAGGMVAAGATALGAVPVLFSQTLSQRVQDCMFGFGAGVMLAASAFSLVVPGIAAAG
FT                   AQGYGPWGAGILVGAAILLGGAVLLASDRLLPHEHFIKGKEGRASRTLRRTWLFVFAIM
FT                   LHNVPEGLAIGVGYAGSDSLRGAALATGIAIQDVPEGLVVALALLAAGYSRAFSVALGM
FT                   LSGLVEPLGAIVGAAVVGWSAAMLPWGLGFAAGAMLFVISHEIIPESHRKGHEVPATAG
FT                   LMLGFVLMMLLDTALG"
FT   misc_feature    196114..196200
FT                   /note="Signal peptide predicted for BP0194 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.982) with cleavage site
FT                   probability 0.671 between residues 29 and 30"
FT   misc_feature    join(196150..196218,196246..196314,196351..196419,
FT                   196432..196500,196579..196647,196675..196743,
FT                   196762..196830,196843..196911,196930..196989)
FT                   /note="9 probable transmembrane helices predicted for
FT                   BP0194 by TMHMM2.0 at aa 13-35, 45-67, 80-102, 107-129,
FT                   156-178, 188-210, 217-239, 244-266 and 273-292"
FT   misc_feature    196162..196194
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        197402..198502
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="BP0195"
FT                   /product="glycine cleavage system T protein"
FT                   /EC_number="2.1.2.10"
FT                   /note="Similar to Escherichia coli aminomethyltransferase
FT                   GcvT or B2905 SW:GCST_ECOLI (P27248) (363 aa) fasta scores:
FT                   E(): 5.7e-67, 53.406% id in 367 aa, and to Pseudomonas
FT                   aeruginosa glycine-cleavage system protein T1 GcvT1 or
FT                   Pa5215 TR:Q9HTX5 (EMBL:AE004934) (360 aa) fasta scores:
FT                   E(): 1.6e-71, 59.280% id in 361 aa"
FT                   /db_xref="GOA:Q7W0E5"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0E5"
FT                   /protein_id="CAE40574.1"
FT                   /translation="MSAPLKRTPLAEEHLAAGACMVDFGGWDMPLAYGSQLEEHHAVRQ
FT                   DAGMFDVSHMLNVDVGGADATAFLRRLVANDVARLATPGKALYSCMLNPQGGIIDDLII
FT                   YYFAPDQWRVVVNAGTADKDIAWMQRVAAADGFDVVIAPRRDLAMVAVQGPNARAKVWA
FT                   ARPAWQAASEPLAPFSAAAVEAGTLVARTGYTGEDGFEIVLPADAVVQLWRDLLAQGVR
FT                   PCGLGARDTLRLEAGMNLYGQDMDELVHPDQAGLSWTVALKDEARRFVGRDAIEQFAVP
FT                   RAFVGLKLQERGVMRAHMPVRCAQGMGELTSGTMSPTLGVSVGFARMPVGVQPGDAVEV
FT                   EIRGKWVPALVCKLPFVRHGKAVEHS"
FT   misc_feature    197546..198478
FT                   /note="HMMPfam hit to PF01571, Glycine cleavage T-protein
FT                   (aminomethyl transferase)"
FT   CDS_pept        198584..198958
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="BP0196"
FT                   /product="glycine cleavage system H protein"
FT                   /note="Similar to Escherichia coli glycine cleavage system
FT                   H protein GcvH or B2904 SW:GCSH_ECOLI (P23884) (128 aa)
FT                   fasta scores: E(): 4e-20, 53.659% id in 123 aa, and to
FT                   Pseudomonas aeruginosa glycine cleavage system protein H1
FT                   GcvH1 or Pa5214 TR:Q9HTX6 (EMBL:AE004934) (129 aa) fasta
FT                   scores: E(): 1.3e-22, 56.198% id in 121 aa"
FT                   /db_xref="GOA:Q7W0E4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0E4"
FT                   /protein_id="CAE40575.1"
FT                   /translation="MSLPTDRKYTESHEWVQAEGDVFVVGITDNAQEQLGDLVFVGDVK
FT                   VGATLKAGETAGVVESVKAASDIYAPVDGEIVAFNDELEANPSLINESAYTAWIFKIKP
FT                   ANAADLDKLLDAAGYQAVAG"
FT   misc_feature    198587..198955
FT                   /note="HMMPfam hit to PF01597, Glycine cleavage H-protein"
FT   CDS_pept        199018..201882
FT                   /transl_table=11
FT                   /gene="gcvP"
FT                   /locus_tag="BP0197"
FT                   /product="glycine cleavage system P protein"
FT                   /EC_number="1.4.4.2"
FT                   /note="Similar to Escherichia coli glycine dehydrogenase
FT                   [decarboxylating] GcvP or B2903 SW:GCSP_ECOLI (P33195) (956
FT                   aa) fasta scores: E(): 2.2e-207, 58.254% id in 951 aa, and
FT                   to Pseudomonas aeruginosa glycine cleavage system protein
FT                   P2 GcvP2 or Pa2445 TR:Q9I137 (EMBL:AE004672) (959 aa) fasta
FT                   scores: E(): 0, 66.422% id in 953 aa"
FT                   /db_xref="GOA:Q7W0E3"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0E3"
FT                   /protein_id="CAE40576.1"
FT                   /translation="MSRAPDTHSDFIPRHIGPSDEDQATMLVAIGAASLDALIDEVVPP
FT                   RIRSRAPLALPAARSETDVLQDLKRIAARNQIYRNYIGQGYYGTHTPNVVLRNVLENPA
FT                   WYTAYTPYQPEISQGRLEALLNYQTMVADLTGLDISNASLLDEGTAAAEAMTLARRGSR
FT                   SSSPVFFVSQHCHPQTLEVVRTRAEGLGIELVIGDESRGLPECFGVLLQYPHSLGGVAD
FT                   YRELAQAAHAQGAVVACVTDLLALALIEPPGQWGADIAVGSAQRFGVPFGFGGPHAGFM
FT                   ACRDAYKRNMPGRLVGVSKDAQGNPALRLALQTREQHIRREKATSNICTAQVLLAVMAG
FT                   LYAVWHGPRGVRRIAERVQSLTGALRAALAGLGVKVANDTWFDTLSLETGAATPAILAA
FT                   ADCARINLRQVDGARLAVSLDETVTLADLQALVNVFAAGLGKDEVALAPPQASLDGIPA
FT                   AVRRQGPILSHPVFSSVQSETDMLRYLRKLADKDLALDRTMIPLGSCTMKLNATAEMIP
FT                   ITWPEFALIHPFAPASQTPGYRELIEGLSAQLCEITGYDGISLQPNSGAQGEYAGLLAI
FT                   RAYHQANGQPQRNVCLIPASAHGTNPASAQLAGMDVVVVASDANGNVDLADLRARIAQV
FT                   GERLAALMITYPSTHGVFEEAVTEICDAVHEAGGQVYLDGANMNAMVGVAQPGKFGSDV
FT                   SHLNLHKTFCIPHGGGGPGVGPVAVRAHLAPYLPGVLDARGRLDPEAKVGPVSAAPYGS
FT                   AGILPIPYVYIALMGAEGLRRATEVAILNANYIATRLRGHYPVLYAGRNGRVAHECILD
FT                   VRPLKETSGISAEDIAKRLMDYGFHAPTMSFPVAGTLMVEPTESEGLAELERFIEAMIA
FT                   IRAEIAQVESGERDRDDNVLRNAPHTAQMLLAEEWHHDYPRQQAAYPVASLRENKYWPP
FT                   VARVDNAYGDRNLVCACLPVEAYA"
FT   misc_feature    199054..200322
FT                   /note="HMMPfam hit to PF02347, Glycine cleavage system
FT                   P-protein"
FT   CDS_pept        complement(202027..202767)
FT                   /transl_table=11
FT                   /locus_tag="BP0198"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /note="Similar to Escherichia coli putative L-lactate
FT                   dehydrogenase operon regulatory protein LldR or LctR or
FT                   B3604 SW:LLDR_ECOLI (P33233) (258 aa) fasta scores: E():
FT                   4.3e-12, 31.915% id in 235 aa, and to Streptomyces
FT                   coelicolor putative GntR-family transcriptional regulator
FT                   Scc24.13C TR:Q9L0A4 (EMBL:AL163003) (235 aa) fasta scores:
FT                   E(): 4.3e-14, 34.222% id in 225 aa"
FT                   /db_xref="GOA:Q7W0E2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0E2"
FT                   /protein_id="CAE40577.1"
FT                   /translation="MKTVETNPNPLGPIKAVRSRDLLADALREQILSGARPSGVALPSE
FT                   RELTEETGLSRAAVRDALRVLESEGLIETRQGRYGGSVVKLPANDALARPVALFARARG
FT                   ISLQEMIEARVAIEPTIAELAALRRTPEDLQALIQATDLLQEALPHVEQFLDLNVRWYF
FT                   ALADACHNDLLRAFIVSIAGLILTATSREGQTPEPTRRLILQSHRRVVEAVIAGDAPAA
FT                   RRRMERHVAGYQEHYERLGLTPSA"
FT   misc_feature    complement(202516..202701)
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family"
FT   misc_feature    complement(202576..202641)
FT                   /note="Predicted helix-turn-helix motif with score 1063
FT                   (+2.81 SD) at aa 43-64, sequence PSERELTEETGLSRAAVRDALR"
FT   CDS_pept        202837..204048
FT                   /transl_table=11
FT                   /locus_tag="BP0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium meliloti putative conserved
FT                   membrane-anchored protein Smb21182 TR:CAC49248
FT                   (EMBL:AL603645) (394 aa) fasta scores: E(): 2e-56, 40.769%
FT                   id in 390 aa, and to Sphingomonas aromaticivorans
FT                   hypothetical 41.0 kDa protein TR:O86014 (EMBL:AF079317)
FT                   (388 aa) fasta scores: E(): 8.9e-55, 41.732% id in 381 aa"
FT                   /db_xref="GOA:Q7W0E1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0E1"
FT                   /protein_id="CAE40578.1"
FT                   /translation="MAAVSSSVPPTPLGGVRVLDLSKVLAGPLCTQYMADMGADVIKVE
FT                   AAGQGDDTRGWPPFQDGQAAVFLSCNRNKRSIALDLKSAHGRAVVQRLAAWADVVVHSF
FT                   GPGVAQKLGVDWEALSEINPRLVYCAISGFGPVGSLSHGKGFDVVLQAFCGMISITGET
FT                   EGGAVRSPFSPVDQATGLHALIGILAALRQRDASGRGVTVDASLFDTALGFMGYFMQGY
FT                   WARGTEPARAGAGHESLCPYQDFATADKPIILGIANDALWRAFCALAERPELASDPRFA
FT                   TNAQRVANRAQTLAATRALLAARTRGEWLPALEQAGIPCSPIHTLVEVDAHPHTRESGM
FT                   VFDYPETGTDAGPLKGVAQPVRFDGMRLTTPKRPPSLNQDWASVLADAGYSDPEVRDLL
FT                   QQMA"
FT   misc_feature    203065..203631
FT                   /note="HMMPfam hit to PF02515, CAIB/BAIF family"
FT   CDS_pept        204077..205045
FT                   /transl_table=11
FT                   /locus_tag="BP0200"
FT                   /product="putative exported protein"
FT                   /note="Similar to Pseudomonas putida and Pseudomonas sp
FT                   hypothetical 34.5 kDa protein in clcB-clcD intergenic
FT                   region precursor SW:YCLC_PSEPU (Q47100) (329 aa) fasta
FT                   scores: E(): 1.3e-33, 36.246% id in 309 aa, and to
FT                   Rhizobium meliloti conserved hypothetical protein Sma1927
FT                   TR:AAK65716 (EMBL:AE007292) (330 aa) fasta scores: E():
FT                   1.8e-32, 34.663% id in 326 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0E0"
FT                   /protein_id="CAE40579.1"
FT                   /translation="MMNVLIRRALCAAIASLAAAAAHAAYPEQPVRIVVAFAPGSGTDN
FT                   VARYYATRLSEELKQPFVVENKPGANGSIAATQVARTQPDGYTLFLGSNSTLSAAPFLF
FT                   KKLPYEPLKDFTAVARLSDIPSMLVVGADSPIRDFDQFIGKARAEPGRVTWANANTAHL
FT                   AAGMALTKQAQLDMISVPYKSSPQALTDVIGGQVTAMVVDTSAGTAFVQQGKVRALAVT
FT                   TARPVAAMPGVPSMSERFPGIDVYSWLGIVGPAGMPDEVVTVVNKAILKINASEDTVRF
FT                   LRENAGAEPPPSSSPAEFTQFMHAQLEVWRKLLRDANVEPM"
FT   misc_feature    204077..204148
FT                   /note="Signal peptide predicted for BP0200 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 24 and 25"
FT   CDS_pept        205042..205560
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0201"
FT                   /product="probable enoyl-CoA hydratase (Pseudogene)"
FT                   /EC_number="4.2.1.17"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. Similar to Escherichia coli probable
FT                   enoyl-CoA hydratase PaaG or B1394 SW:PAAG_ECOLI (P77467)
FT                   (262 aa) fasta scores: E(): 4.4e-14, 35.443% id in 158 aa,
FT                   and to Azoarcus evansii putative enoyl-CoA hydratase PacA
FT                   or PaaG TR:Q9ETY7 (EMBL:AJ278756) (273 aa) fasta scores:
FT                   E(): 5.3e-14, 41.615% id in 161 aa"
FT                   /db_xref="PSEUDO:CAE40580.1"
FT   misc_feature    205120..205557
FT                   /note="HMMPfam hit to PF00378, Enoyl-CoA
FT                   hydratase/isomerase family"
FT   misc_feature    205381..205443
FT                   /note="ScanRegExp hit to PS00166, Enoyl-CoA
FT                   hydratase/isomerase signature. Confirmed by InterPro eMOTIF
FT                   pattern match."
FT   misc_feature    join(205381..205449,205477..205545)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BP0201 by TMHMM2.0 at aa 114-136 and 146-168"
FT   repeat_region   205557..205588
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   205557..206609
FT   CDS_pept        205659..206609
FT                   /transl_table=11
FT                   /locus_tag="BP0202"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q79H25"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H25"
FT                   /protein_id="CAE40581.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT"
FT   misc_feature    205917..205982
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    206040..206573
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(206578..206609)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(206604..206642)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0202A"
FT                   /product="transposase (pseudogene)"
FT                   /note="transposase fragment for IS1002"
FT   repeat_region   complement(206604..206732)
FT                   /note="Fragment of a IS1002 element"
FT   repeat_region   206704..206732
FT                   /note="Inverted repeat for IS481-like element"
FT   repeat_region   complement(206707..206732)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(206729..207679)
FT                   /transl_table=11
FT                   /locus_tag="BP0203"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA3"
FT                   /protein_id="CAE40583.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   repeat_region   206729..206760
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(206729..207781)
FT   misc_feature    complement(206765..207298)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(207356..207421)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   repeat_region   complement(207750..207781)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(207794..208795)
FT                   /transl_table=11
FT                   /locus_tag="BP0204"
FT                   /product="putative restriction endonuclease"
FT                   /note="Similar to Escherichia coli EcoVIII restriction
FT                   endonuclease TR:Q46974 (EMBL:U48806) (333 aa) fasta scores:
FT                   E(): 9.4e-22, 34.677% id in 248 aa, and to Haemophilus
FT                   influenzae type II restriction enzyme HindIII or Hi1393
FT                   SW:T2D3_HAEIN (P43870) (300 aa) fasta scores: E(): 7.4e-20,
FT                   30.420% id in 286 aa"
FT                   /db_xref="GOA:Q7W0D9"
FT                   /db_xref="InterPro:IPR019043"
FT                   /db_xref="InterPro:IPR038373"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0D9"
FT                   /protein_id="CAE40584.1"
FT                   /translation="MPVARHGVGERVVQCPPMLTTSDPLPHPLPHPLLHDGVVAAVVRL
FT                   CADATLDFPARCARLEAAIRACTRDQIIEHLQHGGVISECIGHDSSEEKLLAKYSDVLL
FT                   ACALGELGFQARVLAERSDAADVYAECGDQRIVGDGKIFRLSRTALNPKDYKVPSLKKW
FT                   RQGAGYSADYSVLLAPSFQYPLSRSQLYAQAIDNNVLLLSFEQLAFLVRHHQPGRDYRP
FT                   LWEYAGTRAGQDTAAWKEARQYWHGLNQLVARLAGQTEQALRDSYAARRQLLQRQFDDE
FT                   IAHWDAEAQRIRGLSREQAIAELLVSKKIQARVDLMRGAQRQLTLQLDDARA"
FT   CDS_pept        complement(208886..209452)
FT                   /transl_table=11
FT                   /locus_tag="BP0205"
FT                   /product="putative exported protein"
FT                   /note="Similar to the C-terminal regions of Thermus
FT                   thermophilus nusA/infB operon DNA TR:Q56428 (EMBL:Z48001)
FT                   (275 aa) fasta scores: E(): 0.00019, 39.583% id in 96 aa,
FT                   and to Pseudomonas aeruginosa hypothetical protein Pa4718
FT                   TR:Q9HV80 (EMBL:AE004885) (158 aa) fasta scores: E():
FT                   0.00051, 33.962% id in 106 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0D8"
FT                   /protein_id="CAE40585.1"
FT                   /translation="MQLTIRKLAYTLAFSTLVLAGCTTASKKTDGQAATPADQASSQQA
FT                   SAASVEFYVAQAKAGDGLMEVKVPDGSLYMQRQPVLTRADLTEAAALVDRQGQNFVGLR
FT                   FTEAGARKLNDISSKNIGNMLALVIDRELVAAPRIAEPLNRGVLAFGVPSAKAASEIAA
FT                   KIRGDAGAPAAGVPAAPAPKPAPKP"
FT   misc_feature    complement(209372..209452)
FT                   /note="Signal peptide predicted for BP0205 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.994) with cleavage site
FT                   probability 0.482 between residues 27 and 28"
FT   misc_feature    complement(209387..209419)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        209771..211684
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="BP0206"
FT                   /product="thiamine biosynthesis protein"
FT                   /note="Similar to Escherichia coli thiamine biosynthesis
FT                   protein ThiC or B3994 SW:THIC_ECOLI (P30136) (631 aa) fasta
FT                   scores: E(): 2.3e-150, 68.780% id in 631 aa, and to
FT                   Neisseria meningitidis thiamine biosynthesis protein ThiC
FT                   or Nmb2040 TR:Q9JXI0 (EMBL:AE002554) (633 aa) fasta scores:
FT                   E(): 2.9e-180, 71.429% id in 630 aa"
FT                   /db_xref="GOA:Q7W0D7"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0D7"
FT                   /protein_id="CAE40586.1"
FT                   /translation="MNANPTFLAATAEVDAAAVAPLPKSRKVYETGSRPDIRVPFREIE
FT                   QADTPTMFGGEKNPPLTVYDTSGPYTDPQASIDIRRGLPALRRAWIEERGDTEVLDGPT
FT                   SDYGKERLTDPKLTAMRFDLQRPPRRARAGANVTQMHYARRGIVTPEMEFIALRENLRR
FT                   EHYLETLRASGPDGEKLAKRLLRQHPGQSFGAALPSAITPEFVREEVARGRAIIPANIN
FT                   HPEIEPMIIGRNFLVKINANIGNSAVSSGIGEEVEKMTWAIRWGGDTVMDLSTGKHIHE
FT                   TREWIIRNSPVPIGTVPIYQALEKVDGKAEELTWEIFRDTLIEQAEQGVDYFTIHAGVR
FT                   LPFIPMTADRMTGIVSRGGSIMAKWCLAHHKESFLYERFEEICEIMKAYDVSFSLGDGL
FT                   RPGSGYDANDEAQFAELKTLGELTQVAWKHDVQVMIEGPGHVPMQMIKENMELQLKHCD
FT                   EAPFYTLGPLTTDIAPGYDHITSGIGAALIGWYGTAMLCYVTPKEHLGLPNKKDVKDGI
FT                   ITYKIAAHAADLAKGHPGAAIRDNALSKARFEFRWDDQFNLGLDPDTAKEFHDETLPKD
FT                   SMKVAHFCSMCGPHFCSMKITQDVRDYAAAQGVSEKDALQQGMQEKAVEFVKKGAEVYH
FT                   RT"
FT   misc_feature    210182..211573
FT                   /note="HMMPfam hit to PF01964, ThiC family"
FT   CDS_pept        complement(211726..213156)
FT                   /transl_table=11
FT                   /locus_tag="BP0207"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /note="Similar to Rhizobium meliloti putative aldehyde
FT                   dehydrogenase Smb20891 TR:CAC49585 (EMBL:AL603646) (477 aa)
FT                   fasta scores: E(): 5.1e-123, 68.697% id in 476 aa, and to
FT                   Rhizobium loti aldehyde dehydrogenase Mlr5236 TR:Q98CA3
FT                   (EMBL:AP003006) (479 aa) fasta scores: E(): 1.8e-118,
FT                   67.230% id in 473 aa. Similar to several B. pertussis CDSs
FT                   including BP0360 (44.025% identity in 477 aa overlap),
FT                   BP2303, BP0757, BP1976."
FT                   /db_xref="GOA:Q7W0D6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0D6"
FT                   /protein_id="CAE40587.1"
FT                   /translation="MHANFIDGAWLDGVDARPNINPSNLADVVGDYAQADAAQAGMAIA
FT                   AASAAAHAWARSTGQRRADVLDAVGTELLARKEELGRLLSREEGKTLPEGVSEVTRAGH
FT                   IFKFFAGEALRIQGEKLPMTRPGIEVDVTREPVGVVGIIAPWNFPIAIPAWKIAPALAY
FT                   GNTVVFKPADLVPGSAWALAEILSRAGLPAGVFNLVMGRGSVVGQAILDDRRVNAISFT
FT                   GSVATGRRVAEAAIGRMAKVQLEMGGKNPLVVLNDADLKVAVDCAVNGAFFSTGQRCTA
FT                   SSRLIVQKGIYPRFVEAVRERLQGLKVDDALAPGTDIGPVVDRSQFDQNLAYIAIGREE
FT                   GAQLAWGGEPLKRANEGYYLAPALFVDCDNSLRIAREEIFGPVAAVIPVDSYEQALEVA
FT                   NDTEFGLSSGIVTTSLRHATHFKRESQAGMVMVNCPTAGVDYHVPFGGRKGSSYGPREQ
FT                   GRHAAEFYTSVKTAYTAA"
FT   misc_feature    complement(211729..213132)
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
FT                   family"
FT   misc_feature    complement(212308..212343)
FT                   /note="ScanRegExp hit to PS00070, Aldehyde dehydrogenases
FT                   cysteine active site. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   misc_feature    complement(212404..212427)
FT                   /note="ScanRegExp hit to PS00687, Aldehyde dehydrogenases
FT                   glutamic acid active site."
FT   CDS_pept        complement(213269..214681)
FT                   /transl_table=11
FT                   /locus_tag="BP0208"
FT                   /product="putative oxidoreductase"
FT                   /note="Similar to Rhizobium loti putative oxidoreductase
FT                   Mlr7440 TR:Q986B0 (EMBL:AP003011) (476 aa) fasta scores:
FT                   E(): 8.5e-78, 46.970% id in 462 aa, and to Rhizobium
FT                   meliloti putative oxidoreductase protein Smc00985
FT                   TR:CAC45439 (EMBL:AL591785) (496 aa) fasta scores: E():
FT                   1.5e-76, 44.255% id in 470 aa. Also similar to BP3139,
FT                   49.785% identity in 466 aa overlap."
FT                   /db_xref="GOA:Q7W0D5"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0D5"
FT                   /protein_id="CAE40588.1"
FT                   /translation="MSASEFSQRLTQALGADVVATSPADIEPWLSDWRGIYRGQAQAVV
FT                   RPRTTDEVARCLALCQQAGVPVVPRGGNTGLCGGATPDAAQANVVLSLERMNAIRALDT
FT                   VANTMVAEAGCILGNLRRAAQDANRLLPLSLAAEDSSQIGGNVATNAGGVNVVRYGMAR
FT                   ELVLGLEAVLPNGEVLHGLRTLRKDNTGYDLKQLLIGSEGTLGVITAVALRLFPRADTR
FT                   TVVLAAVESPRQALQLYELLFEQCGARLQAFEYFSGDCLDLVLTHVDGLHEPFAQRYPA
FT                   YVLVELADTIDEAALNALVEEVIGAALERELCLDAAVSASLAQLQTLWRLREEISEAQR
FT                   ADGPHLKHDVSLPIERIPEFMETAAARVRERYPDIRPFIFGHFGDGNLHYNLSRPAGAP
FT                   REWAAEQGDAVTDLVLDEVLRYGGSISAEHGIGQLKRDHFLHSKDPLELRLMREIKRVL
FT                   DPAGIMNPGKLL"
FT   misc_feature    complement(214052..214660)
FT                   /note="HMMPfam hit to PF01565, FAD binding domain"
FT   misc_feature    complement(214385..214414)
FT                   /note="ScanRegExp hit to PS00339, Aminoacyl-transfer RNA
FT                   synthetases class-II signature 2."
FT   CDS_pept        complement(214698..215393)
FT                   /transl_table=11
FT                   /locus_tag="BP0209"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /note="Similar to Rhizobium meliloti putative GntR-family
FT                   transcriptional regulator Sma0246 TR:AAK64788
FT                   (EMBL:AE007207) (233 aa) fasta scores: E(): 4e-20, 36.771%
FT                   id in 223 aa, and to Rhizobium loti transcriptional
FT                   regulator Mll8575 TR:Q982M5 (EMBL:AP003014) (247 aa) fasta
FT                   scores: E(): 5.4e-19, 36.123% id in 227 aa"
FT                   /db_xref="GOA:Q7W0D4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0D4"
FT                   /protein_id="CAE40589.1"
FT                   /translation="MLQPTPTLTDQVAGQLARAIADGAYAVGAKLPTGRALAQQYGVSA
FT                   AVIREATERLRAQGLVQSRQGSGCTVVARTPAGGFQVPAGGLDRAHLARVYELRMELEG
FT                   GAAALAARRRGAADLDRMRQALQALQREPIEPEQGVVHDVGFHVAIATATANPYYLQLL
FT                   QYLNLQLRQAVETARANTRRQGDPVHAVHEEHLAIYRAIERGEPEAARAAAQHHLLGAA
FT                   ARLQLDMNL"
FT   misc_feature    complement(215181..215360)
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family"
FT   repeat_region   215510..215541
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   215510..216562
FT   CDS_pept        215612..216562
FT                   /transl_table=11
FT                   /locus_tag="BP0210"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTJ9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTJ9"
FT                   /protein_id="CAE40590.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVSEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDKYNLLTVHS"
FT   misc_feature    215870..215935
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    215993..216526
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(216535..216562)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   216559..216590
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   216559..217611
FT   CDS_pept        216661..217611
FT                   /transl_table=11
FT                   /locus_tag="BP0211"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTC0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTC0"
FT                   /protein_id="CAE40591.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHN"
FT   misc_feature    216919..216984
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    217042..217575
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(217580..217611)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(217636..218535)
FT                   /transl_table=11
FT                   /locus_tag="BP0212"
FT                   /product="putative hydrolase"
FT                   /note="Similar to Staphylococcus cohnii streptogramin B
FT                   lactonase VgbB TR:O87275 (EMBL:AF015628) (295 aa) fasta
FT                   scores: E(): 1.4e-42, 41.637% id in 281 aa, and to
FT                   Streptomyces coelicolor putative hydrolase Scd6.27C
FT                   TR:Q9KZX7 (EMBL:AL353815) (299 aa) fasta scores: E():
FT                   3.6e-47, 46.875% id in 288 aa"
FT                   /db_xref="GOA:Q7W0D3"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011217"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0D3"
FT                   /protein_id="CAE40592.1"
FT                   /translation="MNQVEMTEFPVGKPEEALYGVASTPDGALWFTLAKGNAIGRLSPD
FT                   GEVSRFPLPHADGQPTTITCGPDGRPWFTLSSANAVGRLSPDGALRMFELPRPASRPFG
FT                   IAAGHDGCLWFAEMAGDRIGRITIDGDIEEYDLPVKGGYPSCMAAGRDGLMWFTLNQAG
FT                   AIGSISATAAPRIFPLGAADAAPVGIASDAQGALWIAQAGNGAIARFDAGGRITEFPLH
FT                   SRAARPHALAADAAGNLWFTEWGANRIGRISEAGDTAGYELAAPGSEPHGIAIDPHGCV
FT                   WAALETGSLVRLQASPRD"
FT   CDS_pept        218690..219238
FT                   /transl_table=11
FT                   /locus_tag="BP0213"
FT                   /product="putative acetyltransferase"
FT                   /note="Similar to Alcaligenes faecalis phosphinothricin
FT                   N-acetyltransferase Pat SW:PAT_ALCFA (P31668) (197 aa)
FT                   fasta scores: E(): 1.4e-35, 59.884% id in 172 aa, and to
FT                   Caulobacter crescentus phosphinothricin N-acetyltransferase
FT                   Cc0935 TR:Q9A9P1 (EMBL:AE005770) (180 aa) fasta scores:
FT                   E(): 3.6e-32, 53.757% id in 173 aa"
FT                   /db_xref="GOA:Q7W0D2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0D2"
FT                   /protein_id="CAE40593.1"
FT                   /translation="MTASTPTAILIRDSRDADLPAIAAIYAHHVLHGTASFELEPPGLE
FT                   ALRERRAAVLAHGLPYLAAECGGEIVGYAYATPYRPRPAYRHTVEDSVYVRAGHAGQGI
FT                   GGKLLAALIDRCAAGGWRQMLAVVGDSANTASVALHARHGFDTIGTFRSVGYKHGQWRD
FT                   TVLMQRALGEGDATPPSRP"
FT   misc_feature    218873..219127
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family"
FT   CDS_pept        complement(219277..219996)
FT                   /transl_table=11
FT                   /locus_tag="BP0214"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Caulobacter crescentus ExsB protein
FT                   Cc3160 TR:Q9A3P2 (EMBL:AE005980) (242 aa) fasta scores:
FT                   E(): 2.7e-64, 63.983% id in 236 aa, and to Rhizobium loti
FT                   Mll5936 protein TR:Q98AM3 (EMBL:AP003007) (245 aa) fasta
FT                   scores: E(): 8.9e-59, 60.606% id in 231 aa"
FT                   /db_xref="GOA:Q7W0D1"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0D1"
FT                   /protein_id="CAE40594.1"
FT                   /translation="MQNHQRRALVLFSGGQDSTTCLAWALERYAHVETLGFDYGQRHRV
FT                   ELDARQVVLRELRANFPDWAQRLGDDHLLDLGILAQVGDTAMTSDREIEMQANGLPNTF
FT                   VPGRNLLFLTLAAALGYRRQLDVLVGGMCETDFSGYPDCRDDTIKSQQVTLGLGLGTRV
FT                   TIETPLMWLDKAQTWELADRLGGQALVDMVIEHSHTCYLGERGQRHDWGYGCGHCPACA
FT                   LRKNGWERWVAGAAHAD"
FT   CDS_pept        220068..223010
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="BP0215"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="Similar to Corynebacterium crenatum
FT                   phosphoenolpyruvate carboxylase Ppc TR:AAK92540
FT                   (EMBL:AF406314) (919 aa) fasta scores: E(): 1.2e-95,
FT                   41.587% id in 945 aa, and to Corynebacterium glutamicum
FT                   phosphoenolpyruvate carboxylase Ppc SW:CAPP_CORGL (P12880)
FT                   (918 aa) fasta scores: E(): 5.4e-95, 41.288% id in 947 aa"
FT                   /db_xref="GOA:Q7W0D0"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0D0"
FT                   /protein_id="CAE40595.1"
FT                   /translation="MAAYNAPVSNCQFRLTHILPIPQRHGAPTDPFQMNAIRQQSDSAE
FT                   PLRHDIRLLGRCLGEVIQACEGKRVYDTIETLRRTAVRFRRAGDPADDKLLQARVKQLR
FT                   GNDPNSVARAFSYFLHLSNIAEDRDQNRRQRERALAGAGPERGSLRQAIESLKAQGVNN
FT                   ARIRRLLSEACVMPVLTAHPTEVQRKSTLDVHREISSLLVQRERELTADELSELDLALI
FT                   GQVATLWQTRMLRYTRLTVADEIENALSYYRSTFLNVIPRVYGDLARLLNREPVKPFTP
FT                   PPPPLEPFLRMGSWIGGDRDGNPNVDAATLERALLRQATVLFEHYLQEVHALGAELSAS
FT                   TLLIEADPALLALADAGGDDSPHRRDEPYRRALIGIYARLAATARHLTGQKLARRATVP
FT                   AAPYDTPDALAADLAVIAASLSARHGAPIARLRLSGLQQAVTVFGFHLATVDLRQSSDV
FT                   HERVLAELFARAGDGIDGQAVDYLALDEAARVAGRELAHARPLASPWIAYSEETASELA
FT                   VLRAAAAGRARYGRQAVLQSIVSHTETLSDLLEVLVLQKEAGLIAPPGETIAPGDGLMV
FT                   VPLFETIPDLQRGPEIMAAWLDLPEVRQRVRLAQGDTQEVMLGYSDSNKDGGFLTSNWS
FT                   LYQAERALVDVFSARSVRLRMFHGRGDSVGRGGGSSYDAILAQPPGTVAGQLRLTEQGE
FT                   VIQSKYKDAEVGRWHLELLVAATLESSLAPQAAATSAEDAHMQQHAPAMSFMSELAQRT
FT                   YRGLVYDTPGFADYFFAATPISEIAGLNIGSRPASRKKGQHIEDLRAIPWGFSWAQCRL
FT                   MLTGWYGMGSAIEAYLETGAQGAPRSRRARLAQLREMASDWPAFRTLLSNMEMVLAKSD
FT                   LAIAAGYAQLVPRRGLRERVFGAITAEHGRTLAMLRLLTRRDLLADNPGLMASLRERFA
FT                   YIDPLNYLQIELIKRHRAAQRRAGDDADIRVPRAIHLTINGIAAGLRNSG"
FT   misc_feature    220398..220985
FT                   /note="HMMPfam hit to PF00311, Phosphoenolpyruvate
FT                   carboxylase"
FT   misc_feature    220599..220634
FT                   /note="ScanRegExp hit to PS00781, Phosphoenolpyruvate
FT                   carboxylase active site 1. Confirmed by InterPro eMOTIF
FT                   pattern match."
FT   misc_feature    221679..222908
FT                   /note="HMMPfam hit to PF00311, Phosphoenolpyruvate
FT                   carboxylase"
FT   misc_feature    221913..221951
FT                   /note="ScanRegExp hit to PS00393, Phosphoenolpyruvate
FT                   carboxylase active site 2. Confirmed by InterPro eMOTIF
FT                   pattern match."
FT   CDS_pept        223601..226399
FT                   /transl_table=11
FT                   /gene="sphB1"
FT                   /locus_tag="BP0216"
FT                   /product="autotransporter subtilisin-like protease"
FT                   /note="Previously sequenced as Bordetella pertussis
FT                   autotransporter subtilisin-like protease SphB1 TR:CAC44081
FT                   (EMBL:AJ318229) (1039 aa) fasta scores: E(): 0, 100.000% id
FT                   in 932 aa, and dimilar to Xylella fastidiosa serine
FT                   protease Xf1026 TR:Q9PEK2 (EMBL:AE003939) (905 aa) fasta
FT                   scores: E(): 1.1e-45, 31.919% id in 943 aa"
FT                   /db_xref="GOA:Q7W0C9"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034061"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0C9"
FT                   /protein_id="CAE40596.1"
FT                   /translation="MMPPPAVPPQLPEVPAADLPRVRAPLSTYRRPQRTDFVTPTGGPF
FT                   FAKQDKALNTIDLKMAHDLKLRGYRVKVAVVDEGVRSDHPLLNVEKKYGGDYMADGTRT
FT                   YPDPKRQGRHGTSVALVLAGQDTDTYRGGVAPNADLYSANIGTRAGHVSDEAAFHAWND
FT                   LLGHGIKIFNNSFATEGPEGEQRVKEDRNEYHSAANKQNTYIGRLDRLVRDGALLIFAA
FT                   GNGRPSGRAYSEVGSVGRTPRVEPHLQRGLIVVTAVDENGRLETWANRCGQAQQWCLAA
FT                   PSTAYLPGLDKDNPDSIHVEQGTSLSAPLVTGAAVLVQDRFRWMDNDNLRTTLLTTAQD
FT                   KGPYGVDPQYGWGVLDVGRAVQGPAQFAFGDFVARVTDTSTFGNDISGAGGLVVDGPGA
FT                   LVLAGSNTYAGRTTIKRGTLDVFGSVTSAVTVEPGGTLTGIGTVGTVTNQGTVVNKEAG
FT                   LHVKGDYSQTAQGLLVTDIGSLLDVSGRASLAGRLHVDDIRPGYVGGDGKSVPVIKAGA
FT                   VSGVFATLTRSPGLLLNARLDYRPQAVYLTMRRAERVHAAAQRGADDGRRASVLAVAER
FT                   LDAAMRELDALPESQRDAAAPAAAIGRIQRVQSRKVLQDNLYSLAGATYANAAAVNTLE
FT                   QNRWMDRLENHLAQAGGERVAAIAEYRHGQLRWRPDGLQGRQRGNGIMLGLAREVSAGL
FT                   SLAAALTHSRTHWDESSGAPARDNAAMTTPGVLLGARRAWEDGWFVQGALGYSRYRNQA
FT                   TRHISLGDAGHTVGATARGHVWQADAGLGRQWTLAPGHTLAPRAGLQLTHLRQQGFSES
FT                   GAQGLGLRAHALTRTVPTLWAQLQSRHAFMLGATPMTAQLQLGVWHDLRARRYAASGGF
FT                   AGLAQDQGASGYWPVPRTRVQGALGLRAEFAPGLVLGLGYTGQLATHWVDHQLSASLTY
FT                   RY"
FT   misc_feature    223811..224023
FT                   /note="HMMPfam hit to PF00082, Subtilase family"
FT   misc_feature    224507..224539
FT                   /note="ScanRegExp hit to PS00138, Serine proteases,
FT                   subtilase family, serine active site."
FT   misc_feature    224507..224686
FT                   /note="HMMPfam hit to PF00082, Subtilase family"
FT   misc_feature    225626..225682
FT                   /note="ScanRegExp hit to PS00095, C-5 cytosine-specific DNA
FT                   methylases C-terminal signature."
FT   CDS_pept        226857..227789
FT                   /transl_table=11
FT                   /locus_tag="BP0217"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="Similar to Clostridium acetobutylicum
FT                   3-hydroxybutyryl-CoA dehydrogenase Hbd or Cac2708
FT                   SW:HBD_CLOAB (P52041) (282 aa) fasta scores: E(): 7.6e-33,
FT                   42.199% id in 282 aa, and to Rhizobium loti
FT                   3-hydroxybutyryl-CoA dehydrogenase Mlr6793 TR:Q988C8
FT                   (EMBL:AP003010) (309 aa) fasta scores: E(): 3.7e-37,
FT                   36.452% id in 310 aa"
FT                   /db_xref="GOA:Q7W0C8"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0C8"
FT                   /protein_id="CAE40597.1"
FT                   /translation="MDNPIQNLAVVGAGAMGSGIAALFASKGFDVVLIDPMEGALTRAA
FT                   QVIERQLGVYAPDAIAPAMQRIRMDAGLEAACSAQLVIEAVPEKLALKRDIFARLDTLC
FT                   DPQAIFATNTSGLSINDIAQAVTRRDRFVGTHFFTPADVIPLVEVVRNDDTSEQTVARV
FT                   MDMLRAGGKRPVLVRKDIPGFIANRIQHALAREAISLLEKGVASAEDIDEVVKWSLGIR
FT                   LALSGPLEQRDMNGIDVHYAIASYLYQDLENRTTPSELLENKVQAGELGAKSGQGFYAW
FT                   PPERRERVLRDKSAALAELAAWLENRKPV"
FT   misc_feature    226878..227699
FT                   /note="HMMPfam hit to PF00725, 3-hydroxyacyl-CoA
FT                   dehydrogenase, C-terminal domain"
FT   CDS_pept        227901..229250
FT                   /transl_table=11
FT                   /locus_tag="BP0218"
FT                   /product="short-chain fatty acids transporter"
FT                   /note="Similar to Escherichia coli short-chain fatty acids
FT                   transporter AtoE or B2223 SW:ATOE_ECOLI (P76460) (440 aa)
FT                   fasta scores: E(): 1.4e-62, 39.636% id in 439 aa, and to
FT                   Alcaligenes eutrophus hypothetical 47.8 kDa protein
FT                   TR:Q9F189 (EMBL:AF042280) (446 aa) fasta scores: E():
FT                   1.5e-125, 75.281% id in 445 aa. Also similar to BP0404,
FT                   44.988% identity (46.283% ungapped) in 429 aa overlap."
FT                   /db_xref="GOA:Q7W0C7"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0C7"
FT                   /protein_id="CAE40598.1"
FT                   /translation="MNKLTSFFTELMRKYLPDPFVFAIALTLLTVLMAFGIEGQPLDQI
FT                   TREWGKGFWSLLAFTTQMAVILAMGYVLATAPLTDRLLDRIVSHVHQPRTAIIVATLVG
FT                   GVGSYLNWGFGLVIGGVVAKKLALKVKGVHYPLIIAAAYSGFTMYGLGLSASIPVLVTT
FT                   PGHPTADQMGVIPLSETIFSLPMLITSLVIIVTLPLLNAWLHPKQGEQVVEVDPAIDQS
FT                   SAPAKTADELTAEDTLASRLNNSRILSLLIGLLGIAYVVFYFMDGKSLDLNLINFIILF
FT                   LGIILLGTPAAYVAKLNEGIKTISGIILQYPFYAGIMAIMAIMAGSGLVATISKVFVDV
FT                   ASPGSLPFWGLISSFVINFFAPSAGGHWVIQGPFMIDAAKEIGSALNQTTMAVMLGNAW
FT                   NDLVQPFWILPALALSKLKLRDVMGYTVIMMLWVGVIHIAAVLAWGYLTH"
FT   misc_feature    227901..228008
FT                   /note="Signal peptide predicted for BP0218 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.941) with cleavage site
FT                   probability 0.635 between residues 36 and 37"
FT   misc_feature    227901..229232
FT                   /note="HMMPfam hit to PF02667, Short chain fatty acid
FT                   transporter"
FT   misc_feature    join(227958..228017,228054..228122,228186..228254,
FT                   228315..228383,228441..228509,228639..228695,
FT                   228723..228782,228831..228899,228942..229010,
FT                   229173..229241)
FT                   /note="10 probable transmembrane helices predicted for
FT                   BP0218 by TMHMM2.0 at aa 20-39, 52-74, 96-118, 139-161,
FT                   181-203, 247-265, 275-294, 311-333, 348-370 and 425-447"
FT   CDS_pept        229282..230007
FT                   /transl_table=11
FT                   /locus_tag="BP0219"
FT                   /product="probable short-chain dehydrogenase"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   short-chain dehydrogenase Pa4162 TR:Q9HWL9 (EMBL:AE004832)
FT                   (238 aa) fasta scores: E(): 3.1e-29, 45.887% id in 231 aa,
FT                   and to Streptomyces coelicolor putative short chain
FT                   oxidoreductase 2 Scg61.28C TR:Q9K3Y7 (EMBL:AL359949) (253
FT                   aa) fasta scores: E(): 1.8e-20, 42.324% id in 241 aa.
FT                   Similar to BP3244 (49.153% identity in 236 aa overlap) and
FT                   to BP1222 (44.726% identity in 237 aa overlap"
FT                   /db_xref="GOA:Q7W0C6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0C6"
FT                   /protein_id="CAE40599.1"
FT                   /translation="MKPTAYLVTGASSGISAAIARALLDAGHRVVNIDYRLPADAPQGL
FT                   ASYQADLTDEAQTLAVAREVTEAYDIVGLVNNAGATRPGTADTATLADLDYVVALHLRT
FT                   AMILVQAALPAMRAAGYGRIVNMSSRAALGKPERVVYSATKAGLIGLTRTLAMELGGDG
FT                   ITVNAIGPGPIATELFRNSNPEGAPRTQRIIDSIVVKRLGTPEDVARAAMFFLSPDNGF
FT                   VTGQVLYVCGGTTLGVAPV"
FT   misc_feature    229282..229341
FT                   /note="Signal peptide predicted for BP0219 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.931) with cleavage site
FT                   probability 0.543 between residues 20 and 21"
FT   misc_feature    229291..229812
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase"
FT   misc_feature    229663..229749
FT                   /note="ScanRegExp hit to PS00061, Short-chain
FT                   dehydrogenases/reductases family signature."
FT   misc_feature    229879..229971
FT                   /note="HMMPfam hit to PF00678,"
FT   CDS_pept        complement(230058..230909)
FT                   /transl_table=11
FT                   /locus_tag="BP0220"
FT                   /product="probable transcriptional regulator"
FT                   /note="Similar to Rhodococcus opacus PcaR TR:O67983
FT                   (EMBL:AF003947) (265 aa) fasta scores: E(): 1.2e-41,
FT                   50.602% id in 249 aa, and to Rhizobium meliloti putative
FT                   transcriptional regulator, IclR family protein Smb20586
FT                   TR:CAC49898 (EMBL:AL603647) (251 aa) fasta scores: E():
FT                   2.2e-39, 48.780% id in 246 aa"
FT                   /db_xref="GOA:Q7W0C5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR012794"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0C5"
FT                   /protein_id="CAE40600.1"
FT                   /translation="MASRLYNGARSERLHFHLLHTGSMVEQVPQQPGVSYVQSFARGLS
FT                   VIRAFGPQRPQMTLSEVAAATGLTRAGARRILLTLASLGYVAQEDRRFTLTPRILELGY
FT                   AYLSATPLWDLALPYMEEVAETTRESCSVSVLDGVDIVYILRLSTHKVMTINLAVGSRL
FT                   PAWVTSMGRVLLAGLPEAEQDRLLDESQIQPYTPATVVDRAELKRILAGVRADGYACVV
FT                   QELEPGLQSVAVPIVDRGGRVIGAMNVSGHANRYSREEMLQAFLPPLRSAAEHINQALR
FT                   RR"
FT   misc_feature    complement(230073..230633)
FT                   /note="HMMPfam hit to PF01614, Bacterial transcriptional
FT                   regulator"
FT   misc_feature    complement(230676..230741)
FT                   /note="Predicted helix-turn-helix motif with score 1256
FT                   (+3.46 SD) at aa 57-78, sequence MTLSEVAAATGLTRAGARRILL"
FT   CDS_pept        231039..231725
FT                   /transl_table=11
FT                   /gene="catI"
FT                   /gene_synonym="pcaI"
FT                   /locus_tag="BP0221"
FT                   /product="3-oxoadipate CoA-transferase subunit A"
FT                   /EC_number="2.8.3.6"
FT                   /note="Similar to Pseudomonas putida 3-oxoadipate
FT                   CoA-transferase subunit A PcaI SW:PCAI_PSEPU (Q01103) (231
FT                   aa) fasta scores: E(): 3.6e-59, 71.689% id in 219 aa, and
FT                   to Acinetobacter calcoaceticus 3-oxoadipate CoA-transferase
FT                   subunit A PcaI and CatI SW:PCAI_ACICA (Q43973) (228 aa)
FT                   fasta scores: E(): 7.8e-54, 65.929% id in 226 aa. Also
FT                   similar to BP1788 (50.228% identity in 219 aa overlap), and
FT                   to BP2401 (48.684% identity in 228 aa overlap)."
FT                   /db_xref="GOA:Q7W0C4"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0C4"
FT                   /protein_id="CAE40601.1"
FT                   /translation="MISKLVATAADALADVPDGATVMIGGFGTAGQPMELIDALLEQGA
FT                   KDLVIINNNAGNGTTGLAALLGAGRVRKIICSFPRQVDSQIFDGLYRAGKLELELVPQG
FT                   NLAERIRAAGAGIGAFFTPTGYGTPLADGKETREINGRQYVLEYPLHADYALIQAERGD
FT                   RWGNLVYRKTARNFGPIMASAARVAVAQVRQVVELGQLDPEAVVTPGIFVKRVVQIDAP
FT                   RGAKEQ"
FT   misc_feature    231048..231698
FT                   /note="HMMPfam hit to PF01144, Coenzyme A transferase"
FT   misc_feature    231090..231137
FT                   /note="ScanRegExp hit to PS01273, Coenzyme A transferases
FT                   signature 1. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        231725..232369
FT                   /transl_table=11
FT                   /gene="catJ"
FT                   /gene_synonym="pcaJ"
FT                   /locus_tag="BP0222"
FT                   /product="3-oxoadipate CoA-transferase subunit B"
FT                   /EC_number="2.8.3.6"
FT                   /note="Similar to Pseudomonas putida 3-oxoadipate
FT                   CoA-transferase subunit B PcaJ SW:PCAJ_PSEPU (Q01104) (212
FT                   aa) fasta scores: E(): 1.9e-53, 66.190% id in 210 aa, and
FT                   to Acinetobacter calcoaceticus 3-oxoadipate CoA-transferase
FT                   subunit B PcaJ and CatJ SW:PCAJ_ACICA (Q59091) (218 aa)
FT                   fasta scores: E(): 4.1e-50, 62.981% id in 208 aa. Also
FT                   similar to BP1789 (50.472% identity in 212 aa overlap), and
FT                   to BP2400 (49.268% identity in 205 aa overlap)."
FT                   /db_xref="GOA:Q7W0C3"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0C3"
FT                   /protein_id="CAE40602.1"
FT                   /translation="MSSKLTRDEIAARVAQDIPEGAYVNLGIGLPTLVANHLPADREVI
FT                   LHTENGMLGMGPAPAKGQEDYDLINAGKQPVTELPGCSFFHHADSFAMMRGGHLDICVL
FT                   GAFQVSQQGDLANWHTGAPDAIPAVGGAMDLAIGAKDVFVMMELQTRDGQSKLVQACTY
FT                   PLTGVRCVSRVYTDMAVFDLRAGQITVTDLFGDTTREQLLALTGLPLKFAD"
FT   misc_feature    231740..232342
FT                   /note="HMMPfam hit to PF01144, Coenzyme A transferase"
FT   CDS_pept        232426..232701
FT                   /transl_table=11
FT                   /gene="catC2"
FT                   /gene_synonym="mmlJ"
FT                   /locus_tag="BP0223"
FT                   /product="methylmuconolactone isomerase"
FT                   /EC_number="5.3.3.4"
FT                   /note="Similar to Alcaligenes eutrophus methylmuconolactone
FT                   isomerase MmlJ TR:O51800 (EMBL:X99639) (91 aa) fasta
FT                   scores: E(): 5.3e-23, 63.736% id in 91 aa, and to
FT                   Acinetobacter lwoffii muconolactone delta-isomerase 2 CatC2
FT                   SW:CTC2_ACILW (O33951) (96 aa) fasta scores: E(): 1.7e-22,
FT                   63.736% id in 91 aa"
FT                   /db_xref="GOA:Q7W0C2"
FT                   /db_xref="InterPro:IPR003464"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR026029"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0C2"
FT                   /protein_id="CAE40603.1"
FT                   /translation="MLFMVQMQVNLPPDMPAERADKLKADEKALAQQMQRDGKWRHLWR
FT                   VAGRYANVSIFDAADNDELHQMLSALPLFPYMDIQVTALARHPSAI"
FT   misc_feature    232426..232698
FT                   /note="HMMPfam hit to PF02426, Muconolactone
FT                   delta-isomerase"
FT   CDS_pept        232727..233023
FT                   /transl_table=11
FT                   /locus_tag="BP0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Alcaligenes eutrophus hypothetical 11.0
FT                   kDa protein TR:Q9F188 (EMBL:AF042280) (98 aa) fasta scores:
FT                   E(): 6.7e-25, 65.306% id in 98 aa, and to Caulobacter
FT                   crescentus hypothetical protein Cc0069 TR:Q9AC00
FT                   (EMBL:AE005681) (93 aa) fasta scores: E(): 2.7e-08, 45.122%
FT                   id in 82 aa"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0C1"
FT                   /protein_id="CAE40604.1"
FT                   /translation="MPYIIETFDKPGSLAVRQQHRNAHLQFLDQHKHLLLACGAKLDDD
FT                   GKDLGGGLYVVDVDTRAAAEQFIQADPFHLAGLFERVAITRWRKAYVDGTSYL"
FT   CDS_pept        233069..233848
FT                   /transl_table=11
FT                   /gene="catD2"
FT                   /locus_tag="BP0225"
FT                   /product="3-oxoadipate enol-lactone hydrolase"
FT                   /EC_number="3.1.1.24"
FT                   /note="Similar to Alcaligenes eutrophus 3-oxoadipate
FT                   enol-lactone hydrolase CatD2 TR:Q9EV45 (EMBL:AF042280) (259
FT                   aa) fasta scores: E(): 4.2e-56, 58.915% id in 258 aa, and
FT                   to Pseudomonas putida PcaD-like protein TR:Q9WWZ4
FT                   (EMBL:AF031417) (228 aa) fasta scores: E(): 1.1e-35,
FT                   45.778% id in 225 aa"
FT                   /db_xref="GOA:Q7W0C0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0C0"
FT                   /protein_id="CAE40605.1"
FT                   /translation="MSYADLSQARLYYVIDGPADAPVLVLSNSLGTCADMWARQIPELS
FT                   RRFRVLRYDTRGHGKSSVPDGEYSFAQLGGDVAELLEHLRIERAHFCGLSMGGPTGMWL
FT                   ALERPELIDRLVLCNTAARIGSAEGWSARIAAVRQDGLETMAPGLVERWLTPQYRAAEP
FT                   GLVQVLVDMLRRIPDAGYMANCAALRDADLRERVAAIRARTLVISSTHDLAATPQDGKA
FT                   LAAAIPGARYVELDTSHISNWEQPEAFTRALTGFLTE"
FT   misc_feature    233210..233839
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold"
FT   CDS_pept        233845..234894
FT                   /transl_table=11
FT                   /locus_tag="BP0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical 34.1
FT                   kDa protein Scif3.09C TR:CAC37528 (EMBL:AL590982) (320 aa)
FT                   fasta scores: E(): 1e-08, 33.529% id in 340 aa"
FT                   /db_xref="GOA:Q7W0B9"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0B9"
FT                   /protein_id="CAE40606.1"
FT                   /translation="MNGMQRWKQRPPGSNWGDFGPDDQLGRLNLITPAEVLKAAQEIRA
FT                   GRSFCLSLPLDLPGGNVLNPRRHPPQLSPTRLQDTPYVNFPLRNINPDAVDVLSDDQVL
FT                   LSMQYSTQWDSLAHVGALFDADGDGRAELCYYNGYRAGIDIVGPADADHAGCGCNTGGP
FT                   SSALKLGIENLAQHSVQGRGVLLDLARHYGAGRTLVGYKELTQALAADGIEIESGDMLV
FT                   LRTGYAKAVVGMNGKPDADVLHQYGAALDGTDAELLQWITDSGIAAICADNYAVEAYPA
FT                   RERQGPRAMLPLHHHCLFKLGLPLAELWYLKDLAEWLHANGRHRFMLTAPPLRLPHAIG
FT                   SPVTPVATV"
FT   CDS_pept        complement(234999..235322)
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="BP0227"
FT                   /product="phosphate starvation-inducible protein precursor"
FT                   /note="Similar to Escherichia coli phosphate
FT                   starvation-inducible protein PsiF precursor or B0384
FT                   SW:PSIF_ECOLI (P27295) (106 aa) fasta scores: E(): 0.00082,
FT                   51.220% id in 82 aa, and to Pseudomonas aeruginosa
FT                   hypothetical protein Pa4874 TR:Q9HUT9 (EMBL:AE004901) (138
FT                   aa) fasta scores: E(): 2.9e-11, 50.562% id in 89 aa"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0B8"
FT                   /protein_id="CAE40607.1"
FT                   /translation="MISRVSKFAACTLVSLFCSTAAWAQASASKELTPQQKRMAECNKS
FT                   ATGKTGDERKAYMSSCLKGEEPANKLTPQQQRMKDCNSRASEQALTGKKRKAYMSTCLS
FT                   GKS"
FT   misc_feature    complement(235251..235322)
FT                   /note="Signal peptide predicted for BP0227 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.992 between residues 24 and 25"
FT   CDS_pept        complement(235479..236429)
FT                   /transl_table=11
FT                   /locus_tag="BP0228"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q79H25"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H25"
FT                   /protein_id="CAE40608.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT"
FT   repeat_region   235479..235510
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(235479..236531)
FT   misc_feature    complement(235515..236048)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(236106..236171)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   repeat_region   complement(236500..236531)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(236528..237325)
FT                   /transl_table=11
FT                   /locus_tag="BP0229"
FT                   /product="beta-D-hydroxybutyrate dehydrogenase"
FT                   /EC_number="1.1.1.30"
FT                   /note="Similar to Pseudomonas putida beta-D-hydroxybutyrate
FT                   dehydrogenase BdhA TR:Q9AE70 (EMBL:AJ310211) (256 aa) fasta
FT                   scores: E(): 1.6e-35, 45.349% id in 258 aa, and to
FT                   Pseudomonas SpGM101 beta-hydroxybutyrate dehydrogenase HbdH
FT                   TR:Q9KH52 (EMBL:AF271714) (255 aa) fasta scores: E():
FT                   2.1e-35, 45.736% id in 258 aa"
FT                   /db_xref="GOA:Q7W0B7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0B7"
FT                   /protein_id="CAE40609.1"
FT                   /translation="MNPARPLHGRCALITGAEAGLGLAIADTLARSGADIVMHCLQANE
FT                   SARQAQAALAREHGVRVLLLQADLRDVDQIEAMAAQALAELPRLDILVNNAVVRHFEPA
FT                   HELPRAHWDESLAVNLSAAFHLARLALPGMLAQGWGRIINLSSVYGAGAAANRVGYVTT
FT                   KTALLGLTRALAVETAASGITSNAVAPGTAPTPAIVGRITEIARRDGVAQEQAEREYLA
FT                   ARQPTGRFVAMENVAALVAFLCSDAGRDITGATLPIDGGWTAA"
FT   misc_feature    complement(236552..236644)
FT                   /note="HMMPfam hit to PF00678,"
FT   misc_feature    complement(236738..237298)
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase"
FT   misc_feature    complement(236801..236887)
FT                   /note="ScanRegExp hit to PS00061, Short-chain
FT                   dehydrogenases/reductases family signature."
FT   CDS_pept        complement(join(237322..237579,237581..238258))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0230"
FT                   /product="conserved hypothetical protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 226. The sequence has been checked
FT                   and believed to be correct. Similar to Archaeoglobus
FT                   fulgidus hypothetical 29.0 kDa protein Af1509 TR:O28763
FT                   (EMBL:AE000998) (262 aa) fasta scores: E(): 3.4e-06,
FT                   30.290% id in 241 aa, and to Deinococcus radiodurans
FT                   conserved hypothetical protein Dr1823 TR:Q9RTE2
FT                   (EMBL:AE002022) (253 aa) fasta scores: E(): 0.00019,
FT                   30.043% id in 233 aa"
FT                   /db_xref="PSEUDO:CAE40610.1"
FT   misc_feature    complement(join(237433..237579,237581..238045))
FT                   /note="HMMPfam hit to PF00753, Metallo-beta-lactamase
FT                   superfamily"
FT   variation       complement(237581..237582)
FT                   /note="GG in pertussis; GG(GT) in parapertussis"
FT   misc_feature    complement(237965..237997)
FT                   /note="ScanRegExp hit to PS00136, Serine proteases,
FT                   subtilase family, aspartic acid active site."
FT   CDS_pept        238275..238685
FT                   /transl_table=11
FT                   /gene="pcaC"
FT                   /locus_tag="BP0231"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /EC_number="4.1.1.44"
FT                   /note="Similar to Acinetobacter calcoaceticus
FT                   4-carboxymuconolactone decarboxylase PcaC SW:DC4C_ACICA
FT                   (P20370) (134 aa) fasta scores: E(): 1.2e-19, 43.333% id in
FT                   120 aa, and to Pseudomonas putida PcaC-like protein
FT                   TR:Q9WWZ5 (EMBL:AF031417) (130 aa) fasta scores: E():
FT                   2.7e-24, 55.556% id in 108 aa"
FT                   /db_xref="GOA:Q7W0B6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0B6"
FT                   /protein_id="CAE40611.1"
FT                   /translation="MALRPEFQTEQFQKGLAVRRAVVGDAYVDKSLNSADDLTASLQKL
FT                   VTEYCWGEVWTRPGLERKTRSFLNLAMLIALNRPNELRLHLRGAINNGVTKDEIVEVVL
FT                   QAAIYCGVPAALDAMKAVREVVETMEKEGAFA"
FT   misc_feature    238386..238646
FT                   /note="HMMPfam hit to PF02627, Carboxymuconolactone
FT                   decarboxylase"
FT   CDS_pept        join(238740..238847,238851..239690)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0232"
FT                   /product="probable oxidoreductase (Pseudogene)"
FT                   /note="Pseudogene. This CDS contains an in-frame TAA stop
FT                   codon. The sequence has been checked and believed to be
FT                   correct. Similar to Escherichia coli
FT                   2-hydroxy-3-oxopropionate reductase GarR or B3125
FT                   SW:GARR_ECOLI (P23523) (294 aa) fasta scores: E(): 5.1e-26,
FT                   34.164% id in 281 aa, and to Salmonella typhimurium
FT                   hypothetical oxidoreductase YihU TR:Q9L7S0 (EMBL:AF220438)
FT                   (298 aa) fasta scores: E(): 9.7e-45, 47.751% id in 289 aa"
FT                   /db_xref="PSEUDO:CAE40612.1"
FT   misc_feature    238761..238802
FT                   /note="ScanRegExp hit to PS00895, 3-hydroxyisobutyrate
FT                   dehydrogenase signature. Confirmed by InterPro eMOTIF
FT                   pattern match."
FT   variation       238848..238850
FT                   /note="TAA stop codon in pertussis; CAA in parapertussis"
FT   misc_feature    239319..239342
FT                   /note="ScanRegExp hit to PS00687, Aldehyde dehydrogenases
FT                   glutamic acid active site."
FT   CDS_pept        complement(239707..240450)
FT                   /transl_table=11
FT                   /locus_tag="BP0233"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="Similar to Rhizobium loti transcriptional regulator
FT                   Mll6786 TR:Q988D5 (EMBL:AP003010) (223 aa) fasta scores:
FT                   E(): 8.7e-21, 40.196% id in 204 aa, and to Deinococcus
FT                   radiodurans transcriptional regulator, GntR family Dr0815
FT                   TR:Q9RW54 (EMBL:AE001936) (267 aa) fasta scores: E():
FT                   2e-17, 38.839% id in 224 aa"
FT                   /db_xref="GOA:Q7W0B5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0B5"
FT                   /protein_id="CAE40613.1"
FT                   /translation="MPFPFCNTNRMTSPAAPEGEFKVQRVASVLRHSVTESIRNAILVG
FT                   RFRPGERLPERELCEMTGVSRTLVREALRQLESEGLIVVIPHRGPVVERLSPEQARGIY
FT                   QVREELEGLACQLFAEHATEPQLAALQEAFQALKRALTRGTPLEQIAAKNAFYQQLLDG
FT                   AGNEALTTTLRLLNSRVMLLRSTSMQAPGRAKHSVAELSNLLQALVARDGKAARKAGSL
FT                   HVRNAASVAIAILQDSLADAAATAE"
FT   misc_feature    complement(240175..240351)
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family"
FT   misc_feature    complement(240229..240294)
FT                   /note="Predicted helix-turn-helix motif with score 1104
FT                   (+2.95 SD) at aa 53-74, sequence LPERELCEMTGVSRTLVREALR"
FT   CDS_pept        complement(240494..241537)
FT                   /transl_table=11
FT                   /locus_tag="BP0234"
FT                   /product="putative solute-binding periplasmic protein"
FT                   /note="Similar to Rhodobacter capsulatus
FT                   C4-dicarboxylate-binding periplasmic protein precursor DctP
FT                   SW:DCTP_RHOCA (P37735) (333 aa) fasta scores: E(): 1.5e-08,
FT                   24.074% id in 324 aa, and to Rhizobium meliloti putative
FT                   ABC transporter periplasmic solute-binding protein Smb20036
FT                   TR:CAC48439 (EMBL:AL603642) (338 aa) fasta scores: E():
FT                   3.2e-09, 25.237% id in 317 aa"
FT                   /db_xref="GOA:Q7W0B4"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0B4"
FT                   /protein_id="CAE40614.1"
FT                   /translation="MSQRFPLPRGFQAALAAAALCTASWSGAAAAQTYDLTMAVITSPG
FT                   DGYSILTASVPERVAKATDGKVKVTVSDSLVPPAQIATAVREGRVDMSAALHTYLAADE
FT                   PRMGIFNLPGLINNIQEYKQVCDAFWCEDTRKIWKDKWNAIVLAEGAWCTQQLFSKDPI
FT                   HKVEDFKGKRLRVHNPQTAEVVNALGGKPVAMPTTEIFPALERGVIDGLFISTCVGGSL
FT                   EFWRIAKNVQNWSLGPINGWAILANPDSWQKLPADVQKQVQGAMDALQQEAFGNYDTFV
FT                   SNAQQEMMKKGVTFWVAPEEERAKLMQQQYIGPSYEAWNKRAKQVGFDGPAYLDRVRTT
FT                   LGKSASN"
FT   misc_feature    complement(241445..241537)
FT                   /note="Signal peptide predicted for BP0234 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.903 between residues 31 and 32"
FT   CDS_pept        241708..243810
FT                   /transl_table=11
FT                   /locus_tag="BP0235"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pasteurella multocida hypothetical
FT                   protein Pm1708 TR:Q9CKB6 (EMBL:AE006207) (634 aa) fasta
FT                   scores: E(): 7e-37, 27.192% id in 673 aa, and to
FT                   Haemophilus influenzae hypothetical protein Hi0147
FT                   SW:Y147_HAEIN (P44543) (633 aa) fasta scores: E(): 4.2e-36,
FT                   27.769% id in 641 aa"
FT                   /db_xref="GOA:Q7W0B3"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0B3"
FT                   /protein_id="CAE40615.1"
FT                   /translation="MSSIEMPAPVMPIEPAELAGASPYPLAIDQDFCLIRWMAAISRAC
FT                   GALATVALLLMALSMCYEIFSRYLFNAPTAWATEISGYLLVATVFFGLAAAQASNSHVQ
FT                   VELWIDRLSAPVRLRVELLCQWLALLFCVVLGWQMASFNVREYLNDTRDWGLLSTPQWM
FT                   PELAVSVGMVVFCMSILVDIYRLSPPAQAWRRWLTPALLALLAAALVALGANAVPMAAG
FT                   GRFDWGMALIVAALLACAWAWSGVRTLAHVVLVVGGCAVLYGLARGQSLGWVAFLLVAS
FT                   MMLLLFLGVRIGVALGLVGLFGVYFLLSRPQLSLLAERAWSSTNTFTLTAVPMFIFMGG
FT                   LLLRSGITAGMFDALVRWFGRAPGGLAHASAGASAVFAAVSGSSLATAATLGKVACPDM
FT                   IERGYSPRLTYGVAAAGATLGILIPPSIPMIIYGTTVGASVTHLFLAGMLPGLLLMACF
FT                   MLGALVWALAVPGSAPVARAYTLREKLSASRGMVPFVAIIGAVLGSMYTGVATPTEAAA
FT                   IGAVSAFVLCLVRRQLSWRALFEIAHDSAKVTALLLLIVVGAGIFSWVFDYLRLPREVV
FT                   NLIQGADLSPALIVAAMVLAYLVLGMFVESIAMMLMTLPVTYPIAMSLGLDPIWFGVFL
FT                   VLMIELGLITPPVGMVLFVLRSMNEKARFTDIIRGALPFVLIILLFLCLIYIYPQIVMW
FT                   LPQQVK"
FT   misc_feature    join(241837..241905,241933..242001,242059..242127,
FT                   242203..242271,242305..242373,242386..242439,
FT                   242452..242520,242563..242631,242668..242736,
FT                   242806..242874,242935..243003,243046..243114,
FT                   243175..243243,243349..243405,243466..243534,
FT                   243592..243660,243721..243789)
FT                   /note="17 probable transmembrane helices predicted for
FT                   BP0235 by TMHMM2.0 at aa 44-66, 76-98, 118-140, 166-188,
FT                   200-222, 227-244, 249-271, 286-308, 321-343, 367-389,
FT                   410-432, 447-469, 490-512, 548-566, 587-609, 629-651 and
FT                   672-694"
FT   CDS_pept        join(243807..244331,244331..245194)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0236"
FT                   /product="conserved hypothetical protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 175. The sequence has been checked
FT                   and believed to be correct. Similar to Pseudomonas
FT                   aeruginosa hypothetical protein Pa0881 TR:Q9I564
FT                   (EMBL:AE004522) (450 aa) fasta scores: E(): 6.3e-26,
FT                   30.752% id in 452 aa, and to Methanothermobacter
FT                   thermautotrophicus conserved protein Mth965 TR:O27046
FT                   (EMBL:AE000870) (452 aa) fasta scores: E(): 6.3e-22,
FT                   28.285% id in 449 aa"
FT                   /db_xref="PSEUDO:CAE40616.1"
FT   variation       244331..244333
FT                   /note="GCC in pertusssis; G(CTGGGCG)CC in parapertussis"
FT   misc_feature    244439..244483
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   CDS_pept        245221..246177
FT                   /transl_table=11
FT                   /locus_tag="BP0237"
FT                   /product="putative exported protein"
FT                   /note="Similar to Variovorax paradoxus 2,4-diphenoxyacetic
FT                   acid gene cluster TR:Q9RHQ7 (EMBL:AB028643) (337 aa) fasta
FT                   scores: E(): 5.4e-37, 39.048% id in 315 aa, and to
FT                   Rhizobium meliloti conserved hypothetical protein Sma1927
FT                   TR:AAK65716 (EMBL:AE007292) (330 aa) fasta scores: E():
FT                   1.7e-39, 37.898% id in 314 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0B2"
FT                   /protein_id="CAE40617.1"
FT                   /translation="MKKRIWGTLLAAAMTVGSGAAHAGYPDKAVRIVVPFAAGGGVDAL
FT                   ARPFAKELGDILGQSIVVENKPSNTGQIGATDVARAAADGYTLLLSSAAFATTPAFYPQ
FT                   VPYDPVKDFSPVMIMAAAPQVLVASNRFKAASLPDVLAQARQSDRINFALSASTGIQAL
FT                   ATAMLAGQGGVTFMTIPYKGAGAAFMDLISGEVDLMIDNPASSLVHVRAGKLRVLATTG
FT                   SKRMAILPDVPTVAETLPGFEARNWFVLAAPQGTPPAVIQKLNEASARALNTPAMRQML
FT                   ERDGIDLVADSPAHAAAFLQDEIAKWGKVVKEGNLQP"
FT   misc_feature    245221..245289
FT                   /note="Signal peptide predicted for BP0237 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 23 and 24"
FT   CDS_pept        complement(246196..246687)
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="BP0238"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridi
FT                   ne pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="Similar to Escherichia coli
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase FolK or B0142 SW:HPPK_ECOLI (P26281) (158
FT                   aa) fasta scores: E(): 3.4e-15, 38.854% id in 157 aa, and
FT                   to Pseudomonas fluorescens
FT                   7,8-dihydro-6-hydroxymethylpterin -pyrophosphokinase FolK
FT                   TR:Q9ZEP9 (EMBL:AJ130846) (133 aa) fasta scores: E():
FT                   1.1e-17, 52.101% id in 119 aa"
FT                   /db_xref="GOA:Q7W0B1"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0B1"
FT                   /protein_id="CAE40618.1"
FT                   /translation="MNGSPASTLAYVGLGASLGDAAATLRSVLAELAAAPGILACKASR
FT                   LYRTAPVEAQGPDFVNAVAALDTTLAPLDLLDLLQALEQRHGRERPYRNAPRTLDLDLL
FT                   LYGEQAIDHPRLSVPHPRMHERAFVLAPLCELVPALRLAQGDCAALLAALEDQAIEPLR
FT                   "
FT   misc_feature    complement(246277..246663)
FT                   /note="HMMPfam hit to PF01288,
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)"
FT   misc_feature    complement(246376..246411)
FT                   /note="ScanRegExp hit to PS00794,
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
FT                   signature."
FT   misc_feature    complement(246622..246687)
FT                   /note="Signal peptide predicted for BP0238 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.859) with cleavage site
FT                   probability 0.659 between residues 22 and 23"
FT   CDS_pept        complement(246684..248039)
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="BP0239"
FT                   /product="poly(A) polymerase"
FT                   /EC_number="2.7.7.19"
FT                   /note="Similar to Escherichia coli poly(A) polymerase PcnB
FT                   or B0143 SW:PCNB_ECOLI (P13685) (472 aa) fasta scores: E():
FT                   6e-64, 43.596% id in 445 aa, and to Pseudomonas aeruginosa
FT                   poly(A) polymerase PcnB or Pa4727 TR:Q9HV72 (EMBL:AE004886)
FT                   (467 aa) fasta scores: E(): 7.2e-77, 48.802% id in 459 aa"
FT                   /db_xref="GOA:Q7W0B0"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0B0"
FT                   /protein_id="CAE40619.1"
FT                   /translation="MITETIRKFVGRLFAPALRGPQRIGAERHGIDRRNVSRHAIKVCD
FT                   VLRQHGYEAYIVGGAVRDLIVGLEPKDFDVATNATPEQIRPLFRRARIIGRRFQLVHVV
FT                   FGQEIIETSTFRAPASDDQETDEHGRILRDNVFGSQEEDAARRDFTMNALYYDPHTEEV
FT                   IDYHQGVQDLKKRQVRIIGDPVKRYREDPVRMLRAVRFAAKLNGSIDTATRQPIRTMAS
FT                   LIENVPASRLFDEMLKLLTCGHAMDCLRQLRNDGLHHGLLPLLDVVLEQPGGENFVELA
FT                   LERTDARVRAGKTISPSFLFAALLWQLVDVRWKQLRAQGEHNIPALVQAADSVLDEQTE
FT                   KLAIQRRFSSDMREIWFMQPRFERRAGKTIYRMLEQPRFRAACDFLQLRAAAGEFDSVL
FT                   AQWWMDLANGDDATRAEMIEETAHLPRETGDAPAQKRRRPRRRPSNRPREPQ"
FT   misc_feature    complement(247158..247181)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    complement(247227..247706)
FT                   /note="HMMPfam hit to PF01743, Poly A polymerase family"
FT   CDS_pept        complement(248040..248738)
FT                   /transl_table=11
FT                   /locus_tag="BP0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa0335 TR:Q9I6F6 (EMBL:AE004471) (217 aa) fasta
FT                   scores: E(): 1e-33, 46.575% id in 219 aa, and to Neisseria
FT                   meningitidis hypothetical protein Nma1278 TR:Q9JUK0
FT                   (EMBL:AL162755) (222 aa) fasta scores: E(): 2e-31, 41.629%
FT                   id in 221 aa"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="PDB:3FVV"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0A9"
FT                   /protein_id="CAE40620.1"
FT                   /translation="MTTRRLALFDLDHTLLPLDSDYQWADFLARTGRAGDPAEARRRND
FT                   DLMERYNRGELTAEQAAEFMLGLLAAHSPVELAAWHEEFMRDVIRPSLTVQAVDVVRGH
FT                   LAAGDLCALVTATNSFVTAPIARAFGVQHLIATDPEYRDGRYTGRIEGTPSFREGKVVR
FT                   VNQWLAGMGLALGDFAESYFYSDSVNDVPLLEAVTRPIAANPSPGLREIAQARGWQVID
FT                   LFDHLEDAKS"
FT   CDS_pept        complement(248735..249436)
FT                   /transl_table=11
FT                   /locus_tag="BP0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Neisseria meningitidis hypothetical
FT                   protein Nma1279 TR:Q9JUJ9 (EMBL:AL162755) (243 aa) fasta
FT                   scores: E(): 1e-19, 35.470% id in 234 aa, and to
FT                   Escherichia coli hypothetical protein yfge YfgE or B2496 or
FT                   Z3759 or Ecs3358 SW:YFGE_ECOLI (P76570) (248 aa) fasta
FT                   scores: E(): 6.5e-15, 33.906% id in 233 aa"
FT                   /db_xref="GOA:Q7W0A8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR017788"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0A8"
FT                   /protein_id="CAE40621.1"
FT                   /translation="MNRQLLLDVLPAPAPALNNYIAGPNGQALAAAHALTAGRAIYLWG
FT                   PAGCGRTHLLRGLSARPEAIYIDAARAAQSLRELAEADSTAPMPRLVAVDDVHRMDDAR
FT                   QAGLFALYNRWRESAATGRAFALAVSGDRAPMSLPLREDLRTRLGWDLVFRLDPLSDAD
FT                   KLAALTAQAAERGLQLAPEVINWMLTHHERDIRKLAALLDALDRYSLATGRPITIPLLR
FT                   AMLADPHSQAT"
FT   CDS_pept        249689..250738
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /gene_synonym="purG"
FT                   /locus_tag="BP0242"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="Similar to Escherichia coli
FT                   phosphoribosylformylglycinamidine cyclo-ligase PurM or PurG
FT                   or B2499 SW:PUR5_ECOLI (P08178) (344 aa) fasta scores: E():
FT                   1.5e-71, 56.598% id in 341 aa, and to Neisseria
FT                   meningitidis putative phosphoribosylformylglycinamidine
FT                   cyclo-ligase PurM or Nma1421 TR:Q9JUA2 (EMBL:AL162755) (344
FT                   aa) fasta scores: E(): 1.4e-84, 67.151% id in 344 aa"
FT                   /db_xref="GOA:Q7W0A7"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0A7"
FT                   /protein_id="CAE40622.1"
FT                   /translation="MTNQHSAPLTYRDAGVDIDAGDALVDRIKPLAARTMRPGVLAGIG
FT                   GFGALFEVPKKFREPVLVSGTDGVGTKLRLAFDWNRHDTVGIDLVAMSVNDILVQGAEP
FT                   LYFLDYFACGKLSVDTAAAVVGGIARGCELAGCALIGGETAEMPGMYPDGEYDLAGFAV
FT                   GAVDKSAIIDGKSIQPGDVVLGLASSGAHSNGYSLVRKILERAGARPDQDFHGQPLVDV
FT                   VMAPTRIYVKQVLAALDRHGPAIKGLAHITGGGLLDNVPRILQPGMAAQLQRDGWEMPK
FT                   LFQWLQQQGSVADAEMHRVFNCGIGMVLVVAADQADAVAATLREQGEIVNRIGEIVPQQ
FT                   DGMAQTVVV"
FT   misc_feature    249794..250702
FT                   /note="HMMPfam hit to PF00586, AIR synthase related
FT                   protein, N-terminal domain"
FT   CDS_pept        complement(250844..251785)
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /gene_synonym="trpX"
FT                   /locus_tag="BP0243"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.8"
FT                   /note="Similar to Escherichia coli and Shigella flexneri
FT                   tRNA delta(2)-isopentenylpyrophosphate transferase MiaA or
FT                   TrpX or B4171 SW:MIAA_ECOLI (P16384) (316 aa) fasta scores:
FT                   E(): 1.6e-56, 54.839% id in 310 aa, and to Pseudomonas
FT                   aeruginosa tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase MiaA or Pa4945 TR:Q9HUL9 (EMBL:AE004907) (323
FT                   aa) fasta scores: E(): 8.8e-60, 57.419% id in 310 aa"
FT                   /db_xref="GOA:Q7U366"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7U366"
FT                   /protein_id="CAE40623.1"
FT                   /translation="MTPRAIICLAGPTAAGKSASTLALAQRWPLEIINVDSATIYRGMD
FT                   IGTAKPSAAERAQVPQHLLDIRDPAQSYSAAEFRADALRLIAEIHARGRIPLLAGGTML
FT                   YYKALREGLDDLPQADPALRAELEARAARLGWPALHAELALLDPATAARLSPNDSQRIQ
FT                   RALEICRLAGQPMSALLQGERRGDAPSPYRYVTLSLEPSERAALHARIAQRFDAMLAAG
FT                   LVEEVRGLHARPDLHPGLPSVRCVGYRQMWSYLDGDIDLDTAREQGVAATRQLAKRQLT
FT                   WLRAQPERVIIDCLAGDAVARTVDAMARALPD"
FT   misc_feature    complement(250901..251674)
FT                   /note="HMMPfam hit to PF01715, IPP transferase"
FT   misc_feature    complement(251711..251785)
FT                   /note="Signal peptide predicted for BP0243 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.996) with cleavage site
FT                   probability 0.522 between residues 25 and 26"
FT   misc_feature    complement(251732..251755)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        complement(251782..253671)
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="BP0244"
FT                   /product="DNA mismatch repair protein"
FT                   /note="Similar to Escherichia coli DNA mismatch repair
FT                   protein MutL or B4170 SW:MUTL_ECOLI (P23367) (615 aa) fasta
FT                   scores: E(): 4.4e-33, 39.350% id in 554 aa, and to
FT                   Pseudomonas aeruginosa DNA mismatch repair protein MutL or
FT                   Pa4946 TR:Q9HUL8 (EMBL:AE004907) (633 aa) fasta scores:
FT                   E(): 1.5e-81, 49.304% id in 647 aa"
FT                   /db_xref="GOA:Q7W0A6"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0A6"
FT                   /protein_id="CAE40624.1"
FT                   /translation="MSDRRPIATLPDLLISQIAAGEVIERPASVLKEILENAIDAGARA
FT                   IEVRLEGGGIRRIAVTDDGSGIPPEELPLALTRHATSKIRSLDELESVASMGFRGEALA
FT                   SIASVADLTIISRTRGAEHAWQIDGGSLQVSPASGPPGTTIDVRQLFDRVPARRKFLRS
FT                   EATEFGHCVDAMERIALAHPEVAFRLFHHDRAQRQWLPADHGQRIRDVLGAEFVGHVLP
FT                   VLAAAGAIALMGMVTRPTAARARADRQYLYVNGRFVRDRTVSHALRSAYADVLHGDRQP
FT                   AYVLYLDIDPGAVDVNVHPAKHEVRFRDSGAVHRFVSQVVGQTLAQTGGAEAVPAGVPD
FT                   GAAPDTAYAGEPAAAAPGLAEPRAPYPAAYPSPGQSPYQGSPARPHTQVPFRLHGEPAG
FT                   IPATDWQSLYRPLPGDAAPAATALRAAPATPLPTADEHPLGQALAQLHGIYILAQNSRG
FT                   LVLVDMHAAHERVVYEQLKRALDDRALPRQDLLVPVVFHAAEKDVALVEEHETQLNELG
FT                   FEMRPSGPASIAVRSVPALLARGDIESLARAVLRDLGAVGVSRLLTEQRNELLSTMACH
FT                   GSVRANRRLTLEEMNALLRQMEITERADQCNHGRPTWVQWSVNDLDKLFLRGQ"
FT   misc_feature    complement(251818..251883)
FT                   /note="Predicted helix-turn-helix motif with score 1054
FT                   (+2.78 SD) at aa 597-618, sequence MEITERADQCNHGRPTWVQWSV"
FT   misc_feature    complement(252718..253248)
FT                   /note="HMMPfam hit to PF01119, DNA mismatch repair protein"
FT   misc_feature    complement(253363..253383)
FT                   /note="ScanRegExp hit to PS00058, DNA mismatch repair
FT                   proteins mutL / hexB / PMS1 signature."
FT   misc_feature    complement(253423..253608)
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, phytochrome-like ATPase"
FT   CDS_pept        253758..254396
FT                   /transl_table=11
FT                   /gene="dedA"
FT                   /locus_tag="BP0245"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli Deda protein or B2317 or
FT                   Z3579 or Ecs3201 SW:DEDA_ECOLI (P09548) (219 aa) fasta
FT                   scores: E(): 6.7e-36, 51.485% id in 202 aa, and to
FT                   Burkholderia mallei DedA TR:Q9AI54 (EMBL:AF285636) (226 aa)
FT                   fasta scores: E(): 5.3e-51, 64.929% id in 211 aa"
FT                   /db_xref="GOA:Q7W0A5"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0A5"
FT                   /protein_id="CAE40625.1"
FT                   /translation="MLDFFNMVLHIDQTLGIWVEQYGVWVYLVLFLIVFAETGLVVLPF
FT                   LPGDSLLFIAGAFGATGHMDPVLTAALLIVAAISGNTVNYTIGRYIGPRVFSMNLRFLD
FT                   RNALMRTHAFYEKHGGKTIVMSRFIPVIRTFAPFVAGVADMRLARFQLFNIGGALLWVI
FT                   SLVAAGYFFGNIPLVREHLNTIVLIGLGAAIVPVVIGALVRLLQVRRGQ"
FT   misc_feature    join(253827..253895,253953..254021,254211..254279,
FT                   254307..254375)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BP0245 by TMHMM2.0 at aa 24-46, 66-88, 152-174 and 184-206"
FT   misc_feature    253839..254318
FT                   /note="HMMPfam hit to PF00597, DedA family"
FT   CDS_pept        complement(254539..255783)
FT                   /transl_table=11
FT                   /gene="amiC"
FT                   /locus_tag="BP0246"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="Similar to Escherichia coli
FT                   N-acetylmuramoyl-L-alanine amidase AmiC precursor or B2817
FT                   SW:AMIC_ECOLI (Q46929) (417 aa) fasta scores: E(): 8.8e-41,
FT                   50.608% id in 411 aa, and to Pseudomonas aeruginosa
FT                   N-acetylmuramoyl-L-alanine amidase AmiA or Pa5538 TR:Q9HT36
FT                   (EMBL:AE004966) (397 aa) fasta scores: E(): 1e-33, 41.667%
FT                   id in 408 aa"
FT                   /db_xref="GOA:Q7W0A4"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0A4"
FT                   /protein_id="CAE40626.1"
FT                   /translation="MRTWPADEYTRVTLELDSELKAEHFTLENPHRLVVDIEGLSVNAA
FT                   LNDLVSKVRHDDPYIQGLRVAQNRPNVVRLVFDLKQSVAPQVFTLKPVADYQYRLVLDL
FT                   YPKVAQDPLMAILNKQSGPDVDDPLARVLDEIARNQPAPDQPAAPLARGQEPAPALPAP
FT                   PIKPLPAPGRSASRKRMLTIALDPGHGGEDPGAIGRSGLREKDVVLRIARRLKTLIDAQ
FT                   PYMRAYLTRDDDYFVPLHVRVQKARRVRADLFVSIHADAFIKPTANGSSVFALSERGAS
FT                   STQARWLADKENAADLIGGVNLGSHDRQVAKVLLDLSTTAQINDSLKVGSAFLDEIKKI
FT                   NRLHKNRVEQAGFAVLKAPDIPSILVETAFISNPKEEALLRSAAHQEKLAQAMMTGIDR
FT                   YFTANPPLARVGDVS"
FT   misc_feature    complement(254578..255057)
FT                   /note="HMMPfam hit to PF01520, N-acetylmuramoyl-L-alanine
FT                   amidase"
FT   CDS_pept        complement(255855..256391)
FT                   /transl_table=11
FT                   /locus_tag="BP0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YjeE or B4168 or Z5775 or Ecs5144 SW:YJEE_ECOLI (P31805)
FT                   (153 aa) fasta scores: E(): 1.6e-19, 44.218% id in 147 aa,
FT                   and to Neisseria meningitidis hypothetical protein Nmb0457
FT                   TR:Q9K0V2 (EMBL:AE002401) (153 aa) fasta scores: E():
FT                   8.7e-18, 44.375% id in 160 aa"
FT                   /db_xref="GOA:Q7W0A3"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0A3"
FT                   /protein_id="CAE40627.1"
FT                   /translation="MSAPPTTLCLHLPDEAATENLARQLAPLVDGRRGGQPGGQIHLQG
FT                   DLGAGKTAFTRALLRECGIQGRIKSPSYALLESYKVSNLYFYHLDFYRFSDSREWLDAG
FT                   FRDLLRDDAVVLIEWPERAAGLLPPPDLLISLAYADQGRDASLTAHTARGQTWLNAIVP
FT                   PPTARSLPAPPPADA"
FT   misc_feature    complement(255954..256340)
FT                   /note="HMMPfam hit to PF02367, Uncharacterised P-loop
FT                   hydrolase UPF0079"
FT   misc_feature    complement(256236..256259)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        256543..257934
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="BP0248"
FT                   /product="fumarate hydratase class II"
FT                   /EC_number="4.2.1.2"
FT                   /note="Similar to Escherichia coli fumarate hydratase class
FT                   II FumC or B1611 SW:FUMC_ECOLI (P05042) (467 aa) fasta
FT                   scores: E(): 4.8e-121, 71.522% id in 460 aa, and to
FT                   Myxococcus xanthus fumarate hydratase Fhy TR:P95331
FT                   (EMBL:AF013216) (466 aa) fasta scores: E(): 1e-119, 70.370%
FT                   id in 459 aa"
FT                   /db_xref="GOA:Q7W0A2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W0A2"
FT                   /protein_id="CAE40628.1"
FT                   /translation="MKTRTEKDTFGPIEVPEQHLWGAQTQRSLHFFAISTEKMPVPLVA
FT                   AMARLKRAAAKVNAELGELDPQVADAIMRAADEVIAGKWPDEFPLSVWQTGSGTQSNMN
FT                   MNEVLANRASELLGGERGEGRKVHPNDHVNRGQSSNDTFPTAMHVAAAVEVEHRVLPAL
FT                   KALRGTLAAKSAAFYDIVKIGRTHLQDATPLTLGQEISGYVAQLDLAEQQIRATLAGLH
FT                   QLAIGGTAVGTGLNAHPQFSAKVSAELAHDTGSAFVSAPNKFQALASHEALLFAHGALK
FT                   TLAAGLMKIANDVRWLASGPRSGLGEISIPENEPGSSIMPGKVNPTQCEAVTMLAAQVM
FT                   GNDVAINVGGASGNFELNVFKPLVIHNFLQSVRLLADGMVSFDKHCAAGIEPNRERITE
FT                   LVERSLMLVTALNPHIGYDKAAQIAKKAHKENLSLKEAALALGHLTEAQFAEWVVPGDM
FT                   TNARR"
FT   misc_feature    256573..257910
FT                   /note="HMMPfam hit to PF00206, Lyase"
FT   misc_feature    257488..257517
FT                   /note="ScanRegExp hit to PS00163, Fumarate lyases
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        complement(257951..258931)
FT                   /transl_table=11
FT                   /locus_tag="BP0249"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa5466 TR:Q9HTA4 (EMBL:AE004959) (314 aa) fasta
FT                   scores: E(): 1.1e-31, 43.189% id in 301 aa, and to
FT                   Rhizobium meliloti hypothetical transmembrane protein
FT                   Smc01358 TR:CAC45885 (EMBL:AL591786) (311 aa) fasta scores:
FT                   E(): 3.2e-19, 31.922% id in 307 aa"
FT                   /db_xref="GOA:Q7W0A1"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0A1"
FT                   /protein_id="CAE40629.1"
FT                   /translation="MSENSSLRRDAEAPLLSIFLPGSMSVALLVLPDFMLVALGWALRH
FT                   KLGFSREFFAGTERMVYFVLFPALLFQSILRTPISAGHAMQLLQATAALMACGVALAWL
FT                   AGPVLRPAPVALASAAQCGYRFNTYIGLALAASLAGGPGQTIMALIVGFAVPMANVAAV
FT                   YGLARHSGNGLLRELARNPLLVSTLLSLACNLAGLSLPGPIDTVMARLGAAALALGIMC
FT                   VGASLAWEGGKGHGRLIGWMLAVKLAAMPSAALGIAWALGLPALETRMLVLFSALPTAS
FT                   AAYVLAMRMGGDGRMVAVLISLGTLASAATIPLWLTAAAGLGAPN"
FT   misc_feature    complement(join(257975..258040,258056..258121,
FT                   258152..258217,258245..258310,258326..258391,
FT                   258431..258496,258605..258670,258710..258766,
FT                   258827..258892))
FT                   /note="9 probable transmembrane helices predicted for
FT                   BP0249 by TMHMM2.0 at aa 13-35, 55-74, 87-109, 145-167,
FT                   180-202, 207-229, 238-260, 270-292 and 297-319"
FT   CDS_pept        259067..260050
FT                   /transl_table=11
FT                   /locus_tag="BP0250"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti conserved hypothetical
FT                   protein Sma1927 TR:AAK65716 (EMBL:AE007292) (330 aa) fasta
FT                   scores: E(): 1.1e-49, 44.207% id in 328 aa, and to
FT                   Comamonas testosteroni OrfJ protein TR:Q9RHM9
FT                   (EMBL:AB029044) (326 aa) fasta scores: E(): 1.3e-40,
FT                   39.752% id in 322 aa."
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="PDB:2DVZ"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W0A0"
FT                   /protein_id="CAE40630.1"
FT                   /translation="MNKVRTLVQAIAVATGLVAAAGAQAADAYPSKAIRVIVPFAPGGS
FT                   TDIIARLVTQRMSQELGQPMVVENKGGAGGAIGASEAARAEPDGYTLSIATVSTMAVNP
FT                   ACRPKDLPYDPIKDFQPVTNFANTANVVAVNPKFPAKDFKGFLEELKKNPGKYSYGSSG
FT                   TCGVLHLMGESFKMATGTDIVHVPYKGSGPAVADAVGGQIELIFDNLPSSMPQIQAGKL
FT                   RAMAIAWPTRIDAIKDVPTFADAGFPVLNQPVWYGLLAPKGTPMDVVNKLRDAAVVALK
FT                   DPKVIKALDDQGSAPSGNTPEEFAKEIKEQYDWAQDVVKKQNIKLD"
FT   misc_feature    259067..259141
FT                   /note="Signal peptide predicted for BP0254 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.968 between residues 25 and 26"
FT   CDS_pept        complement(260115..261014)
FT                   /transl_table=11
FT                   /locus_tag="BP0251"
FT                   /product="LysR family transcriptional regulator"
FT                   /note="Similar to Escherichia coli transcriptional
FT                   activator protein LysR or B2839 SW:LYSR_ECOLI (P03030) (311
FT                   aa) fasta scores: E(): 5.5e-19, 32.155% id in 283 aa, and
FT                   to Rhizobium loti transcriptional regulator Mlr7023
FT                   TR:Q987J8 (EMBL:AP003010) (301 aa) fasta scores: E():
FT                   1.7e-21, 34.237% id in 295 aa"
FT                   /db_xref="GOA:Q7W099"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W099"
FT                   /protein_id="CAE40631.1"
FT                   /translation="MRLRHIEIFEAIRRTGSLTEAAAALHISQPAASKLLAHAEAQLGF
FT                   KLFERVKGRLVATREAEILAPEVARLNQDLGSVRRLAASLRDRPHGHLRLGCAPALGLG
FT                   LLPGVVRASRDAQPGITFDIHTHHSAELVQGLLAHELDLAITFDANNHPGLTRTSLGHT
FT                   ELVHLSRLPGAGTTRLQELGGETLIVLDARDASGSLLQMALDAQGLAPRVAIQVQTHYV
FT                   ACALAEAGCGDAVVDAITARAMLRPGMALRRLEPALRVPISVMTRSQDALSTLHHDFIE
FT                   RLRQACSVLQAQPAPQPE"
FT   misc_feature    complement(260580..261008)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    complement(260904..260969)
FT                   /note="Predicted helix-turn-helix motif with score 1762
FT                   (+5.19 SD) at aa 16-37, sequence GSLTEAAAALHISQPAASKLLA"
FT   CDS_pept        261121..262875
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="BP0252"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /EC_number="2.3.2.2"
FT                   /note="Similar to Escherichia coli
FT                   gamma-glutamyltranspeptidase precursor Ggt or B3447
FT                   SW:GGT_ECOLI (P18956) (580 aa) fasta scores: E(): 1.6e-52,
FT                   35.484% id in 589 aa, and to Vibrio cholerae
FT                   gamma-glutamyltranspeptidase Vc0194 TR:Q9KVF2
FT                   (EMBL:AE004109) (588 aa) fasta scores: E(): 5e-98, 49.206%
FT                   id in 567 aa"
FT                   /db_xref="GOA:Q7W098"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W098"
FT                   /protein_id="CAE40632.1"
FT                   /translation="MPLRTLLAALCAAAICQAPAWAREAPGVAREDVNPEIASARSERA
FT                   QAHAQRYMIATANPLASEAGYRILRAGGSATDAIIAAQLVLNLVEPQSSGIGGGAFMVH
FT                   YDRGAGELRVYDSRETAPAAARPDRFLREGKPLSYAESVNNGRAVGTPGLLRGLELAHR
FT                   QHGKLPWQALFEPAIAMAEQGFAVSPRLHESIAGDKALAAQPAAARYFYGPDGQAWPVG
FT                   HRLRNPEFAATLRSIAREGADAFYRGPIARDIVAAVRAHPTPGDLAEADLAGYRAVVRE
FT                   PVCGLYRGYRLCGAPPPSSGPLAVLQMLGELEQYPLARMRPGSVEAVHYFSEAGRLAFA
FT                   DRDFYVADPAFVDVPVRALLDPAYLRQRGALIRPDRSMKTALPGDPQGLLAERARDDAI
FT                   EVPSTSHLVAVDAAGNVVSMTSTIEAAFGSKIFVRGFLLNNEMTDFSSSYRDPEGRLVA
FT                   NRVEPGKRPRSSMAPMIVFRAGKPVLALGSPGGSAIINYVAKTLVGVLDWKLDVQQAIA
FT                   LPNLGSRNKETELERGTALEALAPALRRMGHEVRITDFPSGIQGIVIGPHGLAGGADPR
FT                   REGLALGD"
FT   misc_feature    261121..261186
FT                   /note="Signal peptide predicted for BP0252 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 22 and 23"
FT   misc_feature    261316..262860
FT                   /note="HMMPfam hit to PF01019,
FT                   Gamma-glutamyltranspeptidase"
FT   CDS_pept        complement(262883..264007)
FT                   /transl_table=11
FT                   /locus_tag="BP0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa3592 TR:Q9HY34 (EMBL:AE004779) (395 aa) fasta
FT                   scores: E(): 1.4e-94, 68.144% id in 361 aa, and to
FT                   Rhizobium meliloti putative conserved membrane-anchored
FT                   protein Smb21182 TR:CAC49248 (EMBL:AL603645) (394 aa) fasta
FT                   scores: E(): 7.2e-57, 44.986% id in 369 aa"
FT                   /db_xref="GOA:Q7W097"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W097"
FT                   /protein_id="CAE40633.1"
FT                   /translation="MAVAALPPGALQGCRVIDLSRVLGGPYCTQILADHGADVLKIEPP
FT                   GGDETRGWGPPFSGQTASYFIGVNRNKRGMALDLSQPAGQELLRGLLADADVLVENFKP
FT                   GTLEKWGLGYDTLSQAFPRLVHCRVSGFGADGPLGGLPGYDACAQAMCGLMSVNGEADG
FT                   PATRVGLPVVDMVTGLNAAVAVLLALQERQRSGLGQFLDITLYDCALSLLHPHAPNYFY
FT                   SGRVPTRTGNAHPNIAPYKTLPTGAGPIFLAVGNNRQFAALADALGAPQLAQDARFASN
FT                   AERLAHRDALCAALTELLRPHEAASLAERLLRLGVPAAAVLDVAQALDHPHARHRGMLL
FT                   EAGDYRGIASPIKLSRTPARLRSVPPALQEPAGA"
FT   misc_feature    complement(263216..263785)
FT                   /note="HMMPfam hit to PF02515, CAIB/BAIF family"
FT   CDS_pept        complement(264021..265001)
FT                   /transl_table=11
FT                   /locus_tag="BP0254"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti conserved hypothetical
FT                   protein Sma1927 TR:AAK65716 (EMBL:AE007292) (330 aa) fasta
FT                   scores: E(): 5.2e-48, 45.122% id in 328 aa, and to
FT                   Comamonas testosteroni OrfJ protein TR:Q9RHM9
FT                   (EMBL:AB029044) (326 aa) fasta scores: E(): 4.8e-44,
FT                   43.750% id in 320 aa."
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W096"
FT                   /protein_id="CAE40634.1"
FT                   /translation="MQQLIRSLVLAAGLALLGGAAAPALADYPDRPVTLVVPFPPGGPT
FT                   DAMARRLAEGLKTQLDQTVVVENRGGAGGNIGAELVAHAKPDGYTLLFGTSGPLAINIS
FT                   LYKKQNYDPRTSFAPIVRIGHLPNILVVHPSVPANNVQELIAYAKANPDKLSYASSGNG
FT                   ASSHLAGVLFNRMAGTRILHVSYKGTGPALNDLLGGQVSMSFTDILTALPHIQAGKLKA
FT                   IGLASAQRSQALPELPTIAEQGLAGYDVSVFFGIVAPKGTPDAIVQKLNAAFIAALDAP
FT                   EVRDTLRKQGIVPAPERTPQALAGFINEEVDKWGELIRAAQISLD"
FT   misc_feature    complement(264924..265001)
FT                   /note="Signal peptide predicted for BP0254 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.989 between residues 26 and 27"
FT   CDS_pept        complement(265037..265630)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0255"
FT                   /product="C-terminal region of a putative oxidoreductase
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. This CDS is the C-terminal region of
FT                   BP3256. Similar to the C-terminal region of Pseudomonas
FT                   aeruginosa probable acyl-CoA dehydrogenase Pa3593 TR:Q9HY33
FT                   (EMBL:AE004779) (575 aa) fasta scores: E(): 2.5e-31,
FT                   55.556% id in 198 aa, and to Mycobacterium tuberculosis
FT                   CDC1551 putative acyl-CoA dehydrogenase Mt3904 TR:AAK48270
FT                   (EMBL:AE007184) (593 aa) fasta scores: E(): 1.2e-09,
FT                   34.973% id in 183 aa"
FT   misc_feature    complement(265403..265633)
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal domain"
FT   misc_feature    complement(265463..265522)
FT                   /note="ScanRegExp hit to PS00073, Acyl-CoA dehydrogenases
FT                   signature 2. Confirmed by InterPro eMOTIF pattern match."
FT   repeat_region   265630..265661
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   265630..266682
FT   CDS_pept        265732..266682
FT                   /transl_table=11
FT                   /locus_tag="BP0256"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA3"
FT                   /protein_id="CAE40636.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   misc_feature    265990..266055
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    266113..266646
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(266651..266682)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        266682..267068
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0257"
FT                   /product="C-terminal region of TonB dependent receptor
FT                   protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. This is the C-terminal region of BP0703.
FT                   Similar to the C-terminal region of Pseudomonas spBG33R
FT                   ferrisiderophore receptor-like protein TR:Q9RC04
FT                   (EMBL:AF153707) (691 aa) fasta scores: E(): 1.4e-26,
FT                   55.645% id in 124 aa, and to Neisseria meningitidis
FT                   putative siderophore receptor FhuA TR:Q9JPK1
FT                   (EMBL:AJ391270) (703 aa) fasta scores: E(): 4.9e-09,
FT                   35.156% id in 128 aa"
FT   misc_feature    266760..267065
FT                   /note="HMMPfam hit to PF00593, TonB dependent receptor
FT                   C-terminal region"
FT   misc_feature    267012..267065
FT                   /note="ScanRegExp hit to PS01156, TonB-dependent receptor
FT                   proteins signature 2."
FT   CDS_pept        267242..267787
FT                   /transl_table=11
FT                   /locus_tag="BP0258"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Agrobacterium tumefaciens Agr_l_1535p
FT                   TR:AAK89343 (EMBL:AE008274) (214 aa) fasta scores: E():
FT                   7.4e-40, 62.941% id in 170 aa, and to Methanococcus
FT                   jannaschii hypothetical protein Mj1563 SW:YF63_METJA
FT                   (Q58958) (152 aa) fasta scores: E(): 2.8e-06, 30.935% id in
FT                   139 aa"
FT                   /db_xref="GOA:Q7W095"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W095"
FT                   /protein_id="CAE40638.1"
FT                   /translation="MALSPQTERFVLHFGEMGSRWGVNRTVGQIYALLFLSPKALHADD
FT                   IAEALGFSRSNVSMGLKELQSWRLVKLMHQVGDRRDYFETPKDVWEIFRILMEEKRKRE
FT                   IDPTLTLLRDTLLERPADEAQVYAQQRMHEMLELIELSTGWFDEVQRLPPETLQNLMKL
FT                   GSKVQKVLGFAGKLRGKD"
FT   misc_feature    267362..267427
FT                   /note="Predicted helix-turn-helix motif with score 1256
FT                   (+3.46 SD) at aa 41-62, sequence LHADDIAEALGFSRSNVSMGLK"
FT   CDS_pept        267871..269490
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /gene_synonym="cyd-1"
FT                   /locus_tag="BP0259"
FT                   /product="cytochrome D ubiquinol oxidase subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /note="Similar to Escherichia coli cytochrome D ubiquinol
FT                   oxidase subunit I CydA or Cyd-1 or B0733 SW:CYDA_ECOLI
FT                   (P11026) (522 aa) fasta scores: E(): 1.8e-121, 60.980% id
FT                   in 510 aa, and to Vibrio cholerae cytochrome D ubiquinol
FT                   oxidase subunit I Vc1844 TR:Q9KR03 (EMBL:AE004260) (541 aa)
FT                   fasta scores: E(): 1.7e-122, 60.148% id in 542 aa"
FT                   /db_xref="GOA:Q7W094"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W094"
FT                   /protein_id="CAE40639.1"
FT                   /translation="MSAVRAGLPSGSVSMIDLDVVNLSRFQFAATALYHFLFVPLTLGL
FT                   SFILAIMESVYVMTGRQIWKRMTMFWGTLFGINFALGVATGVAMEFQFGMNWSYYSHYV
FT                   GDIFGAPLALEGLMAFFLEATFVGLFFFGWNRLSKVGHLVVTWLVAFGTNFSALWILIA
FT                   NGWMQNPVGAMFNPDTMRMEMTDFAAVLLNPVAQAKFVHTVSAGYVAGAMFVMSISAWY
FT                   LLKGRHIDLAKRSMAVAASFGLASALSVVVLGDESGYLTTEHQKMKIAAIEAMWHTEPA
FT                   PASFNLIAIPNQEERRNEFAISIPYVMGLIGTRSLTTPLLGIDDLVRRAEVRIREGITA
FT                   YEALQRVRANPKDVDARMLFERTWPDLGYALLVKRYQPDLSKATDEQIAQAALDTVPNV
FT                   APLFWAFRVMVAVGFYLILFFGVAFWLASRGRLDSRPGLLKVALWSLPLPWVAIESGWF
FT                   VAEYGRQPWVIEGVLPTYYAASGLTITDLAISLAIFLVLYTVLLVIGVKVMLHAVKAGP
FT                   KGEASEPAGRRADPVQAAVDAY"
FT   misc_feature    267937..269442
FT                   /note="HMMPfam hit to PF01654, Bacterial Cytochrome
FT                   Ubiquinol Oxidase"
FT   misc_feature    join(267952..268020,268078..268146,268204..268272,
FT                   268291..268359,268474..268542,268579..268632,
FT                   269077..269145,269182..269250,269320..269388)
FT                   /note="9 probable transmembrane helices predicted for
FT                   BP0259 by TMHMM2.0 at aa 28-50, 70-92, 112-134, 141-163,
FT                   202-224, 237-254, 403-425, 438-460 and 484-506"
FT   misc_feature    269101..269148
FT                   /note="ScanRegExp hit to PS00225, Crystallins beta and
FT                   gamma 'Greek key' motif signature."
FT   CDS_pept        269506..270660
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /gene_synonym="cyd-2"
FT                   /locus_tag="BP0260"
FT                   /product="cytochrome D ubiquinol oxidase subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /note="Similar to Escherichia coli cytochrome D ubiquinol
FT                   oxidase subunit II CydB or Cyd-2 or B0734 or Z0901 or
FT                   Ecs0769 SW:CYDB_ECOLI (P11027) (379 aa) fasta scores: E():
FT                   4.5e-71, 50.529% id in 378 aa, and to Brucella abortus
FT                   cytochrome D oxidase subunit II CydB TR:Q9FDD0
FT                   (EMBL:AF284438) (384 aa) fasta scores: E(): 1.6e-78,
FT                   55.789% id in 380 aa."
FT                   /db_xref="GOA:Q7W093"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W093"
FT                   /protein_id="CAE40640.1"
FT                   /translation="MDSLIPFDYATLRVLWWLLLGALLIGFAVMDGFDLGVAALLPLVA
FT                   KTDVERRVVLNVVGPVWEGNQVWLITAGGAIFAAWPLLYAASFSGFYLAMMLVLIALIL
FT                   RPVGFKYRSKMEGTRWRSRWDAVLCFCGVVAALVFGVAMGNIILGVPFGFDAATLRPEY
FT                   EGHFYQLFKPFALLAGLVSVAMMVMHGGVLLAWRTHDPVSSRARNWGRLAALATAALFV
FT                   AGGFWVAYGLDGHVITSAVDMHAPSNPMLKTVELQAGGWMANYEKWPLTWIAPALGVGG
FT                   ALLAFVLLSARANVLAFLASSVSIAGIILTVGFALFPFIMPSSSRPGAGLTVWDGSSSL
FT                   LTLWIMLLAVAFFLPIITVYTAWVYRVMRGKVTEDSVDGTPNSY"
FT   misc_feature    269533..270624
FT                   /note="HMMPfam hit to PF02322, Cytochrome oxidase subunit
FT                   II"
FT   misc_feature    join(269542..269595,269752..269820,269881..269949,
FT                   270025..270093,270130..270198,270310..270378,
FT                   270397..270465,270523..270591)
FT                   /note="8 probable transmembrane helices predicted for
FT                   BP0260 by TMHMM2.0 at aa 13-30, 83-105, 126-148, 174-196,
FT                   209-231, 269-291, 298-320 and 340-362"
FT   CDS_pept        270674..270799
FT                   /transl_table=11
FT                   /locus_tag="BP0261"
FT                   /product="putative exported protein"
FT                   /note="Similar to Escherichia coli protein YbgT or B0734.1
FT                   SW:YBGT_ECOLI (P56100) (37 aa) fasta scores: E(): 0.00014,
FT                   56.250% id in 32 aa, and to Vibrio cholerae hypothetical
FT                   protein Vc1842 TR:Q9KR05 (EMBL:AE004260) (35 aa) fasta
FT                   scores: E(): 1.3e-07, 63.636% id in 33 aa"
FT                   /db_xref="GOA:Q7W092"
FT                   /db_xref="InterPro:IPR011724"
FT                   /db_xref="InterPro:IPR012994"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W092"
FT                   /protein_id="CAE40641.1"
FT                   /translation="MWYFSWILGLSLACAFGILNAMWFELREGHAHDPYKKPADE"
FT   misc_feature    270674..270736
FT                   /note="Signal peptide predicted for BP0261 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.954) with cleavage site
FT                   probability 0.819 between residues 21 and 22"
FT   misc_feature    270677..270745
FT                   /note="1 probable transmembrane helix predicted for BP0261
FT                   by TMHMM2.0 at aa 2-24"
FT   CDS_pept        270796..272547
FT                   /transl_table=11
FT                   /locus_tag="BP0262"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /note="Similar to Escherichia coli transport ATP-binding
FT                   protein CydD or HtrD or B0887 SW:CYDD_ECOLI (P29018) (588
FT                   aa) fasta scores: E(): 1.9e-57, 38.529% id in 571 aa, and
FT                   to Shewanella sp barophilic bacterium DNA for pressure
FT                   regulated cluster CydD TR:P96012 (EMBL:D88785) (601 aa)
FT                   fasta scores: E(): 7.7e-53, 37.367% id in 562 aa"
FT                   /db_xref="GOA:Q7W091"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W091"
FT                   /protein_id="CAE40642.1"
FT                   /translation="MSGASGIEHDPAAALNKPPREHSRWLAMRARAARVPLAVAGAAPL
FT                   IGGVLLVIQAWLLARVLDQAIVQGAARAELATSIVAISALMLARAALAWLGERAGAAAA
FT                   ERIKRQVREALFARLLALGPQWSRQRASGELASAMVEQVEALDAFFAKYLPAMGAAAVL
FT                   PVAFAVVVLPVDVITGLLLLVSAPLIPLFMALVGWGAEAASRRHLQAFARLSGFFADRL
FT                   RGLATLKLYGRAEAEEQSVVAASDALRQRTMAVLRIAFLSSAVLEFFAAQGVAGVAVYI
FT                   GLTYLGFLDVRASVLTLQGGFFCLLLAPEVYGPLRQFAAHYHDRAAARAAVAQIARTFD
FT                   GLPSPGVEPAPPAQAPALARGAARLAASGLTVTQPGRPAPVLREAALQLDAGAHVALRG
FT                   ASGAGKTTLLELLARLRDGAGAIALDGVPLADWDEAALRERVVLIGQRPYLYAGSIADN
FT                   IRLARPGASAALVEEAARRACVMEFAQALPRGLDTPLGSRGHGLSGGQAQRVALARLFL
FT                   RDPGLILLDEPAAHLDAATQARVLDEVLAFAQGRTLLLATHADAVARRLPRQWMLEQGR
FT                   LRELQPA"
FT   misc_feature    join(270904..270972,271015..271083,271240..271308,
FT                   271321..271389,271570..271638)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BP0262 by TMHMM2.0 at aa 37-59, 74-96, 149-171, 176-198 and
FT                   259-281"
FT   misc_feature    270904..271713
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region."
FT   misc_feature    271969..272520
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    271990..272013
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    272299..272343
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        272544..274223
FT                   /transl_table=11
FT                   /locus_tag="BP0263"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /note="Similar to Escherichia coli transport ATP-binding
FT                   protein CydC or MdrA or MdrH or SurB or B0886 SW:CYDC_ECOLI
FT                   (P23886) (573 aa) fasta scores: E(): 5.4e-45, 34.535% id in
FT                   527 aa, and to Vibrio cholerae transport ATP-binding
FT                   protein CydC or Vc1180 TR:Q9KSS6 (EMBL:AE004198) (573 aa)
FT                   fasta scores: E(): 1.3e-48, 35.818% id in 550 aa"
FT                   /db_xref="GOA:Q7W090"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W090"
FT                   /protein_id="CAE40643.1"
FT                   /translation="MSLWRLLFRLYARRKGALALALALSLLTVAAGVGLLGVSGWFLTG
FT                   AALAGAGAVFNLFVPSSLVRGLSFIRIASRYGERLAGHAATLRLLADLRASVFRSLVRL
FT                   TPRQLARYRGGDLVARLTSDVDALDTVFLFVLAPVAVALAGGAILTAVMGAWIPAAALV
FT                   VAAALLLCCAVAPWWLARAGRRPGAAVQESAAALRAATLDAVEGHADIAALHAGAQARA
FT                   QFADACEQSARARAAQVRIAARGQWLAQLAAGAAVLAVLWFGLDGLAAGELGGPLLAGL
FT                   LLATIGIFEVAGPVMRGVSRLGAAVAAAARIGEIAAREPDLRDPAAPRALPPAGELALE
FT                   DVTFAYPVPDAAPHPVLDGASLRVAPGQRVAIVGASGAGKSTVLQLLLRLEDPQRGAVR
FT                   YAGCDVRECAQAELHRRVALLSQDAPLLLGTVRTNLLIGDAQADDAALWRALDAARLGE
FT                   VVRGLPHGLDTWIGETGAGLSAGQARRLCLARALLTGASAILLDEPTAGLDAATEAELL
FT                   ADLARATQGRTVVLATHARLPPGTVDTVYTLQAGRLHRAAPM"
FT   misc_feature    272544..272690
FT                   /note="Signal peptide predicted for BP0263 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.716 between residues 49 and 50"
FT   misc_feature    272595..273428
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region."
FT   misc_feature    join(272601..272669,272682..272750,272934..273002,
FT                   273012..273080,273264..273332,273360..273428)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP0263 by TMHMM2.0 at aa 20-42, 47-69, 131-153, 157-179,
FT                   241-263 and 273-295"
FT   misc_feature    273642..274196
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    273663..273686
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    273975..274019
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   CDS_pept        274286..274834
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="BP0264"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="Similar to Escherichia coli adenine
FT                   phosphoribosyltransferase Apt or B0469 SW:APT_ECOLI
FT                   (P07672) (183 aa) fasta scores: E(): 1.4e-28, 45.349% id in
FT                   172 aa, and to Neisseria meningitidis adenine
FT                   phosphoribosyltransferase Nmb1662 TR:Q9JYB4 (EMBL:AE002517)
FT                   (188 aa) fasta scores: E(): 1.2e-39, 60.355% id in 169 aa"
FT                   /db_xref="GOA:Q7W089"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W089"
FT                   /protein_id="CAE40644.1"
FT                   /translation="MQTDYAELVRRTIRSVPDWPTPGVTFRDITPVLQDPRTFRVLIDL
FT                   FVYRYMRQRLDLVAGVDARGFIVGAVLAHELNLGFVPVRKKSKLPYRTVAEEYSLEYGN
FT                   AAVEMHTDSVRTGQRVLLVDDLIDTGGTMLAAIKLLQRLGANVVEAAAIIDLPYLGGSA
FT                   QITATGTPLYTVCQYQEGD"
FT   misc_feature    274355..274822
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain"
FT   misc_feature    274643..274681
FT                   /note="ScanRegExp hit to PS00103, Purine/pyrimidine
FT                   phosphoribosyl transferases signature. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   CDS_pept        complement(join(274847..274978,274978..275733))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0265"
FT                   /product="probable LysR-family transcriptional regulator
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 252. The sequence has been checked
FT                   and believed to be correct. Similar to Rhizobium meliloti
FT                   putative LysR-family transcriptional regulator Sma1602
FT                   TR:AAK65531 (EMBL:AE007274) (302 aa) fasta scores: E():
FT                   2e-48, 47.959% id in 294 aa, and to Pseudomonas aeruginosa
FT                   probable transcriptional regulator Pa3135 TR:Q9HZ90
FT                   (EMBL:AE004737) (306 aa) fasta scores: E(): 3.5e-32,
FT                   39.041% id in 292 aa. Also similar to BP3239, 49.329%
FT                   identity (50.690% ungapped) in 298 aa overlap."
FT                   /db_xref="PSEUDO:CAE40645.1"
FT   variation       complement(274975..274978)
FT                   /note="GGCC in pertussis; (GGCG)GGCC in parapertussis and
FT                   bronchiseptica"
FT   misc_feature    complement(275302..275721)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    complement(275587..275679)
FT                   /note="ScanRegExp hit to PS00044, Bacterial regulatory
FT                   proteins, lysR family signature."
FT   misc_feature    275965..276048
FT                   /note="Signal peptide predicted for BP0266 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.991 between residues 28 and 29"
FT   CDS_pept        275977..276255
FT                   /transl_table=11
FT                   /locus_tag="BP0266"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches. Similar to BP1766,
FT                   BP2719, BP3099, BP3683, and BP3731"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W088"
FT                   /protein_id="CAE40646.1"
FT                   /translation="MKRHALATALMVSVTLAGMSAAHADGKTREQVRAELAAAKAAGQV
FT                   TFGELDYPAPAAAPAAGKTREQVRAELAAAKAAGEVTFGELDYPPAK"
FT   misc_feature    276037..276060
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    276145..276168
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        276465..277298
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0267"
FT                   /product="N-terminal region of an outer membrane porin
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. The C-terminal region of this CDS is
FT                   BP0138. Similar to the previously sequenced Bordetella
FT                   pertussis outer membrane porin protein precursor
FT                   SW:OMP_BORPE (Q04064) (385 aa) fasta scores: E(): 3.3e-53,
FT                   58.844% id in 294 aa (BP0840), and to Bordetella pertussis
FT                   OmpQ TR:Q45342 (EMBL:U16266) (364 aa) fasta scores: E():
FT                   1.5e-20, 34.752% id in 282 aa (BP3405). Also similar to
FT                   BP2851 (63.345% identity in 281 aa overlap), and to BP0840
FT                   (58.844% identity in 294 aa overlap)."
FT   misc_feature    276465..276524
FT                   /note="Signal peptide predicted for BP0267 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 20 and 21"
FT   misc_feature    276624..276779
FT                   /note="HMMPfam hit to PF00267, Gram-negative porin"
FT   CDS_pept        complement(277299..278249)
FT                   /transl_table=11
FT                   /locus_tag="BP0268"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA3"
FT                   /protein_id="CAE40648.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   repeat_region   277299..277330
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(277299..278351)
FT   misc_feature    complement(277335..277868)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(277926..277991)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   repeat_region   complement(278320..278351)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        278527..278688
FT                   /transl_table=11
FT                   /locus_tag="BP0270"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="InterPro:IPR025319"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W087"
FT                   /protein_id="CAE40649.1"
FT                   /translation="MGILTVTGDEIEQVTRKKRRQAQAKVLKALGIRLQIRPDGTLLVF
FT                   RTSLGIPH"
FT   CDS_pept        278696..278836
FT                   /transl_table=11
FT                   /locus_tag="BP0271"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W086"
FT                   /protein_id="CAE40650.1"
FT                   /translation="MRKSEVLRIWKADIDLPRRMIYLPEAKAGAREQPITAALAEFLDA
FT                   F"
FT   CDS_pept        278937..>279185
FT                   /transl_table=11
FT                   /locus_tag="BP0272"
FT                   /product="integrase (remnant)"
FT                   /note="Partial CDS. Lacking both the N-terminal region and
FT                   a stop codon. Similar to Bacteriophage SfII integrase Int
FT                   TR:O21941 (EMBL:AF021347) (205 aa) fasta scores: E():
FT                   0.024, 33.333% id in 78 aa, and to Escherichia coli Int
FT                   protein Int TR:CAC43408 (EMBL:X16664) (386 aa) fasta
FT                   scores: E(): 0.11, 39.726% id in 73 aa"
FT                   /db_xref="GOA:Q7W085"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W085"
FT                   /protein_id="CAE40651.1"
FT                   /translation="MGRAGLNIARVVSHTAVSHLVQVGVSLSTVQRMSGPRLAIVARYA
FT                   HQNGDHIRAAMSNLEGRISGTITPKLHKRKSRLQRKRP"
FT   tRNA            complement(279202..279277)
FT                   /note="tRNA Thr anticodon TGT, Cove score 95.16"
FT   CDS_pept        complement(279355..279804)
FT                   /transl_table=11
FT                   /gene="sspB"
FT                   /locus_tag="BP0273"
FT                   /product="stringent starvation protein B"
FT                   /note="Similar to Escherichia coli stringent starvation
FT                   protein B SspB or B3228 or Z4586 or Ecs4101 SW:SSPB_ECOLI
FT                   (P25663) (165 aa) fasta scores: E(): 9.6e-13, 40.845% id in
FT                   142 aa, and to Neisseria meningitidis stringent starvation
FT                   protein B Nmb1952 TR:Q9JXN9 (EMBL:AE002543) (130 aa) fasta
FT                   scores: E(): 9.6e-19, 50.407% id in 123 aa"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W084"
FT                   /protein_id="CAE40652.1"
FT                   /translation="MGETSTKPYLIRALHEWCTDNGYTPYITVQVDEHTMVPVAHVRDG
FT                   QITLNVGTLATNKLSLGNEFIEFQARFSGVTENVYVPVGAVSAIYARETGAGMGFEVQA
FT                   YEAPEHADAAPPPPESAEAGDAAASPAGDDGDGDEPKRPHLTIVK"
FT   CDS_pept        complement(279814..280425)
FT                   /transl_table=11
FT                   /gene="sspA"
FT                   /gene_synonym="ssp"
FT                   /locus_tag="BP0274"
FT                   /product="stringent starvation protein A"
FT                   /note="Similar to Escherichia coli stringent starvation
FT                   protein A SspA or Ssp or Pog or B3229 SW:SSPA_ECOLI
FT                   (P05838) (211 aa) fasta scores: E(): 5.4e-29, 42.857% id in
FT                   203 aa, and to Neisseria meningitidis stringent starvation
FT                   protein A Nmb1953 TR:Q9JXN8 (EMBL:AE002543) (201 aa) fasta
FT                   scores: E(): 1.4e-56, 70.443% id in 203 aa"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W083"
FT                   /protein_id="CAE40653.1"
FT                   /translation="MMVLYSGTTCPFSQRCRFVLFEKGMDFEIRDIDLYNKPEDISVMN
FT                   PYGQVPILVERDLVLYESNIINEYIDERFPHPQLMPADPVMRARTRLFLYNFEKELFVH
FT                   VCALEDRSAKPDDKKMVQARQSIRDRLAQLAPMLLKNKYMLGDEFSMLDVAVAPLLWRL
FT                   DHYGIELPKNAAPLQKYAERIFSRPAYIEALTPSEKVMRR"
FT   misc_feature    complement(279862..280422)
FT                   /note="HMMPfam hit to PF00043, Glutathione S-transferase,
FT                   C-terminal domain"
FT   CDS_pept        complement(280584..281432)
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="BP0275"
FT                   /product="cytochrome C1 precursor"
FT                   /note="Similar to Chromatium vinosum cytochrome C1
FT                   precursor PetC SW:CY1_CHRVI (O31216) (244 aa) fasta scores:
FT                   E(): 2.7e-26, 41.637% id in 281 aa, and to Neisseria
FT                   meningitidis ubiquinol--cytochrome C reductase, cytochrome
FT                   C1 Nmb2051 TR:Q9JXH1 (EMBL:AE002555) (266 aa) fasta scores:
FT                   E(): 6.6e-32, 42.908% id in 282 aa"
FT                   /db_xref="GOA:Q7W082"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W082"
FT                   /protein_id="CAE40654.1"
FT                   /translation="MIKKLIGAVALMLTCTATLAAEGGFPLEKAPDRINDVASLQNGAK
FT                   LFVNYCLNCHSAQSMRYNKLQDIGLTDQQIQDSLLFTGDKVGDLMKIAMTPQDAKKWFG
FT                   TTPPDLSVIARAKSVNAGPSGADYLYTYLRTFYRDTSKATGWNNLAFPNVGMPHALWDR
FT                   QGPRELTTVAVHQVEAADGTRNWERVTTVYDAQGYATAKTEPLADYRGHGSLETRFKAV
FT                   NPAQSADYDQDVADLTAFMSWMAEPVQLYRKQLGVWVLLFLGLFLVVAWRLNAAYWKHV
FT                   R"
FT   misc_feature    complement(join(280605..280670,281352..281417))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BP0275 by TMHMM2.0 at aa 17-39 and 266-288"
FT   misc_feature    complement(281088..281153)
FT                   /note="Predicted helix-turn-helix motif with score 986
FT                   (+2.55 SD) at aa 94-115, sequence MTPQDAKKWFGTTPPDLSVIAR"
FT   misc_feature    complement(281265..281282)
FT                   /note="ScanRegExp hit to PS00190, Cytochrome c family
FT                   heme-binding site signature."
FT   misc_feature    complement(281373..281432)
FT                   /note="Signal peptide predicted for BP0275 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.992 between residues 20 and 21"
FT   CDS_pept        complement(281458..282840)
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /gene_synonym="cytB"
FT                   /locus_tag="BP0276"
FT                   /product="cytochrome B"
FT                   /note="Similar to Rhodocyclus gelatinosus cytochrome B PetB
FT                   TR:AAK55422 (EMBL:AF380164) (423 aa) fasta scores: E():
FT                   5.3e-99, 70.824% id in 449 aa, and to Neisseria
FT                   meningitidis cytochrome B CytB or Petb or Nma0384 TR:Q9JWG5
FT                   (EMBL:AL162753) (449 aa) fasta scores: E(): 6.1e-92,
FT                   58.747% id in 463 aa"
FT                   /db_xref="GOA:Q7W081"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W081"
FT                   /protein_id="CAE40655.1"
FT                   /translation="MAGEKTVETTGLLGWLDQRFPVTSTWKAHLSEYYAPKNFNFWYFF
FT                   GSLALLVLVIQIVTGIFLVMHYKPDAERAFQSVEYIMREVPWGWLVRYMHSTGASMFFV
FT                   VVYLHMLRGLFYGSYRKPRELVWIFGVAIFLCLMGEAFFGYLLPWGQMSYWGAQVIVNL
FT                   FSAIPFIGPELSIWIRGDYVVSDATLNRFFSFHVIAIPLVLIGLVAAHLVALHEVGSNN
FT                   PDGVEIKKGPKDKYGRPKDGIPFHPFYTVHDIMGVAGFLIIFAAIVFFGPEMGGYFLEY
FT                   NNFLPADPLKTPPHIAPVWYFTPFYSMLRATTDVFTWVLAGAAILGAIALLLRAKGAMR
FT                   IVAPVILVVVAVLLRTIDAKFWGVVAMGGAVVILFFLPWLDHSPVKSIRYRPTWHKWLY
FT                   GIFIVNFLVLGYLGTQPPSDAFNLTSQIGTLIYLGFFFLMPVWSRLGTFKPVPDRVTFH
FT                   AH"
FT   misc_feature    complement(join(281515..281580,281602..281655,
FT                   281701..281757,281779..281829,281842..281895,
FT                   282028..282093,282199..282264,282304..282369,
FT                   282400..282465,282487..282552,282652..282717))
FT                   /note="11 probable transmembrane helices predicted for
FT                   BP0276 by TMHMM2.0 at aa 41-63, 96-118, 125-147, 157-179,
FT                   192-214, 249-271, 315-333, 337-354, 361-380, 395-413 and
FT                   420-442"
FT   misc_feature    complement(281908..281985)
FT                   /note="HMMPfam hit to PF00032, Cytochrome
FT                   b(C-terminal)/b6/petD"
FT   misc_feature    complement(282184..282813)
FT                   /note="HMMPfam hit to PF00033, Cytochrome
FT                   b(N-terminal)/b6/petB"
FT   misc_feature    complement(282556..282591)
FT                   /note="ScanRegExp hit to PS00192, Cytochrome b/b6
FT                   heme-ligand signature. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   CDS_pept        complement(282905..283546)
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="BP0277"
FT                   /product="ubiquinol-cytochrome C reductase iron-sulfur
FT                   subunit"
FT                   /EC_number="1.10.2.2"
FT                   /note="Similar to Chromatium vinosum ubiquinol-cytochrome C
FT                   reductase iron-sulfur subunit PetA SW:UCRI_CHRVI (O31214)
FT                   (207 aa) fasta scores: E(): 6.6e-34, 51.613% id in 186 aa,
FT                   and to Rhodocyclus gelatinosus rieske protein PetA
FT                   TR:AAK55421 (EMBL:AF380164) (198 aa) fasta scores: E():
FT                   8.4e-50, 65.979% id in 194 aa"
FT                   /db_xref="GOA:Q7W080"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W080"
FT                   /protein_id="CAE40656.1"
FT                   /translation="MSQDTLVHDDDGAVDPNLPPDPSRRFWVTTACAVGGVAGVATAVP
FT                   FVSTFAPSEKARAAGAPVEVDVGDLAPGQMRTVEWRGKPVWIIRRTDDQLKGIKSQDGL
FT                   MADPNSERPGFTPAYAKNEYRSRKPELFVCVGICTHLGCSPTAHFETGGGAGMPGNWQG
FT                   GFLCPCHGSTFDMAGRVYKDKPAPDNLEVPPYQYLSDTRIIVGVDEDNKA"
FT   misc_feature    complement(282989..283192)
FT                   /note="HMMPfam hit to PF00355, Rieske [2Fe-2S] domain"
FT   misc_feature    complement(283031..283048)
FT                   /note="ScanRegExp hit to PS00200, Rieske iron-sulfur
FT                   protein signature 2."
FT   misc_feature    complement(283115..283135)
FT                   /note="ScanRegExp hit to PS00199, Rieske iron-sulfur
FT                   protein signature 1."
FT   CDS_pept        283686..284144
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="BP0278"
FT                   /product="large-conductance mechanosensitive channel"
FT                   /note="Similar to Clostridium perfringens large-conductance
FT                   mechanosensitive channel MscL SW:MSCL_CLOPE (P53380) (152
FT                   aa) fasta scores: E(): 3.7e-14, 46.774% id in 124 aa, and
FT                   to Bradyrhizobium japonicum MscL TR:Q9RH75 (EMBL:AF065159)
FT                   (157 aa) fasta scores: E(): 1.6e-23, 55.862% id in 145 aa"
FT                   /db_xref="GOA:Q7W079"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W079"
FT                   /protein_id="CAE40657.1"
FT                   /translation="MSKATGFIKEFRDFAVKGNAIDLAVGVIIGAAFGKIVDSLVKDVV
FT                   MPLVNFILGGSVDFSNKFLVLSMPDGYTGPMTYADLTKAGANVLAWGNFITIIINFVLL
FT                   AFVIFWMVKAIYFARRKEEAAPEAPAAPPEDVTVLREIRDLLKDKQGS"
FT   misc_feature    283704..284132
FT                   /note="HMMPfam hit to PF01741, Large-conductance
FT                   mechanosensitive channel, MscL"
FT   misc_feature    join(283743..283796,283815..283883,283947..284015)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BP0278 by TMHMM2.0 at aa 20-37, 44-66 and 88-110"
FT   CDS_pept        complement(284169..284945)
FT                   /transl_table=11
FT                   /locus_tag="BP0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa4445 TR:Q9HVX2 (EMBL:AE004859) (252 aa) fasta
FT                   scores: E(): 8.6e-49, 53.516% id in 256 aa, and to
FT                   Neisseria meningitidis hypothetical protein Nma0382
FT                   SW:Y382_NEIMA (Q9JWG6) (249 aa) fasta scores: E(): 6.7e-46,
FT                   50.996% id in 251 aa"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W078"
FT                   /protein_id="CAE40658.1"
FT                   /translation="MKTIHIRELADWLDGALQAARFKDYCPNGLQVEGKAEIAHIITGV
FT                   TASEALLRAAIERGADAVLVHHGWFWRNEDRRVLGPRRTRLALALGHELNLLAYHLPLD
FT                   AHPQWGNNAQLARVLGLQAETGPDGAPRTCGADNLVWLGSAPGVQTVAQLQQRVAERLG
FT                   RTPLVVGEPDRPVRRVAWCTGGAQGMLADAVDAGADAYITGEASESTVHLARETGVAFV
FT                   GAGHHATERYGVQALGEAVARQFGIRVEFIDIDNPV"
FT   misc_feature    complement(284184..284909)
FT                   /note="HMMPfam hit to PF01784, Domain of unknown function
FT                   DUF34"
FT   misc_feature    284978..285037
FT                   /note="1 probable transmembrane helix predicted for BP0280
FT                   by TMHMM2.0 at aa 5-24"
FT   CDS_pept        284999..286135
FT                   /transl_table=11
FT                   /gene="degQ"
FT                   /gene_synonym="hhoA"
FT                   /locus_tag="BP0280"
FT                   /product="protease"
FT                   /EC_number="3.4.21.-"
FT                   /note="Similar to Escherichia coli protease DegQ precursor
FT                   or HhoA or B3234 SW:DEGQ_ECOLI (P39099) (455 aa) fasta
FT                   scores: E(): 1.6e-38, 41.642% id in 341 aa, and to
FT                   Pseudomonas aeruginosa AlgW protein or Pa4446 TR:Q9HVX1
FT                   (EMBL:AE004859) (389 aa) fasta scores: E(): 5.9e-58,
FT                   51.862% id in 376 aa"
FT                   /db_xref="GOA:Q7W077"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W077"
FT                   /protein_id="CAE40659.1"
FT                   /translation="MTVSLAILFVVITLRPDWLRLSGPAPATRAPAAAASGQAGASYAD
FT                   AVARAAPAVVNVYTTKHVNVPLVPLPDDPVLRQLFGQVPGLSRREASTSLGSGVIVSAE
FT                   GYVLTNYHVVEAADAIEVALADGRQAAAKVVGADPETDLAVLKLAGKLGELPVATFADK
FT                   RAPRVGDVVLAIGNPFGVGQTTTQGIVSALGRNGLGINTYENFIQTDAAINPGNSGGAL
FT                   IDAHGDLVGINTAIYSETGGSLGIGFAIPVDSARRVMEDIVRTGAVRRGWFGIEPQDMT
FT                   PELARAFQLPREARGVIIAGVMRDGPAGKAGMRVGDIVQALNGAPVIDTRGLLGQIASL
FT                   QPGQQAVASVLRAGKPADRLLPACMPLRCPPWPAIRPG"
FT   misc_feature    285242..285775
FT                   /note="HMMPfam hit to PF00089, Trypsin"
FT   misc_feature    285779..286057
FT                   /note="HMMPfam hit to PF00595, PDZ domain (Also known as
FT                   DHR or GLGF)."
FT   CDS_pept        complement(286132..287082)
FT                   /transl_table=11
FT                   /locus_tag="BP0281"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTB4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTB4"
FT                   /protein_id="CAE40660.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHI"
FT   repeat_region   286132..286163
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(286132..287184)
FT   misc_feature    complement(286168..286701)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(286759..286824)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   repeat_region   complement(287153..287184)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(287181..287807)
FT                   /transl_table=11
FT                   /locus_tag="BP0282"
FT                   /product="putative regulatory protein"
FT                   /note="Similar to Bacillus subtilis protease synthase and
FT                   sporulation negative regulatory protein Pai2 PaiB
FT                   SW:PAIB_BACSU (P21341) (207 aa) fasta scores: E(): 3.2e-17,
FT                   30.476% id in 210 aa, and to Pseudomonas aeruginosa
FT                   hypothetical protein Pa4182 TR:Q9HWJ9 (EMBL:AE004834) (212
FT                   aa) fasta scores: E(): 3.6e-27, 41.237% id in 194 aa"
FT                   /db_xref="GOA:Q7W076"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W076"
FT                   /protein_id="CAE40661.1"
FT                   /translation="MYTPPAYEERDRHKLHAWMRDWSFATLVTHGDQGLQATHLPFLLD
FT                   PLRGPHGTLISHLARRNPQAADIQAGAQAMVVFQGPHAFISPSWYRNRQTFPTWNYAAI
FT                   HAHGQAAAIEDAQRIRAILTRTVQTYDTPLGGEWTFEAMPEDLIVPRLSAIIALEIPIA
FT                   RLEGKVKLNQDKSPEDRAGVLAALENRRDPGSRGVARMMREALLA"
FT   CDS_pept        complement(287830..288756)
FT                   /transl_table=11
FT                   /locus_tag="BP0283"
FT                   /product="putative 2-hydroxyacid dehydrogenase"
FT                   /note="Similar to Escherichia coli putative 2-hydroxyacid
FT                   dehydrogenase in phoH-csgG intergenic region YcdW or B1033
FT                   SW:YCDW_ECOLI (P75913) (325 aa) fasta scores: E(): 2.7e-30,
FT                   36.364% id in 297 aa, and to Rhizobium loti probable
FT                   dehydrogenase Mll7048 TR:Q987H7 (EMBL:AP003010) (307 aa)
FT                   fasta scores: E(): 1.1e-35, 42.391% id in 276 aa"
FT                   /db_xref="GOA:Q7W075"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W075"
FT                   /protein_id="CAE40662.1"
FT                   /translation="MTLIAIASQAPDLLRLPPALRALDPSIDVVVWPDPRCAAAEVAVC
FT                   WAPPPGALAAMPALRLLHTVSAGVDNVLAAPGLPDVPLCRVVDAELNLGMAQYILWGAL
FT                   YFSRGFDQARASQAAGQWRRPDRYGQPPLRVGLMGLGAIGMAALPLLRAAGLPVTGWSR
FT                   TAKRIDGVATHHGPDGLAPFLAASDILVNLLPLTESTRGLLCAATFAGLPPGAALIHCG
FT                   RGAHLVEADLQAALADGRLRGALVDVYAQEPLPPQHPLWRCPSLVITPHMASVAPFERV
FT                   AGQILENLRRLNAGEALMNLVDPRRGY"
FT   misc_feature    complement(287944..288207)
FT                   /note="HMMPfam hit to PF00389, D-isomer specific
FT                   2-hydroxyacid dehydrogenase, catalytic domain"
FT   CDS_pept        complement(288765..290351)
FT                   /transl_table=11
FT                   /locus_tag="BP0284"
FT                   /product="probable extracellular solute-binding protein,
FT                   family 5"
FT                   /note="Similar to Rhizobium meliloti probable extracellular
FT                   solute-binding protein, family 5 Sma2075 TR:AAK65791
FT                   (EMBL:AE007299) (543 aa) fasta scores: E(): 2e-63, 36.364%
FT                   id in 539 aa, and to Rhizobium loti ABC transporter
FT                   oligopeptide-binding protein Mlr3395 TR:Q98GC1
FT                   (EMBL:AP003001) (536 aa) fasta scores: E(): 8e-52, 33.594%
FT                   id in 512 aa. Also similar to BP2293, 59.693% identity in
FT                   521 aa overlap."
FT                   /db_xref="GOA:Q7W074"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W074"
FT                   /protein_id="CAE40663.1"
FT                   /translation="MNYRHIRGTLRALLLASAAIATLAGAPAQAQTRGGTLRAIVHPEP
FT                   PILITAINSQSPTQFVGGKIFQGLLTYDADLKPQPSLARAWRISPDGLVYTFELQPDVK
FT                   WHDGKPFSADDVVFSIDKLVREVHPRTKLILNAYVESVRAVDPATVEIRLKEPFAPFIS
FT                   MFETGTMPMMPKHLYEGTDYRNNPANQHPVGTGPFKFKEWVRGSHIALVRNDEYWKPGL
FT                   PYLDGIRFQVIPDSASRAVAFEQANVDLVYGDDVDSVDIKRLRALPGVQYTTKGWEMFG
FT                   PMGLMVLNQREAPFDNVLVRRAVMHALNRDFIVKNIFFGMGRVPTGPFSSATLFHDKDL
FT                   PVYDYNIKKARALIKESGVDVGQRTLRLLAFPYGANWERVGEYTRQTLEQLGFKVDIQA
FT                   TDAGGWASRMSQWDFDISFNHPYQYGDPVLGVQRLYLSSNRVKGTPFGNNQGYHNPKAD
FT                   ALWQQAARSVDPAERQKLYSELQRILVDDAALGWLLEIDYPTLYRGNVHNLVTSAIGVK
FT                   ESFDTVYLDAR"
FT   misc_feature    complement(288777..289022)
FT                   /note="HMMPfam hit to PF00496, Bacterial extracellular
FT                   solute-binding proteins, family 5"
FT   misc_feature    complement(289248..290321)
FT                   /note="HMMPfam hit to PF00496, Bacterial extracellular
FT                   solute-binding proteins, family 5"
FT   misc_feature    complement(290262..290351)
FT                   /note="Signal peptide predicted for BP0284 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.994 between residues 30 and 31"
FT   CDS_pept        complement(290348..291352)
FT                   /transl_table=11
FT                   /locus_tag="BP0285"
FT                   /product="putative acetyl esterase"
FT                   /note="Similar to Escherichia coli acetyl esterase Aes or
FT                   B0476 SW:AES_ECOLI (P23872) (319 aa) fasta scores: E():
FT                   2.7e-29, 35.032% id in 314 aa, and to Streptomyces
FT                   coelicolor putative lipase Sc4b10.32 TR:Q9FC55
FT                   (EMBL:AL391515) (316 aa) fasta scores: E(): 2.6e-28,
FT                   36.760% id in 321 aa"
FT                   /db_xref="GOA:Q7W073"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W073"
FT                   /protein_id="CAE40664.1"
FT                   /translation="MTTAALPYPLDPQIQRFVERMQADSAAHPRRDLVPVEQAHAISEA
FT                   VRRPWAEGGPQMARTREIHVPTPHGPVRLRVYTPRAARPGPALLYVHGGGWVLFSLDTH
FT                   DRLMREYAERAGLTVIGVDYTRAPEARYPRAIEEIVGVIDWLDAHGAELEVDRARLCIG
FT                   GDSAGANLSVAACLTLRERGAAPLAGMVLNYGVYDANLFRDSTVKYGGGEYLLSTQQMV
FT                   WFYWNYLRAGDDPRDPRISPVHADLRGLPPAFMAITELDLLHDTNQDMAARLREAGVDV
FT                   QAKVYPGTVHSFLEAVSLAQVSVAAFDDTAAWLRAVLRPDAAAAAIHTGEHQP"
FT   CDS_pept        291552..292412
FT                   /transl_table=11
FT                   /locus_tag="BP0286"
FT                   /product="probable transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator Pa0791 TR:Q9I5E7 (EMBL:AE004514)
FT                   (262 aa) fasta scores: E(): 1.2e-37, 44.898% id in 245 aa,
FT                   and to Rhizobium loti probable transcriptional regulator
FT                   Mll2686 TR:Q98HW2 (EMBL:AP003000) (292 aa) fasta scores:
FT                   E(): 2.3e-36, 43.902% id in 246 aa. Also similar to BP0288
FT                   (40.840% identity in 262 aa overlap), and to BP3550
FT                   (41.121% identity in 214 aa overlap)"
FT                   /db_xref="GOA:Q7W072"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W072"
FT                   /protein_id="CAE40665.1"
FT                   /translation="MPAIAKDPSPRRAPAFPAPRQLSYLDLLTRQVQSAPGEMAALATD
FT                   YPAGTVSSLHRHDRGQLLYAMSGVVTVITDLGSWVVAPGQALWIAPGVLHQTRGFESVA
FT                   IRSLYIDPAHADGLPAACQTIQVSPLLQALILEAVKLPPQDAGSERAGHIRALILDEMR
FT                   HVCAAPLYVPMPRDARLARICQALLRDPANAGSLDAWAAYGGLSRRNLTRLFRAQTGAS
FT                   FNAWRQKVLLMEALARLSRGEQITAVALDLGYGSPGAFTAMFRRALGVSPREYFRWTEA
FT                   PQRAD"
FT   misc_feature    292131..292388
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix proteins, araC family"
FT   misc_feature    292134..292199
FT                   /note="Predicted helix-turn-helix motif with score 1165
FT                   (+3.15 SD) at aa 195-216, sequence GSLDAWAAYGGLSRRNLTRLFR"
FT   CDS_pept        complement(292444..293445)
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="BP0287"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="Similar to Corynebacterium glutamicum
FT                   2-isopropylmalate synthase LeuA SW:LEU1_CORGL (P42455) (616
FT                   aa) fasta scores: E(): 8.9e-69, 55.077% id in 325 aa, and
FT                   to Mycobacterium tuberculosis 2-isopropylmalate synthase
FT                   LeuA or Rv3710 or Mt3813 or Mtv025.058 SW:LEU1_MYCTU
FT                   (P96420) (644 aa) fasta scores: E(): 3.1e-73, 58.154% id in
FT                   325 aa. Also similar to N-terminal region of BP0131,
FT                   68.598% identity (68.598% ungapped) in 328 aa overlap."
FT                   /db_xref="GOA:Q7W071"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W071"
FT                   /protein_id="CAE40666.1"
FT                   /translation="MLAHPATKYRPFAPFAADHAERAWPARRPAAAPIWMSTDLRDGNQ
FT                   ALIEPMDGARKLRLFEQLVAVGLKEIEVAFPSASQTDFDFVRKLIDERRIPDDVTIEAL
FT                   TQSRPDLMARTFEALAGSPRAIVHLYNPIAPQWRRIVFGMSRAEIKEIALAGTRQIRAL
FT                   ADANPGTQWIYEYSPETFSLAELDFAREVCDAVSAIWGPTPQRKMIINLPATVESSTAN
FT                   VYADQIEWMHRSLARRDCIVLSVHPHNDRGTAVAAAELAVLAGAERIEGCLFGNGERTG
FT                   NVDLVALALNLERQGIASGLDFRDMAALRACVSECNQLPIDVFHPYAWLDQD"
FT   misc_feature    complement(292477..293331)
FT                   /note="HMMPfam hit to PF00682, HMGL-like"
FT   misc_feature    complement(292678..292719)
FT                   /note="ScanRegExp hit to PS00816, Alpha-isopropylmalate and
FT                   homocitrate synthases signature 2."
FT   misc_feature    complement(293278..293328)
FT                   /note="ScanRegExp hit to PS00815, Alpha-isopropylmalate and
FT                   homocitrate synthases signature 1."
FT   CDS_pept        293516..294325
FT                   /transl_table=11
FT                   /locus_tag="BP0288"
FT                   /product="probable transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator Pa1235 TR:Q9I4A3 (EMBL:AE004553)
FT                   (260 aa) fasta scores: E(): 1.1e-46, 52.697% id in 241 aa,
FT                   and to Rhizobium loti probable transcriptional regulator
FT                   Mll2686 TR:Q98HW2 (EMBL:AP003000) (292 aa) fasta scores:
FT                   E(): 3.4e-35, 40.927% id in 259 aa"
FT                   /db_xref="GOA:Q7W070"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W070"
FT                   /protein_id="CAE40667.1"
FT                   /translation="MNPLEKDIAESKPQLAPHEHARAPVTALAVDYRDGEHVPRHRHRR
FT                   AQLLYAIEGVMTVQAEAGIWVAPPTRGIWLPAGMAHSIRMHGQPRVRTVFVAPRAAGHL
FT                   PDRCCVLAVGPLLRELIVAATRVPPDWRPGGRDARLMALLLDEIRLEPALPLHLPQPDE
FT                   PRVARVCRGILREPGAARGLAEWAAELGVTAKTVQRLFVRHTGMTFGRWRQQAGLLWAM
FT                   RRLAEGVRVLDVALELGYDSPSAFAAMFRRAVGEPPSAFAARREPPA"
FT   misc_feature    294053..294310
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix proteins, araC family"
FT   misc_feature    294056..294121
FT                   /note="Predicted helix-turn-helix motif with score 1471
FT                   (+4.20 SD) at aa 181-202, sequence RGLAEWAAELGVTAKTVQRLFV"
FT   CDS_pept        294403..296262
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="BP0289"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="Similar to Escherichia coli dihydroxy-acid
FT                   dehydratase IlvD or B3771 SW:ILVD_ECOLI (P05791) (616 aa)
FT                   fasta scores: E(): 9.7e-180, 75.041% id in 617 aa, and to
FT                   Neisseria meningitidis dihydroxy-acid dehydratase Nmb1188
FT                   or Nmb1150 TR:Q9JS61 (EMBL:AE002466) (619 aa) fasta scores:
FT                   E(): 5.7e-183, 73.506% id in 619 aa. Also similar to
FT                   BP3043, 36.661% identity (40.653% ungapped) in 611 aa
FT                   overlap."
FT                   /db_xref="GOA:Q7W069"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W069"
FT                   /protein_id="CAE40668.1"
FT                   /translation="MPHYRSRTSTHGRNMAGARALWRATGMKDGDFGKPIIAVVNSFTQ
FT                   FVPGHVHLRDLGALVAREIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPVVFVSGGPMEAGKITSPVDGKVIA
FT                   KLDLVDAMIKAADPNVSDAEAEEVERSACPTCGSCSGMFTANSMNCLTEAIGLALPGNG
FT                   TIVATHAWRKGLFEQAGRLVVELCRRYYEQDDASVLPRSIATKSAFENAMTLDVAMGGS
FT                   TNTVLHLLAAAQEAGVDFTMSDIDRISRRVPCLCKAAPATDKYHIEDVHRAGGILGILG
FT                   ELGRADLLDLSCGNVHSGTLGEAINQWDINGGAGEAAQKFFRAAPGGIPTTVAFSQDAT
FT                   FLTLDMDRQTGCIRDKAHAYSQDGGLAVLYGNLAEKGCIVKTAGVDESQWVFTGRARVF
FT                   ESQEDAVEGILGDRVQAGDVVIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKTCALFTDG
FT                   RFSGGSSGLVIGHASPEAAEGGTIGLVEEGDTIEIDIPNRRIHLAVGDTVLAERRAAMQ
FT                   ARGEQAWQPVDRERVVSQALRAYAALATSADRGAVRDLSQLKR"
FT   misc_feature    294592..296091
FT                   /note="HMMPfam hit to PF00920, Dehydratase family"
FT   misc_feature    294766..294798
FT                   /note="ScanRegExp hit to PS00886, Dihydroxy-acid and
FT                   6-phosphogluconate dehydratases signature 1. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   CDS_pept        complement(296391..297593)
FT                   /transl_table=11
FT                   /locus_tag="BP0290"
FT                   /product="probable transporter"
FT                   /note="Similar to Rhizobium loti transmembrane efflux
FT                   protein Mlr4084 TR:Q98EU2 (EMBL:AP003003) (397 aa) fasta
FT                   scores: E(): 8.6e-82, 64.987% id in 397 aa, and to
FT                   Streptomyces coelicolor putative transmembrane efflux
FT                   protein Sch24.37 TR:Q9X8V1 (EMBL:AL049826) (404 aa) fasta
FT                   scores: E(): 2e-71, 56.566% id in 396 aa. Also similar to
FT                   BP0940 (36.896% identity in 393 aa overlap), and to BP1608
FT                   (48.947% identity in 380 aa overlap)"
FT                   /db_xref="GOA:Q7W068"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W068"
FT                   /protein_id="CAE40669.1"
FT                   /translation="MPIALWALAAGAFGIGTTEFVIMGLLPEVGADLGVSIPQAGLLVT
FT                   GYALGVVVGAPPVAILTARLPRKTLLLGLMLIFTLGNLACALAPGYGALMAARVLTSLA
FT                   HGAFFGVGSVVATSLVRPDKQASAIALMFTGLTLANVLGVPFGTWLGQAWGWRATFWAV
FT                   TAVGIAAMAAIMYWVPASRGQHQADLAGELRALARPQVLLGFAMTVLGFGGVFTTFTYI
FT                   APILTGVSGIAAAAVSPILLLFGVGLVAGNTLGGRLADRRLMPTLVGSLAVLAAVLAAF
FT                   AWTAHHSIAAVATVALLGAAAFATVPPLQMRVLQQAGGAPNLASAFNIAAFNLGNAAGA
FT                   WLGGLTIDHGPGLAATPLVAAAVTGGGLALALLSWSRDRRNDANQRAPALAARACESGQ
FT                   M"
FT   misc_feature    complement(join(296466..296531,296562..296627,
FT                   296667..296726,296739..296804,296844..296909,
FT                   296925..296990,297051..297116,297147..297212,
FT                   297234..297290,297321..297386,297408..297473,
FT                   297519..297584))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BP0290 by TMHMM2.0 at aa 40-62, 77-99, 106-128, 138-157,
FT                   164-186, 196-218, 238-260, 265-287, 300-322, 326-346,
FT                   359-381 and 391-413"
FT   CDS_pept        297707..298588
FT                   /transl_table=11
FT                   /locus_tag="BP0291"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator Pa1859 TR:Q9I2N6 (EMBL:AE004612)
FT                   (295 aa) fasta scores: E(): 7e-66, 59.386% id in 293 aa,
FT                   and to Neisseria meningitidis putative LysR-family
FT                   transcriptional regulator Nma0601 TR:Q9JW03 (EMBL:AL162753)
FT                   (299 aa) fasta scores: E(): 7.2e-46, 45.392% id in 293 aa.
FT                   Also similar to BP1607, 58.703% identity (58.703% ungapped)
FT                   in 293 aa overlap."
FT                   /db_xref="GOA:Q7W067"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W067"
FT                   /protein_id="CAE40670.1"
FT                   /translation="MPLNSDALRLFLAVVDAGSMRAAAELLGHTASGVSRGLARLEAEL
FT                   GVTLLTRTTRRMELTEEGRQFQQKARAILLALDEAQECMRIRHQQPAGRLRVDASAPVM
FT                   LHCLVPHVEEFSRRYPEIQLELTSNDRIVDLIEHRSDVALRAGVLSDSSLHARAFKPST
FT                   LLVVASPAYLARHGKPRDVAALRRHRLLGFTQPETLNRWPLRHDGGSTFVVEPDIGASS
FT                   GETLRGLALAGAGIACLSDFMLRADLASGSLVRLLESADNGYRQPLHAVYYRNTQLARR
FT                   IACFLDFYAERM"
FT   misc_feature    297719..298138
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    297758..297823
FT                   /note="Predicted helix-turn-helix motif with score 1196
FT                   (+3.26 SD) at aa 18-39, sequence GSMRAAAELLGHTASGVSRGLA"
FT   CDS_pept        complement(join(298622..299149,299152..299961))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0292"
FT                   /product="conserved hypothetical protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 270. The sequence has been checked
FT                   and believed to be correct. Similar to Streptomyces
FT                   glaucescens StrU TR:Q54201 (EMBL:X89010) (428 aa) fasta
FT                   scores: E(): 4.6e-07, 33.258% id in 445 aa, and to
FT                   Agrobacterium tumefaciens Agr_l_3299p TR:AAK90225
FT                   (EMBL:AE008367) (489 aa) fasta scores: E(): 1.2e-96,
FT                   54.505% id in 444 aa"
FT                   /db_xref="PSEUDO:CAE40671.1"
FT   variation       complement(299150..299153)
FT                   /note="(AC)2 in pertussis; (AC)1 in parapertussis and
FT                   bronchiseptica"
FT   CDS_pept        complement(300091..300651)
FT                   /transl_table=11
FT                   /locus_tag="BP0294"
FT                   /product="putative 5'(3')-deoxyribonucleotidase"
FT                   /EC_number="3.1.3.5"
FT                   /note="Similar to Homo sapiens mitochondrial 5' Dnt-2
FT                   TR:Q9NPB1 (EMBL:AJ277557) (228 aa) fasta scores: E():
FT                   4.3e-26, 44.865% id in 185 aa, and to Mus musculus 5' Dnt
FT                   or Nt TR:Q9JM14 (EMBL:AF078840) (200 aa) fasta scores: E():
FT                   5.1e-26, 42.162% id in 185 aa, and to Staphylococcus aureus
FT                   subspaureus Mu50. conserved hypothetical protein sav0725
FT                   TR:BAB56887 (EMBL:AP003360) (180 aa) fasta scores: E():
FT                   1.4e-05, 29.609% id in 179 aa"
FT                   /db_xref="GOA:Q7W066"
FT                   /db_xref="InterPro:IPR010708"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W066"
FT                   /protein_id="CAE40672.1"
FT                   /translation="MLILLDQDGVLADFEHAFIDAWRKRHPDIEPVAFEERKSFHIRED
FT                   YAPELRGLAEAIYTAPGFIRDLPPVPGAVEAFRELLALGMDVRICSSPLMQFENCVAEK
FT                   YLWVERHLGRDATQRLILTRDKTLVQGDLLIDDRPVITGAARPRWRHIIYDAPYNRDQT
FT                   DRPRLDWRNWRNVLAGELYRSDA"
FT   CDS_pept        complement(300711..301661)
FT                   /transl_table=11
FT                   /locus_tag="BP0295"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q79H25"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H25"
FT                   /protein_id="CAE40673.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT"
FT   repeat_region   300711..300742
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(300711..301763)
FT   misc_feature    complement(300747..301280)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(301338..301403)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   repeat_region   complement(301732..301763)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(301853..302113)
FT                   /transl_table=11
FT                   /locus_tag="BP0296"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W065"
FT                   /protein_id="CAE40674.1"
FT                   /translation="MVIELIYDTLDPDVAKYLKNNKPAPGIHWHRQLSEDLGARQLVSR
FT                   CFEVVGMAKTCHSIRELRDRVAEHYGHNTVQLTLTLPRSQR"
FT   repeat_region   302127..302158
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   302127..303179
FT   CDS_pept        302229..303179
FT                   /transl_table=11
FT                   /locus_tag="BP0297"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA3"
FT                   /protein_id="CAE40675.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   misc_feature    302487..302552
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    302610..303143
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(303148..303179)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(303176..304174)
FT                   /transl_table=11
FT                   /locus_tag="BP0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa2789 TR:Q9I054 (EMBL:AE004706) (359 aa) fasta
FT                   scores: E(): 6.5e-06, 33.134% id in 335 aa, and to
FT                   Agrobacterium tumefaciens Agr_l_258p TR:AAK88699
FT                   (EMBL:AE008210) (357 aa) fasta scores: E(): 0.042, 26.897%
FT                   id in 290 aa"
FT                   /db_xref="GOA:Q7W064"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W064"
FT                   /protein_id="CAE40676.1"
FT                   /translation="MISLSVPGGNFYLAMALSLFCLSTLLTWAVTLAANRGARRWLAAH
FT                   RRLGPALMVLLAVAGAIFPYQHFSQWRQAQREAREQTARRAVLEAARRVDGIDMPAGTE
FT                   LRLAEPGRLDSFQGADFPVPAHVAGLRVTRLVRHGAAPGGRQGWSVTLDGNQRIDGWLC
FT                   SRGHQVELAVRDGTPAFAGCHLAAGNEIGGAAVPPGAWVAARQPGPWLLRTEGSDPLDV
FT                   GRLPLLKVDMTLDDRRQVAGFEGLLARELTLGEMTYPTGTRVASAPAGLAQAQAGDLLF
FT                   SPSRGRAARRGAGTEIVAGKSVLQAPDGTVRAVLANRDAGVLDFAAVRMAP"
FT   misc_feature    complement(join(303980..304030,304070..304135))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BP0298 by TMHMM2.0 at aa 13-35 and 48-65"
FT   misc_feature    complement(304088..304174)
FT                   /note="Signal peptide predicted for BP0298 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.992) with cleavage site
FT                   probability 0.734 between residues 29 and 30"
FT   CDS_pept        complement(304217..304720)
FT                   /transl_table=11
FT                   /locus_tag="BP0299"
FT                   /product="MarR-family transcriptional regulator"
FT                   /note="Similar to Rhodopseudomonas palustris
FT                   transcriptional activatory protein BadR SW:BADR_RHOPA
FT                   (O07458) (175 aa) fasta scores: E(): 7.3e-06, 28.873% id in
FT                   142 aa, and to Rhizobium loti transcriptional regulator
FT                   Mll5432 TR:Q98BT7 (EMBL:AP003006) (156 aa) fasta scores:
FT                   E(): 6.6e-22, 48.905% id in 137 aa"
FT                   /db_xref="GOA:Q7W063"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W063"
FT                   /protein_id="CAE40677.1"
FT                   /translation="MIDTPDLETRAAPEDHHALRLWLRMLTCCNLIESEIRSRLRTEFD
FT                   TTLPRFDLMAQLQRAPKGMKMGELSRHMMVTNGNITGITDQLEKEGLVVRTKVESDRRS
FT                   SVLKLTPQGKRTFARMARAHESWVTGMLDDLPEASRHAMYKALGELKLQVVAHRALAQR
FT                   DGAS"
FT   misc_feature    complement(304271..304585)
FT                   /note="HMMPfam hit to PF01047, MarR family"
FT   misc_feature    complement(304382..304486)
FT                   /note="ScanRegExp hit to PS01117, Bacterial regulatory
FT                   proteins, marR family signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   CDS_pept        complement(304724..305614)
FT                   /transl_table=11
FT                   /locus_tag="BP0300"
FT                   /product="putative esterase"
FT                   /note="Similar to Pseudomonas paucimobilis esterase
FT                   TR:Q9APE2 (EMBL:AF305841) (284 aa) fasta scores: E():
FT                   4.4e-12, 28.058% id in 278 aa, and to Pseudomonas spCA10.
FT                   hypothetical 31.6 kDa protein TR:Q9AQQ0 (EMBL:AB047272)
FT                   (289 aa) fasta scores: E(): 2.2e-63, 58.845% id in 277 aa"
FT                   /db_xref="GOA:Q7W062"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W062"
FT                   /protein_id="CAE40678.1"
FT                   /translation="MAAIYRHYDRAALDVQYNARATVPDIQPILKRYAEASQQARDALP
FT                   CTLDVPYGDHPDELLDIFPADGVRAAPVLVYIHGGYWRALNKSDSCNMAPAFTRAGALV
FT                   VAVNYSLAPAVTLDRIVDQNRRALAWIHRHIAEYGGDPARITICGSSAGGHLVGALLAG
FT                   GWHGQYGAPEDIVHSAAPLSGLFDLRPLVHTHINEWMRMSPADAERNSPALHMPRRGCP
FT                   IVVSYGETETDEFKRQSDDFLRDWLALGYPGRYIPMPGTNHYDIVLTLNEPASALTQAI
FT                   FALMGLAPPPTPSIR"
FT   misc_feature    complement(305132..305242)
FT                   /note="HMMPfam hit to PF00135, Carboxylesterase"
FT   CDS_pept        305837..307000
FT                   /transl_table=11
FT                   /locus_tag="BP0301"
FT                   /product="putative ABC transporter substrate binding
FT                   protein"
FT                   /note="Similar to Rhodopseudomonas palustris putative ABC
FT                   transporter substrate binding protein HbaE TR:O07470
FT                   (EMBL:U75364) (392 aa) fasta scores: E(): 4.5e-32, 32.741%
FT                   id in 394 aa, and to Pseudomonas spCA10. putative ABC
FT                   transporter subunit TR:Q9AQP4 (EMBL:AB047548) (386 aa)
FT                   fasta scores: E(): 1.7e-50, 41.237% id in 388 aa"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W061"
FT                   /protein_id="CAE40679.1"
FT                   /translation="MRLIPSLLAALALAPGLANADPIKVGIANDISGPFAALGAEARDG
FT                   FNLAIKELGGKLGGQQAEFLQTDMGGNPDQARQLVTRYIQREKVDFFTGPIGSNVALAV
FT                   GPALFAAKIPYLSNNPGPSQYAGAQCNKFWFGNSYQNDAFHEAAGKVAADRGYKKVFIM
FT                   APDYPAGKDALTGFKRGYKTAVAEELYTKLGQIDYAAELAQIRAAKPDAVYIFLPGGMG
FT                   INFVKQFVSTGLAQGTALVGPGFSADEDVIQAVGEPMLGMVNTAQWAHDLDVPQNKKFV
FT                   EAFRKEYNGRYPSVYAAQAYDVIMSIDAAVKQAGGKASDRDAIVKALEQADYPSVRGSF
FT                   TYGKNHYPIQAYYARVVEKDGSGRITNKLTGKVFDKYQDVYVGDCKL"
FT   misc_feature    305837..305896
FT                   /note="Signal peptide predicted for BP0301 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.996 between residues 20 and 21"
FT   CDS_pept        307097..308017
FT                   /transl_table=11
FT                   /locus_tag="BP0302"
FT                   /product="probable branched-chain amino acid transport
FT                   system, permease component"
FT                   /note="Similar to Rhodopseudomonas palustris putative ABC
FT                   transporter subunit HbaF TR:O07469 (EMBL:U75364) (286 aa)
FT                   fasta scores: E(): 1.9e-34, 45.333% id in 300 aa, and to
FT                   Rhizobium meliloti putative permease ABC transporter
FT                   protein smc03118 TR:CAC47554 (EMBL:AL591792) (295 aa) fasta
FT                   scores: E(): 1.9e-22, 35.593% id in 295 aa"
FT                   /db_xref="GOA:Q7W060"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W060"
FT                   /protein_id="CAE40680.1"
FT                   /translation="MTFTLIVEQLLNGLQFGLMLFLIAAGLTLVFGIMDIMNLAHGSLY
FT                   MAGAYVAAETMQRTGSFTAAVLVAALATGLVGAVLELTLIRKLAVRDHLAQVLGTYAVI
FT                   LIANDLVKMIWGPAPVMLNMPAALSGPVRLLPDLLYPAYRLMIIVFGLAAAAGLYWFVT
FT                   RTRAGVLVRAGASNRQMATLMGVRVPLLFLGVFVLGAMLAAVAGALLGPVTAVQIGMGE
FT                   GILILVLVCIVIGGIGSIRGAFVGALLVGMVDTAGRAFLPMLLRQVFPPAVASSVGPTL
FT                   AAIAIYVLMAGVLVFRPAGLFPARG"
FT   misc_feature    307097..307252
FT                   /note="Signal peptide predicted for BP0302 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.761) with cleavage site
FT                   probability 0.492 between residues 52 and 53"
FT   misc_feature    307112..308014
FT                   /note="HMMPfam hit to PF02653, Branched-chain amino acid
FT                   transport system / permease component"
FT   misc_feature    join(307130..307198,307283..307351,307388..307456,
FT                   307514..307582,307643..307711,307739..307807,
FT                   307820..307888,307916..307984)
FT                   /note="8 probable transmembrane helices predicted for
FT                   BP0302 by TMHMM2.0 at aa 12-34, 63-85, 98-120, 140-162,
FT                   183-205, 215-237, 242-264 and 274-296"
FT   CDS_pept        308021..308986
FT                   /transl_table=11
FT                   /locus_tag="BP0303"
FT                   /product="probable branched-chain amino acid transport
FT                   system, permease component"
FT                   /note="Similar to Rhizobium meliloti putative permease ABC
FT                   transporter protein Smc03117 TR:CAC47555 (EMBL:AL591792)
FT                   (330 aa) fasta scores: E(): 4.2e-27, 39.000% id in 300 aa,
FT                   and to Agrobacterium tumefaciens Agr_l_1453p TR:AAK89305
FT                   (EMBL:AE008271) (335 aa) fasta scores: E(): 4.9e-28,
FT                   38.658% id in 313 aa"
FT                   /db_xref="GOA:Q7W059"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W059"
FT                   /protein_id="CAE40681.1"
FT                   /translation="MHRSTLWTLALLAALALFPLVAPALGLDFYISFVRRVLIYALAAT
FT                   SLNLILGYGGMVALGHAAFFGAGAYAVGILGAAGITSALLAWPAAIALAGALAWITGAI
FT                   SLRTRGVYFIMITLAFAQMVYYVFISLRQYGGEDGLNLSGYSTLPGLDLANDLTFYYLV
FT                   LVLFAVLMGVFGRVVDSRFGAALQGIRENESRMESLGYPVYRLKLTAFVISGAAAGLAG
FT                   ALLANHNLFISPSLMHWTQSANLLIMVLVGGIGLRYGGVAGAVVMLVLEEVLRQWTEYW
FT                   HLPLGVLLLCVVLGAPRGLVGLVGPWFAGRAGADSTRAGT"
FT   misc_feature    308021..308098
FT                   /note="Signal peptide predicted for BP0303 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.617 between residues 26 and 27"
FT   misc_feature    join(308033..308101,308129..308197,308201..308260,
FT                   308270..308338,308351..308419,308477..308545,
FT                   308648..308716,308759..308827,308864..308932)
FT                   /note="9 probable transmembrane helices predicted for
FT                   BP0303 by TMHMM2.0 at aa 5-27, 37-59, 61-80, 84-106,
FT                   111-133, 153-175, 210-232, 247-269 and 282-304"
FT   misc_feature    308096..308935
FT                   /note="HMMPfam hit to PF02653, Branched-chain amino acid
FT                   transport system / permease component"
FT   CDS_pept        308983..309777
FT                   /transl_table=11
FT                   /locus_tag="BP0304"
FT                   /product="putative branched-chain amino acid transporter,
FT                   ATP-binding protein"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   branched-chain amino acid transport ATP-binding protein
FT                   Scf42.19C TR:Q9L2J9 (EMBL:AL137165) (266 aa) fasta scores:
FT                   E(): 9.1e-30, 43.243% id in 259 aa, and to Rhizobium
FT                   meliloti putative branched-chain amino acid uptake ABC
FT                   transporter ATP-binding protein Smb20785 TR:CAC49877
FT                   (EMBL:AL603647) (254 aa) fasta scores: E(): 1.8e-26,
FT                   41.057% id in 246 aa"
FT                   /db_xref="GOA:Q7W058"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W058"
FT                   /protein_id="CAE40682.1"
FT                   /translation="MNAPAASPALRADGLVRRFGALVATDRVSLTLAPGEIHALIGPNG
FT                   AGKSTLIHLLSGTLPADAGSLKMGERDITALNAHQRVAAGLSRSYQITNIFKSFSVLDN
FT                   LLLAVQARAGSSFRFWRRRAAERELYDAAHELARQCAIDAGMLQRPAGTLPHGEQRKVE
FT                   FALALAARPSVLLLDEPMAGMGPDETLRLTELIETLRGRAAMLLVEHDMQAVFRLADRI
FT                   SVLVYGRVIATGTPEQIRANPEVRQAYLGDEEQTAALEGARC"
FT   misc_feature    309085..309666
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    309106..309129
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        309771..310475
FT                   /transl_table=11
FT                   /locus_tag="BP0305"
FT                   /product="high-affinity branched-chain amino acid
FT                   transporter, ATP-binding protein"
FT                   /note="Similar to Escherichia coli high-affinity
FT                   branched-chain amino acid transport ATP-binding protein
FT                   LivF or B3454 SW:LIVF_ECOLI (P22731) (237 aa) fasta scores:
FT                   E(): 7.5e-27, 44.915% id in 236 aa, and to Alcaligenes
FT                   eutrophus TR:P95538 (EMBL:D64144) (240 aa) fasta scores:
FT                   E(): 7e-54, 67.521% id in 234 aa"
FT                   /db_xref="GOA:Q7W057"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W057"
FT                   /protein_id="CAE40683.1"
FT                   /translation="MLNVNAVESGYGASQVLFGVDLEIGAGQVVTLLGRNGMGKTTLLR
FT                   TLFGQLPLRAGSVRFAGQEIGGWSPDRIARAGLAIVPEGHQCFPNLTVREHLTAFVAAR
FT                   NPSIGQPWTPQRVFELFPRLGERAGNMGNQLSGGEQQMLAIGRALVTNPRLLILDEATE
FT                   GLAPKIREEIWTCLARLREAGQTILVIDKYVERLLGLADRHVILERGKVVWKGDSAALD
FT                   ADRGLWERYLGV"
FT   misc_feature    309849..310400
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    309870..309893
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    310173..310217
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   CDS_pept        join(310681..311124,311126..313027)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0306"
FT                   /product="probable bifunctional hydroxylase/oxidoreductase
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a stop codon
FT                   and a frameshift following codon 148. The sequence has been
FT                   checked and believed to be correct. Similar to Azoarcus
FT                   evansii 2-amninobenzoyl-CoA monooxygenase/reductase
FT                   TR:AAL02071 (EMBL:AF320254) (773 aa) fasta scores: E():
FT                   8.4e-206, 64.277% id in 781 aa, and to Streptomyces
FT                   coelicolor putative bifunctional hydroxylase/oxidoreductase
FT                   Stbac16h6.15 TR:CAC44594 (EMBL:AL596162) (801 aa) fasta
FT                   scores: E(): 1.2e-88, 52.734% id in 768 aa"
FT                   /db_xref="PSEUDO:CAE40684.1"
FT   misc_feature    join(311071..311124,311126..311707)
FT                   /note="HMMPfam hit to PF01360, Monooxygenase"
FT   variation       311125..311127
FT                   /note="TAA stop codon in pertussis; TAcgccgA (no stop
FT                   codon) in parapertussis"
FT   misc_feature    311918..312937
FT                   /note="HMMPfam hit to PF00724, NADH:flavin oxidoreductase /
FT                   NADH oxidase family"
FT   misc_feature    312173..312217
FT                   /note="ScanRegExp hit to PS00399, ATP-citrate lyase /
FT                   succinyl-CoA ligases family active site."
FT   misc_feature    312428..312466
FT                   /note="ScanRegExp hit to PS00383, Tyrosine specific protein
FT                   phosphatases active site."
FT   CDS_pept        join(313024..313272,313275..313817)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0308"
FT                   /product="probable short chain dehydrogenase (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 83. The frameshift occurs within a
FT                   polymeric tract of (GC)6. The sequence has been checked and
FT                   believed to be correct. Similar to Pseudomonas spGM101
FT                   beta-hydroxybutyrate dehydrogenase HbdH TR:Q9KH52
FT                   (EMBL:AF271714) (255 aa) fasta scores: E(): 2e-30, 45.669%
FT                   id in 254 aa, and to Thauera aromatica putative alcohol
FT                   dehydrogenase TR:Q9AJT0 (EMBL:AJ278289) (260 aa) fasta
FT                   scores: E(): 3.3e-53, 63.320% id in 259 aa"
FT                   /db_xref="PSEUDO:CAE40685.1"
FT   misc_feature    join(313054..313272,313275..313607)
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase"
FT   variation       313264..313275
FT                   /note="(GC)6 in pertussis; (GC)5 in parapertussis"
FT   misc_feature    313458..313544
FT                   /note="ScanRegExp hit to PS00061, Short-chain
FT                   dehydrogenases/reductases family signature."
FT   misc_feature    313698..313790
FT                   /note="HMMPfam hit to PF00678,"
FT   CDS_pept        313839..314702
FT                   /transl_table=11
FT                   /locus_tag="BP0309"
FT                   /product="putative enoyl-CoA hydratase/isomerase"
FT                   /note="Similar to Azoarcus evansii putative enoyl-CoA
FT                   hydratase/isomerase TR:AAL02065 (EMBL:AF320253) (281 aa)
FT                   fasta scores: E(): 7.9e-79, 71.583% id in 278 aa, and to
FT                   Rhizobium loti Mll5431 protein TR:Q98BT8 (EMBL:AP003006)
FT                   (267 aa) fasta scores: E(): 7.8e-71, 67.407% id in 270 aa"
FT                   /db_xref="GOA:Q7W056"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W056"
FT                   /protein_id="CAE40686.1"
FT                   /translation="MTQSEQVHTMKHHKRPYAGHAARTFQWQVSDDGKIATITLNRPER
FT                   KNPLTFDSYAELRDLFRGLVYATDIKVVVLTGAGGNFCSGGDVHEIIGPLTRMSMPELL
FT                   DFTRMTGDLVKAMRACPQPIVAAVDGVCAGAGAMMALASDMRLGTPAARTAFLFTRVGL
FT                   AGADMGACTLLPRMIGQGRASELLYTGRAMNADEGLQWGFFNALHDPAELSGAALALAE
FT                   QLAAGPTFAHGVTKKLLHQEWNMGVDEAIEAEAQAQAQAICMQTQDFRRAYDAFVARRK
FT                   PVFEGD"
FT   misc_feature    313944..314465
FT                   /note="HMMPfam hit to PF00378, Enoyl-CoA
FT                   hydratase/isomerase family"
FT   misc_feature    314211..314273
FT                   /note="ScanRegExp hit to PS00166, Enoyl-CoA
FT                   hydratase/isomerase signature."
FT   CDS_pept        314705..315874
FT                   /transl_table=11
FT                   /locus_tag="BP0310"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /note="Similar to Azoarcus evansii putative acyl-CoA
FT                   dehydrogenase TR:AAL02066 (EMBL:AF320253) (404 aa) fasta
FT                   scores: E(): 2.7e-99, 71.318% id in 387 aa, and to Thauera
FT                   aromatica putative acyl-CoA dehydrogenase TR:Q9AJS9
FT                   (EMBL:AJ278289) (388 aa) fasta scores: E(): 3e-95, 67.700%
FT                   id in 387 aa"
FT                   /db_xref="GOA:Q7W055"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W055"
FT                   /protein_id="CAE40687.1"
FT                   /translation="MPDLSWQDWPFFDPLHRELARELEAWCGPALAAIDHRDTDAACCA
FT                   LVRSLGQAGWLRYAVPAGPGGGWGGRLPKIDSRAVCILRETLARHDGLADFAFAMQGLG
FT                   SGAISLMGSDALRQQYLPPVARGEAIAAFALSEPEAGSDVAALACEARADGDGYVLNGE
FT                   KTWISNGGIADFYCVFARTGEAPGARGISAFVVDAGTPGLEIAERIDLIAPHPLARLRF
FT                   ADCRIPASRRLGEAGQGFKLAMMTLDIFRASVVAAALGFARRALDEGLARARGRRMFGQ
FT                   TLADLQLTQAALGDMATAVDASALLTYRAAWMRDVQEVRTTREAAMAKMTATESAQAVI
FT                   DRALQMFGGAGVVAGTTVERLYREIRALHIYEGATEVQKLIIARELLKS"
FT   misc_feature    314993..315319
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal domain"
FT   misc_feature    315104..315142
FT                   /note="ScanRegExp hit to PS00072, Acyl-CoA dehydrogenases
FT                   signature 1. Confirmed by InterPro eMOTIF pattern match."
FT   misc_feature    315362..315856
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal domain"
FT   CDS_pept        315915..317564
FT                   /transl_table=11
FT                   /locus_tag="BP0311"
FT                   /product="probable acid-coenzyme A ligase"
FT                   /note="Similar to Rhodopseudomonas palustris
FT                   benzoate-coenzyme A ligase BadA TR:Q59760 (EMBL:L42322)
FT                   (521 aa) fasta scores: E(): 1.1e-49, 34.990% id in 523 aa,
FT                   and to Azoarcus evansii 2-aminobenzoate-CoA ligase
FT                   TR:AAL02069 (EMBL:AF320253) (542 aa) fasta scores: E():
FT                   5.2e-121, 58.165% id in 545 aa"
FT                   /db_xref="GOA:Q7W054"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W054"
FT                   /protein_id="CAE40688.1"
FT                   /translation="MEPSAHLDSFARDNLPPASEWPEFLLDGPDVAYPKRFNCAAELVD
FT                   AMVRQGHGERVALRWRQDERIETMTYGQLQALTNRIARVLVEDMGLVPGNRLLLRGPNN
FT                   PMMAAAWLGAIKAGLVTVPTMPLLRAKELRQIIEKAQVQAVLCDARLKDEALHCAAPAH
FT                   EHYCPGLGQVMLFNDGAPDALDARAAAKPEDFPACDTAADDVCLIAFTSGTTGAPKGCM
FT                   HFHRDVLAMCDLFPRHVIRPGPDDIFCGTPPLAFTFGLGGLLCFPLRVGASAVLAEKLS
FT                   PDTLLALIHDFRATISFTAPTFYRQMAALAPKYDISSLRKSVSAGEALPDATRQLWRQA
FT                   TGIEMIDGIGGTEMIHVFVSSPPEEVRQGAIGKAVPGYVAEVVDEQMRPVPNGTVGRLA
FT                   IKGPTGCRYLADERQQRFVQQGWNLPGDTFLRDDDGYFFYQARNDDMIISAGYNIAGPE
FT                   VEDALLRHEAVAECGVVGAPDDDRGQLVKAYVVLKPGYEPDDALAAALQAFVKAGIAPY
FT                   KYPRAIEFVDALPRTETGKLQRFALRRMAAEG"
FT   misc_feature    316122..317336
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme"
FT   misc_feature    316536..316571
FT                   /note="ScanRegExp hit to PS00455, Putative AMP-binding
FT                   domain signature. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   CDS_pept        317566..318000
FT                   /transl_table=11
FT                   /locus_tag="BP0312"
FT                   /product="probable 4-hydroxybenzoyl CoA thioesterase"
FT                   /note="Similar to Pseudomonas SpdJ-12. 4-hydroxybenzoyl-CoA
FT                   thioesterase FcbC TR:Q9RBQ8 (EMBL:AF051771) (142 aa) fasta
FT                   scores: E(): 7.8e-07, 33.333% id in 132 aa, and to Bacillus
FT                   halodurans 4-hydroxybenzoyl-CoA thioesterase Bh1999
FT                   TR:Q9KBC9 (EMBL:AP001514) (138 aa) fasta scores: E():
FT                   3.8e-05, 26.772% id in 127 aa"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W053"
FT                   /protein_id="CAE40689.1"
FT                   /translation="MAEPFVSEVEVRFRHCDPAGIVFYPRYFEMINDFVEEWFDKGMGL
FT                   PFHALHVDRHIGTPLASVQCDFSAPSRWHERLRQELSVRRIGGASFRADVRFLGPDDRL
FT                   RLSADLTIVTVDLRSMRSTPLPDDLRARMQAFLSPQARDA"
FT   CDS_pept        318025..318426
FT                   /transl_table=11
FT                   /locus_tag="BP0313"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Azoarcus evansii hypothetical 14.6 kDa
FT                   protein TR:AAL02075 (EMBL:AF320254) (132 aa) fasta scores:
FT                   E(): 3e-28, 55.303% id in 132 aa, and to Rhizobium loti
FT                   Mll5429 protein TR:Q98BU0 (EMBL:AP003006) (137 aa) fasta
FT                   scores: E(): 3.2e-31, 62.879% id in 132 aa"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W052"
FT                   /protein_id="CAE40690.1"
FT                   /translation="MKILQPPDWLAPRGYSNGTLTEMAVGSKLVFVGGQVGWNGQQQFE
FT                   TDDFAEQVRQTLVNVLAIMAEGGAGPQHIVRMTWYVKNKAEYVASYPEIGKHYRELIGR
FT                   HFPAMTAVEVADLIEDRAKVEIEVTAVIP"
FT   misc_feature    318046..318420
FT                   /note="HMMPfam hit to PF01042, YjgF family"
FT   CDS_pept        complement(318520..320145)
FT                   /transl_table=11
FT                   /locus_tag="BP0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Vibrio cholerae hypothetical protein
FT                   Vca1085 TR:Q9KKL8 (EMBL:AE004434) (556 aa) fasta scores:
FT                   E(): 3.5e-23, 27.632% id in 456 aa, and to Thermotoga
FT                   maritima conserved hypothetical protein Tm0735 TR:Q9WZJ4
FT                   (EMBL:AE001744) (455 aa) fasta scores: E(): 2.1e-13,
FT                   30.947% id in 475 aa"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W051"
FT                   /protein_id="CAE40691.1"
FT                   /translation="MTIANALQLELDEATCVLSAAYAPTGENDTLPTWDTLVAAVQARG
FT                   WPATVLDQISAIVFIEQCRDTAGPVEACIGEVRNGTFELEVAEDRMSAQLTLRAPKGGQ
FT                   PVGESDLLAGLQAHGIVHGLIPEALRQALERGACEALEIARGTLPEAGEPARFESLLDA
FT                   LKTRLSEDDENAIIDYRNLGDLTLVSAGTPLMRRIPATPGQPGTNVLGGPVAPPAVADP
FT                   PFAPKLNGVEVDPEDPGLLRAAIAGSPMLVQHGATVNSLVEVPAVDLSSGNIDFEGTLR
FT                   VKGDITAGMHVRVSGDVVVNGTIEAAHVEAGGNVTVNGGIIGSAEGVADSRGGSRMARI
FT                   VSGGSVKARFIDNAQVRAEKNVAAEREIRQSTVTAGETITVGPPGSQQGVITGGTAHAY
FT                   KSVHAGTLGSMAGIPTVVRAGLNPHANAKRAALETRARELEEEKAKLEKLILFLHNNPA
FT                   KNVNNMSERARQTHAKISADLVELQAEDARLAKELQPLETAMIVASRRFFGGVTLHLGV
FT                   KVTEFLEDQVGGKAVLEQGELAIR"
FT   misc_feature    complement(319474..319494)
FT                   /note="ScanRegExp hit to PS00092, N-6 Adenine-specific DNA
FT                   methylases signature."
FT   CDS_pept        complement(320385..321668)
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /gene_synonym="gsa"
FT                   /gene_synonym="popC"
FT                   /locus_tag="BP0315"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="Similar to Escherichia coli glutamate-1-semialdehyde
FT                   2,1-aminomutase HemL or Gsa or PopC or B0154 SW:GSA_ECOLI
FT                   (P23893) (426 aa) fasta scores: E(): 6.9e-94, 60.094% id in
FT                   426 aa, and to Neisseria meningitidis
FT                   glutamate-1-semialdehyde 2,1-aminomutase HemL or Nma0592
FT                   SW:GSA_NEIMA (Q9JW10) (427 aa) fasta scores: E(): 3.1e-105,
FT                   65.808% id in 427 aa"
FT                   /db_xref="GOA:Q7W050"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W050"
FT                   /protein_id="CAE40692.1"
FT                   /translation="MSTNAELFDRACRSIPGGVNSPVRAFRSVGGTPRFIQRAQGPYVW
FT                   DAEGKQYIDYVGSWGPAILGHAHPEVVRAVQEAAVHGLSFGAPTEAEVELAEMLIARLP
FT                   SLEQVRLVSSGTEATMTAIRLARGATGRHKIIKFEGCYHGHSDSLLVKAGSGLLTFGNP
FT                   SSAGVPPEFVAHTLTLEFNNLAVVDAAFSQHGAEIACVIVEPVAGNMNLIKPAEGFLAG
FT                   LRELCTRHGAVLIFDEVMTGFRIGPQGVQGLTGVRPDLTTLAKVIGGGMPVGAFGGRAD
FT                   LMTHIAPLGGVYQAGTLSGNPVAVAAGLATMRLIGEPGFYERLSAQTARLAQGLQERAR
FT                   AAGVPFSADAIGGMFGLYFGDRVPASFAEVSACDTEAFKRFFHAMLERGIHFAPSAFEA
FT                   GFVSATHDDAVIDATLEAAEQVFATLRA"
FT   misc_feature    complement(320457..321548)
FT                   /note="HMMPfam hit to PF00202, Aminotransferase class-III"
FT   misc_feature    complement(320859..320969)
FT                   /note="ScanRegExp hit to PS00600, Aminotransferases
FT                   class-III pyridoxal-phosphate attachment site."
FT   CDS_pept        complement(321685..322338)
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="BP0316"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="Similar to Escherichia coli thiamine-phosphate
FT                   pyrophosphorylase ThiE or B3993 SW:THIE_ECOLI (P30137) (211
FT                   aa) fasta scores: E(): 4.3e-12, 37.811% id in 201 aa, and
FT                   to Xylella fastidiosa thiamin-phosphate pyrophosphorylase
FT                   Xf0378 TR:Q9PGC4 (EMBL:AE003889) (234 aa) fasta scores:
FT                   E(): 5.2e-25, 43.062% id in 209 aa"
FT                   /db_xref="GOA:Q7W049"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W049"
FT                   /protein_id="CAE40693.1"
FT                   /translation="MKTLRFPAGLYGITPEWDDTDRLLAAVRAAAAGGMTALQLRRKLA
FT                   DERLRAAQARALAPLCRELGVVFLVNDHWKLALDVGADGAHLGRDDADPATVRAQAGAG
FT                   LLLGVSCYNDLRRADALLAAGADYVAFGTVFASPTKPEAVHAPLQTLTEARARVLACPA
FT                   PRPAVVAIGGITPANVSQVAQAGADSAAVISGLFEAPDIQAAARACAAAFSVNP"
FT   misc_feature    complement(321751..322179)
FT                   /note="HMMPfam hit to PF02581, Thiamine monophosphate
FT                   synthase/TENI"
FT   CDS_pept        complement(322335..323183)
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="BP0317"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="Similar to Escherichia coli phosphomethylpyrimidine
FT                   kinase ThiD or B2103 SW:THID_ECOLI (P76422) (266 aa) fasta
FT                   scores: E(): 0.0004, 24.255% id in 235 aa, and to
FT                   Pseudomonas aeruginosa phosphomethylpyrimidine kinase ThiD
FT                   or Pa3975 TR:Q9HX41 (EMBL:AE004815) (265 aa) fasta scores:
FT                   E(): 3.6e-12, 31.298% id in 262 aa"
FT                   /db_xref="GOA:Q7W048"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W048"
FT                   /protein_id="CAE40694.1"
FT                   /translation="MRPDYPFFAVVPVLDSVTPPLVLIIGPVDPSGADGLPADAVSCAR
FT                   LGCHALAAVTALTVQDTAGIEEVHPVAPELLDDQARCLLEDMSVQAIKVGALLSAEAAS
FT                   VAAQIAADYSHVPLVLHLGQRTPLPQDAADQDDADDLLAATLELVLPQTDLVVVEHVRL
FT                   AQWQADGSIDTSGAPSPAHALLAGGAQWALVLGSPARPGHQVNMLVGPEGQTSTWPWQA
FT                   PPDRNGDTGGVAAIAAAAMLAQGMEMPRAVEQALAHAERTIAASFLPGMGRRLPNRVAQ
FT                   S"
FT   CDS_pept        323300..323464
FT                   /transl_table=11
FT                   /gene="rubA"
FT                   /locus_tag="BP0318"
FT                   /product="rubredoxin"
FT                   /note="Similar to Acinetobacter calcoaceticus rubredoxin
FT                   RubA SW:RUBR_ACICA (P42453) (54 aa) fasta scores: E():
FT                   1.2e-15, 55.556% id in 54 aa, and to Pseudomonas aeruginosa
FT                   rubredoxin Pa5350 TR:Q9HTK8 (EMBL:AE004947) (55 aa) fasta
FT                   scores: E(): 6.2e-16, 62.963% id in 54 aa"
FT                   /db_xref="GOA:Q7W047"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W047"
FT                   /protein_id="CAE40695.1"
FT                   /translation="MRTWMCLICGWVYDEEAGLPDEGIAPGTRWEDVPPNWVCPECGAR
FT                   KEDFELMEI"
FT   misc_feature    323300..323446
FT                   /note="HMMPfam hit to PF00301, Rubredoxin"
FT   misc_feature    323396..323428
FT                   /note="ScanRegExp hit to PS00202, Rubredoxin signature."
FT   CDS_pept        323552..324157
FT                   /transl_table=11
FT                   /locus_tag="BP0319"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa AlgH or Pa0405
FT                   TR:Q9RQ16 (EMBL:AF137022) (189 aa) fasta scores: E():
FT                   2.9e-31, 49.730% id in 185 aa, and to Neisseria
FT                   meningitidis hypothetical protein Nma1550 TR:Q9JU12
FT                   (EMBL:AL162756) (182 aa) fasta scores: E(): 7.6e-30,
FT                   43.407% id in 182 aa"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W046"
FT                   /protein_id="CAE40696.1"
FT                   /translation="MTDSHRPDADDIPDDDELSTDFSNQFLLAMPGVVEGSLAGTVIYI
FT                   CEHTRRGALGLVINRPTDLTLATLFERIDLKLEIGPVKDEMVFFGGPVQTDRGFVLHAP
FT                   AGDYTSSINLGELALTTSRDVLQAVADGNGPARMLVTLGYAGWGAGQLESEMAQNSWLS
FT                   VGADSHIIFDVAPEDRYPAALKLLGVDPVMLAGGAGHA"
FT   misc_feature    323609..324154
FT                   /note="HMMPfam hit to PF02622, Uncharacterized ACR,
FT                   COG1678"
FT   CDS_pept        324150..324551
FT                   /transl_table=11
FT                   /locus_tag="BP0320"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YqgF or B2949 SW:YQGF_ECOLI (P52050) (138 aa) fasta scores:
FT                   E(): 1.9e-19, 47.727% id in 132 aa, and to Pasteurella
FT                   multocida hypothetical protein Pm1870 TR:Q9CJX0
FT                   (EMBL:AE006224) (140 aa) fasta scores: E(): 6.2e-17,
FT                   43.182% id in 132 aa"
FT                   /db_xref="GOA:Q7W045"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W045"
FT                   /protein_id="CAE40697.1"
FT                   /translation="MPEETLLAFDFGEKKIGIAIGNTLTRQARPLEIIFSETRAARFGR
FT                   IGQLLQEWQPQRAVVGLPLTLDGQEQPASARARRFANQLHGHFGLAVELVDERSSSMEA
FT                   QQLLGTHADDDAVAAAVILQRYLDTLSQP"
FT   CDS_pept        324565..325518
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="BP0321"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="Similar to Pseudomonas putida aspartate
FT                   carbamoyltransferase PyrB SW:PYRB_PSEPU (Q59711) (334 aa)
FT                   fasta scores: E(): 6.5e-77, 64.821% id in 307 aa, and to
FT                   Pseudomonas aeruginosa aspartate carbamoyltransferase PyrB
FT                   or Pa0402 SW:PYRB_PSEAE (Q59653) (334 aa) fasta scores:
FT                   E(): 2.7e-78, 66.234% id in 308 aa"
FT                   /db_xref="GOA:Q7W044"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W044"
FT                   /protein_id="CAE40698.1"
FT                   /translation="MLNPQLNRHGELIHLLSTEGLPRRIIEQILDLAATFVPAPGQEFP
FT                   KLPLLHGKSVFNLFFENSTRTRTTFEIAAKRLSADVVNLNIAASSTSKGESLLDTIANL
FT                   SAMQADLFVVRHGASGAPYLIAQHVAPHVHVINAGDGRHAHPTQALLDMYTIRHHKGDF
FT                   NQLTVAIVGDVLHSRVARSDIHALTTLGVPEVRVVAPATLLPEGLAQMGVRVCTDMEEG
FT                   LRDADVVIMLRLQNERMRGALLPSAHEYFKHYGLTQARLALARPDAIVMHPGPMNRGVE
FT                   IASEVADSGQAVILDQVTFGIAVRMAAMSLVAGVRP"
FT   misc_feature    324604..325044
FT                   /note="HMMPfam hit to PF02729, Aspartate/ornithine
FT                   carbamoyltransferase, carbamoyl-P binding domain"
FT   misc_feature    324739..324762
FT                   /note="ScanRegExp hit to PS00097, Aspartate and ornithine
FT                   carbamoyltransferases signature."
FT   misc_feature    325051..325503
FT                   /note="HMMPfam hit to PF00185, Aspartate/ornithine
FT                   carbamoyltransferase, Asp/Orn binding domain"
FT   CDS_pept        325515..326690
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /gene_synonym="pyrC'"
FT                   /gene_synonym="pyrX"
FT                   /locus_tag="BP0322"
FT                   /product="dihydroorotase"
FT                   /note="Similar to Pseudomonas aeruginosa
FT                   dihydroorotase-like protein PyrC' or PyrX or Pa0401
FT                   SW:PYRX_PSEAE (Q51551) (423 aa) fasta scores: E(): 5.5e-50,
FT                   44.041% id in 386 aa, and to Pseudomonas putida
FT                   dihydroorotase-like protein PyrC' SW:PYRX_PSEPU (Q59712)
FT                   (424 aa) fasta scores: E(): 2.5e-49, 42.674% id in 389 aa"
FT                   /db_xref="GOA:Q7W043"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W043"
FT                   /protein_id="CAE40699.1"
FT                   /translation="MTVRTVRIAGGRLIDPASGADARADLYLADGRIAAIGQAPAGFQA
FT                   QQHIDARGLAVLPGLVDLSARVHGAGLAPLACEMQAALAGGVTRLVVPPDTDPPLDEPG
FT                   RVEMLRHRAHQAGQAQLHPLGALTEGLRGERLSEMAALAEAGCVAFSQAGLPVADTRVL
FT                   WRAMQYARTFGLALWLRPLDPWMGRDGVAAAGAYASRLGLAEVPVQAETLALHTIFELQ
FT                   RATGARVHLMRLSSAAGVALVRAARREGLPLTCDVAAHQIHLTDVDIGFFDSRFRLDPP
FT                   LRGQRDRDAIVAGLADDTIDAICSDHRPVGDTGKLLPFAEAEAGASGLELLLSLTLKWA
FT                   QRERVPLARALALVTSAPAAILRAATAAPPPCGELAAGAPADLCLVDLDAD"
FT   misc_feature    325653..326684
FT                   /note="HMMPfam hit to PF00744, Dihydroorotase-like"
FT   CDS_pept        326810..327550
FT                   /transl_table=11
FT                   /locus_tag="BP0323"
FT                   /product="acyltransferase"
FT                   /note="Similar to Neisseria gonorrhoeae
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase PlsC
FT                   SW:PLSC_NEIGO (Q59601) (255 aa) fasta scores: E(): 5.3e-21,
FT                   33.862% id in 189 aa, and to Burkholderia pseudomallei
FT                   putative 1-acyl-sn-glycerol-3-phosphate acyltransferase
FT                   PlsC TR:O69114 (EMBL:AF064070) (289 aa) fasta scores: E():
FT                   6.4e-25, 34.694% id in 245 aa"
FT                   /db_xref="GOA:Q7W042"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W042"
FT                   /protein_id="CAE40700.1"
FT                   /translation="MKLLRFVFRVFLVVPWVLFGLLCVTLVYRGLRQDQRARLNRCWSA
FT                   CLMRLCGIAVHVRGAPRLRGGVLWVANHVSWIDIFVVNSVRATSFVAKSEIRAWPVIGY
FT                   LAAGAGTLFIDRTQRHAVHAMGQSIHDCFARGDAVGLFPEGTTTEGFTTRPFHASLFEP
FT                   ARAEGVDIQPVALRFMHRGQRSGFAAFVGEETLVANLWRVLGTTGLAVEVVFLEPLPTQ
FT                   HAEGHQPTRLELSHMVRNAIAGEL"
FT   misc_feature    326828..326896
FT                   /note="1 probable transmembrane helix predicted for BP0323
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    326978..327520
FT                   /note="HMMPfam hit to PF01553, Acyltransferase"
FT   CDS_pept        complement(327587..328420)
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="BP0324"
FT                   /product="diadenosine-tetraphosphatase"
FT                   /EC_number="3.6.1.41"
FT                   /note="Similar to Escherichia coli
FT                   bis(5'-nucleosyl)-tetraphosphatase ApaH or B0049
FT                   SW:APAH_ECOLI (P05637) (280 aa) fasta scores: E(): 6.3e-42,
FT                   40.221% id in 271 aa, and to Burkholderia pseudomallei
FT                   bis(5'-nucleosyl)-tetraphosphatase ApaH SW:APAH_BURPS
FT                   (O69115) (282 aa) fasta scores: E(): 1.5e-63, 56.767% id in
FT                   266 aa"
FT                   /db_xref="GOA:Q7W041"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W041"
FT                   /protein_id="CAE40701.1"
FT                   /translation="MKGNIWTIGDVQGCCAPLAELLAHPEIAGDTDSRFWFAGDLVNRG
FT                   PQSLAVLRRIMAMGERCTAVLGNHDLHLLAAYAGVRKPSKSDTLDEVLQAPDAVDLIDW
FT                   LRFRPLAHYEAGHLMVHAGVLAKWDVAKTLALAGEVEQALRGPNWRKALQKMYGNEPAT
FT                   WKDDHTGGKRMRVIINALTRIRLCTPSGHMEFATKVAPGAWPAGLVPWFDVPNRATRDV
FT                   TVVFGHWSTLGLLMRPDVICLDTGCVWGGALSALRLHDRKLVQVKCKRFQDPNGD"
FT   CDS_pept        complement(328417..329595)
FT                   /transl_table=11
FT                   /locus_tag="BP0325"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa3827 TR:Q9HXH5 (EMBL:AE004800) (355 aa) fasta
FT                   scores: E(): 3e-11, 28.212% id in 358 aa, and to Vibrio
FT                   cholerae hypothetical protein Vc2499 TR:Q9KP76
FT                   (EMBL:AE004319) (356 aa) fasta scores: E(): 9.1e-10,
FT                   25.956% id in 366 aa"
FT                   /db_xref="GOA:Q7W040"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W040"
FT                   /protein_id="CAE40702.1"
FT                   /translation="MRTARRYLAREIYRSCAVVLLALLGLFTFFALVDDLDNVGDKFSM
FT                   LALFYMQALALPTRLYDLLPIGLLIGAILALAGLAQRNELVILRVSGVSGMRLLGMLWV
FT                   ITIPLMIGATLLSEFVTPAAEIKSGEADLTFRGKTGGGRLNSGYWFKEPTPQNGTRIIN
FT                   IKTLLADGQVKDVTLYEFRSDLEMTALWTAPNGRFSRGDLVLTDVSETRIDEHAPSALA
FT                   DAKQPKEPPARVTKVPELKLDTTLSPERLLARVLTPERMSALTLVDYIEYLRHNQLQYD
FT                   RQVVALWRKLVYPFTLLVMITIAAPIGFMQTRRGGVGAKVFIGILLGVGFFMLNQLALN
FT                   VGMLSRWPPWITALGPNLGALLLAFGALSMMEYRHAIARFMQHRWPWRKVPA"
FT   misc_feature    complement(join(328483..328548,328579..328644,
FT                   328666..328722,329275..329340,329356..329421,
FT                   329497..329562))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP0325 by TMHMM2.0 at aa 41-63, 88-110, 115-137, 321-340,
FT                   347-369 and 379-401"
FT   misc_feature    complement(329497..329595)
FT                   /note="Signal peptide predicted for BP0325 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.991 between residues 33 and 34"
FT   CDS_pept        complement(329692..330363)
FT                   /transl_table=11
FT                   /gene="mtgA"
FT                   /locus_tag="BP0326"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /EC_number="2.4.2.-"
FT                   /note="Similar to Escherichia coli monofunctional
FT                   biosynthetic peptidoglycan transglycosylase MtgA or B3208
FT                   SW:MTGA_ECOLI (P46022) (242 aa) fasta scores: E(): 6.1e-24,
FT                   39.623% id in 212 aa, and to Neisseria gonorrhoeae
FT                   monofunctional biosynthetic peptidoglycan transglycosylase
FT                   MtgA SW:MTGA_NEIGO (Q51005) (233 aa) fasta scores: E():
FT                   3.8e-33, 44.495% id in 218 aa"
FT                   /db_xref="GOA:Q7W039"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W039"
FT                   /protein_id="CAE40703.1"
FT                   /translation="MAVLCIAILYQLWMFSLVVWYAYRDPGSSAIMRQELARLRERDPE
FT                   AELKYQWVPYDRISNTLKQAVVASEDANFTEHDGVEWDAIRKAWEYNQRQAERGRTKMR
FT                   GGSTITQQLAKNLFLSGSRSYLRKGQELVLAYMIEHVMPKERILELYLNVAEWGVGVFG
FT                   AEAAARHYYNTSAARLGAGQAARLAAMLPNPRYYDRHRNTGYLNSRTATLTRRMRMVEI
FT                   P"
FT   misc_feature    complement(329752..330276)
FT                   /note="HMMPfam hit to PF00912, Transglycosylase"
FT   misc_feature    complement(330322..330387)
FT                   /note="1 probable transmembrane helix predicted for BP0326
FT                   by TMHMM2.0 at aa 46-68"
FT   repeat_region   330441..330472
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   330441..331493
FT   CDS_pept        330543..331493
FT                   /transl_table=11
FT                   /locus_tag="BP0327"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q79H25"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H25"
FT                   /protein_id="CAE40704.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT"
FT   misc_feature    330801..330866
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    330924..331457
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(331462..331493)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(331490..331864)
FT                   /transl_table=11
FT                   /locus_tag="BP0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacillus halodurans Bh0200 protein
FT                   TR:Q9KGB0 (EMBL:AP001507) (107 aa) fasta scores: E(): 3.3,
FT                   30.108% id in 93 aa, and to the N-terminal region of Vibrio
FT                   cholerae UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase
FT                   Vc0918 TR:Q9KTI4 (EMBL:AE004175) (413 aa) fasta scores:
FT                   E(): 8.2, 26.126% id in 111 aa. Also similar to BP0934,
FT                   48.598% identity (48.598% ungapped) in 107 aa overlap."
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W038"
FT                   /protein_id="CAE40705.1"
FT                   /translation="MNAMPRHKLVVLTNPVEGREQEFDDWYMNTHMPDVMRVPGFVSGQ
FT                   RFTWAHAQAKPHAQTWRYLTILEIDTDDLQATLDDLMARPGTAAMRMSDALAEQRLAYV
FT                   FTAATPVFAPDGAGGITLRD"
FT   CDS_pept        complement(331861..333540)
FT                   /transl_table=11
FT                   /locus_tag="BP0329"
FT                   /product="putative coenzyme A ligase"
FT                   /note="Similar to Pseudomonas diterpeniphila coenzyme A
FT                   ligase TdtL TR:AAK95584 (EMBL:AF274704) (543 aa) fasta
FT                   scores: E(): 3.2e-55, 36.813% id in 546 aa, and to
FT                   Streptomyces griseus subspgriseus NonL TR:O85737
FT                   (EMBL:AF074603) (555 aa) fasta scores: E(): 4.4e-53,
FT                   35.754% id in 537 aa. Also similar to BP0930, 60.517%
FT                   identity (61.308% ungapped) in 542 aa overlap."
FT                   /db_xref="GOA:Q7W037"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W037"
FT                   /protein_id="CAE40706.1"
FT                   /translation="MKQTQPTPPAAAIDVHAAFGEMRHWTTGHIVARRAALSGSQTFLR
FT                   NMADGRCHTYLDLHRQTNGIAQALAALGIGHGDHVAVMLENCPEQVFSYVALGKLGAVS
FT                   VPINTAAKGQLLRYYLDHADCTAIVVSDTLAAPLADIIAALPRLQRVIVLGQARAAAAG
FT                   LPDGVAVHPFPDVDGSDAAPRVPVRFDDLAYLLYTSGTTGPSKAIMITHACAHFWGEQN
FT                   IRYRHFLPGEVDYVFLPLFHANALLLGVTSALMAGTTVALARRFSTSRFWSDVRTAGAT
FT                   RFNAIGAVGNFLYSQPPDPRDRDHKVRLCSLAPPPPFVHDFERRFGIKVLNGYALSDYC
FT                   AATWSPLDAPPQKVFSAGLARDSVRVRIVDDDDFDLPADSPGEILLRVEQPWGTPLGYY
FT                   KMPEATLAAHRNGWFHTGDRGRLDADGYLHFTDRKKDAIRRRGENISAYEVEAIILGHP
FT                   AVRQAAVYPVRSEFTEDEVAASIVLHDGQALTPEALVLHCRDNMSSFMVPRFVEFVAEL
FT                   PLTLTNKVEKYKLRARAEADPAALWDSQQHAGGTARAAATGG"
FT   misc_feature    complement(332146..333381)
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme"
FT   misc_feature    complement(332923..332958)
FT                   /note="ScanRegExp hit to PS00455, Putative AMP-binding
FT                   domain signature."
FT   CDS_pept        complement(333550..334566)
FT                   /transl_table=11
FT                   /locus_tag="BP0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas chlororaphis hypothetical
FT                   35.8 kDa protein TR:Q9L3W5 (EMBL:AJ271325) (336 aa) fasta
FT                   scores: E(): 4e-24, 30.380% id in 316 aa, and to Rhizobium
FT                   meliloti conserved hypothetical protein Sma1927 TR:AAK65716
FT                   (EMBL:AE007292) (330 aa) fasta scores: E(): 1.3e-23,
FT                   31.288% id in 326 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W036"
FT                   /protein_id="CAE40707.1"
FT                   /translation="MKPMPVHRAGAAGPDAVRRSLLAAIPGLMLGAVARAQPAAYPAHR
FT                   VTLLVPYTAGTAADAVARFIAAKLTALWGTTVLVENKAGADGVVGTRAVLQAPADGHMV
FT                   LFTGPPFLYNTEMLQTAPYVPLRDFQPVARVSSAMWLFAAGRQAPFANLAELIALDKRQ
FT                   GRAADIAVSGSAAMAVATALKNATGARLNIVPYTSTSQAITDAAAGHVDAVAAAIAGVA
FT                   PLVRSGMLNALGVSGPTRSLAVPEIPTLAEAGAPGFGFVSWNAAFVRSGTPEAAIARLA
FT                   EGMGAVAASAEFREFAREQGVEPAFMGPDAWPAEAADQQARWSGLLREAGLIKPKQG"
FT   CDS_pept        complement(334579..334992)
FT                   /transl_table=11
FT                   /locus_tag="BP0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Methanococcus jannaschii hypothetical
FT                   protein Mj1552 TR:Q58947 (EMBL:U67596) (141 aa) fasta
FT                   scores: E(): 4.3e-07, 36.842% id in 95 aa, and to
FT                   Archaeoglobus fulgidus conserved hypothetical protein
FT                   TR:O29957 (EMBL:AE001085) (165 aa) fasta scores: E():
FT                   2.2e-06, 25.424% id in 118 aa. Also similar to BP0932,
FT                   50.400% identity (50.806% ungapped) in 125 aa overlap."
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W035"
FT                   /protein_id="CAE40708.1"
FT                   /translation="MNIENPAPILDQDPYVQAYPETRAFWEAAAQGRFVLPRCRDCGQS
FT                   HWYPRGLCPLCGSTALEWQDAAGTGTLYSYSVMRAAPQPYAIAYVQLAEGPLVLTNIVD
FT                   SDLERLRIGQPVRVAFQRTQEGRSAPVFVALAD"
FT   misc_feature    complement(334591..334932)
FT                   /note="HMMPfam hit to PF01796, Domain of unknown function
FT                   DUF35"
FT   CDS_pept        complement(334989..336185)
FT                   /transl_table=11
FT                   /locus_tag="BP0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa1016 TR:Q9I4V7 (EMBL:AE004534) (383 aa) fasta
FT                   scores: E(): 3.6e-43, 40.874% id in 389 aa, and to
FT                   Rhodococcus spNCIMB 9784 non-specific lipid carrier-like
FT                   protein CampC TR:AAK50624 (EMBL:AF323755) (408 aa) fasta
FT                   scores: E(): 7.9e-30, 31.807% id in 393 aa. Also highly
FT                   similar to BP0933, 80.964% identity (81.378% ungapped) in
FT                   394 aa overlap."
FT                   /db_xref="GOA:Q7W034"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W034"
FT                   /protein_id="CAE40709.1"
FT                   /translation="MGGEQRETNLSIRGKAYIVGAFEHPLRYAPAHSVAQLHAECALGA
FT                   LADAGLTLADVDGYFCAGDAGASPATLVDHMNLRLRHVDGTEIGGGSYLALIGHAAQAI
FT                   ASGKCRVALITLAGKPRSAGQATGTEARQPGPDRPASAWEAPYRWTVAGIYGNFARRHM
FT                   HEYGTTSEQLAWVKVAASHHAQHNEHALLRKVYSVEDVLASPMIADPLHRLDCCVITDG
FT                   GGALVLAAPEVARSLARPRIRVLGCGETIRTNNGGHHADMLHTGAQRSGPAAFAEAGVT
FT                   PADIKYASVYDNFTIMVIMQLEDLGFCEKGAGGRFVADGNLISGTGRLPWNTDGGGLCN
FT                   NHPANRGGITKAIEAVRQLRGEAHPSVQVPNCDLALAAGPGLVFGVGHSHATVILERE"
FT   CDS_pept        complement(336272..337156)
FT                   /transl_table=11
FT                   /locus_tag="BP0333"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /note="Similar to Alteromonas carrageenovora arylsulfatase
FT                   precursor AtsA or Ats SW:ARS_ALTCA (P28607) (328 aa) fasta
FT                   scores: E(): 8.2e-09, 27.541% id in 305 aa, and to
FT                   Caulobacter crescentus metallo-beta-lactamase family
FT                   protein Cc1176 TR:Q9A918 (EMBL:AE005795) (317 aa) fasta
FT                   scores: E(): 6.4e-13, 29.097% id in 299 aa"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W033"
FT                   /protein_id="CAE40710.1"
FT                   /translation="MNLWLLGTGTPTPSLWRMCSGYLVRVGDEYLVFDHGFGAHHRMLE
FT                   LGVRATQVSHAFFSHHHYDHMGDYPRLLLTRWDQGVGRIDDMDVYGPPPLKLITERLIG
FT                   DDGAFGPDLISRTENQCSIDVYQARGGTGMRARPQPHLHELAADAVVRTPGWTVRVAPV
FT                   NHFAPHLVSYGYRLDADGQSFVYSGDTGPSRALRELAQDCDVLVHMCHYVSGTAPSKTF
FT                   AAFTMGHRELAELAAEANVRNLVISHVTEQFDHPGMRERIVREVGEIYRGNIFFGEDGM
FT                   EIPFAGPRQTRLD"
FT   misc_feature    complement(336470..337117)
FT                   /note="HMMPfam hit to PF00753, Metallo-beta-lactamase
FT                   superfamily"
FT   CDS_pept        complement(337169..338164)
FT                   /transl_table=11
FT                   /locus_tag="BP0334"
FT                   /product="putative exported protein"
FT                   /note="Similar to Comamonas testosteroni OrfJ protein
FT                   TR:Q9RHM9 (EMBL:AB029044) (326 aa) fasta scores: E():
FT                   1.3e-37, 41.176% id in 323 aa, and to Pseudomonas putida
FT                   hypothetical 34.5 kDa protein in clcB-clcD intergenic
FT                   region precursor SW:YCLC_PSEPU (Q47100) (329 aa) fasta
FT                   scores: E(): 8.8e-35, 38.816% id in 304 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W032"
FT                   /protein_id="CAE40711.1"
FT                   /translation="MQHLHRPTRLMGAIAIITTAFALAGVPAQAGAAPSDQPLRIVVPY
FT                   APGGTGDVIARLVAKKLGEQSGQSVVVENKPGAAGSIGASTVARAAADGNTLLLGYTSE
FT                   MVINPIVQKGVSYDVARDFAPVALAGSTPLLLVANPTVGVNSIAELVALAKAKPNRLSY
FT                   ASAGPGSPAHIAGALLAREAGIQLLHVPYKGGSQAVTDTVGGVVSIYFSGMPPAVPFVK
FT                   NGKLTALGVTARQPSPALPDVPALAAQDYPRLDLAGWFGFFAPREVPAPVQAALHDRIT
FT                   AALAADDIRQALAVQGVETRPMSAQAFGDFVAAEQKKYARFIDELGIAAE"
FT   misc_feature    complement(338069..338134)
FT                   /note="1 probable transmembrane helix predicted for BP0334
FT                   by TMHMM2.0 at aa 45-67"
FT   misc_feature    complement(338069..338164)
FT                   /note="Signal peptide predicted for BP0325 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.606 between residues 32 and 33"
FT   CDS_pept        join(338269..338472,338471..338971)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0335"
FT                   /product="LysR-family transcriptional regulator
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 68. The frameshift occurs within a
FT                   dimeric tract of (CG)2. The sequence has been checked and
FT                   believed to be correct. Similar to Pseudomonas aeruginosa
FT                   probable transcriptional regulator pa2206 TR:Q9I1R1
FT                   (EMBL:AE004647) (315 aa) fasta scores: E(): 1.8e-12,
FT                   30.516% id in 213 aa, and to Rhizobium meliloti putative
FT                   transcriptional activator of the pca operon, lysr family
FT                   protein TR:CAC49892 (EMBL:AL603647) (313 aa) fasta scores:
FT                   E(): 1.5e-10, 30.435% id in 207 aa"
FT                   /db_xref="PSEUDO:CAE40712.1"
FT   misc_feature    join(338317..338472,338471..338746)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    338359..338451
FT                   /note="ScanRegExp hit to PS00044, Bacterial regulatory
FT                   proteins, lysR family signature."
FT   variation       338469..338472
FT                   /note="(CG)2 in pertussis; (CG)3 in parapertussis"
FT   variation       338912..338914
FT                   /note="There is a large insertion in parapertussis and
FT                   bronchispetica, relative to pertussis, following this
FT                   codon"
FT   CDS_pept        339025..339855
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0336"
FT                   /product="putative exported protein (pseudogene)"
FT                   /note="Pseudogen. The N-terminal region of this CDS is
FT                   deleted relative to its orthologues in B. pertussis and B.
FT                   bronchiseptica. Similar to the C-reminal regions of
FT                   Rhizobium meliloti conserved hypothetical protein Sma0690
FT                   TR:AAK65024 (EMBL:AE007228) (466 aa) fasta scores: E():
FT                   2.3e-08, 28.617% id in 311 aa, and to Escherichia coli
FT                   hypothetical protein YacH or B0117 SW:YACH_ECOLI (P36682)
FT                   (617 aa) fasta scores: E(): 8.7e-11, 30.357% id in 280 aa"
FT                   /db_xref="PSEUDO:CAE40713.1"
FT   CDS_pept        339852..340682
FT                   /transl_table=11
FT                   /locus_tag="BP0337"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical 34.3 kDa
FT                   protein Sma0689 TR:AAK65023 (EMBL:AE007228) (316 aa) fasta
FT                   scores: E(): 4.7e-14, 32.971% id in 276 aa"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR021556"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W031"
FT                   /protein_id="CAE40714.1"
FT                   /translation="MSMHNKHSMVRRALGALALAWATAGAAMAQAPYPTAQAAGDALVD
FT                   AIATSDDVAMARVLGANYRQVFPAGDHTQAIYRFLAAWADRHDIQSEGDRRAWLAVGLS
FT                   GWTFPVPMARGGQGQWRFDLQAGVAEMRRRTIGRNELVAIDGVRQLVQAQARYAQGPGQ
FT                   GRYASRLVSRPEHRDGLYWPAADQADAPPFGPDALAMGADTPLDQAYAGYRFRVEAAPD
FT                   GKDFRVVAWPAQYRRSGVYTFAADASGQVLQRDLGGAGAVGMRTDLAGWQPVAQ"
FT   misc_feature    339852..339938
FT                   /note="Signal peptide predicted for BP0337 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.980 between residues 29 and 30"
FT   misc_feature    339888..339956
FT                   /note="1 probable transmembrane helix predicted for BP0337
FT                   by TMHMM2.0 at aa 13-35"
FT   CDS_pept        complement(340692..341834)
FT                   /transl_table=11
FT                   /locus_tag="BP0338"
FT                   /product="putative membrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="GOA:Q7W030"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W030"
FT                   /protein_id="CAE40715.1"
FT                   /translation="MYRTDRLYSPPAWPVTRWLADPGRNVPDDIRQALLGGLFGTISIF
FT                   VGGVLNSVLVALIIAIRLPQAPFIAWLAFELACCLARAVVLVSARRAAAAGRPTHTDAY
FT                   IVLTVLWSCSVGYGTLISVASGDWVAAILACLSAAAMVGGICFRNFSAPRLTALMICVS
FT                   LGPCTTLPWFTGEHSLWIVSVQLPLYLASMTVAAYRFNRMLVATMQAERDSDRLARCDA
FT                   LTGLMNRFGLGFALERAVAATRRDGNEFALLYLDLDGFKSVNDTHGHAAGDRLLRDVAA
FT                   RLTELAPADAAIARIGGDEFVLLVRDCDEACATALGDRIVARICELYDLGTPRPVRIGG
FT                   SVGIALVPRHGQEMTAILKAADRALYLAKSAGKSRTALAA"
FT   misc_feature    complement(340710..341204)
FT                   /note="HMMPfam hit to PF00990, GGDEF domain"
FT   misc_feature    complement(join(341235..341300,341313..341369,
FT                   341385..341450,341463..341528,341568..341633,
FT                   341664..341729))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP0338 by TMHMM2.0 at aa 35-57, 67-89, 102-124, 128-150,
FT                   155-174 and 178-200"
FT   misc_feature    complement(341424..341468)
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   CDS_pept        complement(341929..342516)
FT                   /transl_table=11
FT                   /gene="ogt"
FT                   /locus_tag="BP0339"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="Similar to Escherichia coli
FT                   methylated-DNA--protein-cysteine methyltransferase Ogt or
FT                   B1335 SW:OGT_ECOLI (P09168) (171 aa) fasta scores: E():
FT                   1e-25, 42.857% id in 168 aa, and to Caulobacter crescentus
FT                   methylated-DNA--protein-cysteine methyltransferase Cc0689
FT                   TR:Q9AAB5 (EMBL:AE005744) (220 aa) fasta scores: E():
FT                   2.5e-30, 53.254% id in 169 aa"
FT                   /db_xref="GOA:Q7W029"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W029"
FT                   /protein_id="CAE40716.1"
FT                   /translation="MRGTRAPHTVKAPSNQERIMQFFQAQLESPLGALSLVTDDRQQVR
FT                   ALEFADSPQRLQRLLHLHYGTYTLREAPAPAAIVTALAHYFSGQCDALDGIATATGGSA
FT                   LQQRVWQALRRIPAGEVTSYGALARQLGHDDRQAARAIGGANAANPIALIVPCHRVIGK
FT                   DGALKGYAWGLERKRWLLAHENAAAGLLREAG"
FT   misc_feature    complement(341950..342291)
FT                   /note="HMMPfam hit to PF01035, 6-O-methylguanine DNA
FT                   methyltransferase, DNA binding domain"
FT   misc_feature    complement(342034..342054)
FT                   /note="ScanRegExp hit to PS00374,
FT                   Methylated-DNA--protein-cysteine methyltransferase active
FT                   site. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        complement(342537..343187)
FT                   /transl_table=11
FT                   /gene="alkB"
FT                   /gene_synonym="aidD"
FT                   /locus_tag="BP0340"
FT                   /product="alkylated DNA repair protein"
FT                   /note="Similar to Escherichia coli alkylated DNA repair
FT                   protein AlkB or AidD or B2212 SW:ALKB_ECOLI (P05050) (216
FT                   aa) fasta scores: E(): 9.4e-44, 56.808% id in 213 aa, and
FT                   to Brucella melitensis AlkB TR:Q9LA70 (EMBL:AF148683) (212
FT                   aa) fasta scores: E(): 9.9e-47, 58.294% id in 211 aa"
FT                   /db_xref="GOA:Q7W028"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W028"
FT                   /protein_id="CAE40717.1"
FT                   /translation="MQADLFDAEQTGIRTRLGEQAWVLRGFALPWLDALLPALRAVIAQ
FT                   APLRHMATPGGFTMSVALTNCGALGWTTDAHGYRYRPDDPQTGLPWPPMPQAFAQLARE
FT                   AAAQAGFAGFDPDACLVNRYAPGARMSLHQDKNERDFGAPIVSVSLGLPAMFLFGGARR
FT                   DERPARIPLLHGDVAVWGGVDRLRYHGVMPLAEGQHPLLGRQRINFTLRRAGA"
FT   CDS_pept        complement(343199..343921)
FT                   /transl_table=11
FT                   /locus_tag="BP0341"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium loti Mlr1862 protein TR:Q98JN4
FT                   (EMBL:AP002998) (247 aa) fasta scores: E(): 2.1e-59,
FT                   61.039% id in 231 aa, and to Caulobacter crescentus
FT                   hypothetical protein Cc0708 TR:Q9AA98 (EMBL:AE005746) (234
FT                   aa) fasta scores: E(): 7.4e-54, 57.778% id in 225 aa"
FT                   /db_xref="GOA:Q7W027"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W027"
FT                   /protein_id="CAE40718.1"
FT                   /translation="MDTCPNTVQARIGALDWPALETALDARGAAVAHGLLDARECGELA
FT                   ALYAQPRLFRSRIVMARHGFGRGEYQYFAYPLPPLVAQLRTAFYPPLAAVANRWNAALR
FT                   DPMRYPARHADWLHTCHQADQARPTPLLLKYGPGDYNCLHQDLYGERVFPLQVAILLSR
FT                   PGRDFDGGEFVMTEQRSGHAARAEVMPLAQGDALVFAVNRRPAQGARGPVQASLRHGVS
FT                   ELRAGQRYTIGIIFHDAT"
FT   CDS_pept        344066..344566
FT                   /transl_table=11
FT                   /locus_tag="BP0342"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa0312 TR:Q9I6H9 (EMBL:AE004469) (164 aa) fasta
FT                   scores: E(): 5.4e-27, 58.182% id in 165 aa, and to
FT                   Rhizobium loti Mll0105 protein TR:Q98NK1 (EMBL:AP002994)
FT                   (167 aa) fasta scores: E(): 1.1e-26, 59.236% id in 157 aa"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W026"
FT                   /protein_id="CAE40719.1"
FT                   /translation="MEWVLVSACLLGRPVRYDGRDAATGHPVLARWQAERRVVAVCPEV
FT                   AGGLPTPRPPAEIAAGAGGAAVLDGLAQVREASGVDVSAAFVEGARQALALVRERGIRV
FT                   AVLKEGSPSCGSGYTYDGSFSGARIAREGVTAASLRRAGVRVFSEHELDAAQAWLRHLE
FT                   TGA"
FT   CDS_pept        complement(344570..345358)
FT                   /transl_table=11
FT                   /gene="bhuV"
FT                   /locus_tag="BP0343"
FT                   /product="putative ATP-binding component of hemin transport
FT                   system"
FT                   /note="Similar to Yersinia pestis hemin transport system
FT                   ATP-binding protein HmuV SW:HMUV_YERPE (Q56993) (266 aa)
FT                   fasta scores: E(): 1.6e-23, 41.176% id in 255 aa, and to
FT                   Yersinia enterocolitica ATPase component HemV TR:P74981
FT                   (EMBL:X77867) (266 aa) fasta scores: E(): 1.7e-24, 42.353%
FT                   id in 255 aa"
FT                   /db_xref="GOA:Q7W025"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W025"
FT                   /protein_id="CAE40720.1"
FT                   /translation="MTLQARNLTLARGGAPILTDVSLTLAPGALVGLLGANGAGKSTLL
FT                   AALAGELAPRSGQVFLGDADLATLSARQLARRRAVLPQKPSLSFDLGVSDVVGMGAYPF
FT                   PELDPAAVRQLVRDALEQAGVTHLAQRRYPQLSGGEQQRVQFARVLAQCHAMHAPGQTR
FT                   YLMLDEPISNLDPRHQMELLATARALAHEAGMGVLVIVHDINQAARWCDTLALLADGRL
FT                   AALGPPADVLTPDHMRRVYGIEADVLAHPTLPGRLLVLAR"
FT   misc_feature    complement(344699..345277)
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    complement(344909..344953)
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   misc_feature    complement(345233..345256)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        complement(345373..346308)
FT                   /transl_table=11
FT                   /gene="bhuU"
FT                   /locus_tag="BP0344"
FT                   /product="putative hemin permease"
FT                   /note="Similar to Yersinia enterocolitica hemin permease
FT                   HemU TR:P74980 (EMBL:X77867) (334 aa) fasta scores: E():
FT                   4.8e-47, 50.000% id in 286 aa, and to Yersinia pestis hemin
FT                   transport system permease protein HmuU SW:HMUU_YERPE
FT                   (Q56992) (334 aa) fasta scores: E(): 7.3e-47, 49.141% id in
FT                   291 aa. Also similar to BP3340, 40.256% identity (42.568%
FT                   ungapped) in 313 aa overlap."
FT                   /db_xref="GOA:Q7W024"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W024"
FT                   /protein_id="CAE40721.1"
FT                   /translation="MGILAAASGAVHIPLADLARLIGGDSTPRDALWRNVLFDIRLPRV
FT                   LFAATAGAALAICGAAMQALFRNPLAEPGLVGISAGGAMGAVLAIVLTSGGFAITAPAA
FT                   FAGSLLATGCAYVLGRRAHGVAGLLLAGIAINTVAGSVIGLLTFMASDAQLRDLTFWSM
FT                   GSLAGARWSLLAFLAPWTLLWSWWLMRQWRAMNALLLGEREAHHLGFALRSVRRQLVLA
FT                   TALIVGPLVAATGGIGFVGLVVPHLIRMTLGADHRWLLPASMLAGALALTLADWLARVV
FT                   IVPAELPIGLVTSLVGGPFFLWLLARGRRL"
FT   misc_feature    complement(345388..346284)
FT                   /note="HMMPfam hit to PF01032, FecCD transport family"
FT   misc_feature    complement(join(345391..345447,345469..345534,
FT                   345580..345645,345745..345810,345871..345936,
FT                   345952..346017,346030..346086,346108..346173))
FT                   /note="8 probable transmembrane helices predicted for
FT                   BP0344 by TMHMM2.0 at aa 45-67, 74-93, 97-119, 124-146,
FT                   166-188, 221-243, 258-280 and 287-306"
XX
SQ   Sequence 346359 BP; 56210 A; 115468 C; 118411 G; 56270 T; 0 other;
     atggattttc cccgcgaatt tgatgtgatc gtcgttggtg gcggtcacgc cggtacggag        60
     gcagccctgg ctgcagcccg cgccggcgca cagacattgc tgcttaccca caatatcgag       120
     accctgggcc aaatgtcctg caatccctcc atcgggggga taggcaaggg tcatttggtc       180
     aaggaagtcg atgcgttggg cggcgcgatg gctatcgcca ccgacgaggc aggtatccaa       240
     ttccgtattc tcaacagctc caaggggcca gcggtacgtg ccacgcgtgc ccaagccgac       300
     cgggtgctgt accgaaacgc catacgtgca cagctcgaga accagcccaa cctctggctg       360
     ttccagcagg cggtggacga tctgatggtg cagggcgacc aggtggtggg cgccgttacg       420
     cagatcgggt tgcgctttcg tgcccgtacc gtggtgctga cggctgggac cttcctcaac       480
     ggtttgattc acgtggggct gcagaactat tccggagggc gggcagggga tcctcccgcc       540
     aattccctgg gccagcggct caaggagctg caacttccgc aaggccgcct gaaaactggc       600
     acgccgccgc gcatcgacgg acgcagcatc aactacagtg tgttggaaga gcagcccggc       660
     gatcttgatc ccgtgccggt gttctcgttc ctgggcaagg cctccatgca cccgcgccag       720
     ctgccttgct ggatcacgca taccaatgcc cgcacgcacg aaatcatccg tggcggtctg       780
     gaccgttcgc ccatgtacag tggggtcatc gaaggagtgg ggcctcgtta ctgcccatcc       840
     atcgaggaca agatccatcg ttttgcggac aaggcatcgc accaggtatt cctggaaccg       900
     gaaggcctga atacccatga gatctatccg aacggtgttt ccaccagcct gcctttcgat       960
     gtgcagtacg agttgatcca ttccctgccc ggactggaga acgcgcacat cctgcgcccg      1020
     ggctatgcca tcgagtacga ttacttcgac ccgcgtgccc tgaagtccac gctggagacc      1080
     aaggcgattt ccgggctgtt cttcgccggc cagatcaacg gcacgaccgg ctatgaagag      1140
     gcggcggccc aaggcctgct ggccggcgcc aatgccgcct tgcaggccca ggggaaagaa      1200
     ccttgggtgc cgcgtcgcga tgaagcctat ctcggcgtcc tggtcgatga cctggttacg      1260
     cgcggcgtga ccgagcctta tcggatgttc acgtcccgtg ccgaatatcg gctcagcctg      1320
     cgcgaagaca acgccgatct gcgcctgacc gaaatcggcc gccggctcgg gctggtggac      1380
     gacgtgcgct gggatgcttt cagccgcaaa cgcgatgccg tggcccagga agtcgaacgg      1440
     ctcaaatcca cgtgggtgaa cccgcgcgtc ctgccggcgc atgccgccga agccctgctg      1500
     ggcaaggcaa ttgagcgtga gtactcacta tcagacctgt tgaaacgtcc caatgtttcc      1560
     tacgaggcgt tgatgcaggc ccgtaccgac gagggcgagt tgctggctgg tcctggcgtg      1620
     ctcgaggatc aagtgctggc cgagcaggtc gaaacccagg tcaagtacgc cggctatatc      1680
     gcgcgccagc aagacgaagt gcagaaacac ctctcgcacg agcagcagcc catccctgcg      1740
     gatatcgatt acgacgccgt caccagcctg tcgttcgagg tacgccagaa gctgaagacg      1800
     catcggcccg agaccatagg gcaggccgcg cgcgtctccg gggtgacgcc ggctgccatt      1860
     tccctgttgc tgatccatct caagcgcctg cattacggct cgcgcaagca agcggcatga      1920
     gcgccgttcc cgatatcccc ggcggccccg cgcagcggct ggcccaggcc tgcgatgcgc      1980
     tgcgattgcc ggccgacgcc ggccagcagc agaagctgct gcgctatatc gagcaaatgc      2040
     agcgctggaa ccgcacgtac aacctgactg ccatccggga tccggggcag atgctcgtgc      2100
     agcacctgtt cgacagtctg tcggtcgtgg cgccgctgga gcgtggcctg cccgccgccg      2160
     ggtccggcgc gcgcgtcaag ctgttcgacg tcggctccgg cggcggcctg cccggcgtgg      2220
     tgctggccat catgcgcgcc cattgggacg tcacatgcgt ggacgcagtc gagaagaaaa      2280
     ccgcattcgt gcgacagatg gccggcgcgc tcggactgcc caatctgcag gccgcgcata      2340
     cccgtatcga acagctcgaa ccggcgcaat gcgacgtggt gatatcgcgt gcgttcgctt      2400
     cgttacagga cttcgcgaag ctggccggcc gccacgtgcg cgagggtggt accctcgtcg      2460
     ccatgaaggg caaggtgccc gatgacgaaa tccaggcgtt acagcaacac ggccactgga      2520
     cggtcgaacg gatcgaaccg ttggtggtgc cggcactcga cgcgcaacgc tgcctgatat      2580
     ggatgcgacg cagtcaagga aacatatgaa aaacataccg cccagcaagt ccgcccgcgt      2640
     gttctgcatc gccaaccaga agggcggcgt cggcaagacc accaccgcca tcaaccttgc      2700
     ggctggcctg gctacgcaca agcagcgggt gctgctggtc gatctcgatc cgcagggcaa      2760
     cgccaccatg ggcagcggca tcgacaagag tacgctcgaa tccaacctgt accaggtgct      2820
     catcggcgag gccggtatcg aacagacgcg cgtgcgttcg gagtccggcg gctacgacgt      2880
     attgccggcc aaccgcgaac tgtccggcgc cgagatcgac ctggtgcaga tggacgagcg      2940
     cgagcgccag ctcaaggccg ccatcgacaa gatcgccggc gaatacgatt tcgtgctgat      3000
     cgattgcccg cccacgctgt cgctgcttac ccttaacggg ctggctgccg cgcacggcgt      3060
     catcattccg atgcagtgcg agtactttgc gctcgaaggc ctgtccgacc tggtaaacac      3120
     catcaagcgc gtgcatcgca atatcaacaa cgaactccgt gtcatcggtt tgttgcgcgt      3180
     gatgttcgac ccgcgcatga ccttgcagca gcaggtgtcg gcccagctcg aatcccactt      3240
     cggcgacaag gtcttcacca cggtggtgcc acgcaatgtg cggttggccg aggcgcccag      3300
     ctatggcatg ccgggcgtgg tgtatgaccg cgcgtcgcgc ggcgcgcagg cctatattgc      3360
     atttggcgcg gaaatgatag aacgcgtcaa agagctggat tgaacctcga tgccagctgt      3420
     gcttgctgtt ccggccgccc accccgctcc cgcagcggga ggggagctgg cgcgcctgga      3480
     agaggcggcg ctcaatgcca ccacggttcg cgagcagatg ctctacgaag gatggctggt      3540
     gcgttgggcg ccttcgcggg ccaagcgtgc gcgctgcgtc aatgtactcg ggttatccac      3600
     acgtccgctc gatgagcggc tggcgtactg tacccgatgg tatgcgggcc acggggtgcc      3660
     gctgatcgtg cggttgacct ccatcggccc cgatttttcc ctggatgcac agctgcatga      3720
     gcgcgggttc gtcgcgttcg accgtacctg cgtcatggcg gcgtccgtcg tgccgttcac      3780
     ggcgcaagcg ccgtccgggc tggtgttcga acggacaacc cccgggcggt tcgcacagga      3840
     agcagggcgc ctgcaggcgg cgccgctgga aaacttgccg ctgctggtgc gcgacgccag      3900
     cggcgaatgt atcgcggcag ggctggcggc attcgatgcc gagctggtcg ggctgttcga      3960
     tatcgttacc gcgccgcagc ggcgccgcca gggttgcggc gcggcggtgc tgaagtattt      4020
     gctggagcag gccagccacg ccggcgcgcg ccaggcgtac ctgcaggtcg agccgcagaa      4080
     cacggccgcc cgtgccttgt atgcgcgttt cggcttcgtg gatcgctaca cgtattggta      4140
     tcgttcaatg tccgaagcaa cgcccgtttg agcggtcaac ggtcaactgc tgaagggaag      4200
     aggatttatt cgctatggtt accaagaagc ccaagggctt gggtcgagga ctggatgcct      4260
     tgctgggcgc ggacgtgccc gccatcgaca acatcggcaa ggcccccgcg gccgcgccgg      4320
     agggaccgcc ggcgaccctg cctgtgtcca agatgcgcgc cggcaaatat cagccgcgca      4380
     cgcgcatgga cgaaggcgcg ctcaacgaac tggccgagtc catccgcacc cagggcatca      4440
     tgcagcccat cctggtgcgt gcgctgggcg ccgacgcgcc cggccagtac gaaatcatcg      4500
     tcggcgaacg gcgctttcgc gcggcgcaac tggccggcct gaaagaagtg ccggtgctgg      4560
     tgcgcgaagt cgccgacgag aacgccgcgg tcatggcgct gatcgagaac atccagcgcg      4620
     aagacctcaa tccgctcgaa gaggcgcacg gtgttcgccg cctgctcgac gagttcggcc      4680
     tgacgcacga acaggccgcc caggccatcg gccgctcgcg ttcggccacc agcaacctgc      4740
     tgcgcctgct caacctggcc gcgccggtgc agaccatgct gctggcgggc gatgtcgaca      4800
     tgggccatgc ccgcgccttg ctggcggtcg atgccgccac gcagatccag ttggccaacc      4860
     aggtcatcgc caagcgcctg tcggtacgcg aggccgagaa gctggtcgcg cgggcgcaaa      4920
     aggatgtcga cgccgcgccg cgcaagaagg gcaatggcgc ttcgcgcgat gtcacgcggc      4980
     tcgaggaagc gctgtcggat catctcggca cgcgcgttgc gctgaaggtc ggggcgcgtg      5040
     aaaaaggcca gatcgtgatc gatttccatg gctgggaaca tctgaactcg ctgctggagc      5100
     gccagggcct gtccggggta gtggatgcct gaggcccggc tgccgcggat tgccgtcctg      5160
     gcgaccggcg gcaccattgc cggcgcgcaa accgacgcgg ccagcggcgc ttaccgcgcc      5220
     ggctcgtacg gcgtcgggca gttgctggcg gccgtgcctc aactggccgg cctggcgcgc      5280
     atcggcgccg agcagatcgc caacgtcggc agccagaaca tgagccatgc cgtctggcgg      5340
     cagctcgcgc tgcgcgccgc cgcgctgtgc gacgatccgg cgaccgacgg catcgtcatt      5400
     acccatggca ccgatacgct ggaagagacc gcttatttcc tcagcctggt attgcctgtg      5460
     gataaaccgg tggtgctgct gggcgccatg cgcccggcca ccgcgttgag cgccgacggg      5520
     ccggtcaatc tatacaacgc ggtggcgttg gcctgccatc cggccgcacg cggccgcggg      5580
     ccgctggtcg tgatgaacga ggatatccat ctggcccgtc atgtgcagaa aacggccgcc      5640
     tctggcatcg ccgcgttcgc ttcgcccaat gcaggccggg ccggcgtcat gcagggcggc      5700
     cggccggtgt ttcacgcccg cgccgagcgc caggccgccg acgcgctgct caggccggac      5760
     gaattgccgc agcaggcctg gccgcgggtc gacatcgtgc atgcctgtgt cgatctcgac      5820
     ggcgagctca tcgatttcat ggccgggcga gcccagggca tcgtgttggc cggcgtgggc      5880
     gacggcaacg ccaccgacgc ggccctgtag gccctgcagc gggccagcgc gcggggcgtt      5940
     gcggtggtgc gggcgtcgcg caccggctcg ggcaaggtgg ggcgcaatat cgagatcgac      6000
     gacgacgcct gcggcttcat tgccgccggc gacctcagcc cccagaaggc ccgcgtgctg      6060
     cttaccctcg gcctgtgcca gacccgcgat accgcgcgcc tgcaggcgtt gttcgacagc      6120
     cgctgaaacc gggcggcgcg ttggcgcccc tgtcggcggc tgggccgccg atcccgtttc      6180
     aacaccttaa tttgacattc aatttgaatg tgttcataat ctcaaattct ccgctggagg      6240
     agtgcccgag tggttaaagg gggcagactg taaatctgtt ggccttgcgc ctacgttggt      6300
     tcgaatccaa cctcctccac cagagaccca tgttccggtc cagtatgacg ccaggatcgg      6360
     cgctttgcga gagcagcgcg cccgtaccag ttccaggctc agcaagacga aatccaggtg      6420
     cggttcggcc tggattttgc aacgtaaggc caggtgtcct ggcttgccgc tgcgggaata      6480
     tggaggagat gcaaggtgaa agggtggcct gcgggtgtag ctcaatggta gagcagaagc      6540
     cttccaagct tacgacgagg gttcgattcc cttcacccgc tccaagattt gcccatgtgg      6600
     ctcagtggta gagcactccc ttggtaaggg agaggtcacg cgttcgatcc gcgtcatggg      6660
     caccatcgaa ttctaagttc ttcttcaagt cagaagcttc aatccaggtc aggagtcagc      6720
     catggcaaaa ggcaagtttg aacgtaccaa gccgcacgtg aacgtgggta cgattggtca      6780
     cgttgaccac ggcaaaacga cgttgacggc ggcgatcacg acggtgctgt cgaacaagtt      6840
     cggcggcgag gctcgcggct acgaccagat tgacgcggcg ccggaagaga aggcgcgtgg      6900
     gatcacgatc aacacctcgc acgttgagta cgagacggag acgcgtcact acgcgcacgt      6960
     tgattgcccg ggtcacgctg actacgtgaa gaacatgatc acgggtgctg cgcagatgga      7020
     cggcgcgatc ctggtggtgt cggccgcaga cggcccgatg ccgcagacgc gcgagcacat      7080
     tttgctgtcg cgccaggttg gcgtgccgta catcatcgtg ttcctgaaca aggcggacat      7140
     ggttgatgac gcggagctgc tcgagctggt ggagatggaa gtccgcgaac tgctgagcaa      7200
     gtacgatttc ccgggcgatg acacgccgat cgtgaagggt tcggccaagc tggcgctgga      7260
     aggcgacaag ggcgaactgg gcgagcaggc gattctgtcg ctggcgcaag cgctggacac      7320
     gtacattccg acgccggagc gcgcggtcga cggtgcgttc ctgatgccgg tggaagacgt      7380
     gttctcgatc tcgggccgtg gcacggtggt gactggccgt atcgagcgcg gcgtggtgaa      7440
     ggttggcgag gaaatcgaaa tcgtgggcat caagccgacg gtgaagacga cctgcacggg      7500
     cgtggagatg ttccgcaagc tgctggacca gggccaggcg ggcgacaacg tgggtatctt      7560
     gctgcgcggc accaagcgtg aagacgtcga gcgtggccag gtgctggcca agccgggttc      7620
     gatcaacccg cacacggact tcacggccga ggtgtacatt ctgtccaagg aagagggtgg      7680
     ccgtcacacg ccgttcttca acggctatcg tccgcagttc tacttccgca cgacggacgt      7740
     gaccggcacg atcgacctgc cggcggacaa ggaaatggtg ctgccgggcg acaacgtgtc      7800
     gatgaccgtc aagctgctgg ccccgatcgc catggaagaa ggtctgcgtt tcgccatccg      7860
     tgaaggcggt cgtaccgtcg gcgccggcgt cgtcgccaag atcatcaagt aaggcgcggt      7920
     tttcccatgg atagaggggc cggatggccc tctatccatg tttgctggaa aagtagtact      7980
     atgtatggtt ccgcaaggtg ccacgcgtag cttgaaagtt ttaggggtat agctcaattg      8040
     gcagagcgtc ggtctccaaa accgaaggtt gtaggttcga ttcctactgc ccctgccacc      8100
     cgccggagag tatcgcgagt tgcgcattca cggcgggctc gtgtcgcaaa atgtctaata      8160
     ccagcataga aaccgttacc agtaccgctg accggatcaa gctcgggttg gcggttctcg      8220
     tcgttattgc tggcatcgtt gggttttcca tgctcgacgc gcagcccatg gtggcgcgta      8280
     tcggcgtgtt tgtcggcggc ctggtcgtcg cggcgttgct tgcgtggttc agcgaacccg      8340
     gccgccgtac cctcagcttt gccggcgagt cgtacaacga agtcaagcga gtctcgtggc      8400
     ccacgcgcaa agagacgatc cagatgaccg gtatcgtctt cgccttcgtc gcggtgatgg      8460
     gtcttctgat gtgggtgctc gataaaggca tcgagtgggt tctctacggc ctgttgctgg      8520
     gctggaaata aggacggcgc atgagtaaac gttggtatgt cgtccatgtg tattccggca      8580
     tggagaaaag cgtacaaaag gctctgaacg agcgcatcga gcgcgcggag ctgcagacgt      8640
     cttttggccg cattcttgtt ccctccgaag aagtcgtcga ggtcaagggc ggacagaagt      8700
     cgatcaccga acgccgcatt ttccccggtt atgtcctggt cgaaatggat ctgaccgacg      8760
     aaacgtggca tttggtcaag aacaccaatc gtgtcactgg tttcctgggt ggttcgggca      8820
     accgtccgac gccgatttcc gaacgggaag tcgagaaaat cctcaaccag atggaagagg      8880
     gtgtcgaaaa gccccggccc aagattctgt tcgaagtggg cgagatggtg cgcgtcaagg      8940
     aaggtccgtt tgctgacttc aacggcaacg tcgaagaagt caactacgaa aagagcaagg      9000
     tgcgtgtgtc ggtcaccatt tttggtcgcg cgacgcccgt cgaactcgat ttcagccagg      9060
     tcgaaaagac ctgattttca aaccccgggg agctctgcgc atagccgcag ggcgctataa      9120
     cccgcaagga gcaaagcatg gcgaagaaga tcgtcggctt tatcaagctg caagtgccgg      9180
     ctggtaaggc aaacccctcc cccccgattg gcccggcgct gggtcagcgc ggcctgaaca      9240
     tcatggaatt ctgcaaggcg ttcaacgcca agacccaagg catggagctc ggtctgccga      9300
     ttccggtggt gatcaccgcc ttcgcggaca agagcttcac cttcatcatg aagaccccgc      9360
     ccgcgacggt cctcatcaag aaggcgtccg gcgtgcaaaa gggttcggcc aagccgcata      9420
     ccgacaaggt cggcacgctg acgcgcgccc aggctgaaga aatcgccaag accaagcagc      9480
     ccgacctgac cgcggccgat ctggacgccg ccgtccgtac gatcgctggc agcgcccgca      9540
     gcatgggcat cacggttgag gggggttaat catggctaaa ttgtccaagc gcgccgccgc      9600
     cattgcgcag aaaatcgacc gtaccaagct gtacccggtc ggcgaagccc tgaatctggt      9660
     caaggaaacc gccaccgcca agttcgatga atccatcgat gtggccgtcc agctgggcat      9720
     cgaccccaag aagtcggacc aactggtccg tggttcggtc gtgctgcccg ccggtaccgg      9780
     caagacggtt cgcgttgccg tgttcgccca aggcgaaaag gctgatgccg cccgtgccgc      9840
     cggcgccgac atcgtcggcc tggacgacct ggccgagcag atcaaggctg gccagatgga      9900
     cttcgacgtg gtcatcgcct cgcccgacac gatgcgtgtc gtgggtgccc tgggccaggt      9960
     gctgggtccc cgtggcctga tgccgaaccc caaggtcggt accgtgacgc ccgacgtggc     10020
     caccgccgtg aagaacgcca aggccggtca gatccaatac cgtaccgaca aggctggcat     10080
     cattcacgcc accatcggcc gcgcctcgtt cggcgtggaa caactgcaaa acaacctggc     10140
     cgccctggtc gatgccctgc aaaaggctcg tcccgccgct gccaagggta tttacctgcg     10200
     caagctggcc gtttcgtcca cgatgggcgg cggtgctcgc gtggaaattg cttcgctgtc     10260
     ggccaactaa caggccgctg gcacatagaa ctttgggccg catccggact tgtccggatg     10320
     ctgctgtcaa agaccgctgg agcgctagcc ggttgtttgg cgaatgctta atcccgaagc     10380
     tggttcagtt cggatccagc gtagacggcg tccccaggaa gatttcttta cccgaagaac     10440
     tcaaccaggc gccgcattcg gttgacgcgc aaggctagcg ccccaagcgt cttttgatgg     10500
     agtgttcaaa ccgtgagtct caatcgccaa gagaaagcgg tggtaatcga ggaagtctcg     10560
     gcacaagtgg ccaaggcgca atcgattgtt atcgccgagt accgtggtct ggacgtcgcc     10620
     tctgtcaccg tactgcgcaa aactgcgcgt gaatcgggcg tttacctgcg tgttctgaag     10680
     aacacgctgg tccgtcgtgc ggttgctggc acggctttcg agccgctgtc cgagcaactc     10740
     accggtccgc tgatctatgg tattagcgct gatccggtcg ccgcggccaa ggttctcgct     10800
     ggtttcgcaa aaagcaacga caagctggtc atcaaggcgg gctcgctgcc caacagcctg     10860
     ctgacccagg atggcgtcaa ggccctggcc acgatgccct cccgcgagga gttgctctcg     10920
     aaactgctgg gcaccatgca agccccgatc gcgcaattcg tgcgtacgct caacgaagtt     10980
     ccgaccaagt tcgcccgcgg cctcgctgcc gtgcgcgatc agaaagcggc ggcctgatca     11040
     ggctccgcgt ccggaattcg ctgaacgaca aagcgacacc caaccctggc attacccaat     11100
     tttggagttc taaacaaaat ggcacttagc aaagctgaaa tccttgacgc catcgctggc     11160
     atgtccgtgc tcgagctgtc cgagctgatc aaggaaatgg aagaaaagtt tggcgtgtcg     11220
     gctgctgccg ccgccgtggc cgtggccgcc ccggccgctg gtggcgctgg cgccgctgct     11280
     gctgaagagc agaccgagtt caccgttgtg ctgctggaag ccggcgcgaa caaggtcagc     11340
     gtcatcaagg ccgtgcgcga gctgaccggt ctgggtctga aggaagccaa ggacctggtt     11400
     gacggcgctc cgaagcccgt caaggaagcg ctgcccaagg ctgacgccga agccgccaag     11460
     aagaagctgg aagaagctgg cgccaaggtc gaagtcaagt aagacctcgc gtcgacgccc     11520
     ggggacagcg ctcttagccg tccccgggct tttgcgtttc caggaaaccc ctactgatgg     11580
     gtcgagttca gcagggtttc ctggagtcgt atcacctggg gccgtggttt acggtccatg     11640
     caacctcgag tcggagtgct catgccttac tcgtacaccg aaaaaaagcg catccgcaaa     11700
     agctttgcca aacgtgagga cgttcaaaac gttcccttcc tgttggcgac acagcttcaa     11760
     tcctacctaa ctttcctgca agccgacacc gcgacctcgg atcgcgtcaa tgaaggtctg     11820
     caggcggcgt tctcgtcgat ttttccgatt gtcagccata acggaatggc gcgcttggag     11880
     ttcgtcagct atgcgctggg cgagccggtg tttgatgtca aggaatgtca gcagcgcggc     11940
     ctgacctatg cgtcgccgct gcgcgccaag gtgcgcctgg tgctgctgga ccgcgaagtc     12000
     agcaagccga ccatcaagga agtcaaggag caggaagtct acatgggcga aattccgctc     12060
     atgaccggca ccggctcgtt cgtcatcaac ggcaccgagc gcgtcatcgt ctcgcagctg     12120
     catcgttcgc cgggcgtgtt cttcgagcac gaccgcggca agacgcacag ctcgggcaag     12180
     ctgctgttct cggcccgcgt gattccctac cgcggctcgt ggctggactt cgaattcgat     12240
     cccaaggacg tgctgttctt ccgcgtggac cgtcgccgca agatgccggt gacgatcctg     12300
     ctgaaggcca tcggcatgac gcccgaatcg atcctcgcgc acttcttcga tttcgacaac     12360
     ttcgaactca agagcgaagg cggcatgatg gaattcgtcg ccgaacgctg gaagggcgag     12420
     atggcgcgct ttgacatcgc cgaccgcgac ggcaaggtga tcgtcgagaa ggacaagcgt     12480
     atcaacgcca agcacctgcg cgacctggct gccggcggca tccagcgcgt gtcggtgccc     12540
     gaggatttcc tgtacggccg cgtgctggcc aagaacatcg tcgatcccga caccggcgaa     12600
     gtcgtggcgc atgccaacga cgagatcacc gaaagcgtgc tcaacgcgat gcgcgccgcc     12660
     aacgtgcgcg acatccagac gctgtacacc aacgacctgg atcgcggtcc ctacatttcg     12720
     cagacgctgc gcgccgacga aaccgccgac cagatggccg cgcgcgtggc gatctaccgc     12780
     atgatgcgtc ctggcgaacc gcccaccgaa gaagcggtgg aagcgctgtt ccagcgtctg     12840
     ttctacagcg aagagacgta cgacctgtcg cgcgtgggcc gcatgaaggt caacagccgc     12900
     ctgggtcgcg gcgacgacag caccggtccg atgacgctga ccaacgagga catcctcgaa     12960
     accatcaagg tgctggtcga gctgcgcaac ggccgtggcc agatcgatga catcgatcac     13020
     ctgggcaacc gccgcgtgcg ttgtgtcggc gaactggccg agaaccagtt ccgcgctggc     13080
     ctggtgcgtg tcgagcgcgc cgtcaaggag cgtctgggcc aggccgagac cgaaaacctg     13140
     atgccgcacg acctgatcaa ctccaagccg atctcggccg ccatcaagga gttcttcggt     13200
     tcgagccagc tgtcgcagtt catggaccag accaacccac tgtcggaaat cacgcacaag     13260
     cgtcgcgttt ccgcactggg cccgggcggc ctgacgcgcg aacgcgccgg ctttgaagtg     13320
     cgcgacgtgc acccgaccca ctacggccgc gtctgcccga tcgaaacgcc ggaaggcccg     13380
     aacatcggcc tgatcaactc gatggcgctt tacgcgcgcc tgaacgagta cggcttcctg     13440
     gaaaccccgt atcgcaagat catcgacggc aaggtcagcg accagatcga ctacctgtcg     13500
     gccatcgagg aaagccacta cgtgatcgcg caggccaacg ccgcgctcga tgacgaaggc     13560
     cgtttcgtcg acgacctggt ggcttgccgc gaagcgggcg aaaccatgct gaccgcgccg     13620
     ggcaacgtgc actacatgga cgtggcgccg tcgcagatcg tgtcggtcgc ggcgtcgctg     13680
     atcccgttcc tcgagcacga cgacgccaac cgtgcactga tgggcgccaa catgcagcgc     13740
     caggccgtgc cttgcctgcg tccggaaaag ccgctggtcg gcaccggcgt cgagcgcacc     13800
     gttgcggtcg actcgggcac gaccgtgcag gcgctgcgtg gcggcgtggt tgaccacgtc     13860
     gacgccgacc gcgtcgtgat ccgcgtcaac gacgaagaga acgtcgctgg cgaagtgggc     13920
     gtggacatct acaacctgat caagtacacg cgttccaacc agaacacgaa catcaaccag     13980
     cgtcccatcg tggcccgcgg cgacaaggtc gccaagggtg acgtgctggc cgacggcgcg     14040
     tccaccgacc tcggtgaact cgcgctgggc cagaacatgc tgatcgcgtt catgccctgg     14100
     aacggctaca acttcgaaga ctcgatcctg atctccgaac gcgtcgtggc cgacgatcgc     14160
     tacacctcga tccacatcga agagctgacc gtggtcgctc gcgatacgaa gctgggaccc     14220
     gaggaaatca cgcgcgacat cagcaacctg gctgaaacgc agctcaaccg cctggatgac     14280
     tccggcatcg tctacattgg cgcggaagtc agcgccgacg acgtgctggt gggcaaggtc     14340
     acgccgaagg gcgaaaccca gctcacgccg gaagaaaagc tgctgcgcgc catcttcggc     14400
     gaaaaggctt ccgacgttaa ggacacctcg ctgcgcgtgc cctcgggcat gaccggcacg     14460
     gtgatcgacg tgcaggtgtt cacgcgcgaa ggcatcgtgc gcgacaagcg cgcccagtcc     14520
     atcatcgacg atgaactgcg ccgttatcgc caggacctca acgaccagct gcgcatcgtc     14580
     gagaacgacc agttcgaccg tatcgagaag atgctggtcg gcaagaccgt caatggcggc     14640
     ccgcgcaagc tggccaaggg cgccaccttg accaaggcct acctggccga cctggatcgc     14700
     tggcagtggt tcgacatccg cctggccgac gaacagcacg ctgtcgtgct ggagcaggcc     14760
     aaggaatcgc tcgagcagaa gcgccaccag ttcgacctgg ccttcgaaga gaagcgcaag     14820
     aagctgacgc agggcgacga actgccgccg ggcgtgctga agatgatcaa ggtctacctg     14880
     gccgtcaagc gccgcctgca gccgggcgac aagatggccg gccgccacgg caacaagggc     14940
     gtggtttcgc gcattacgcc ggtcgaggac atgccccaca tggccgacgg cactcccgcc     15000
     gacatcgttc tgaacccgct gggcgtgccc tcgcggatga acgtcggcca ggtgctggaa     15060
     gtccatctgg gctgggccgc caagggcgtg ggctaccgca tcgccgacat gctgcgcgac     15120
     gagcgcacgg cgcaggccaa gagcgtccgc ggctacctgg agaaggtgta caacaccacg     15180
     ggcagcagcg cgcatatcga cagcctgacc gacgaggaag tgctggaact ggccaacaac     15240
     ctgaagaagg gtgtgccgtt tgccacgccg gtgttcgacg gtgcgaccga agaagaaatc     15300
     ggcaagatgc tggaactggc ctatcccgac gacgtcgccg cgcgcatgcg cctgacggcg     15360
     tcgcgttcgc aggcatggct gtatgacggc cgtaccggcg agcagttcga gcgtccggtc     15420
     acgatcggct acatgcacta cctgaaactg caccacttgg tggacgacaa gatgcacgcg     15480
     cgttccaccg gcccgtactc gctggttacc cagcagccgt tgggcggcaa ggcgcagttc     15540
     ggcggtcagc gtttcgggga aatggaagtg tgggcgctgg aagcctacgg cgcctcctac     15600
     accctgcagg aaatgctgac ggtgaagtcc gacgacatca ccggccgcac gaaggtttac     15660
     gaaaacatcg tcaagggcga ccacgtcatc gatgccggca tgccggaatc gttcaacgtg     15720
     ctggtcaagg aaattcgctc gctggccctg gacatggatt tggagcgtaa ctgatgaaag     15780
     cgctactcga cctcttcaag caagtctcgc aagacgagca gttcgatgcc atcaagatcg     15840
     gcatcgcctc gcccgagaag atccgttcgt ggtctttcgg cgaagttcgc aagcccgaga     15900
     cgatcaacta ccgtacgttc aagcccgagc gtgacggcct gttctgcgcc aagatcttcg     15960
     gtcccatcaa ggactacgaa tgcttgtgcg gcaagtacaa gcgcctgaag catcgtggcg     16020
     tgatctgcga aaagtgcggc gtggaagtca ccgtcgccaa ggtgcgccgc gagcgcatgg     16080
     gccatatcga actggccagc ccggttgcgc acatctggtt cctcaagagc ctgccgtcgc     16140
     gcctgggcat ggtgctcgac atgacgctgc gcgacatcga gcgcgtgctg tacttcgaag     16200
     cctggtgcgt gatcgagccc ggcatgacgc cgctcaagcg cggccagatc atgtccgatg     16260
     acgacttcct ggccaagacc gaagagtacg gcgacgactt ccgtgccctg atgggcgccg     16320
     aggccgtgcg cgaactgctg cgcaccatcg acatcgatcg cgaagtcgag acgctgcgcg     16380
     gcgagctcaa ggccaccagc tcggaagcca agatcaagaa gatctccaag cgtctgaagg     16440
     tgctggaagg cttccagaag tccggcatca aggccgaatg gatggtcatg gaagtgctgc     16500
     ccgtgttgcc gccggacctg cgtccgctgg tgccgctgga cggcggccgc ttcgcgacct     16560
     ccgacctgaa cgacctgtac cgccgcgtca tcaaccgcaa caaccgcctc aagcgcctgc     16620
     tcgaactgaa ggcgcccgag atcattctgc gcaacgaaaa gcgcatgctg caggaagccg     16680
     tcgactcgct gctcgacaac ggccgccgcg gcaaggccat gaccggcgcc aacaagcgcc     16740
     agctcaagtc gctggccgac atgatcaagg gcaagagcgg tcgtttccgc cagaacctgc     16800
     tgggcaagcg cgtcgactac tcgggccgtt cggtcatcgt ggtgggcccg cagctcaagc     16860
     tgcaccagtg cggcctgccc aagctgatgg cgctcgagct gttcaagccg ttcatcttca     16920
     atcgcctgga gatgatgggc ctggccacga ccatcaaggc tgccaagaag ctggtcgaga     16980
     gccaggagcc ggtggtgtgg gacatcctcg aagaggtgat ccgcgagcac ccggtcatgc     17040
     tcaaccgtgc gccgacgctg caccgcctgg gcatccaggc gttcgagccg gtgctgatcg     17100
     aaggcaaggc catccagctg cacccgctgg tctgcgccgc cttcaacgcc gacttcgacg     17160
     gcgaccagat ggccgtgcac gtgccgctgt cgctcgaagc gcagctcgaa gcgcgtacgc     17220
     tgatgctggc ctcgaacaac gtattgttcc cggccaacgg cgagccgtcc atcgtgccgt     17280
     cgcaggatat cgtgctgggc ctgtactaca cgacccgcga acgcatcaac ggcaagggcg     17340
     aaggcatttt ctttgccgac gtgtcggaag tgcagcgcgc ctatgacaac ggcgaagtcg     17400
     aactgcagac ccgcatcacc gtacgcctga ccgagtacga gcgcgacgag cagggcgagt     17460
     ggcagccggt caagcaccgc catgaaacga cggtcggccg tgcgctgctg tccgagatcc     17520
     tgcccaaggg cctgcccttc acggtgctga acaaggccct gaagaagaaa gagatctcgc     17580
     gcctgatcaa ccagtcgttc cgccgttgcg gcctgcgcga cacggtgatc tttgccgaca     17640
     agctgatgca gtcgggcttc cgcctggcca cgcgcggcgg catctcgatc gccatggaag     17700
     acatgctgat cccgaaggcc aaggaaggca tcctggccga ggccagccgc gaggtcaagg     17760
     aaatcgacaa gcagtactcg tcgggtctgg tgacctcgca agagcgctac aacaacgtgg     17820
     tcgatatctg gggcaaggcc ggcgacaagg tcggcaaggc gatgatggag caactggcca     17880
     ccgagccggt cgtcaaccgt catggcgagg aagtgcgcca ggaatcgttc aactcgatct     17940
     acatgatggc cgactcgggc gcccgtggtt cggccgccca gattcgccag ctggccggca     18000
     tgcgcggcct gatggccaag ccggacggct cgatcatcga gaccccgatt accgccaact     18060
     tccgcgaagg cctgaacgta ctgcagtact tcatctcgac gcacggcgcg cgcaagggct     18120
     tggccgatac cgcgctgaag acggcgaact cgggctacct gacgcgccgc ctggtcgacg     18180
     tgacccagga tctggtgatc accgaagacg attgcggcac cagccatggc tacgcgatga     18240
     aggccctggt cgagggcggt gaagtcatcg aaccgctgcg cgaccgtatc ctcggccgcg     18300
     tggccgcgat cgacgtcgtc aaccccgaca cgcaggaaac ggccatcgcg gctggcaccc     18360
     tgctcgacga agacctggtc gacctgatcg accgcctggg cgtggacgaa gtcaaggtcc     18420
     gcacgccgct gacgtgcgaa acgcgtcacg gcctgtgcgc gcattgctat ggccgcgatc     18480
     tgggccgcgg ttcgcacgtc aacgtgggcg aggccgtcgg cgtcatcgcc gcgcaatcga     18540
     tcggcgaacc gggcacgcag ctcaccatgc ggacgttcca catcggtggc gccgcttcgc     18600
     gttcggccct ggccagcgcc gtggaaacca agtccaacgg cacggtcggc ttcgccagca     18660
     cgatgcgcta tgtcaccaac gccaagggcg agcgtgtggc gatttcgcgt tccggcgaac     18720
     tggccatctt cgacgacaac ggccgcgagc gcgagcgcca caagatccct tatggcgcca     18780
     ccgtcctggt tggcgacggc gaagcggtca aggccggcac ccgtctggcc agctgggatc     18840
     cgctgacccg tccgatcgtg tccgagtaca gcggcgcggt gcgcttcgag aacatcgaag     18900
     aaggcgttac cgttgccaag caggtcgacg aagtcaccgg cctgtcgacg ctggtcgtga     18960
     tcacgcccaa gacgcgcggc ggcaagatcg tcatgcgtcc gcagatcaag ctggtcaacg     19020
     agaacggcga agacgtcaag atcgccggca ccgatcactc ggtgaacatc tcgttcccgg     19080
     tgggtgcgct gatcaccgtg cgcgacggcc agcaggttgc cgtgggcgag gtcctggcgc     19140
     gtattccgca ggaatcgcag aagacccgcg acatcaccgg cggtctgccg cgcgtggccg     19200
     agctgttcga agcccgttcg cccaaggatg ccggcatgct ggccgaagtc acgggtacgg     19260
     tatcgttcgg caaggacacc aagggcaagc agcgcctggt catcaccgac ctggaaggcg     19320
     tcagccacga gttcctgatc ctgaaggaaa agcaggttct ggtgcacgac ggccaggtgg     19380
     tgaacaaggg cgaaatgatc gtcgacggcc cggccgatcc gcacgacatc ctgcgcctgc     19440
     agggcatcga gaagctggcg acctacatcg tcgacgaagt gcaggacgtc taccgtctgc     19500
     agggcgtgaa gatcaacgac aagcacattg aagtgatcgt ccgccagatg ctgcgccgcg     19560
     tgaacatcgt cgatccgggt gacaccgagt tcatcccggg cgagcaggtc gagcgttcgg     19620
     aactgctcaa cgagaacgat cgcgtggtcg ccgaggacaa gcgtccggct tcgtacgaca     19680
     acgtgctgct gggtattacc aaggcctcgc tgtcgaccga ttcgttcatc tcggcggcgt     19740
     cgttccagga aacgacccgc gtgctgaccg aagcggcgat catgggcaag cgcgacgacc     19800
     tgcgcgggct gaaggaaaac gtgatcgtcg gccgtctcat cccggctggt actggcctgg     19860
     cgtatcacat tgcccgcaag gacaaggaag cgctggaagc tgccgagcgc gaagccgccc     19920
     ggcagctggc caacccgttc gaggatgcgc cggttacggt cggcggcgaa ccggaggctc     19980
     cggccgccga tacgccgtcg gacgactcgg ccgagtgatg ccgtactgac tggaaggcgc     20040
     gccccgcgag gggcgtggcc cgacagccaa aaaaaggccg ctgatgcata tcagcggcct     20100
     tttgcttgac gcggttgcga ttgcggtcag gtgccggctt tcgattgcgc ggcccgaaag     20160
     accgggcccc aggcgggatg tccggcttcg ttgggcgcca gcgtgaaact ggagtccagg     20220
     tgcagtatgc gcacgaatgc gtcttcgcac agctgggtgt aattgctcac gcagtagctg     20280
     aatgcctgca gcttgaacgc ttcgatacgc accgctttcg gcgcggccgc cagttcatcg     20340
     gagcgcgcga cgcggcggat gacctcgcca taatggcctg cgccatattc cgtacgcact     20400
     tcggctaggg cctgcagcgc ggcgggggtg gcgggggcct cggcagcggg ctgggacagg     20460
     ttggcgcagc cgcttagcgc gagcacggcc agggaaagac tgggcaggaa agggcggagg     20520
     attatgggca tgatggacga gggcaggaaa cggggttcga ggttggtata tccttgcgcc     20580
     gcgggcatat tcgtaaaatc cggccaagta gcctggataa tatccataag gcggcccgca     20640
     aggatgggcg tgtcctacga agtgcgtcga gacgacaata tgtttatcga aacgtaagga     20700
     tagccgcgct ttcagcatca caagcacaat atccggttat cgctgccgtt ttttgctttt     20760
     gtcatagaac tatgcctctt ttcgccgctt cccagcatcc ccgcagtcct tttgcaggcg     20820
     ccgcgcctct cgcgcatcgc ccgttgagcg ctattgcggc caccgctgcc ggaggcgtgc     20880
     cgcaagcccg catcaagcgc ctgctgggcg agctggtgcc gcagctggcc agcgtgcatg     20940
     agcagggaca tatctgcggc gacatcaccg tcgattcggt ggggctggat gaaagcgggc     21000
     gcgcgcatct gctggcgctc aatggggcgg cccagggcga agccgcgctg ccggcgccgg     21060
     gatacgcgcc attcgagctt tatgtggagg atcctgcctg gccgcgcggt ccttggaccg     21120
     acatctacgc attgagcgcc gtggcgcact cgctcattac cggccgccgc ccgcctgcgg     21180
     cgccggagcg ctcggtcaac gacggctatc agccgctcgc gcagcgcgat ctgcccaagt     21240
     atgacaacga tttcctgcgc gccatcgatg ccggcctggc cgtgcggccg cacacgttcg     21300
     aggcctttgt cgactcgctc aagttccccg agccggagcc gcccgccgag gccatggcgc     21360
     ctctgcccag cgaaccgccg ccacgcgacg aggtgcacga cgaagagccg gtacggcagc     21420
     gtccggcggt gcgcagcatt ctgttcgcga tcctgctggc gttggcgacg ctgggcgtgg     21480
     ccgtctattg gtggcagcgc ctgaccggta cgcccagcgg cgtgatcacg agctccgaac     21540
     gcgtgacgac gcccggcgcc actgccacgc catcagactc ccgcgaggct gaaccgccgg     21600
     ccgccggcgc cgcgtcgccg cagggcggcg acgccggcag cgccgataca tccggcgctg     21660
     cgccgccggc gcaagcacag gctggtccgg acgccgctcc cgcgcccgat gttgcgccgg     21720
     aggacgctgc aacagacgcg caggccgaat ccgaggccgc cgcgacgccg gcaccggccg     21780
     ctgcccgcgt gacggtacgc atcaacgtgc agccgtgggg cgagatctgg atcaatggcg     21840
     tgcggcgtgg tgtcagcccg cccatgaagg aattgcgcct ggtgccggga cgctactcgg     21900
     tcgtcgtgcg caatgccgac ctgccgccgt atcgggccac gctctaggtc aaggcgggcc     21960
     agccggctcg catcacgcac gtgttccagt gagcgtccgg atggctctca gccagggggt     22020
     gggctggccg gcaggcgcag cacgaaggta gagccggcgg gccccgtgcc cgatggcggg     22080
     ctgatgacct cggcccggcc gcccagccgt tcggcgacgg tgcgcacgaa tgcaagcccc     22140
     aggccagcgc cgcctacttc gttcgagccg gcggtgttga cgcgcgtaaa gggctggaag     22200
     atctgcagct ggtcctgggg agcgatgcca ggtccgtcgt cctggatcga tgcgacccag     22260
     tcatcggcgt cacgcacgac cgtgcagcgg atacggccat cggacggact gaatttgatg     22320
     gcgttgtcca gcaggttgct cagggcctgc tgcagcaagg tgtcgtcgcc gcgcaccagg     22380
     gcgatgggca ggggttcgtc gatctcgatg cggatgccgc gcgcgcgccg gcgcccagaa     22440
     atcgtcggtc gcctcgcgca gcaactcgct caggtccagc tccgtcggtg cgatcttcat     22500
     cgattccgcg cgtgtcaggt ggacgaaatc gtcgaccagc cgcaatgtgc ggttggccag     22560
     catggcgatg cgggcgagcg cgtcgctctg ctgcacgcca ttgagcgagt cctggttcat     22620
     ggccaccagg gcaagtatcg aattctgcgg cgcgcgcatg tcgtgcgaaa tgaagcgcag     22680
     cgtctcttca cgcttgcgct cggcctgtcg tatgacggtg atatccgtca gggtggccac     22740
     ggtgccggcg aaagcgcctt cgtcggtgcg aatgggcgcg cacttcagga tcaggtcgcg     22800
     tccggcctgg tctcggacct ccatgtccac gttccacggc gaatcctgcg catcgggcgg     22860
     cgtatgccgc agggcctcgg tcaaggtctg gcggttgcgt tcgtcggtga tggcgcgctg     22920
     gaacagatcg gcggccagct ggccatggcg cggcgcacgc aaccccaggc tgcgaaaata     22980
     ctggatcgcc gcgcggttgc gaaactgcag ccggccgcgc gggtcgaaca ccagcgtcgc     23040
     gtcgggcatg ccgtccaggc catcggtcag gaagcgtcgc aggttgcgca cgcgcgccag     23100
     cgcttcgcgc aatttgccca ggcggtcttc cagcgaacgg ttgaccagca gcgtgtgggt     23160
     acggccttcg ttgagcaccg gcggatattc gcgctgcagc cgcttgagtt cattgtccat     23220
     gtagcgcagc acggcttcct ggctgcgcca gctccagatc ggatagcaca gcgccagcac     23280
     cagcatcgtg gccgtcggcg gaaaccacac ctggccaaag cgcagggcca gataggtgac     23340
     cggcaatacg gccagcaata tggcgccgtt gagcaccagc gccgccttgg gcgagagcac     23400
     ccgcaggccc aggcacagca gcaggacggg cagcgcagcg gccaaggcgt tatgccaggg     23460
     gctggcgacg gtataggaaa tattctggcg cgccgcctgc agcatgttgc cgatgatctc     23520
     cacgcccgcc atgccattgg cctggtgcga gacgggcgtg gggaacgcat cggtcaggcc     23580
     cgttgcccac gatcccacca gcacatactt gccgcggatc cattcgggcg gtacgttgcc     23640
     ctgcagcacg ctgatatacg acaccgtgcg caaatggccg ggggggccgg cgtatgggat     23700
     gcgggtctgg ccggccgcca gttgcgcggt ggcaaactgc agggcctgtt gcgcctcgcc     23760
     gcccacgctc atcagcgaca gcgagaaatg cggccatagc gcggtgccga cctgggctgt     23820
     ccagatcgag cgccgcagca cgccgtcggt atcgagctcg acattgatga agcccagtgc     23880
     ggcggcggcc tgcgccagcg actcgagcgg cggctcgtgg cccgtcgcgc gcggcaggcg     23940
     gttgagcacc accggcagca ccaccttgcc gttgcggcgg atggcctcgg ccagttgcgc     24000
     gtcgaccgcg ggttcggcgc ggtcgggttc ggcaaagatg atatccaggc ccactgcgcg     24060
     ggcctcgccc agcttgtcca gcagggccgc gtgcaccgtc ctgctccagg gccagcgccc     24120
     cagcgtggcg atactgtcgt cgtcgatcat gacgatcagg atttccgggc tggctggccg     24180
     gccggacagc gatacggccc ggtcgtacag cgtcaggtcg atgcggccca tgccgcccag     24240
     ggcgcccagc agtcccgcaa ccgtcaccag caccatcgtc agcatgatgc cggtgcgcgc     24300
     cgccagccag cgccgggcgg gggagtcggg cagggggcgg cggcggcgca ccttagaatt     24360
     cgctgagcag caccaggtcg ccggtgccgg tggctacgga caggccatag ggcgtggaca     24420
     gcacgtttgc gccttcgaaa ggctgcacgg cttcgcgccc gttcaaaccg gaggcatcca     24480
     cggcgcgaac cgccacgtag taggttccgg cgccgggcgc gcggaaccgt acatcgttgg     24540
     tatcgaaccg gtcggacgcc accacgtgca tgccctccgc gtcgcgcgaa accctcacta     24600
     tataggcgga agcgccggat acgggcgcaa acggcaccgt ccagccgccc gaggcggcgc     24660
     gcgccggggc ttgcagttgg ggggcgggca gcagggcctg cacgcccgag aacgcgccgt     24720
     cgctgccgac attggcgccg tagcccgagg acaccgctac cggcgtggcc agcgcggcgt     24780
     cgggggcgtg cggctgcagg cgtacgctgc cttccaggac ttcgctgctg gcgccccgcg     24840
     gactgctctt gacgcgaaag cgggtgccgc gcacgcccgt gaccgccacc ggcgtacgga     24900
     tctcgaagcg gccaacgccc tggccgcccg gggccacgcg cgattcgagc tcgccttgct     24960
     gtacctggaa gatcgaatcg gtaagcggca cgcgctggaa ttggcgcagg cggttggcgg     25020
     ccaccgtgcc gttctcggga atcgtcacct ggctgccgtc ggacagtttc agggtaacga     25080
     agctgccgga cgcggtcctg atggtgctgc cctcgacgat ctgcgtgccg acccgcaggg     25140
     cctggccgtc ggcggtggcg ttgccgctga cgtggaccac ctcggcgcct gccgcctgca     25200
     ccgggatcat ggccagcgga atgcgcagct cgagggcgat cggcaggcgc tgggggtcgt     25260
     ccacccggtt cagcgtctgc aggatcgacc agttggattc attaccggtg taagtgcttg     25320
     ctaacgctat aagcgtgtcg ccagaacgca ctcggtaaag aaaattctct cccaggctac     25380
     ctgcgggctg ggcttgtacc gcggcgctgg ccacaagggc acacaccagc atgaacgctg     25440
     gcgcgaacgg ccgaatcatg aacttctctc cttggattag tcgtctttgg cgtcgtcgcc     25500
     ctgcggctgc gggtcgctga ccaattccag ccgatagccc agggcatagg acgaagacaa     25560
     gcgcacccca ttctgggggc gcaactgcaa cttctggcga atattcgaca aatgcgtatc     25620
     aagggtgcgc gaggtcgccg ggatctcccg gttccacacg ctttctgcaa gcacatcgcg     25680
     cgagatcagg cgcccgacgt tgcgaaaaaa caactgcgcg agttcgaatt ccttgggcgg     25740
     caacggtacg acctggccgt cgagggcgat ggagcgctcg ttgggatcga tgcgatagcc     25800
     cccgcgaccg agaacggcag atagtcgggc agggcgccct ggctgcggcg caacagggcc     25860
     gccacgcgcg ccagcaattc ggcgggccgc atgggcttta cgatgtagtc gtcggcgcct     25920
     gcctgcaggc cttgcaccag gtcgctttcc tggtcccggc tggtcaggaa aatgataggc     25980
     acggcaaaac cgtagctcgt gcgcagccgg cgcacgactt cgtcgccatt catgtcgggc     26040
     aactgccagt cgagcaggat gaggtcgaac gcctggacgc gcagcgccgc cagcaggtcg     26100
     aggctgcgcg gatagctggt acatgtgtat ccggccgcgg agagcacctg ctggatatgc     26160
     tgcgcctggt ccagatcgtc ttcgagcgac gcaattttca ttcgttgtga cacagagcga     26220
     tgctcgcacg gcagtctgcg agcaggttac ggacaaggcc gggatccggt gcggcgaacc     26280
     gcgcgttcgc caattcgtcg cgagcgcatc tggcgtccca gaaacttact gttcgcacat     26340
     tggcgtaggc gtcatccaaa agtgtatgga accctaacca aacgcatgat aacccggggc     26400
     tcttgttaca tcgtccccaa tgagcataag tgtcaaacat tgcaaagttg acaaatgttg     26460
     actggctctg ttgcgcaaca ccgcgccaca ctgtctcaaa tgcgtacagg cgcgcgcttt     26520
     cccttttgag cgcctgaaag ccggccgcga acccgcggac tggcagggat tcgttatgaa     26580
     gcaattgagc acgttgatca tgacgcccga cgacgccgat cgcgaccgca tcattgcagc     26640
     aatgctgctg gccgggatct cggccaaggg ctgttccacg cccctggagc tgttcgggct     26700
     gttgagtgag gatacctacg acgcggtcgt gatggacctt tccgagctgg gcgagctggg     26760
     ctacgccctg gtggcgcgcc tgcgtggctc gccggagctg ggcatcatcg tcattggcgg     26820
     caacctgacc ctggacgccc gcctgcgctg cctgcaaagc ggcgcggacg cctgcgtgcc     26880
     cctgccggcc gacgagcgcg agctggcatg cgtgctgctt gccctggcgc ggcgcctgcc     26940
     cgcctggcag gaagacgaag aggccgtcgc gcaacgcggt accgacgacg agggctggga     27000
     gctgcgcgac caggactgga cgctcgtggc ccccggcggg gaagagctgt cgctgtcggc     27060
     caacgagcgg cagatcgtcc gcctgctgct gggcgcggcc ggccgcgcca tcggccgcgc     27120
     cgaactggcc agcgagctgg ctgtcgacgg cccggcggtg cgttccaccg gcgagcgcag     27180
     catcgacgtc atcgtcagcc ggctgcgccg caaggccgag ctggcgggcc tggtgcttcc     27240
     catccgaacg gtctacggca gcggctacct gttcgccaac tcctagctgt gaactgtcaa     27300
     taggttgtat ttgtccaggt tgagtctgga gatgggtaca gcgcgcccga tgccttggtg     27360
     gggtcgatgc cagttgtagt ggtgtagcca ggatttcatg gcatcggctc ggtgttggga     27420
     gttctggtag gtgtgagcgt aagcccactc acgcaaggcc gactggatga agcgttcggc     27480
     cttgccattg gtctgtgggc ggtaaggtcg ggtaaagcgg tgcttgatgc ccagctcatg     27540
     gcacagcgcg gcgaaggcgc ggctgcgaaa ggccgagcca ttgtcggtga gcaagcgctg     27600
     gatggtcacg cccaggcgct ggtagtaggc cactgcgtcc ttgaggaact ggacggcgct     27660
     ggggaagcgc tcgtcggggt ggatgtcggt gaaggccacg cgggcgtggt catcgatggc     27720
     cacgaagacg aagtcccagc cggccccctc aacggtatcg cgtcggttgc ccgtgacccg     27780
     gtggccaggg cgctggatac gtcccagctt cttgatgtcg atgtgcagca gatcgccggg     27840
     ggcctgatgc tcgtagcgca ccaccggctc ggccggctcc aggtcggcca ggtgcgacag     27900
     accggcgcgg gccaggacgc ggctgacggt gctggctgac acgcccagcg cctgggcgat     27960
     gcgcgcttgg gtcagccgct tgcggcgcag ctccacgata gccagcgcct tggccggcgc     28020
     aatcgctcgg ggcgagaccg tcgggcgcga ggacgcatcg gccaagcccg cctggccctg     28080
     agccaggaag cggcccagcc atttgcgcac agtcggcgcg gtgaccccat aggcgcgggc     28140
     cgcttcaggc acacaaactt gatgggcgat caattgctgg accatttcga gtcgacgtag     28200
     gaaggtcaat cgggcatgct tatgggtgtt catccggccg ggctccttga gtgaactggg     28260
     ggggtggcga tttccagttt ctcaaatccg gttcggatga accatgcata caacctattg     28320
     aatcttcaca cctagcccca gccgacccat tgtcttcggc cgcaaactgt agataagaac     28380
     atccgccgcg cccagcattt tcctgagact cgcaaggccg gaaggcttct tcaggtccag     28440
     caccacgctg cgcttgtttc gattcaggtg caggaaggtg acgctcattc ccttgttgcg     28500
     ggccggcccg acatgacgtg tcgtgtcccc ttggggcgat tcgatcttgc aaacgtccgc     28560
     gcccatatcg gccaacaaca aggacgcata cggccccatg acgttggacg tcatatccag     28620
     aattcgaacg ccttccaatg gtcctggcat accgttcccc caattccctt cttgtcaggc     28680
     cggcaagtcc gcggatacga aaaccggcag aatctgcgcg ccacgtcgaa cgaaacgcac     28740
     ctgcactttg tctccgacgc caatcgagcc tggcggccct tcgatctgcg tgaacagaaa     28800
     gtacccttcg tccatttcga cgaaacccac ggtataggga acgatagagg cccacaccgg     28860
     ggtcggcccg cgcgtcaccg tactgaagga gtacaccgtt gcgcgtccgc tggacgcttg     28920
     ccagaccagt tggtcggacg aacaatgcgg gcagcgcgaa tgggccggcc agacggattg     28980
     gcggcatgcg acacactgct ggtatgtcag tttctcgtct tgcagcgcat cccaataggg     29040
     ttgggcatcg agcaaccgat agggttgcgg ccagccgttc agtggctctt gttccatcgt     29100
     catttccatt tgctcgcgat tttcctcaag tgcgttccga gtcagagttc cgaggcaaga     29160
     atcgttacgc tccccgcagc cagcatcccg ccggatccct ggacgagcac agtgcgtggc     29220
     cgccttgctg gcgcgcggcc caaggcgttg ccgcgcaatt ggcgtaccgc ctccgcgtag     29280
     ctgtccatgt tgcaggaaat gccgggctgg ccgaatgaga gccagccgcc attggtatcg     29340
     atgggcaggt cgccatcgac gccggtccgg cctgcgcggt acagatccat gccgcgtcct     29400
     ttcgcggcaa agccgagatc ctccatgatg agcggaccca tatgggcaaa attcaccgat     29460
     atctgtgcca tatcgatgtc cgccggcgtc aaacccgatg actcgtatgc ttggcgggcg     29520
     gcctcggcgg ttgccgtatg ggtcagattg ggaaaggcgc cgagagaggg atagcggcaa     29580
     cgtcgcatgt tcatgcgatc tcccagatac tcgtgcgtgg tggccgatcc ataacccatt     29640
     acatagaccg gatcttgcgc tgtccttgcg ttgtcgaccg atgtgaccac cagcgccccg     29700
     cccgttccgc cgccccaggt cgagcacatc cagcggcgca acggcgtggc gacatagggc     29760
     gaagagagca ctttcgcgcg gtctatcgag ccgaatcgcg ccttggccgc atgaggatga     29820
     tgcatggccc atgactggtt cgcgatcgcg acgtcggcca gatcttcttc ggtgatgccg     29880
     aactcatgga agtaccggca cgccgcctga gcgtacaggg cagggatggt cggcccgtag     29940
     ggaatctcga actgcgggtc ggcgtcggct tccgcgccca tggccaccgc gtcgacgaac     30000
     agctcggtcg cgtcactttg caggcacagc acgtattgcg cgcggccggc cgcgatcatc     30060
     tgcgccgcca tcgcaaccgt cgcattcaag ccggcgccat gcatcgtaat ctcgctggta     30120
     atcgtcaccg gcatatgcat gtgcgagcag aatatattgc tccactgcga acgcttgtca     30180
     gcccaggggg agcgcccggt gaatacggcg tccacctgat ctttcgtgat cccggcgtcg     30240
     gccaatgcct tgtgggtcgc cgcgacggca agctggattg gatccttgcg atcttgcatc     30300
     gacgcgtatg catcgcccat gcctacgatc gcggcggtcg gcttcggtgt catggccatg     30360
     gccttcaagc ggccacttca ggcaacgatg ccccgaccaa cgcgtccagg tcttcgcgcc     30420
     ggcgcaacat cagcaaactc cactccccct tctgcaccac ggtcccgtcc tggttgacgg     30480
     ccttcatgaa aaacgtgata acgccgtact tctcgtcctt ctccttcttt ctcatgacct     30540
     cgcagacggc atagatggtg tcgccgatgg aaaccggagc cagaaaccgc atgttgtcga     30600
     tgccatagtt cgcctgaatg ccaaggccga actgaatcaa tccggtaacg atcgagtacg     30660
     tcaacgaccc ttgcaccagg cgcttgccga aacgtgtctt ggacgcgtat tgcacattcg     30720
     aatggatttc gatccagttc cccgtgagtg cgcagaagtt caccacgtcg gtctcggtga     30780
     tggtgcggcc gccggagcga aaaaccttcc cgacttcgat ctcatcgaag gtctgatcga     30840
     tgcgattgtt gattctggcc atgactgatt gcctccttgt tcgatgtgac agcgcgcaag     30900
     gcctgcccgt tgaccgagag tgtggacacg cggtctcgtc gaatcaattt gcaattttcg     30960
     aagcgctgat tctctcgccg cgaatcatcg cctggcggcg gatccggcca gcatggccgc     31020
     aacgtctccc gtacgtccag gatgcgctgt cagcctgcgg gccaaccgtt cagtccgaaa     31080
     cggaagacag ggcgcgagga cgatcgagca actgcttgag caggaggttc gcggccggac     31140
     cggcggcgcg cccgcgcgcc gttgcgatat gaatcgagcg attcgcccag gactcggcga     31200
     gttcgacgcc gacggcatgc tcgaagactt tcaggtccag caagcattct ggctgtatcg     31260
     tgacgcccag cccctcctgg gccaggctga tggcgacgcc ggcgctcgtg acgccgtact     31320
     tcggttcaaa ctcgcgcccc agcctgtcgg ccgccgtcct caaagccatg tgcagcgccg     31380
     ctggaacaat caggttctcc gacagcagat cctcgaaggt aacgctttgc cgctgcgcca     31440
     atctgtgtcc gtgggacatc accaccacca tgcgatcctg ccggtatggc atgacatcca     31500
     cgccgctcag atcgagcgcg ggggctgccg cgaagacgcc gatatcggca tccccctgcg     31560
     ccacggcttg cacgatggcg gcgttctcga cttcgcgcac gatcaggtcc accagcgggt     31620
     aatcccgtat atacgcgccg aactcgtgcg ccagatacgg ggcaatgatc gagcgcgccg     31680
     aagcgacgga cacctctccc cttacgccct cgctgaaggc cgacagctcg gcgcgcaact     31740
     cgtccacgtt ggtgaatatc tgccgtatat ggcgtaccag gacttcgcct gcggggctga     31800
     gtatcacgcc tttcggcgtg cgctccagca gacgcaggcc cacgacatct tccaattcct     31860
     ggatgcgttt tgtcgcagcc gacggcgcaa tgttctcacg cagtgccgca cgcccgatct     31920
     ggccttcttc cactgcggat agaaacaatc tcagtgtgaa gaaatccacc tgtctcaaca     31980
     gccgggtctt gttgaatgag gacatagcct gccttggagg ttatggattg acgtgcgaaa     32040
     ccgactcgcc ctggattctc ccatgcaagc gcaccccgtc acgtccaaag tacggaacac     32100
     aggcctgctc tcccttgcgc catccttgcg cgcggactca aactcgctcc agccggccac     32160
     gccatgcggc gtggcgcgat gaatacgcat caacgctatg gagccgtatc gaacatgcgc     32220
     tacgaagact ttgaattcct gctgtgcgaa ccccaggacg acggcgtcat gctggtcacg     32280
     ctcaaccggc ccgacgccat gaacgccacc aacgaccgca tgcactggga actgacccgg     32340
     atctggggcg tcgtcaacga cgaccccggc gtcaaggcgg tcgtggtcac cggcgccggc     32400
     gaacgggcgt tctcggcggg cggcgacctg tccgtcgtgg aggccatgtc caacagccac     32460
     gaaaccacca tgcgggtcat gaaagaggcc tccgacatcg tctacaacat gctggcctgc     32520
     gacaagccga tcatttccgc gatcaacggc acggccgtgg gcgccggcct ggccgatgtg     32580
     agcgtcatgg ccgaggatgc gaagctgacc gacgggcacg cccggctggg cgtctcggcc     32640
     ggagaccatg ccgccatcat ctggccgatt ctctgcggca tgtccaaggc gaagtactac     32700
     ctgatgaccg cggacttcgt cgacggcaag gaagccgaac gcatcggact ggtgacgttc     32760
     tgcgcgccgc gcgccgaggt cctgcccagg tcgctcgcga ttgccgcgaa gctggcgcgg     32820
     ggcagccaga cagccatccg cgcgaccaag aagtcgctca acaactggat gcgcaccgcc     32880
     ggccccgcct tcgacaattc gctggcgctg gaaatgctgt gcttcctggg cccggacgtc     32940
     aaggaaggat tggccgcgct gcgcgacaag cgcgcgcccg actttccctc ggcgcgcctg     33000
     ccctgaccgt caagccgcgc aagcgacgcc cccctttcga gagaccgcat gaacgcagcc     33060
     ccaagcccct ctaccccgcc cggtaactgc ccgccgctcg aacaggccgt ggtgcgcttc     33120
     atccaggacc tgaagtacga gcatatcgat gccgcggcgc tggccggcgt gaaccgcctg     33180
     atgcgcgacc agctcgcgct gcaggtcggc atctcggcca tgccgtggtc ccggcaattg     33240
     ctggactacg ccctgaccca gcagcgtccg ggcgtcagcc gcgtcagcgc ctcgaccctg     33300
     aaaatgagcg ccgccgacgc cgctttcgtc aatggctcgt acggccacgg cttcgagtac     33360
     gacgacgccc atggtcccag ctacagccat ccgggcagct gcgtcatccc cgccgccctg     33420
     gcgatcggcg aggaactggg ctcgtcgctg caggacgtca tcacggcaat ggtcgccggc     33480
     tatgaggtct acacgcgcat cggcctgctt gccgcgcccg acctgctgcg gcgcggctac     33540
     catccccact gcaccctgtc gaacttcggc gccgccgccg tggcggcaaa actgcgcggc     33600
     ttcgacgccg aaaccaccct ccacgcactg gcgatcgcgc tcagccatac ctcgggcacc     33660
     accgaatact cttcgaccgg cggctccatc aagcgcatcc acgccggcct gggcacccgc     33720
     aacggcatga tggccgccga catggcgcgg gccggcatca cgggaccgcg cgccttcctg     33780
     agcggcaaca agggattctt caagaccttc ctgcagcgcc cggcgggcga ggccccgcag     33840
     cagcgcttcg cgccgggcga acccttccag gtcgcgaccg tctggctcaa ggcctattgc     33900
     gcctgctact gcacgcacgc ctacatcgac gcgctgcggc cctacgccga gcggcgcggc     33960
     gagatcgccg acatacacct gaagatcacg ccgcacttca acgtggtcgt cggcaccgcc     34020
     aacgcctgcg cctacgcacc caccaacatc gaacatgtcc agtttagcct gcccatccag     34080
     gcggcgcttg ccgtccaggg cctgggcaac ggctaccgta tccatcgcga ctacctggac     34140
     ggccgggtgg acatggcgcc ggtcatcgcc atggcgcgcg gcatccgcat caccgaagat     34200
     cccggcctcg aaacgcgcca tcccggcaag ttcgtcgccg acgtgaccgt caccttccgc     34260
     gacggcagcg ccgagcacgt cttcgtggcg gacccgatcg gcacggacac gaatcccatg     34320
     cccgagcacg agcaggacgc caagttcatg gagctgaccg ctgacgccct gggccaggcg     34380
     cgcgcgcggg cgctgctggc cgcgctgcgg aagatggatc cgacgatgaa ggccgccgac     34440
     ctgatggcgc tgtgcgaacc cgcgccatga cgccgggccg gcgcccggca cggccccgcg     34500
     gcccgggccg ctttgcgggc cgactagctg tgaagattca ataggttgta tgcatggttc     34560
     atccgaaccg gatttgagaa actggaaatc gccaacctcc cagttcactc aaggagcccg     34620
     gccggatgaa cacccataag catgcccgat tgaccttcct acgtcgactc gaaatggtcc     34680
     agcaattgat cgcccatcaa gtttgtgtgc ctgaagcggc ccgcgcctat ggggtcaccg     34740
     cgccgactgt gcgcaaatgg ctgggccgct tcctggctca gggccaggcg ggcttggccg     34800
     atgcgtcctc gcgcccgacg gtctcgcccc gagcgattgc gccggccaag gcgctggcta     34860
     tcgtggagct gcgccgcaag cggctgaccc aagcgcgcat cgcccaggcg ctgggcgtgt     34920
     cagccagcac cgtcagccgc gtcctggccc gcgccggtct gtcgcacctg gccgacctgg     34980
     agccggccga gccggtggtg cgctacgagc atcaggcccc cggcgatctg ctgcacatcg     35040
     acatcaagaa gctgggacgt atccagcgcc ctggccaccg ggtcacgggc aaccgacgcg     35100
     ataccgttga gggggccggc tgggacttcg tcttcgtggc catcgatgac cacgcccgcg     35160
     tggccttcac cgacatcccc cccgacgagc gcttccccag cgccgtccag ttcctcaagg     35220
     acgcagtggc ctactaccag cgcctgggcg tgaccatcca gcgcttgctc accgacaatg     35280
     gctcggcctt tcgcagccgc gccttcgccg cgctgtgcca tgagctgggc atcaagcacc     35340
     gctttacccg accttaccgc ccacagacca atggcaaggc cgaacgcttc atccagtcgg     35400
     ccttgcgtga gtgggcttac gctcacacct accagaactc ccaacaccga gccgatgcca     35460
     tgaaatcctg gctacaccac tacaactggc atcgacccca ccaaggcatc gggcgcgctg     35520
     tacccatctc cagactcaac ctggacgaat acaacctatt gacagttcac aactagcgcg     35580
     gcgcctggcc gcgcggcagc cagtgccaga acacggcggc ggcggccagg cccaccccgc     35640
     ccatggccgc caccccggcg gccagcgaca ccagcgcggt gatgccggac agcgccaccg     35700
     gccccaggct gccgcccagg tcggacatca ggcgccacag gcccaggaac tcggtacgcc     35760
     cggacgcagg cgccgcgtcg gcgcccagcg tcatgacaat gcccgagcca atgccgttgc     35820
     ccatgcccag catcatcgcc acgatcacga aaccggccac gccgctggtc agcgaggtgc     35880
     cgatcagggc gcagcccatc agcagcgtcg agggcaccgc cacccacagc cgcccgcgcc     35940
     ggtccatcag catgcctgcc ggatagaaca ccgacatgtc gatcgccgcc accaggccat     36000
     aaatgagcga ggtggtcgcc gggttgacgc ccaggtggtc ggcccacagc gggatcacca     36060
     cctgccggga cgcgcgcacc gcgctgacca gcaggatgcc cagccccagc gtcaggtata     36120
     cctggcgatg cgcgcgcgcc acgtccagca gccgcggccg ggcgacggcc gcctcgccgc     36180
     ggcgccgcgg cggcgccatg tcgggcgcga accacgcaat caggccggcc ccggtcatgg     36240
     ccacggccgc cacccagtac gcgccctgca ggcccatgaa gtggatcagc gccgcgccgg     36300
     cgaacggccc ggcgaacacg ccgatgcgca tggtgccggc cagcgtggac agggcgcgcg     36360
     cgcgcatgta ggcgggcacg gcgtcgatca tgtagccctg ccgcgccagc aggaagaccg     36420
     aggacgccat gccgaccatg aacacgccgg tcgccagcat ccacagcgtg ccggcgaaga     36480
     tgcacagcag cagcgccacc acgctgagcg ccgccgcgcc caccatggag cgccgctcgc     36540
     cgtggcgcga ggtgaacatc gcggcgggga tgttgctgac cagcgaaccg atgccgacca     36600
     ggcccacgat caggcccgag gtagccagcg atgcgcccag ttcccgtgcg gtaagcgcca     36660
     ccacgggcag gatggcgcca ttgctcacgc catagaggat ggaggggccg aaggcgggaa     36720
     cggcaatgtc tttgaggctg aacgaagcgt cgtggtcgga cacgatggga acaggaagtg     36780
     ggggccgacc tgtattctag gacctgtccc gcatggggac cgacattcgc ggcagcgtgt     36840
     gcctgtcccc actgggacag gcacaccgtc gtgcgacacg gcgaacggcg gccgctccgc     36900
     ggacggccaa aaagggacgt gtccgccgtc tgcgccaagg ccagttaaaa tggcgggttt     36960
     tccacgctgc cggctggcgc gcggcctgcc gcgccccgac ttccttaccc ctatgctcac     37020
     cttccagcaa atcatcctca cgctccagga ctattgggac aagcaaggct gcgccctgct     37080
     gcagccgtac gacatggaag tcggcgccgg cacctcgcac acggccacct tcctgcgcgc     37140
     catcggcccc gagccgtggc gcgccgccta cgtgcagcct tcgcgccgcc ccaaggacgg     37200
     ccgctacggc gaaaacccga accgcctgca gcactactac cagtaccagg tcgtgctcaa     37260
     gcccgcgccg cccgaaatcc tcgacctcta catcggctcg ctcaaggcgc tgggcatcga     37320
     ccccacgcaa cacgacatcc gcttcgtgga ggacgactgg gaaaacccca cgctgggcgc     37380
     ctggggccta ggctgggaag tctggctcaa cggcatggaa gtcacccagt tcacctactt     37440
     ccagcaagtc ggcggcctgg actgcacgcc cacgaccggc gagatcacct acggcctgga     37500
     acgcctggcg atgtacctgc aggacgtcga aagcgtctac gacctggtct ggaccgaagg     37560
     cgccaacggc aaccgcgtct actaccgcga cgtgttccac cagaacgagg tcgagcaatc     37620
     gacctacaac ttcgagcacg cgtcggccga catgctgttt gcgcacttca acgattacga     37680
     agccgaggcc aagcgcctga tggacgtgcc gctggccctg ccggcctacg aggcggcgct     37740
     gaaggctgcc cacactttca acatgctgga tgcgcgcggc gcgatcagcg tgaccgagcg     37800
     cgccgcctac atcggccgca tccgcaacct gtcgcgcgcc gtcgcgcagg cctactacga     37860
     ctcccgcgaa cgactgggct tccccatgct tgccggccgc aaggccgccg gggaggcagc     37920
     ctgacatgac caccgatatc cgccccctgc tgattgaact gtttaccgaa gaactgccgc     37980
     ccaaggcctt gcagaagctg ggccaggcgt tcgccgaagg cgtgcgcgcc accctggcgc     38040
     gccaccatct gctggccgac ggctgcgcgg tcgagccttt cgccacgccg cgccggctgg     38100
     cggtgcgcct gtcggccgtg ctggcccagg cccccgagca ggcctacgcc gagaaactga     38160
     tgccggtgaa ggtcggcctg gacgccaacg gccagcccac cgccgcgctg gccaagaagc     38220
     tggccgccaa gggcctggaa ggcctggatc cggccacgct ggaacgcgag tccgatggca     38280
     agcaggaata cctggtggcg cgcggcacgg ccgccggcgc gcaactggcc gtcgggctgc     38340
     aggaggggct ggacgccgcc atcgacggcc tgcccattcc caaggtgatg cgctaccagt     38400
     tggccgacgg ccagaccacc gtcaagttcg tgcgcccggc gcacgggctg gtggccctgt     38460
     tcggcgccga catcgtgccg atcgcggcgc tgggcctgca ggccggccgc gccacgcagg     38520
     ggcaccgctt ccagagcaac ggcgccatcg agctcgccac ggcccaaggc tacgaggccg     38580
     acctggccga gcgcggccgc gtcattgcct cgttcgaggc gcgccgcgcc gagatttcgc     38640
     gcctgctcga cgagcacgcg caacggctgg gcgccacgct gggcgacgac cccgaagtca     38700
     cggccctgct ggacgaagtg accgccctgg tcgaacaccc cacggtctat gtcgggcagt     38760
     tcgaggaaca gttcctgcaa gtgccgcagg agtgcctgat cctgaccatg cggctgaacc     38820
     agaagtactt cccgctgttc gacccggcca gcggcaagct gacgcaccgc ttcctgatcg     38880
     tcagcaacat gcaggtggcc gacccggcca acatcgtcga aggcaaccag cgcgtggtgc     38940
     gtccgcgcct ggccgacgcc cagttcttct tcgagaccga ccgcaagacc ccgctggccg     39000
     cgcgcgtcga gcagctgggc agcatcgtct accacaacaa gctgggcacc cagctcgaac     39060
     gcgtcgagcg cgtgcgcgcc atcgcgcgcg gcatcgccac ggcgctgggc ggcgacgccg     39120
     cccattgcga ccgcgccgcg ctgctggcca aggccgacct gggctcgaac atggtgggcg     39180
     agttccccga gctgcagggc atcatgggcg cctactacgc ccagggcgac ggcgagcccg     39240
     ccgacgtggt caccgccctg cgcacgcaat accgcaaccg ctatgacgcg ccggtcgacg     39300
     ccgccacgct gaccgcggcc acgctgttca tcgccgagcg catcgaaacc ctggtcggca     39360
     tctggagcat cggcctggcg cccaccggcg agcgcgaccc gttcggcctg cgccgcgccg     39420
     cgctgggcct gatcagcgcc ttcgagcaac tggccgccgg cggctggctg aaggtcagcg     39480
     aagacggccc gctgtcgctg gacggcctgc tggcgctggc cgcgcaggcc ttcccggacg     39540
     gcaagatcgg cgccgacacc ctggccgagg tgcgcgcctt catctacgaa cgctaccgca     39600
     accagctgat cggcgaacac gaccgcaacg cggtcgaggc cgtcatcgcg ctggcgccgc     39660
     cgctgcacca ggtggccgca cgcgtacgcg cggtggccgc cttcgcgcaa ctgccggcgg     39720
     cggccagtct ggccgcggcc aacaagcgca tcggcaacct gctcaagaag gccgaagggg     39780
     aaatcggcgc ggtcgatgcc gcgctgctgc aggacccggc cgaaaaggca ctggccgagg     39840
     ccgtggcgca actgcggccg caagcccggg cccagctgca ggcgggcgat ttcgccgcca     39900
     gcctggccac gctggcgcaa gcgcgcgagc cggtggacgc cttcttcgcc gatgtcatgg     39960
     tgatggccga cgacgcggcg ctgcgcgcca accgcctggc gctgctgggc caactgcacg     40020
     gcctcatgaa ccaggtggcc gacatttcca ggctggccca gtgaaactga tcattctcga     40080
     ccgtgacggc gtggtcaacc aggacagcga tgccttcgtc aaatcgccgg acgaatggat     40140
     cgcgctgcct ggcagcctgc aggccatcgc gcgcctgacg caggccgact ggacagtggt     40200
     gctggccacc aaccagtcgg ggcttgcgcg cgggctgttc gacacggcca cgctcaacgc     40260
     catccacgac aagatgcacc gcgcgctggc gcagatgggc ggtgtcgtcg acgccatttt     40320
     catgtgcccc cacgggccgg acgacggctg tgcgtgccgc aagccgctgc cgggcatgta     40380
     tcgcgacatc gcgcgccgct acgacgtcga cctggccggc gtgccggcgg tgggcgactc     40440
     gctgcgcgac ctgcaggcgg ccgcgcaggc aggctgtgcg ccgtggctgg tgcagaccgg     40500
     caacggccgc aagacgctgg cgcagggcgg cctgcccgaa ggcacacgcg tatgcgagga     40560
     cctggccgcg gtggccgagc aactgctgca ggaggcctga tccatggcct ggctgcgttc     40620
     ggcgctgtat gcactgttcc tgatcgtcac cgtcattccc tatgcgttcg cctgcatcct     40680
     gtgggcgccg ctgccgctgc actggcgcta tcgcctgacc gtgggctggc cgcgcctggc     40740
     catctggggc gcgcgcgtga tctgcggcat ccgctggcgc atcaagggcg ccgagaacct     40800
     gcccgacggt cccgccatcc tgctctccaa gcaccagtcc gcctgggaga cgctgttctt     40860
     cccggcccac atgccgcgcg aagtgtgctt cgtctacaag aaagaactgc acatggtgcc     40920
     gttcttcggc tggggcctgg cgctgctgcg catgatcccc atcgatcgcg ccaagggccg     40980
     tgacgccttc gagcaggtcg tgcgccaggg ccaggtgcgc ctggacgaag gccgctggcc     41040
     gctgctgttt cccgagggca cgcgcgtgcc gcccggaaag accggccgct tcaagatggg     41100
     cggcgcgctg ctggcttcgc gcaccggcgc gcgcatcatc ccggtggcgc acaacgccgg     41160
     cgaatgctgg cgccgcaatg ccttcgtcaa gcgccccggc ctgattaccg tctcgatcgg     41220
     ccccgcgata gaatcgcagg acgtcgcccc tgaagtcctc aacgccaaag tacaggcctg     41280
     gatcgaaggc gagatgcgtg ttctcaatcc cgaaaggtat ggccaagcct gatcagctgg     41340
     aactgctgtt cgacgtcgcg ccgccggcgg atccggccag cgcggcgccg cgcaagacgc     41400
     ccaaggcccg gccggcgccg cccgcgccgg ccgccatcgc caccccgtgc cccgatccgc     41460
     tgccgcccgg cgcgcgctgg cgcgaagtcc ataccgaaca acaacccatc ggcttcgtgc     41520
     tgctgcgctc gcgccgccgc agcatcggct tcgtggtggc cgacgacggg ctgcgcgtca     41580
     ccgcgcccaa ctgggtcacg ctggaacaga tcgatgatgc cgtgcgcgag aaggcgcgct     41640
     ggatccttgc caagctgcgc gactggcacg cccgcaagga acaactggcc atggcgcaca     41700
     cgcgctggca ggccggcggc gaactgccct acctgggcaa gcgcatcgtt ctcggcctgg     41760
     gcgccgaacg ccgccaggct tgcctgtcgg gcgatgccga cgcgccctgc gacggcgaca     41820
     ccctgtggct ggcgctgccc gtcgatgccg accaggcgcg catccgcgac gccgcccagg     41880
     catggctgca acagcgcgcc ggagcctggt tcggcgcccg cctggcgcac ttcctgcagc     41940
     tcaccggcct gcgcatccgg cgctggcggc tgtcctcggc cgccacccgc tggggctcgt     42000
     gcaccagcga cggcaacatc atgctcaact ggcgcctgat ccacttcgcg ccggccatca     42060
     tcgattacgt catcgcccac gaactggccc atctgcgcga gatgaaccac agccaggact     42120
     tctggaccga agtcggccat atcctgcccg gcttcgagga cgccaagaac gtactgcggc     42180
     gccacgatcc cgccaccctg ccgcagttct gagcccgcgc cggctggcgc ggccgatttg     42240
     ctacgatgac gccctggacg ttttacccat gaggagttca tcatgcgcct gttgcatacc     42300
     atgctgcgcg tcggcaacct ggataaatcc atcgatttct ataccagcgt gctgggcatg     42360
     cgcgaactgc gccgcaaaga ctacccggat ggccgcttca ccctggcctt tgtcggctac     42420
     caggacgaaa gcgaagccgc cgccatcgag ctgacccaca actgggacac cgagaaatac     42480
     gacctgggca ccggctacgg ccacatcgcc atcgaagtcg acaatgccta cgaggcctgt     42540
     gacaaggtca aggaaaaagg cggcaaggtc acccgcgagg ccggccccat gaagcacggc     42600
     accacggtca tcgccttcgt cgaggatccg gacggctaca agatcgagtt catccagaaa     42660
     aagggtcgca acgactgagg ccccgccatg atccacgcca tactcaagat gggcgacccg     42720
     cgcctgctgc gcgtggccgc gccggtcgag cgctacgaca cgcccgaact gcgcgcgctg     42780
     atcgacgaca tgttcgagac catggcgcac gcccagggcg tgggcctggc cgcgccgcag     42840
     atcggcgtgg atctgcagct ggtgatcttc gggttcgagc gcaacgaccg ctacccggac     42900
     gcgccggccg tgccgcgcac catcctgtgc aacccggtca tcgaaccgct atcggacgag     42960
     atggaagacg gctgggaagg ctgcctgtcg gtacccggcc tgcgcggcct ggtgccgcgc     43020
     taccgccata tccgctacag cggctacgac cccgccggcc agcgcatcga acgcgaagcc     43080
     gaaggcttcc acgcccgggt ggtgcagcac gaatgcgacc acctcatcgg ccggctctac     43140
     cccacccgta tccgcgacct gaccaagttc ggctacaccg aggtgctgtt tccggagatg     43200
     gacccgaacg ccgactgatc caggcgcctg tccccgcggg gacggatacg gtcttggccg     43260
     tcaaaccgca gtgtgcctgt cccagcgggg acaggcacac tggccgcagt tgggacaggc     43320
     acccacgcac ccggagcctg cgcccgctac cgcccgcggc cggtcagctc ctgcggcacg     43380
     aaatcatcga ccgccagcac gcccgccacc gccgcctcgg cggcctcgat ctcggccgcc     43440
     tgctcgggcg tcagcgcgcc gccgcgcagc gcgtcgcgcc aatccggcac gccttcgcgc     43500
     cgcaggcggt ccagcagggg ctgcaccgcc gtcgccaggg caaaggcgcg ctccaggcgg     43560
     cctagctgtg aagattcaat aggttgtatg catggttcat ccgaaccgga tttgagaaac     43620
     tggaaatcgc caccccccca gttcactcaa ggagcccggc cggatgaaca cccataagca     43680
     tgcccgattg accttcctac gtcgactcga aatggtccag caattgatcg cccatcaagt     43740
     ttgtgtgcct gaagcggccc gcgcctatgg ggtcaccgcg ccgactgtgc gcaaatggct     43800
     gggccgcttc ctggctcagg gccaggcggg cttggccgat gcgtcctcgc gcccgacggt     43860
     ctcgccccga gcgattgcgc cggccaaggc gctggctatc gtggagctgc gccgcaagcg     43920
     gctgacccaa gcgcgcatcg cccaggcgct gggcgtgtca gccagcaccg tcagccgcgt     43980
     cctggcccgc gccggtctgt cgcacctggc cgacctggag ccggccgagc cggtggtgcg     44040
     ctacgagcat caggcccccg gcgatctgct gcacatcgac atcaagaagc tgggacgtat     44100
     ccagcgccct ggccaccggg tcacgggcaa ccgacgcgat accgttgagg gggccggctg     44160
     ggacttcgtc ttcgtggcca tcgatgacca cgcccgcgtg gccttcaccg acatcccccc     44220
     cgacgagcgc ttccccagcg ccgtccagtt cctcaaggac gcagtggcct actaccagcg     44280
     cctgggcgtg accatccagc gcttgctcac cgacaatggc tcggcctttc gcagccgcgc     44340
     cttcgccgcg ctgtgccatg agctgggcat caagcaccgc tttacccgac cttaccgccc     44400
     acagaccaat ggcaaggccg aacgcttcat ccagtcggcc ttgcgtgagt gggcttacgc     44460
     tcacacctac cagaactccc aacaccgagc cgatgccatg aaatcctggc tacaccacta     44520
     caactggcat cgaccccacc aaggcatcgg gcgcgctgta cccatctcca gactcaacct     44580
     ggacgaatac aacctattga cagttcacag gtaggcggcc acgaccgcgc ggtcatgcga     44640
     aatgcaggcc ggcgccaggc cgtgcggcac gcgcagttcg ggctggcggc gcgccagcca     44700
     ggtcagcgcc gggcgcgacc aggccgggat gcgcaggcga aacggcggcg aactgagcac     44760
     caggccggcc agcggcgccc attgccgctg cgccaaccgc accgccacca gcgcgcccag     44820
     gctgtggcca agcaggatgg gcgggcgtcc gcagtcgcgg ctccagtcca gcagccgctg     44880
     cgtggcgtcg cgcaccaggt cgtcgggtcg ggccaggccg gccggggggg ccgcccgagc     44940
     ggccgtggcc gcggtgatcg tgcgcgccca cccgccagcc gcgcgcggcc agccagccgg     45000
     ccaggcgctc gtagcggccg gcgtgctcgc tcagcccatg cagcaggtat atgctgggcg     45060
     tgcccgggcc gggcagcggc gcggccacgc ccggggccgc cggccaggcg taattggcca     45120
     ggctgacgcc gtccgcggcg ggagtaaatg aaatcggcga caatttcagg cctctgcagg     45180
     tcgatagcga acccataccc atgatttcaa cgctgtttcg tttcatgctc aagaaacgcg     45240
     tgcggatcct gtggcaggcc ggctgcgccg cgctgctgct ggccgcctgt tcgcccagtt     45300
     acaactggcg cgagatcgac gtggccgatg gccgcgtgcg tgcggcgttc cccggccggg     45360
     tgcagaccga cacccgcgac ctggccctgg ccgaggtgcc gctgcggttt tcgctgacct     45420
     ccgcgcgggt cgagcaggcg gtattcgcca tcggccatgc gccgctgccg cccgaggtgg     45480
     cggccgatcc ggcgcgccgg cgcgcgctgg gcgaggcgct ggcgcgctcg ctgtacgcca     45540
     acctgggagt ccagccgccc gacccgctgc ccgcgccggg cgccgacatc gagatccatg     45600
     ccccgccggg cgagcgcgac gactggctgc tggcgcgggt gtgggcgacc gacgacatgc     45660
     tgatcgaggc cgtggccgcc ggcacccgcc agaccttgcc cgccgagcgg gcgcgcgaat     45720
     tcatcgatgc ggtggagctg cggcggtgag cgccggcagc agcccgcatt gcacggcgcg     45780
     ggccaccgcg gcgcgccggt tggccacacc cagcttggcg caggcattgg ccaggtggaa     45840
     atcgaccgtg cgcgcggcga tgcccaggat gcgggcggtt tcccagctgg tcttgcccag     45900
     cgccgaccag tgcaggcagt ccagctcgcg cggggtgagg gtggtgcgtt gcggcatggc     45960
     ggaccccgtc cttgcccatg aggggcggcc ggccatcatg cggcgcgccg cgccggcatg     46020
     ccaagtctcg attcgtggcg gcatcaagcc gtttatccat atctgaatag gcccagcctc     46080
     gttcatgctt gccgtcgtac agttctactg gtctgccgtc gtgctgctgc tgcccctgct     46140
     ggcatgcgcg ggaatcggcg cctattgggc caagcgcgat taccccttcg gcggcacgtt     46200
     catcaccatg ctggtcacca cggtgaccac cccggcgctg gtgttccaca ctttcgtcac     46260
     cacgcaactg gacgaccgcg cgctgctggc catcgccggc gcctcgctgc tggcgctgct     46320
     ggcctgcgcg ctggcgtgcg ccggcctgct gcggctgttc ggcctgccgg tgcgcacgct     46380
     gctgcccacc gccttcgtgc ccaacgccgg caatctcggc ctgccggttt cgcaactggc     46440
     gttcggcgac gccgggctgt cggcggcggt ggcgttcttc gcggtcaact ccttcgtgac     46500
     gcacacgatc gccgtgcgca tgctgcccgg cgccaacacg cccggcagct ggaagagccc     46560
     ggtcctgctg gcctcggtgg ccgcggtgac cctgcgcgcg ctggacattc cggtgccgga     46620
     ctggctggtc gcgaccagcc gcatgctggg ggcggtgacg gtgccgctga tgctgctgag     46680
     cctgggccac gcgctggcgc tgattcccgc caatggcatg cgcgccggcg cggtggtggc     46740
     cgcgctgcgg ctggcagtcg ggctggccgc gggctacgcg gtggtgtggc tgctcggcct     46800
     gcccgacttg ctggccgggg cgctggccct gcagatggcc atgccctgcg ccgtggtcag     46860
     ctacatgtat gcgcgccgct ataccgacgt cggcgatatc gccgcgggcg cggtgctggt     46920
     gtcgaccgtg gtgttcctgc tgctggcgcc ggccctgctg tggttcacgc gccagtaggc     46980
     gtcagcccgc gccgcacatg ccgcgcaatt gcgccagcag cgtgtcgggg atgtccacgc     47040
     catgctgcag cgcctgcttg cgcagcgcgc tgcggcgctc gccgggcagg cgcacgccat     47100
     cgtcgtggag catggcctcg atgagggttt ccacgcgttc gaggtaggtg tcggtgccgg     47160
     ccagcgcggc cgggtcgatg gccaggaagg cctggcccag tcgcgccggc tcgccgtcgt     47220
     cgtcgaacag cgattcggtc tcgaagccga accgcgcgcc ggagaggctg cacaccagca     47280
     gttcgacgat cagcgccagc atggttccct tggcgcccgc ggcgggcagt atggtgccgg     47340
     ccaggccggc gcgcgggtcg gtggtgggcc ggccttcggc atccagcgcc cagccttccg     47400
     gaatggactc gccgtcgcgc gcggcgatca tcagctggcc gcgcgtggcc tcgcccgggg     47460
     ccaggttgat ctccagcggc gcggcggcgc gggaaggccg ccgcgaccgg gttggtgccc     47520
     agcagcgccc gccggccgcc ccaggccggc atggccgccg gggagttgcc gaaggccagg     47580
     cccaccaggc cggccgcggc gacggcctcc aggtggtagg cggcggcgcc gaaatgatgg     47640
     ctgttggcca ccgccacgaa tgccacgccg tgctggcgcg cccgttcgat ggccagcgcg     47700
     gccgccagcg cgcaggccgg ataggccagg cccgaacccg cgtcgaccag cgccgtgccg     47760
     ccgtgctcgc gcgccagcct gggccgggcg gcgcccttgg cgcgccccac gcgcaggtgg     47820
     gcggcgtagc cgggcacgcg cgccacgcct tgcggcacca ggccctggct gtcggcgtgc     47880
     accagggcgc gcgccgtgct ctcggccatg tcggggttgg cgcccgccgc cgccagcgcg     47940
     gcggcggcca ggtgctgcag ttcgtccagg tagatatggg ccatcggaag gtcccggaaa     48000
     cgcgccgcgt cgcggcaggc atcgcagata tcgatgctgc cacgaacatc ggattccggc     48060
     cagtgctaga attgcgcaca ttgttcggcg ccgatttgcc tgatccgctt gcgggcgcct     48120
     cttataaatc cagctaaaga ggtctgaatg accaatcctg tcctgaatcc ggcgttgcct     48180
     gccatggccg ccgcccctgt cgccgccacg ccttcggccg tgggttccgc cggcatcgtt     48240
     gctcctgtat tcctgcgttt cgacgaaccg ctgccgctgg ccagcggcca gaccctcaat     48300
     ggctacgaac tggccatcga gacctacggc acgctcaatg cgcagcgcac caacgcggtt     48360
     ctggtctgcc acgcgctcaa tgcctcgcac catgtggccg gcgtgtccgc cgacaacccc     48420
     aaggatgtcg gctggtggga caacatggtg gggcccggca agccggtaga caccaatcgt     48480
     tacttcgtca tcggcgtcaa caacctgggc tcgtgcttcg gctcgaccgg gccggccagc     48540
     atcaatccgg ccaccggccg cccctggggc gccgcgttcc cggtcctgac cgtggaagac     48600
     tgggtgcgcg cccaggcgcg cgtggcggat catttcggca tcgagcgctt cgccgcggtc     48660
     atgggcggtt cgctgggcgg catgcaggcc ctgagctggg ccatcacctg cccgcagcgg     48720
     gtggccaatt gcgtggtcgt cgccagcacg ccgcgcctgt cggcgcagaa catcggtttc     48780
     aacgaggtgg cgcggcgcgc catcatcacc gaccccgatt tccatggcgg cgactactac     48840
     gcgcacggca cggtgccggg gcgcggcctg tcggtggccc gcatgatcgg ccatatcacc     48900
     tacctgtccg acgacgacat ggccgagaaa ttcggccgca cgcgccgcga gccggccgcc     48960
     gacggcgcct atcgctatgg ctacgatgtc gaattcgagg tcgagtccta cctgcgctac     49020
     cagggcgaga aattctcgcg ctatttcgac gccaatacct atttgctgat cacccgcgcg     49080
     ctggattatt tcgacccggc gcgcgccacc ggtggcgacc tggcgcgcgc gctggcgccg     49140
     gccacggccg atttcctgct ggtttcgttc tcgaccgact ggcgttttcc gcccgagcgt     49200
     tcgcgcgaaa tggtgcgcgc gctgctcaag aacggcagcc cggtcaccta tgccgagatc     49260
     gacgcgccgc acggccacga cgccttcctg ctggatgacg cgcgctatca cgcggtagtg     49320
     cgcggctact acgaacggat tgcgcgcgaa ctgggcctga acggcgccgt cgcgccggag     49380
     ggaaattccg catgagcccc gtttcggccc gtttcgaacc cgccgccctg cggcccgacc     49440
     tggcgcgcat cgccggctgg atcgagcccg gctcgcgcgt gctggacctg gggtgcggcg     49500
     acggcgcgct gctggcgtac ctgcgcgacc atcgccaggt gcgcggcgcc ggcgtcgaga     49560
     tcgacgacaa ctacgtgatc gcctgcgtgc agcgcggcgt cgaggtcatc cagcagaacc     49620
     tggaagatgg cctggcgctg ttcgacgacc agcagttcga caccgtggtg ctgtcgcaga     49680
     ccctgcagtc catgcaccgt accgagcaca tcctgcgcga aatggcgcgg gtggcgcgcc     49740
     atggcgtggt gtcgtttccc aacttcggct actggccgca tggctggtcg atcctgcgcg     49800
     gccgcatgcc cgtgaccggc cagatgccgt accagtggta caacacgccc aacatccacc     49860
     tctgcacgct gcgcgatttc gaggatctgg ccggcaccct gggcctgcgc atcctgcagc     49920
     gcgccacgtt caacgagggc agggaagtcc gcgtattccc cagttggcgc agtacattgg     49980
     cgctgtatcg tttcgctgcg tcctgacatc cgcaagccgg cgcggattgc tactatccgc     50040
     tagctgtgaa gattcaatag gttgtatgca tggttcatcc gaaccggatt tgagaaactg     50100
     gaaatcgcca cccccccagt tcactcaagg agcccggccg gatgaacacc cataagcatg     50160
     cccgattgac cttcctacgt cgactcgaaa tggtccagca attgatcgcc catcaagttt     50220
     gtgtgcctga agcggcccgc gcctatgggg tcaccgcgcc gactgtgcgc aaatggctgg     50280
     gccgcttcct ggctcagggc caggcgggct tggccgatgc gtcctcgcgc ccgacggtct     50340
     cgccccgagc gattgcgccg gccaaggcgc tggctatcgt ggagctgcgc cgcaagcggc     50400
     tgacccaagc gcgcatcgcc caggcgctgg gcgtgtcagc cagcaccgtc agccgcgtcc     50460
     tggcccgcgc cggtctgtcg cacctggccg acctggagcc ggccgagccg gtggtgcgct     50520
     acgagcatca ggcccccggc gatctgctgc acatcgacat caagaagctg ggacgtatcc     50580
     agcgccctgg ccaccgggtc acgggcaacc gacgcgatac cgttgagggg gccggctggg     50640
     acttcgtctt cgtggccata gatgaccacg cccgcgtggc cttcaccgac atcccccccg     50700
     acgagcgctt ccccagcgcc gtccagttcc tcaaggacgc agtggcctac taccagcgcc     50760
     tgggcgtgac catccagcgc ttgctcaccg acaatggctc ggcctttcgc agccgcgcct     50820
     tcgccgcgct gtgccatgag ctgggcatca agcaccgctt tacccgacct taccgcccac     50880
     agaccaatgg caaggccgaa cgcttcatcc agtcggcctt gcgtgagtgg gcttacgctc     50940
     acacctacca gaactcccaa caccgagccg atgccatgaa atcctggcta caccactaca     51000
     actggcatcg accccaccaa ggcatcgggc gcgctgtacc catctccaga ctcaacctgg     51060
     acgaatacaa cctattgaca gttcacagct agcaggaccg gcgcgcctac cggtcgttcc     51120
     acgggagatc cgccattacc gccgcgaccg aaaccaccaa ggtctatacc aaccgccgcg     51180
     tggcgccgct gctggtgctg ggctttgcca gcggcctgcc gctggcgctg agcagcggca     51240
     cgctgcaggc ctgggccacg gtcgagaacg tctcgttgca gagcataggc ttcctgacgc     51300
     tggccggcac cgcctatacg ctgaaattcc tctgggcccc gctcatcgac cgctacgtgc     51360
     cgccgttcct ggggcgccgc cgcggctgga tgctgctgac ccaggtgctg ctggccgccg     51420
     ccatcatggt gatgggcatg ctgtcgccgg gctcggccct gctgccgctg gccctggtgg     51480
     cggtgctggt ggccttcctg tcggcgtcgc aggacatcgc cttcgacgcc tacagcaccg     51540
     atgtgctgcg ccaggaagag cgcggcgccg gggccgcgat gcgggtcatg ggctaccggc     51600
     tggccatgat cgtctccggc ggcctggcgc tcatcgtggc cgatcgctgg ctgggctggg     51660
     gcaacaccta tgtgctgatg ggcggcctga tgctggcgtg cgcgctgggc acgctatggg     51720
     cgcccgagcc cgagcggccg gccaacccgc cgcgcgatct cggcgcggcg gtggtcgaac     51780
     cctttcgcga gttcttcagc cgccgcggcg ccatcgacat gctgctgctg atcgtcctgt     51840
     acaagctggg cgacgccttc gccggcgcgc tgtccaccac cttcctgctg cgcggcgccg     51900
     ggttcagcgc caccgaggtc ggcaccgtca acaaggtgct gggcctggcc gccaccatcg     51960
     tcggcgcgct ggccggcggc tccatcatga cgcgctgggg cctgtaccgc tcgctgatgg     52020
     cgttcggcct gctgcaggcc gtctccaacc tgggctactg gctgatcgcc gtcagcccca     52080
     agaacctcta cctgatgggg ctggcggtcg gcgtcgagaa cctgtgcggc ggcctgggca     52140
     cggcctcctt cgtggcgctg ctgatggcga tgtgccgcca gcagttctcg gccacgcagt     52200
     tcgcgctgct gtcggcgctg gccgcggtgg gccgcaccta cctggccggg ccgctgacgc     52260
     cggtgctggt cgagtggctc gactggccgg gctttttcat cgtcaccgtc ctcatcgcgc     52320
     tgcccgggtt atggctgctg cggctgcggc gcaacgttat cgacgaactg gacgcccaaa     52380
     ccgcgcgctg agcgtggcga tggtgctaag gttacggcca gcgctacccg cgcaagccgc     52440
     ccgcagtggc ggtattgata acaattcggg caactcacgt ccgaaaaaga agagactgga     52500
     aaatgaagcg actgatccca gccgtcgcgc tggcaggcat gttcgtgggt accgcccacg     52560
     ccgaaaccag tgtcacgctg tacggaatcg ccgacgtcag cgtccgctac ctgagcaccg     52620
     gcaacgacaa cggcaacagc cgcgtgtcga tggaaaacgg cgccatctcc aacagccgct     52680
     ggggcctgcg cggcgtggaa gacctgggcg atggcatgaa ggccttcttc cgcctggaaa     52740
     gcgggttcaa tgtccagaac ggcgagcgct ccgatcccga cagcttcttc aaccgccacg     52800
     cctacgtcgg cctggacggc ggcgagatcg gcgcgatctc gctgggccgc caggacacgc     52860
     ccctgttcac gatcctggcc gattcgtacg acccgctgac cgtcggcaac tatgcgcaga     52920
     actcgtggct gccggtggcg atgtcgcgcg cgcgcagctc caactcggtg cgctatcgca     52980
     acgacaagct ggccggtttc gacatgatcc tgtcgtatgc gttcagcgac agcttcgagg     53040
     accacaagct gggcgaacag tatggcggca cgctgtccta tacgaccggc ccgttctcga     53100
     tcggcggcgg ctacatgctg acgcactcgg ccagcaactc cgactaccag cagcgggtct     53160
     ggaacctcaa cgcctcgtac aagttcgaga ccgccaaggt gtttcgggta cttcaatggc     53220
     cgcgatgaga ccggtttcgt caatgccgtg atgggcaata ccagcctgcc ggacagcggc     53280
     ctggagcgca aggacaacgg ctatttcgcc ggcgtcacct ggcaggccac gccgcgctgg     53340
     gcgttgacgg gcgccgcgta ctacgacacc agcaagaacc tggtcgagga aggcgacaag     53400
     ggcaagcgct acgcgctggt cggggtggcc gagtacgcgc tctccaagcg cacgcaggtt     53460
     tacggcacca tcgactacaa caaggtcaag gacgccgcca ccggcgaaat ccagggcgac     53520
     gacaagcaga tcggcgccgc ggtgggaatc cgccacatct tctgatgcgg cggcggggcg     53580
     cccgcaagag ctccccgctc accagccccg gcggccggaa cttcagccgc cgcggcgata     53640
     ccagcccagc ccggccagcg ccagcgcgtc gatcgagtcg gtcatcgcga cgcccagctc     53700
     cgcgcgcaac gcgtgcggca gcgccagcgg caactccgta caccccagca cgatggcgtc     53760
     cacgcccatg gcgcgcaggc tgtcgatgca cgccagcgcc ggcggcagtg cctgcggcag     53820
     caggttctgc ttgaccaggc gtatcgattg cgcgcacagg ccatctatca ggtcgacggg     53880
     cggcacgacc ggttcgtagc cttgcgccag catttcatgc tggtacaggc ccagccgcag     53940
     cgtcgtggcg gtggccagca ggccgacgcg gcccgcatgg atgccctggc gccgcaggtc     54000
     gtccagcacc gcctccacga tatgcaggac gggcacgctc gccgattgcg ccagttgcgg     54060
     ataccagacg tgagcggtat tgcaggggat ggcgatcgcg gtggcgccgg cctgctccag     54120
     ccgccgtatg ccgtggcgca tccacggcag cggatcggcg ccctgtccgg attgcccagc     54180
     gggccggtcc ggcacgcgcg ggtcgttcca caggatggcc ggtacatgct gctggtcgca     54240
     ggcggcttcg gtcagcgcca ccagccgttg catgaaactg gcgccggcca tcggccccat     54300
     gccgcccagc acgcccagga agcggccctc gaattgcttg tcgtcgtcgc taggcatggc     54360
     ggtcagtggg aaatgatctt ggacaggaaa tgccgcgccc gcggggagcg ttgatccatg     54420
     ttctggaaga agtcgtcgtt gcggcagtct tcgacgatac tgccggcgtc catgaagatg     54480
     acgcgatcgg cgaccttgcg ggcaaagccc atctcgtgcg tcaccaccat catggtcatg     54540
     ccctcgcgcg ccaggtcgat catcacgtcg agcacttcgt tgaccatttc cgggtccagg     54600
     gccgaggtgg gttcgtcgaa cagcatggcg atgggctgca tggccagcgc gcgggcgatg     54660
     gcgacccgct gctgctgccc gccggacaac tggccgggat acttgtgctg gtgcgcctgc     54720
     aggccgaccc gctccagcag ggcgatggcg tgcgcgccca ccgaaacgcc gtcgacgatg     54780
     atttcgccct tctggaaggc ctccagcccg ttgacggtct tgatgagcgt ggacttgccc     54840
     gagcccgacg ggccgcagac gaccacgact tcgccgctgg ccacgctggt cacgcagtca     54900
     ttgagcacct gcgtcgcgcc ataccacttg ctgacattct tgatttctat catgtgacgt     54960
     cctgttcttc gccgcgctta cgcggccatg gtgttgcgtt gctgcaggta gtgcacgaat     55020
     cgcgatgccg cgaagctcat gacgaagtac accgccgcga cgaagagata catttccacc     55080
     agccggttgt cgcgctgggc gacgttgatg cccgctccca ggaagtcggt cagcgacagc     55140
     acgtagacca gcgaggtgtc ctggaacagg acgatggtct gggtgagcag gaccggcgcc     55200
     atgttgcgca gcgcctgggg caggaccaca taagccatcg tctgccagta attgagcccg     55260
     atggcgtagg cggccgaggt ctggccgcgc ggaatggact ggataccggc gcgcatgatt     55320
     tcgcagaagt aggcggcctc gaacagggtg aaggtgatca gcgccgaggt gaagccgccc     55380
     acctgcagcg gcctgccggc gccggtcagc cagccgccta tgtagggcac caggaagtag     55440
     aaccagaaga tgaccaggat cagcggcaag gcgcgtagcc cgttcacgta cgcggcggcg     55500
     accgcgctca gcggcttgat gcccgacagg cggcacatcg ccagcagggt tcccagcgcc     55560
     agccccatgg ccgtggacag gaacgtcagc ttgagcgtga acaccatgcc gtcgcggaac     55620
     aggtatccca gggagcgtcc tatgacgtcg aagtcgaatt cgttcatgtc ggagccagtt     55680
     tggtggtggc ggagacgggg ccgatgaagc ccggcacggc cagccgcgtt tcaatgtatc     55740
     gcattgcgcg cagcacgatc aggttgagca ggaagtagca aagcgtcgcg ccggcgaagg     55800
     cttcgaagac ctggaagctg aattcctgca tcgagcgggc cgcgccgacc agttcgagca     55860
     ggccgatggt gaatgccacc gaggtgttct tgatgaggtt gagcagttcc gaggtcagcg     55920
     gcgggaggat gatgcgaaac gaggtcggca gcagcacgta ccggtacacc tggctgggcc     55980
     gcatgcccag cgcggtggcc gccatgcgct gcctggccgg acgcgactcg atgccggcgc     56040
     gcacctgttc ggccacccgc gacgaggtgt agaagcccag gcacaggacc gccgggatga     56100
     agatgcccca tggcggcggg atgctcttga tcgcgtcgcc aagctgcacc ggcaggattt     56160
     cgggcacgac gaagtaccag aggaacatct gcaccagcag cggaatgttg cggaagaact     56220
     cgacgtacgt ggcgcccagg atgcgcgccc atttcgactg cgtggtgcgg gccacgccca     56280
     ccacgatgcc gatgcccagc gccaggatcc aggccagcgc cgcggtgccg agcgtccacg     56340
     ccatgccggt cagcagcgtg cccaggtaga tgccgccggt cggcgacatc tcaagaaaaa     56400
     tatgccaatt ccagttgtag ttcatggttg tatccaggct gcgcaggcgg gacggcacgg     56460
     cggacgcggc gagcgcgggg cgcggggctg gccccggccc gcgctcaacg ataggtggca     56520
     gggtccgccg aatcggtcgg attcgcgatg acgcgctgca gcgccgcgct catcggcagg     56580
     tgcaggttga cgttgcgcgg cggaatcggc gattcgaacc atttcttgta cagcttggcc     56640
     aggctgccat cgcgcatcat gccggtcacg gtgtcgtcga ccaccttctt gaatgcggga     56700
     tcatccttgg gcaggatcag cgcgtagggc tccaccgtgt aggtgtcctc gctgatcatc     56760
     cactcgtccg gcttgcgctc ggtcgcgacc agccctgcca gcagcacatc gtccatgaag     56820
     aacgcggcgg cccggccgtt ggcgaccgtc agcatggcgg cggggtggtc cttggtgggg     56880
     atgatgcgca tgtccaggct atctttttcg ttggcctgcg tcagccagcg gatattgctg     56940
     gtgccggccg tggagaccac ggtcttgccc ttcatgtcat ccagcttctt gaggttggac     57000
     gatttcttgg ccgcgaagcg cgtcgcggtc acgaaggtgg tcggcgcgaa cgcgacctgc     57060
     tgctggcgct ccacggtatt ggtggcggag ccgcagacca ggtccacggt gccgttggcc     57120
     accagcggga tgcgcgtcga cgaggtcacc ggcaccaggt tgaccttgat ctgcgccatg     57180
     cccagcttgg ccttgatggc ctcgaccgcc ttctcgcaga tttccatcga gtagccgatc     57240
     ggtttctgct tgtcgtccag gtacgaaaac gggatggagg cgtcgcgatg cccgatggtg     57300
     atggtgcccg aggacttgat cttgtcgagc cggccctcgg catgggcggg cgcgcttgcc     57360
     gcgacgccga cgagcgcggc aaaaaatacc gtacttatct tcattctctt gtctcctgtg     57420
     gggcgcctgc ggctctgccg gccgcgatca ggagatggcg cccctgtgtt gaatgcccgg     57480
     ctgtccggac ggacagccta gttgtgaact gtcaataggt tgtattcgtc caggttgagt     57540
     ctggagatgg gtacagcgcg cccgatgcct tggtggggtc gatgccagtt gtagtggtgt     57600
     agccaggatt tcatggcatc ggctcggtgt tgggagttct ggtaggtgtg agcgtaagcc     57660
     cactcacgca aggccgactg gatgaagcgt tcggccttgc cattggtctg tgggcggtaa     57720
     ggtcgggtaa agcggtgctt gatgcccagc tcatggcaca gcgcggcgaa ggcgcggctg     57780
     cgaaaggccg agccattgtc ggtgagcaag cgctggatgg tcacgcccag gcgctggtag     57840
     taggccactg cgtccttgag gaactggacg gcgctgggga agcgctcgtc ggggtggatg     57900
     tcggtgaagg ccacgcgggc gtggtcatcg atggccacga agacgaagtc ccagccggcc     57960
     ccctcaacgg tatcgcgtcg gttgcccgtg acccggtggc cagggcgctg gatacgtccc     58020
     agcttcttga tgtcgatgtg cagcagatcg ccgggggcct gatgctcgta gcgcaccacc     58080
     ggctcggccg gctccaggtc ggccaggtgc gacagaccgg cgcgggccag gacgcggctg     58140
     acggtgctgg ctgacacgcc cagcgcctgg gcgatgcgcg cttgggtcag ccgcttgcgg     58200
     cgcagctcca cgatagccag cgccttggcc ggcgcaatcg ctcggggcga gaccgtcggg     58260
     cgcgaggacg catcggccaa gcccgcctgg ccctgagcca ggaagcggcc cagccatttg     58320
     cgcacagtcg gcgcggtgac cccataggcg cgggccgctt caggcacaca aacttgatgg     58380
     gcgatcaatt gctggaccat ttcgagtcga cgtaggaagg tcaatcgggc atgcttatgg     58440
     gtgttcatcc ggccgggctc cttgagtgaa ctggggggtc ggcgatttcc agtttctcaa     58500
     atccggttcg gatgaaccat gcatacaacc tattgaatct tcacacctag ccgccttgcg     58560
     gccgcgcgtg cacgtccagc tgatcgaacg ccccgtgccc gaactgttcg ccgcgctcca     58620
     ggaaggcgac gccgacgcgc tcgtcaccac ctacgcgccg cagcacatcg aagccgtcaa     58680
     gatgccgttg caccaggaaa aactctacga atcgacctac cagctcgtcg cgcccccgga     58740
     acatcggttc gccagatcgc gccggcccgt gccgctggcg aaactggtca acgaagactg     58800
     gatcctgccc gcccaggact cgatgctgcg caaggagata gactgggtct tccgccgcgc     58860
     cgggctgctg cccccggtgc ccgtggtcga agccaacaac cccaccacca gcatccagct     58920
     ggtcgtggcc ggcatagggc tgggtttcgc gcacggcgaa acgctgcaga acgtcccccc     58980
     ccggcaccgt cgcccccatc cgcatctcgc cctccccggc cagcgcgcag gtcgcgctga     59040
     tctatcgcgc caagcgggtc aatgaaaagg tccaggcatt gcgggcggcg ctggggttgt     59100
     agagggattt caaaggctgc gcaaagcgct gcggccacat cgcaagcaat ggctggacca     59160
     tcgctgtctg cacccactct ttcacgcacg accgcagcga cgatttacgg caattcgtgc     59220
     cagtttgatg ggcctggata gtacggccct acgcaaatgc gggctcgaaa tccaccagat     59280
     cagtgccttg catgccgagc cccctggcca cgacgcgcca gctgcctacg gcctgagcta     59340
     cctccgtcca gattgcggcc gcttcttccg cagccaatct gaagtaaggc gccccttcca     59400
     tcaacatgtc ccggctctca atcggcccgg aatcctccgt caaccatgtc ttgctctcgc     59460
     ggcgatcccc tggcatcgga ttgaggtcga atgctggcga cagacgccag ccatggttac     59520
     gcgagtcata caggaatccg gtattccgca aatggtcatc ggtattgcag atcagaaaat     59580
     tgaggaccag ccggcgccac aactgatgta tgtcggcaat cgggtccgca ccttcccgca     59640
     gcaggacatc gaccagttcc gtataggcgt gcacggtgtc ccggccatca gactgcagca     59700
     tcgtcgcggc cgatacatag ggaatacggc cgccatcgtc ggtacgatcg aaccgccgga     59760
     tgatggcaac cgccgtcccg ccgatcaact ccacacgcgc cgctgccacc ttgatgcctg     59820
     ctttggcagc aagatgcatg gccagcactt cgcctcggat gacatcgcgt cggtcagcct     59880
     ggctgggaaa cttgcccaat gccaggcggc catccgtatc ccgcacgctc gatttgggcc     59940
     gagctccgcc cagcgaagtc ccttgcccga gcagatattg caggtcgcgc gcggtctccg     60000
     ttccagcctc caacgctcga gccgcttgca cgaccttatc cagctccacc aacggcggca     60060
     catgcccggg cgttgcgcct gagcgcaaat agactttggc gtgaggatcg aaaagccgca     60120
     gcgcgccgac acgagcctcg tcatcgaccc acatcaggaa gtcgacaggc tccagcggag     60180
     gcgtctctcc gtcctgctgt cgcaacctcg catgcgcacg ccggatcacg cgttcgcccc     60240
     acgagtccgg cgcagtgtcc tccagcgcgc gaaagaatac ttcctgaggg tgctgtacgc     60300
     tgaggacggg cagcaaatca ggcgacagcg tgaagaacct cgcatcgcgc aaccagcgct     60360
     cgtcgtagct gaacgcactg cgcttgccgc tgcccagata caagcgcccg acaacctggc     60420
     cggtagatcc cagatgcact tccaggtcct gacgcctcaa ggacttggtc gccatcagaa     60480
     gccctccagt tcatcggcgt catcggacgc accttccttg actgcagcgg aatgaccgac     60540
     tcgcggcttg ctgccgcgaa ccgtacgcac tcgttgcggc agttgctccc gcaccagttc     60600
     catccccagc acatcattct cggtggccat cacgcgcagc acatcgtcaa gacggccaag     60660
     cacatgcaag gcgcgcagga aagtatgcaa ggcagtgccg ggatggccgt cttccatacg     60720
     cctgactgta ctgagcgaag tgccaacacg ctgcgccaag tcttcctggc tcaagcgacg     60780
     cacacggcgc gcggtggaga tgtcctgtcc aaggcgttgc aacgcacgct ccacaggccg     60840
     aggcatcgcg acccgcgggc tgcaatttct ctgttcggaa gtcggcatgc gcacacctgc     60900
     tcagatatgg atgaaaatcg ccactaggcg ctcatatttg aacatatcga cacagcacaa     60960
     tcaacgaggc gacttaacaa taaaaattca aatatgaatg tttaatttag ttaaaggctt     61020
     ataaaagaac gaagtactct gcaagccctg taatcagcga agcgagcgac ggatcagtta     61080
     agtaccaacc tcgttaaacc aatgaactac ttcgaacaaa tgtggctcag tggtcaacaa     61140
     catccgaacg gcttcaagca cacggtgtga cacgacagga ttacgcgcgc ccgcacgtgc     61200
     ttcgccgata gtgaagccgc agaatcgctc gccgttgttt gacagcgtca gcgcgatcac     61260
     tcggtaaccg acctctaccg gcaggcctaa agcaagcact ctaccttctt gccgcctggc     61320
     actggccaga gggaaagggt cgaatataaa gtactcacct gtttctatca gctcaccatt     61380
     cgagcccgcg atgtcagata tctctggaac ctcccagtgc atatgcgagg gcatagactc     61440
     cggcacagag atatgtacta aacccacaaa tgggaaacca tagcacagca accctcttac     61500
     ctgtgctctc cccattgtgt ttgcattccg ccccggattg ctaattgatg gacgaacgat     61560
     cttggcttca atggcaatcg tccgttctaa gaggatttcg ttgtcagaga acggaacgat     61620
     caaacagtca acgtctcctg gccgttgatc aggagaaagc tgcagcttgg ctcttggaat     61680
     gttgatcccg acgtaaacgc tttgagcgaa ggcatgttca ggataaggaa atgcggagtc     61740
     aagcgcaaag tacatcgtgc tggcaagcgc ttgccgatta gcaacaatac gcttgagaac     61800
     ttctgcctcg gagctaagcc aatcaagcat aagtgccgct atctgacgga ttcggaacgc     61860
     accaagcagt cttgggcgcg aaacgagcct gctgtcccaa agaaaatcgc atcgaaattc     61920
     agcttcgggc atccggaatg cccgggtcag ttccggaaca gcaccgccta taactgcccc     61980
     accgtccgca tgctccaagg acggaagttc ggtatccata tgggtttgcg gtgaaagttg     62040
     gaacgggtga tggcgtaaaa gggcatagcg atccgctata tccagcctgg caagccaaat     62100
     cagaacgcct ttatcgagcg cttcaatcga acttatcgga ccgaggtgct cgacgcgcac     62160
     ctgttcgcca accttgagct ggtccaagcg attaccgatc aatggctggt cgattacaac     62220
     cagtacccgt ccgcacaaat cgctgggcgg cctcccgccg atgcaattca tgccccggtt     62280
     aaccctcgct ccggtcgtct atcagacaat gtctacttga cagggggggc ttacgacagc     62340
     aaacgctcat ggcccactgc ctctgcctcg atcaagggcc gtttgaacga ccatcgtggt     62400
     ccctattttg agttgcataa agagacgtac aaccggctca catcactcgt cttctttcag     62460
     cgcttcggtg gcggaggctc cccaagcgcg tacattttca ttaaatagcg cctgccactc     62520
     tccgggcgat gtagacggtg ttatcggaac agtgctgctt gcaacgacta atttttgcat     62580
     ctcgggctta gccaaaattt tattaaccgc cacgttcagg atttgcgtta tcgctggtga     62640
     caggcctgct ggagcaaaca agccaaacca acctacatca tcatacgaaa tgccagcctc     62700
     gacaagcgtt ggcacatctg gcagcgcctg agcccgcaca ggtcctgtta tggccaatgc     62760
     tttcaatttc ccatctttga ccatgggcat catcgatata acatcgagaa tgccaatgga     62820
     cacctgcccg gacagcagct cggtgattgc ctcgctgcca cccttgtatg gaatgtgcag     62880
     cattttcatg cctgccaact cctgtatttt ctgcccggcg agatggggtg gagaggcgac     62940
     gccaaaggta gcaaaagaaa tactatcttc attttgtttt gccgctgcga caagatctga     63000
     aatcgagttc agtggtgagt tcgcacgcgt taccaccagc aacggcacca tggatatctg     63060
     cgttattgca gtaaagtcct tgatggggtg aaagctgaga tctggaaaaa tggcgggagc     63120
     gatggcaaat ggagcggatg tcattaatag tgtatagcca tcattatccg cacgcgccac     63180
     ggaagccgcc ccaatattac cggcagctcc actccgattt accacaatga ccggctgctt     63240
     taactccctg cctaactgtt ctgcaagggc gcggcccatg atatccgtgc ccccaccggg     63300
     tgggaacggt acgaccagtg taatagcttt gtcgggatag gccgcagcat tcgcaccccc     63360
     ccatgcccct aagataccga gcgccgttcc cactaccgtc ttagcaatcc agttcatttg     63420
     tctcttcctt tatttttaat atgatttatt tttactggaa aggtcggccc tgcttaattg     63480
     tgagtaattt ttgttcccag caacgttgca aactgagcaa tccacgccgg gtgtgaaggc     63540
     caggcaaagg cggtaaccaa gtttctatcg gtaatcgctt catccatggg aatatcgaca     63600
     tacgtccccc ccgcggctgt cacctcgggg gcgcaggtgt tatagcaggc gcatttatac     63660
     ccttccaaca cacccgcagt actgagaatt tgaatgccgt ggcagataca ggcaactggc     63720
     ttttcggctt caaagaaata acgaaccaac gccaacaatt tcgagttgag acgcaaatac     63780
     tcgggcgccc tgcctcccgg gatcaccagt ccgtcgtact tctccatctc tatctgatcg     63840
     aatgaagcat tcaatgtgaa cctgtggccc ggcttttcac tataggtttg cgctccttcg     63900
     aagtcatgaa cggctgtcat gacgtagtcc ccagcagcct tgtccgggca cacagcatcc     63960
     acctgatacc cgagcgcctg aaaggcctga aaaggcacca tcacttcata atcttcaacg     64020
     tagtccccta caagcatcag caatttcctg gccatactgt tctcctatta attatccaca     64080
     cctacgtaga cgataccttc ttttacagtc gtcttgtata tctgaatcgg cttctctgcg     64140
     gcgcccaagg gtttccccgt ttcaagatcc cactgccaga gatgcttggt acatatcaat     64200
     tttgttttct tgaacaatcc attgcacagc ttttcatcca tatgtggaca gatagcctgg     64260
     gccgcgaaga actgctctcc atttcgcatc aatatgatat cgagcccgtt aattttcttt     64320
     tcaactatat cgccttctct tatctcattt tcttcgcagg ctttaaccaa gttagcgccc     64380
     gtcacagaga acctttattt aaatatgcag tgatcgtttt cactgctctt tgaaaaaata     64440
     tttccagggc tttcggaatt tgggctttca atgataatcg ctgcaacttc aaacaaaact     64500
     atcgcactcg atatcaagcg catcgatctc tgtgttgatc atcagctgcc taatcgtatg     64560
     atccaccatc ggcggtggcc ctgaaatata tacttccttg ccttcccagc ttatgctcgc     64620
     atcattaacg atgtgatcag cgggataccc tgtaaaaaac tcgatatacg ggaatcggcc     64680
     cctgtcctgt acgcttggcg atatatcgct gcatacggca acccggaggt tggaatgaac     64740
     cgccgcatat cgattgaaca ctccgataag gtcgatgggc gatgtgtctc gaacacccca     64800
     gaatatcgtc aggtgccgat catctatgta atgggaggaa atggcccact ccaatgtgga     64860
     cagagccacc gacacgcccg acccgccgac taacatgaca agttcgttat ctttcttggg     64920
     acggatatag gctttaccca gtggcccata tccctgcaat tgcataccga tattgttgat     64980
     atcacagagc tgcggcgaca tcgctccatt tgggttgcat gaaagaatga attccaactg     65040
     gcgggaatcc tgcgcaaaat ttgcgacgga atatgcgcgc gcccgccccc ccgcctttgt     65100
     agccagcatc acatactggc caggtaaaaa acgaatgcta tcgtcaagat ccaccaataa     65160
     acgatacaag ccagaaccca acggccgtac atcgttaagc gacgcggcgt aatgttttgg     65220
     cgctgccaaa tcaggcggta cattcttgtc gtataaggcc tcgaatacgc aatcagacac     65280
     ggcgtggctt tgacacaaat gcacctcggg gcattcgcat gcttggcccg ctgaatgcga     65340
     aacctgtatg aagtcggtac cggtatagac tttcaacgct ccttgaatga gacgcgcctt     65400
     gcaagaaccg cagctaccac ttgcgcaatg ataattaagc ggaaccgact gccgcagccc     65460
     agcttgcagt accgattctt ctcctgcagc tactgcagcg taatcgccga catcgttctt     65520
     gaataatatg cgttgttctt gctgcatcaa tttttaccct tcaaataagc cagcatctca     65580
     tctatacaaa aacaaggctg atatatggga aagcggcaac gataagccag gcaacaagaa     65640
     ttggaataat cattctcaca atctcggcca tcaactcccc gtaatctatt ttcattgtca     65700
     tcgacgtaat gaacagattc aggccatgcg gagggctaat aaatcctatc gacgcgccaa     65760
     taataaaaat catgccccag tgcacaccat tcatgccaat ttctgttgcg ataggagcaa     65820
     atatcggcgc caaaatcagt attactgcaa tgacttccat gaacgtgccg aagagcaaaa     65880
     caatgcccat cattaccgct agcgtaaccg ttgcgccata agcagatgaa agttctacca     65940
     actgaaccaa tatcaagtct ggaatttcca ttacggaaag aatctgttga aactggatgg     66000
     aaaaaacaac gatcggcccg atgattccgg tcaccgaagc gctttccata agtatttttg     66060
     gtatgtctcg aatgccaaac tggctagacc aatatagtcc gatcaccgcg cagtaaatcg     66120
     tgacgacgcc cgcggcttcg gtcgggctaa acaggcccga atacaggccg acaaacaaaa     66180
     gcgcgatagc gataaaggct ggggttgccc caagcaccga ggttcctact tctttaaagt     66240
     agccatctgt ggatttcgat gcgggctcat actgacgcgt acgcatgatc gacacgaaaa     66300
     atatgaacag cagtatgagt atgcctggca atatcgctgc cagattcagc tcaaccggag     66360
     aaacgttaac cgtcaagcta taaatgatga tgatggtgct tggcggaatg agtccgccaa     66420
     ggattccgcc ggcggctacc gtcgcgcctc ctcgtcgcat gggaatttgg gcccgtttaa     66480
     attccggagc catcaacttg cccatggtcg ctgcagcggc tgcactcgaa ccactaatgg     66540
     cgcaaaacat gccactggcc agcaccgagg tggctgccgt tcgacctggc acggcacgga     66600
     taaccgcgcg cgaaaatttg atcaattgtt gtgaaacgcc gcccgcggtg agtagatccc     66660
     ccgtagcaat aaataaaggt actgccagga atgtatagtt ctttaacgaa tcaatggacg     66720
     tcaatcccat actcatcaaa ggataatcaa ttacccaata agatgttgcc gccacccaca     66780
     cagcaagcaa gaggaccatc ggcgtgccga gaatgaacag cgctatacaa aaaaatgaaa     66840
     ttagtaagag cataaatagt cccgacaatt aatttcagct gactcaagcg ctcaaataat     66900
     tattaattcg ctcgttttca agaaagtccc actgaaacag aaccagccat aaccgctgaa     66960
     caattctcaa cattgaaaag gcccaaccca ggggtacccc caaattgatg atccatgcgg     67020
     gaataggcgt actcatgacc atttgctcgg tcacaaaatt gctcgagata agttcggccg     67080
     tactccagaa cacgacggcg ccaatggcca gccatagaat tgcatcgatg acttccaata     67140
     ctcttctgac aggcgcagga agggagtttc tgatctttgt gaagcccagg ttggttccgt     67200
     agcgacaatg ccttgccatg gcaaaccaag atagccagat aaatgagtac atcgcaatct     67260
     caggccccca caagttgctt gctcttggaa aatggctctg cgaatagtct ctccacccac     67320
     cagacagatg agtatgagat aagtgactat catcaccgag ttctctattc tcaggagaac     67380
     ccggtcaaga ttggcgtttg tgcaaatctt cttcagcgtc atcttttccc gccgctttta     67440
     gtattcaaat ttttgatgca ttggcgaatt gcagagacgt gcttatgtcc accacttctc     67500
     ggccattaat tctgtacttg atgtattttt ggcatactcg ctcagggcac cgtagacatc     67560
     gattcctgca atgtcatcaa gttgctttct cagatttgca tacaactgtg agttgttttc     67620
     aaccgagccg ctctccttga acgctgcgtg ctgctcgtgg ctcagtttta tctggcggat     67680
     tttgcctcgt tgatacgcgg aatcaggaga tgggttgggg ccaataccta ctagcgtaga     67740
     ctcggcaata atcgaagttt ggtatgcttc gaccatgctc tcgtatgcag attcgtagat     67800
     cagctcttgc aagcgctcag gcagtttgtc aaaagtcttg gctgccatga aaatcatcga     67860
     atagcctgga caaaactgaa cgtcaatatc ctgagacaag accgagtaca taccgaaccc     67920
     cgcggcagcg cttgggtagg tttctgtcgc gtccaccaac ccagacttca aaccctccag     67980
     cagttctccc caggctaatg ggatgggtgc catccccata ctcttggcga aattgctgat     68040
     catctcgcta ttcgtaattc ggatcttggc gccgttgagt gcatcgggcg atgtgatatc     68100
     cgctgcctcg gaatattttt tgcccatcat aatgttgcgc atacttccgc ttgcatacag     68160
     aggcaccacg ccgtatttgt ttcgcagcac gtcgcgatac aggcgattcg attctttact     68220
     caacaaaaaa ttatgatagg cgactcggct tttccaaaga aatggccagt ccaacgcgac     68280
     ggaatacggc atggttgcgc cggtattctg aaaggtcgag gaacccatgt gcagaatgcc     68340
     actcattact cgctgagcac actgatcttc agagcacgcc tgggctttat caatcagctg     68400
     aattgcaatc tcgccatccg attttcgctg gacgcgctcc acgaagtcgt aaataccagg     68460
     agctgtatac tctgccgctg acggagtata aatagtgccg aatctgaatc ggtaagccgc     68520
     ctttgcttcc gatttggcaa aagaattaaa cggtgcgagg accgcggcgg caccggctcc     68580
     agccgtcaga atggtgccca tgccaagacc agtcaacttg cgcagcgtgc tacggcgcat     68640
     actgttgtga ttgctgtgtg tcatacctcg tctccgttaa tttattagat aggcacatga     68700
     atgcctgagc caagatcacg ggtattcaaa tacaccttgc gctccagcag ccgcagttga     68760
     tcctgtttac gtgtgacttt gtctgtataa ctacctactg caaacaactt ggtggttccg     68820
     cactggtcgg tgtgcatgac catgatctgc gagcggacct catagcagtt ctcctcagca     68880
     gctctaatgc gcaccatgct gatatttctg gtgaaatctc ccttcatccg aacatgctga     68940
     tgaatcagca gcatcagatt acgtatttcc ttgtaatcat gatctagctg tgaagattca     69000
     ataggttgta tgcatggttc atccgaaccg gatttgagaa actggaaatc gccacccccc     69060
     cagttcactc aaggagcccg gccggatgaa cacccataag catgcccgat tgaccttcct     69120
     acgtcgactc gaaatggtcc agcaattgat cgcccatcaa gtttgtgtgc ctgaagcggc     69180
     ccgcgcctat ggggtcaccg cgccgactgt gcgcaaatgg ctgggccgct tcctggctca     69240
     gggccaggcg ggcttggccg atgcgtcctc gcgcccgacg gtctcgcccc gagcgattgc     69300
     gccggccaag gcgctggcta tcgtggagct gcgccgcaag cggctgaccc aagcgcgcat     69360
     cgcccaggcg ctgggcgtgt cagccagcac cgtcagccgc gtcctggccc gcgccggtct     69420
     gtcgcacctg gccgacctgg agccggccga gccggtggtg cgctacgagc atcaggcccc     69480
     cggcgatctg ctgcacatcg acatcaagaa gctgggacgt atccagcgcc ctggccaccg     69540
     ggtcacgggc aaccgacgcg ataccgttga gggggccggc tgggacttcg tcttcgtggc     69600
     catcgatgac cacgcccgcg tggccttcac cgacatccac cccgacgagc gcttccccag     69660
     cgccgtccag ttcctcaagg acgcagtggc ctactaccag cgcctgggcg tgaccatcca     69720
     gcgcttgctc accgacaatg gctcggcctt tcgcagccgc gccttcgccg cgctgtgcca     69780
     tgagctgggc atcaagcacc gctttacccg accttaccgc ccacagacca atggcaaggc     69840
     cgaacgcttc atccagtcgg ccttgcgtga gtgggcttac gctcacacct accagaactc     69900
     ccaacaccga gccgatgcca tgaaatcctg gctacaccac tacaactggc atcgacccca     69960
     ccaaggcatc gggcgcgctg tacccatctc cagactcaac ctggacgaat acaacctatt     70020
     gacagttcac aactagtcag acttcggacc gcatcaagca tggacgcatg tcgcaacggc     70080
     tgtattgacc cagtgaaaac ctgctcacgt cataatcgag gaaacgacgt tgagcatgaa     70140
     gatggaagaa gacatcaaac gatggacggc caagcgcaag agcgcgttgg tgctggacat     70200
     catccagggc aagaccaccg tggccgaagc gagccgtcaa tatgacctgt cgccatcgga     70260
     agtcgagcag tgggtcgacg acggcaagcg gggcatggag aacgccctgc gggccaatcc     70320
     gcaggatgtg cgagagcagt acgagcggca gctcaaggac atgcaggaag cgtatggcga     70380
     ggcgatgctg gagctacgcg cgcgaaaaaa attgcagtcc ctgttgggtg aggacgagaa     70440
     gtgatcgaga tgatccgcca gggactgcaa gccgacggca tcaccgtctc gatcgtcaag     70500
     ctgtgccgct ggttcggcgt gccgcgccgc acggtgtact acaagccggt gaaggtcccg     70560
     cccaaggttg atccgaagtt cgcgacgccg atcaaggcga tgatcgaaga gtcgccgtca     70620
     tttggctacc gtacggtcgc gcacctgttg ggattcaaca agaacaccgt gcagcgcgtg     70680
     ttccagttga tgggctggca ggttcgtaaa cgtccaatcg gcttcaggcc tcgcatccag     70740
     gcgctgccat cagtggcaac gatgcccaat gagcgctggt ccacggattt gtgccgggtg     70800
     tgggcgggtc ggaacggctg ggcgacgctg gcgctggtga tcgactgcca cacccgtgaa     70860
     ctgctgggct ggcacctgtc gcgtagcggt aaagcttgca ctgcgggcag tgccctcgag     70920
     catgccctga tagcgcgctt cgggacgttg ggccgcgtgc cggcgccgtt cctgctgcga     70980
     tcggacaacg gcttggtctt cacctcgcgc agctataccg cgctggtgcg gggatatggt     71040
     ctgcgccagg agttcatcac gccgcactgc ccacagcaaa acggcatggt cgaacgcgtc     71100
     atccggacgc tgaaagagca gtgcgtacat cggcatcgct tcgagaccat ccaacatgcc     71160
     agccgcgtga tcggcgactg gatacgcttt tataacgacc ggcgcccgca tcaggcgctg     71220
     ggcatgaaga ctccggccga ggcatacgct ttagccgaac ctgagcaggt ttcgctgggt     71280
     caatacacgg caggagtcac ccacacgaac cgtagaccca tggcgaagac gcgaccatgg     71340
     cccggcaagg gcaagaccgg ctcgaacgaa atacagggga attttgcaga tggtgcccgg     71400
     ggccggaatc gaaccggcac gccttgcggc gggggatttt gagtcccctg cgtctaccaa     71460
     tttcaccacc cgggcacggg ggaacgggct tcgagcgaag gccgtctgga aggaaggttg     71520
     cgattatatg cggtcttgaa aatcttcgct tgtgccctca tgtgtagggg cacgcccggg     71580
     gccgctgccg tgcgccggcc cgcgattgtt cattttctga ccagttacgt accacgatga     71640
     gccagaccac cacgacttcc gcatccgaaa ccctggggtt ccaggccgag gtgaagcagc     71700
     tgctgcacct gatgattcac tctctctaca gcaacaagga gatcttcctg cgcgagctgg     71760
     tgtcgaacgc gtcggacgcg tgcgacaagc tgcgcttcga ggcgatcgac cagccgggct     71820
     tgctggaagg cgacggggag ctggcgatcc gggtgggtta cgacaaggcc gcccgcacga     71880
     tcacgatttc cgataacggt atcggcctgt cgcgcgacga ggcggtggcc aatctgggca     71940
     cgattgcccg ctcgggcacg cgcgagtttt tctcgcagct gacgggcgac aagcagaagg     72000
     acgcgcagct gatcggccag ttcggggtgg ggttctattc ctcgttcatc gtggccgaca     72060
     aggtgacggt gctgagccgc cgcgccggcc tggcggccaa tgaggcgatc cgctgggagt     72120
     cggacgggca gggcgagttc agcatcgcgc cggccgagaa ggccgggcgc ggtacggatg     72180
     tggtgctgca cttgcgcgcc gacgaggacg agttgctcaa tggttggaag ctgcgcgaga     72240
     tcctgcgccg ctattcggac catatttcgc tgccgatccg catggccaag gaggattggg     72300
     acgcggagaa gggcgagcag gtcaagggcg atgagctgga gacggtgaac caggcgaatg     72360
     cgctgtggac gcgcaacaaa tcggatatta ccgacgagca gtatcgcgag ttctacaaaa     72420
     cggtgtcgca cgattatgac gatccgctgg cgtggacgca taaccgggtg gagggccgca     72480
     gcgagtatac gcagctgctg tatgtgccca agcatgcgcc gttcgatctg tgggaccgcg     72540
     atgcgcgccg cggggtgaag ctgtatgtga agcgggtgtt catcatggac gacgcggagc     72600
     agttgctgcc gtcgtatctg cgtttcgtgc gcggggtgat cgattcggcg gatttgccgc     72660
     tgaacgtgtc gcgcgagatc ctgcaggaga gccgcgatgt gcgggcgatc cgcgagggtt     72720
     cggccaagcg ggtgctgtcg ctgctggagg acatggcgga gaacaaggcg gaggattacg     72780
     cgacgttctg gacggagttc ggccaggtgc tgaaggaagg cacgggcgag gacgcggcca     72840
     accgcgagcg catcgccagg ctgctgcgct ttgcgtcgac gcacgatggc gagcaggcgc     72900
     agacggtgtc gttcgcggat tatgtgggcc gcatgaagga tggccaggac aagatttact     72960
     acgtgacggc ggatacgttc acggcggcgg cgaacagtcc gcacctggag attttccgga     73020
     agaagggcat cgaggtgctg ctgctgtcgg atcgggtgga cgagtggatg ctgtcctatc     73080
     tgcgcgagtt cgacggcaag tcgctggtgt cggtggccaa gggcggcctg gatctggcgg     73140
     agttggcgga cgaagaagag aagaagcgtc agtccgaggt ggccgagacg ttcaagccgc     73200
     tggtcgagcg cctgcagcag gcgctggccg agcaggtgaa ggaggtgcgg gtgacgcagc     73260
     gcctggtgga ttctccggcc tgcgtggtgg tgggccagaa cgagctcagc ccgcatctgc     73320
     tgcgcatgct gaaggcggcc ggccaggagg cgccggaggt caagccggtg ctggagatca     73380
     acccggacca cgcgctggtc gcgcggatcc gcgatgccag cgatgcggag ttcggcgatt     73440
     gggccgcgct gctgctggac caggcgctgc tggccgaagg cgcgcagatc gccgacccgg     73500
     cggccttcgt gaagcgcttg aatgggttgc tgttgaaggc ttgaggatgc gctcgatcaa     73560
     ggggtggctg tccccgcgcg gggggctgac accgttttgg caggctggca ttgagggcgt     73620
     acgacggggt gcctgtccct gcgggggcag gcacgcggag gaggtggctg gtgccagtcc     73680
     ccgttcgggg acaggcaccg aagtgtcagg ttagcggcag tgtcaggatg ccctgggtgg     73740
     cggggcgcat catgaggcgg cggtaccagg ccgagatgtg cggcgtggcg gggcgttcga     73800
     cgggcaggcc cagccagcgg tgcgcggcgc agcccagcgc gatgtcgccc atgctgaatt     73860
     gcgggccggc gatgaagtcg cggcccgcca gggcgttttc cagcatcagg gcgatcttgc     73920
     cggcctggcg ggccgaggct tcgatggcgg cggcgtcgcg ctgttcgggc gcggtgcgca     73980
     ccaggcccat gaaggcggcc agcatgctgg gttgccattc ggtggtctgc cagtccatcc     74040
     agcggtcggc gtcggcgcgc acgcaggggt cggcggggct gatggcgcct tcgccgtagc     74100
     gcgcgcccag gtagcgcacg atggcgttgg attcccacag gatgaagccg ccgtcgtcga     74160
     tcagcggtac cttgcggttg gggttcatgc ggaggtattc gggggtgtcg agcccgccga     74220
     actggccgcc ggcctcgatg aaggtgtgcg gcagcgccag ttcgcgcacg gcccacatga     74280
     ctttttgcac gttgaccgaa ctcagccggc cccagatctt cagcatgtcg aaacccctgg     74340
     tttgattgtc ggtaccgcta tacgggcggc aggttgcgcc gcgggaaccc gctttcgcgg     74400
     ccgaagcgca cccagttgaa ggcgcgtccc gggtcggtct tgcggcccgg ggcgatgtgt     74460
     tcgtggccgc gcgcgtcggc cagcgggtag cgcgcgcgca ggacctgcgc caggcgcgcc     74520
     agcgtggcgt actgggcgtc ggcgtagggc aggatgtcgg tgccttccag ttcgatgccg     74580
     atcgagaagt cgttgcagtt gtcgcggccc ctgaagcggg atacgccggc gtgccaggcg     74640
     cgcgcttcgg tggcggcgaa ctggatgacg gcgccgtcgc ggcggatgaa gaagtgggcc     74700
     gagacatgca ggccgcgcag gcgctcgagc cacgggtcgg cgctgtaatc caggcggttc     74760
     aggaacaggt cggcgacgta cgggccgccg aactggctgg gcggcaggct gatgttgtgg     74820
     atgaccagca ggctgatctg cgtgcccgcg gggcgggcgt tgacgttggg cgaaggggcg     74880
     cgggtgaccg cgggcccggg gatcagccag ccgtggcggt ccagtagcaa tcgttgcatg     74940
     atggggtcag gcttgttgcg ggtgaccctg cattatgcag gatggggccg gatcctccag     75000
     cccgtggggt tttgcggcgg ccgccgttca gccgcgctcg gcgccgcggc gggcgtggtc     75060
     gctgctgcac caggtctgcc cgcccagcag cacggcctcg gaacgcggca ggtgcacgcc     75120
     gcaatgggcg cagcgcacca tgggctggct ggcggcgtcc tgggcggggc ggggcggctc     75180
     ggcgcgcggg gcgcgcttgg aggcggcgcg ggcgccggcc aggcgcgcga tgaacagcac     75240
     ggccagaatg acgacgaacc agaagatcag cttgcccact tcaacctcga tgcagaatga     75300
     cttccagcac gaaccggctg ccggtgtagg ccaggatcag gaacgcgaag ccggtcaggg     75360
     tccagcgcag cgcgacgcgg ccgcgccagc cgcagatgtg gcggcccagc agcagcacgc     75420
     cgaaggtggc ccaggacagc agcgtgaaga tggtcttgtg gtcgaacggc aggaatttgc     75480
     cggtcagggt gatggaggcg accgagccgg agcccaccgc cagggtcagg accacgaagc     75540
     cgatccagat gacgcgaaac agcaggcgct cctgcaccag cagcggcggc tgggcgtcca     75600
     gcacgcggcc gacgatgctg cgctcggccg gcgcatccag cgggcggtgc aggtggcggt     75660
     cgagcagggc catcagcatg gcgtgcagcg cggcgatggt gatcaggccg taggcggcca     75720
     gcgcgatgag caggtgggcg cgcagccagg ggttgttggc atggggcacc agctgggcct     75780
     gcgggaacag cgcggctatt gcggttacga tagcggctgc cggcagcaac agcagctgca     75840
     ggccgtcgat gcggatcagc aggctttcca gccagaacac gaccaggccc agccatacgg     75900
     cggccgacag ggccagcgcc cagccgatgt acaggtgttg cgtccccagc atggcttgct     75960
     gcagggccac gccgtgcagg gccagcgcgc ccagcaggcc ggttcgggtt agcttgcttg     76020
     cttgatccac gctgccgcgg ccttgcaggc gtcgccacag cgaccctgcg agtaccgcat     76080
     aagccagcgc ggccacggcg tgaaatacaa tgcctgatga cataaaaacc gttgtctgga     76140
     tggggccatg ggcgcttgtc gcccgccggc ggctagctgc gcccaggcgg cctcgttcaa     76200
     tcaactagtg taagcggaaa cgcctctcat gctcgataac ctgactcaac ggctgtcgcg     76260
     cgtcgtcaag acgctgcgcg gcgaagcccg cctgaccgag gccaacaccc aggagatgct     76320
     gcgcgaagtg cgcatggcgc tgctggaggc cgacgtggcg ctgcccgtgg tgcgcgattt     76380
     cgtggcgcgc gtcaaggaaa aggccctggg cgaagaagtg gccggcagcc tcagccccgg     76440
     ccaggccctg gtgggcgtgg ttcacaagga gctgaccagc ctgatgggcg gcgacctggg     76500
     cgagcacgcc ggcgagctgt cgctggccac ccagccgccc gcggtcatcc tgatggccgg     76560
     cctgcagggc gcgggcaaga ccaccaccac cggcaagctg gcgcgctggc tgtccgaggg     76620
     gcagcacgtc cagggcggcc gcaagacggg caagaagaag gtgctggtgg tcagcgccga     76680
     cgtgtatcgc ccggccgcca tcgagcagct gaagaccgtg gccgcccagg tcggggtgga     76740
     ttttctgccg tcggacgtta gccagaagcc ggaagacatc gcccgcaacg cgatcgacca     76800
     tgcgcgccgc caccactacg acgtgctgat cgtcgacacg gcgggccggc tgggcatcga     76860
     cgaggccatg atgcgcgaga tccgcgcgct gcacgacctg gtcaagccga tcgagacgct     76920
     gttcgtggtc gacgcgatgc agggccagga cgcggtcaat accgcgcggg cctttggcga     76980
     cgcgctgccg ctgaccggcg tggtgctgac caagctggac ggcgacgcgc gcggcggcgc     77040
     ggcgctgtcg gtgcgccacg tcaccggcaa gccgctgaag ttcgtcggcg tctccgaaaa     77100
     gctggacggc ctcgagccgt tccaccccga gcgcatggcg cagcgcgtgc tgggcatggg     77160
     cgacatcgtg tcgctggtcg agcaggcgca gaagaacatc gacatcgccg aggcgcagaa     77220
     gctggcctcg aagatcaagt ccggcaacaa gttcgacttg aacgacttcc gcgaccaact     77280
     cgaccaggtc aagaagctgg gcgacatggg ctcgctgctg gaaaagctgc ccgcgcagct     77340
     ccagcaggca gccggccagc tgcagggcgg ccaggccgag aagcagctgc gccgcaccga     77400
     gggcatcctg aactccatga cgccgggcga gcgcgccaag cccgagttga tcaaggcctc     77460
     gcgcaagcgc cgcatcgccg ccggcgccgg cgtgccggtg caggaagtca accgcctgct     77520
     gtctcagttc gagcagatgc agggcatgat gaagcagatg aaaaaaggcg gcatggccaa     77580
     gatgatgcgc gccatgggcg gcatgaaggg cctgggccgc tttggcggca tgcgctagct     77640
     gtgaactgtc aataggttgt attcgtccag gttgagtctg gagatgggta cagcgcgccc     77700
     gatgccttgg tggggtcgat gccagttgta gtggtgtagc caggatttca tggcatcggc     77760
     tcggtgttgg gagttctggt aggtgtgagc gtaagcccac tcacgcaagg ccgactggat     77820
     gaagcgttcg gccttgccat tggtctgtgg gcggtaaggt cgggtaaagc ggtgcttgat     77880
     gcccagctca tggcacagcg cggcgaaggc gcggctgcga aaggccgagc cattgtcggt     77940
     gagcaagcgc tggatggtca cgcccaggcg ctggtagtag gccactgcgt ccttgaggaa     78000
     ctggacggcg ctggggaagc gctcgtcggg gtggatgtcg gtgaaggcca cgcgggcgtg     78060
     gtcatcgatg gccacgaaga cgaagtccca gccggccccc tcaacggtat cgcgtcggtt     78120
     gcccgtgacc cggtggccag ggcgctggat acgtcccagc ttcttgatgt cgatgtgcag     78180
     cagatcgccg ggggcctgat gctcgtagcg caccaccggc tcggccggct ccaggtcggc     78240
     caggtgcgac agaccggcgc gggccaggac gcggctgacg gtgctggctg acacgcccag     78300
     cgcctgggcg atgcgcgctt gggtcagccg cttgcggcgc agctccacga tagccagcgc     78360
     cttggccggc gcaatcgctc ggggcgagac cgtcgggcgc gaggacgcat cggccaagcc     78420
     cgcctggccc tgagccagga agcggcccag ccatttgcgc acagtcggcg cggtgacccc     78480
     ataggcgcgg gccgcttcag gcacacaaac ttgatgggcg atcaattgct ggaccatttc     78540
     gagtcgacgt aggaaggtca atcgggcatg cttatgggtg ttcatccggc cgggctcctt     78600
     gagtgaactg gggggttggc gatttccagt ttctcaaatc cggttcggat gaaccatgca     78660
     tacaacctat tgaatcttca cacctaggtc gagcccttct tgttaacagg gtgatgcaac     78720
     agaactggac gatgaggcag gccagccagg cggcaggggt gagcctgcgc accggttaca     78780
     agtggcttgc ccgcttccga agcgaaggtc tggacggcct gcttgaccgc agttctcgcc     78840
     cgcaccgcag cccgaaggcc tgtgcgcccg agcaggttga gcacttcgcc cagcagcgcc     78900
     gccagcgtct gccgctgtgg cgcatcgcgc gtgaagccgg ccgcagcctg gccaccgtgg     78960
     cgcggtatat ggaacgcatc ggcctgagtc gactcgcctc gttggagccg ccggcgccgg     79020
     tgcgccgcta tgaacgcgcc agcccaggcg agctgctgca catcgacacc aagcggctgg     79080
     gccgcatccg gggcgtgggc catcgcatca ccggcgatcg ggcccagaac cgcaaccgcg     79140
     gcattggctg ggacgctgtg cacctggcca tcgatgactt ctcgcgcgtg tcctttgctc     79200
     gcatcctcga cgatgaaggc ggcgatcagt gcgctgagtt cctgcgccaa gccaccgcct     79260
     actacgccag tctgggcgtg cgcatcgacc gcgtgatgac cgacaacggc agcggctacg     79320
     tctccaggac ctttcgggcg gtgtgcgtgg agctgggaat ccgtcacatc cgcacccgcc     79380
     cctacacccc caagaccaac ggcaaggccg agcgcctcgt gcagacctgc ttacgggagt     79440
     gggcatacgc caggccctac acgagctcag ccgaacgaca ggctgccttg cagcccttca     79500
     ttgaccgcta caactggcat cgaccccacc aaggcatcgg gcgcgctgta cccatctcca     79560
     gactcaacct ggacgaatac aacctattga cagttcacag ctaggcgtac gtcaccgacg     79620
     catattcccg tacgatctgg cccagcaatt ccgccgcttg ccgcgggctg cacatttgca     79680
     gcgaacgatc gagcatgcgc aattgcccca tgagggtttc gtacggaagg ctgtattccg     79740
     tggcgcgcat gatgcgggga tgcagggttt cacgggagtc ttccccgatc agcagttctt     79800
     cgtacagctt ttccccgggc cgcagtcccg tgatgcgaat ttcgatatcg ccatccggtt     79860
     ggtccgagtt ctttactgtc agtccgtaca ggcgcaccat gcgctcggcc agttcgcgga     79920
     tcaataccgg ttcgcccatg tccagcacga agaccgagcc ggattcgccc atggcgccgg     79980
     cctgcagtac cagttgcgcg gcttcgggta tggtcatgaa gtagcgcgtg atctcggggt     80040
     gcgtgagcgt gatcggcccg ccttccagga tctggcgccg gaacagcggc acgacgctgc     80100
     cggagctgcc cagcacgttg ccaaagcgca ccatcgagaa gcgggtcttg tcctggatct     80160
     gcgcgtgcgc ctgcaggatc agctcggcca ggcgcttgga ggcgcccatg acattggtgg     80220
     ggcgcacggc cttatcggtg gagatcagga cgaaatcgag cacgcccgcc tggatggcgg     80280
     tctcggccat gttgagcgtg ccgaaggcat tggtgcgtat gccctcggag acattgtgct     80340
     cgacgatggg cacgtgcttg tacgcggcgg cgtgataaat ggtctgtacg ccgtgctcct     80400
     gcaactgggc caggcagtgg gcggcgtcgc gcaccgaccc cagcacgccg gcaatttcga     80460
     tgttgcgctc gccgatgcgc tggcgcagat cctgctcgat ggcgtagagc gccggttcgg     80520
     cgatctcgaa gagcaccagc ttgcgggggc gcaaggccag gatctggcgg cacagttcgg     80580
     aaccgatgga gccgccggcg cccgtgacca tgacgacccg gtccgtgacg cagcggccca     80640
     acagcgtgtc gatgggcgcg accggatcgc gtccgagcag atcctccacc tgtacgtcgc     80700
     gcaggcgcac gccattggtg gggtcgatga gttcgcgcat gctcggcacc agccggatgc     80760
     gcaggcggta tggttcggcg gcttcgacga tgctgcggat ctgcttgggc ggcgccgaag     80820
     gcatcgcgat cagcagctgc cggatgttgt ggcggtcgat cagcttgggc agttgctcgg     80880
     gcgggtagac ccgcaggccg ttgacgacca ggcggtgttt acgcttgtcg tcgtcgagca     80940
     tggcgacggg acggtaatgc ggccccgtgc gcagcgccat ggccagttgc gacccggccc     81000
     cgcccgcgcc gtagatcagt accggcgtgc gcggatcggc catgtgatgg tcggcgggga     81060
     acagcagttt gcgggcaatc agccgcacgc cgatcaggcc caccagggcg agcgcggcat     81120
     acaggaccag tacgccgcgc gagatggtgg ccagctgcag gaaggtgttc ccggcggtca     81180
     cgaccatgac cgataccact attcccccca ggatggcggc cagcacccgc tcgctcatgt     81240
     agcgcaggat atagaggtag acgccgaacg ccgccagggc cgcaatgccg cccgcgcagg     81300
     caagcaggga caggaacaga tactggtcgg tcaggaagaa cagctcgaaa cgcagccata     81360
     gcgccaggtg gaaagcgccc agcaggatta cggcatccag cacgatcgcc agcatctgct     81420
     tgaacggtcg cggcaagtcg acgaagaggc gccggatggc ataggggaga gtcataactg     81480
     cgacggacga tgcgaaaaag ggtaggcaag cagtttgcgg attttactga ctagcgtgct     81540
     gcggcaatgc ggctggacgg gacggggcgc catttttctg tggcaagacg gccacgcata     81600
     cgccgaccag aaaccagaag ggctgcagat aaatcatgga actcggggcc atgccggcga     81660
     tcgccgcggt tatcaggcag atgcgtccgg tactgtccga gcgcaccaac agccagccga     81720
     ggaatgccac ccacagcaag cccagatgaa agaacatttc gagccagaag aaatgcggcg     81780
     atgcccattg ggtgtccgtc gccggccaca tcaggttcaa ttgtcccagc cccaggccga     81840
     atgcccattg ccaccagggc atttcgcgga tctgcgcata catgtccagc aatagctgga     81900
     cccgataagc ggtcgagtgg tcgccgttgt tggcaatcac tccgatctcg cccacggggg     81960
     gcatatcctc gccggcctgc gcggattgga tggtctcgtc ggcggccgcg gtggatgccg     82020
     gcgtcagtac ggcgccagcc ccgacctggg cccggggcgc cagggacggg agggtgccga     82080
     actggaagtt gccatgatgc agcaccaggg cggcggccga ggtcgcaagc agcgcgccgg     82140
     ccagcagcgt ccggttgccg tgcttcaggc gccgcgcgta gcccagcagg tacagcacag     82200
     ccccagcacg cttgcggcca gcaagatggt gcggcggttc atggccaggg catagaacca     82260
     acaggtgagg tacaggggga acgacagctt gcgcttgatc aggagccaga tgagattggc     82320
     gaagaccagg gccgtggcca tgtcattgat gttgtaccag acgccgccgg tcagggggta     82380
     gctcatccgg aagcggccgg agccggtcca ggcgtcgtag atcggtatgg cggctgtgat     82440
     cagccagtag aggactatgg ggtacaagcc ttccgcaaaa tccacgcggc ggcggaccag     82500
     cgcgtcggcc agcacggtgt agcagacgcc tgtcagcagg aaggccagaa aacgcagata     82560
     acggtccgta tgctctaccc acagcaactg gatcagcagg accgccgcgg tcgctgccag     82620
     ccagcgggtc agggcactgt ccaggacaac acggcgccat tcccggtcca gcgcgatcag     82680
     agccaggatc agcgcggcgc cgaaatgaaa gggtcgcagc gggtccagca cgtagatgga     82740
     agagccggaa aaacccagtg cgacggcgca caaggccagt ggcgtggata tgttcggcca     82800
     agccagggct cgggtcggcg cgctagacaa agccaatgca aactccgaag aaaagagcgg     82860
     gcgccagcaa accgattgcg atcaaccggc cattcagcat ggcctggatc gcatgataga     82920
     cgtcgtgggt cggacgcgcg tccacgatgc cggcaatgcg gggttccagg acaaatgtga     82980
     gcaggacggt cgcaacgccg ttgatcaatc ctgacagttg cgaaatcgta cttcgatact     83040
     cgtgaaacac cagcgcgaaa aagtatgaaa gtaatacgcc caggcaatag caaaggaaaa     83100
     cgattgcggc cagcagggcg atgcgttttt tcggcaggct ggccggtgcc tccagggcgg     83160
     tccggatttc ttcaacgcgc agtggcggct gccccgcgcg cttgcgcacg gcattggtga     83220
     gcagcgcgat ccaggagtag cgcagccagt aacccagcag ggacagcagc gccgcgccaa     83280
     acatggctgc cagccccatc tggagataga gcgaggtcgg gacctgcttg tcgaccagga     83340
     agcccagcag cggcatcagg gccaggtaga agaagcgggt gaccgtggtg gtggcgttct     83400
     ggatggcata gccggtgacg ggcttgcccg ccatgcgccc cgcgacgcgc gcgtagtagc     83460
     tcagatactc gagcagatgg atgatcgaat agctggcgat gaccagcagg ggtagcaggg     83520
     tcatcatacg gaggcgggct gggtcgcacg ataaagcctg gctgtttcgg tgtaggcgtc     83580
     cagcatcata tccaggcttt tgctccaggt atattcgctg agcacgcggg cccgcccggc     83640
     ggcacccagg cgttgacgca actccgggtt caggaccagc tcctgcagcc tgtcggcggc     83700
     ggcatgggcg tcttcacgcg ccacgatgta gcccgtcttg ccgtcgacca cgacctcggc     83760
     cgggccatcg gcattggaca ccacgaccgg cagggcgcac gagcaggctt ccaggatggc     83820
     gacgccgaag ctgtccatgc ggctcaaggc cacgtacacg tccagggcgc gcaaggcttc     83880
     gggcacctcg gcgtgcggga tgcgtccctt gaattccacc tgattcgcga tatgggcggc     83940
     ctgggcctgc gcgcgcaggc gctggagctg gctgcccgcg ccatagatgc gcaacaccag     84000
     gcgctcggcc atcccgggct ggctggctgc cagggcctgc ctgagcagcg caaaggcctg     84060
     gatcagcgtg tcgatgccgt agtgggtttc cagcgccttg accgtgccta tgacgatggg     84120
     gccgtccgcg gccggcgcct ggacggattg ggccggttgg aacagcgctt cgtcgatgcc     84180
     gaacggggta acgaagatcg ggcgccgcgt caggccgcgc atttcgcgct gcatggcgtg     84240
     gctggtggcc gccagggccg tcgcatggtc gagattgcgc tgcagcaatg ccttgtgcca     84300
     ggtactggag ttcggaaact cgtaaatgtc gctaccccac gctgacagca ggacggggga     84360
     gaaacgggcg cggcgcgcca acaggccgta gccggtcgca tagtgaacgt tgagcagatc     84420
     cgggtcgatg cgtttgagca gtgcccgcag gcggggcgcg gccaggaagt aacccagcgg     84480
     agcgcgccag ggaagccgat actggacgat gcgctcgtcg tacagcgaga gatcgggcgt     84540
     ttccagcgaa agcaggtgta cctgcaggcc gcgcagggcc aatccgtttg cccagcggat     84600
     ggtatggatg ctacgtgccg gtcccagcaa ggctaccctg gcaggcgtgc gttgcgcgaa     84660
     gtctggcgac tggcgagagg gtacgttact tagcaagata aatcatcgaa ccatcgtggg     84720
     tgcgcgcgac cgggcgcatc ctggggacag tcggatggcg ggaaagccgc ggcgttggtg     84780
     cgcaaaggcg cgacactgcc ggggcgcgcc attgagtgcg agtcaaatta acacaatctc     84840
     caatgagcgg cgtgtcttac ccgtggagta agagtatcaa atagtttccg attatctggc     84900
     aacggccagc agggtatggg caatgatttt caggtcaccc aaaaatgtcc gtgtttggac     84960
     atattcggcc tggatacgca atttttccgg aagaatgatt tcgcggtatg tacgttcggg     85020
     gtcgcttgat tgtcccagga tctcgttttc gttgcgaaag cgtatcgacg cgggatcggt     85080
     gattccgggg cgcaccgaaa ggaccaggtc gcgcaacgcg tccggataca ggaccacata     85140
     gcggggcact tcgggacgcg ggccgaccag gctcatgctg ccggtaaaga cgtcgatcaa     85200
     ctggaccagc tcgtccagtt tccacttgcg gatccatttc ccgacacggg ttatgcgagg     85260
     gtcggcgccc accgtgatct gccccgcctg cgggtcctgc cgcacgctca tgctgcgcag     85320
     cttgtggatg cgaaatggca cgccgtcctt gccgacgcgt tcctggcgga aaaacaccgg     85380
     tcccgggctg tccagcttga tggcgatggc gatcagggcg agcagcggca gtagcgccag     85440
     cagccccagc cccgagcaaa cgacgtcaaa cagccgtttg atcatgggcg cagcagttgc     85500
     cgtaccgatg cgatgacgcg ctgtacatcg gcatcggtca tgcgcgagta gatcggcagg     85560
     ctggccatgc cttcgaatgc ggcctgggaa tgggggtaca tgtcaggcgt caggccatat     85620
     cggtcgcgcc aatagggctg caggtgcaac ggcacgtagt gcacgctgca gccgatgccg     85680
     ttctcggtca tgcgcacgat gaagtcgtcg cacttgagcg gcgcctgcgg atggatgcgg     85740
     atggcgtaca ggtgccagga atgctcgtcg tcatcgcggt gggccacgcg ttcgacgccc     85800
     ggcgtgcggc cagggccggg gggcagtgtc agcggcagat cggcgaaggc ctggtcatag     85860
     gccgcggcga tctgtgcgcg ccggtcgcgc atttgctgca cgcgctgcaa ctggacgcgg     85920
     cccatcgcgg cggccgtgtc ggtcatgttg tacttgaagc cgggggcgac gatttcgtag     85980
     taccacgccg gcttcttcga ggtgaagcga tcgaaggcgt cgcggtcgat gccatgcagc     86040
     cgcatgacac ggcagcgctt ggcgagggcg gggtcgcgcg tgaccaccat gcccccttcg     86100
     ccggtggcca gcgtcttggt ggcgtaaaag ctgtagacgg tcaggtcgct ttccaggctg     86160
     ccgatacgcc ggccttgcca ggaggcgggc agcgcgtggg cggcgtcctc gatgactttc     86220
     aggccgtgct tgcgggcgat ctccaggatg ctgtccatgt cgcaggacag gccgccgtag     86280
     tgcaccggca cgattgcgcg ggtgcgcggc gtgatggcgc gttcgatggc ggcgggcgag     86340
     atgcacagcg tggccgggtc gatatcgacc aggaccggtt cggcgcccag gtagcgggcg     86400
     acttcggcgc tggcggtgaa tgtgtgggtg gtggtgatga cttcgtcgcc cgggccgacc     86460
     cctatggctt ccagggccag gtgcaggccg gcggtggccg aattgacggc cacggcctcc     86520
     acgtcggcgc cgatgtaggc cgcgaattcg cgttcgaact cgcgggcgtt ggggccggtg     86580
     gtcagccagc ccgaacgcat ggattcggtg accgcttgga tttcggcctc gccgatatcg     86640
     ggcagggcaa agggcaggaa gtcgctcatg gtgctggatc gctgtagaag tgagaggcgc     86700
     gccgccggcg gcaccggcca attctcgcag attagcgcga ggctgcgcgc cgtggcgtga     86760
     cagattgcac ggcgtcgagg aattgctgcg ccagcaccgg gtagtcgtgg cgggcgagca     86820
     cgtagtcacg gccgcgccgg cccatggcct ggcgctcggc ggcgggcagg gtgcgcaggc     86880
     cgtgcagggc cgcggccagg gcggccggat cttccgccgg cacggacagg ccgcaacggg     86940
     cgtcggccac gatatcgttg ccgctttcga tcgattgcac taccgggcag gccgacagca     87000
     tgtagtcgaa cagcttgttg gggctgacgc cgaactggaa cagcgggctg cgcctcaggc     87060
     cgatataggc cgcgtcgatg tcggccatca cggcctgcac ggcggggcga ggcaccggat     87120
     cggcgaaggc gatgtggcgc aggccgagct ggccggccag gcgcttgagc tccggtttgt     87180
     cggggccatc gcccagcagc aagaggccga tgggttggtc gcgcagccgc gccatcgcct     87240
     gcaacagcat gtccagcgca ttggcgtggc cgtgcgtgcc ggcgtaggca agcacgaaat     87300
     cgcattgttc gcgcaattgg cggatctgcg cgcgtacccg cagatagtcg gggttatcga     87360
     agtcgggcga actgtattcc gtcaccggca cgccgttggg cacgtgcgca taccgccgcg     87420
     ggtccagccc gcgctcgcgc atgtagggca gggcgcatgg cagcatggaa acggtcaggt     87480
     cggcgtgccg gtacgcgtag tcttccgcgt attgcatcga cgcgatcatc ggatgccagg     87540
     ccttgaagcc gcccagcagc ctgggcgtca gcggccacag gtcgtgcact tcgaacacca     87600
     ggcgggcgcc ggtctggcgg gccaggcgtg ccgcgggcag gacgtcgtag ggatgcgtgg     87660
     acgaggcaat gacgatatcc ggccgccagc cgccaaggtc gcggcgcagc ccatacaggc     87720
     gcgcgctgaa ctgcagcata ttgagcaggc ggcgcgcgcc gttgccttgg tacggcaacg     87780
     tggcatacca gagatactcg atgccatcga cgttctcgcg cgtcagccgg ccgcctgcct     87840
     ggggggcgcg cgcccggatg tgcgagatcg tgctggccgc cacttttacc tgatgcccat     87900
     gcccgatcca ttcgcggccg aagtaatacg gccggaactc catgccatag cggggcgagc     87960
     ctgcgtaatg gttgatcagc aggatgttca tggcggtgcg tgtactacgg tggatcagtg     88020
     ggcggccagg gcgtccacga tgcgccgtgc ggcctggccg tcgccgtagg gctgcacgtc     88080
     gcgcggctgt tcgcgcaacg cgtcctggac ggcttgcgcg acaacggcgc tggacaccgg     88140
     cggcgccagg cgattccagc cggcgtcgac cagctcggtc cattcggttt cgtcgcgcag     88200
     cgtgacgcag gggatgcgat ggaaaaacgc ttccttctgc acgccgccgg agtcggtggc     88260
     gatgagggcg gcgtatttct ccagctgcac catgtccagg tagccgaccg gttcgagcaa     88320
     ggtgacggtg gacgccagct cgtcgagcag tcccaggcgg gccaggatgc cccacgtgcg     88380
     cgggtgcagc ggccagacga cctggcgctc ggcggccaac gcctgcagcg cgcgcacgat     88440
     ggtcgtcagg cgttgcgcgt cgtcggtatt ttccgcgcga tggatcgtgg ccagcacata     88500
     gccgcccggc ttcaggccat gggccgccag ggcccggcct tcggcggtga cccgcgcgcc     88560
     gtggtgcagc gcgacgtcgt acatgacatc gccgacctgc acgaccttct cgcccgactg     88620
     gccttcggcg gccaggtggc gcgtggcgct gtcggtaggc gtgaacagcc agcgcgaaat     88680
     gcggtcggtc aggatgcggt tcacttcctc gggcatgcgc aggttgaacg aacgcaggcc     88740
     ggcctccacg tgggcgaccg gaatatgcag cttgaccgcc gccagcgcgc cggccagggt     88800
     cgaattggtg tcgccgtaga ccagcaccac gtccggcttt tccgcctgca tcacctgttc     88860
     gagcgcgacc agcatgcggc cggtcatgtc gccgtggccg ccgccgtgga tgtcgagctg     88920
     gtgggcgggc gtctgcatgc ccagttcgtc gaagaagacg tcggacatgt tggcgtcgaa     88980
     atgctggccc gtgtggacca cgacttccgt cagttccggg tgctgggcaa tggcggcgga     89040
     gacgacgctc gccttgatga attgcgggcg agcgcccagt acggtcagta tcttcttcgg     89100
     catgacgaaa tcagttcagg gcctggcgca acgcggcgac gatcttgtcc tgggtggctt     89160
     cgtccagatc cgggtgcatc ggcaggctca tgacgcgcgc ggccaggtcg tcggaaaccg     89220
     gcgtggcgcc ggcgccctcg gcgtattgct cataggccgg ctgcgcgtgg atggggcgcg     89280
     gatagtgcac ggcggtggga atgccggcct ccttcagctg ggcgatgacg gcttcgcggt     89340
     tgggcaccat gacggtgaac tgggcccaga cgctgtcgcg gtcggggcgc acggttacgg     89400
     tacatgcgcc gccgggcaaa tcggccagca gttgctggta gcgcgcgccg atcttgatgc     89460
     gttgggcgat ttcccaatcg aaacgctcca gcttgcccag caccacggcg cattgcagcg     89520
     tgtccatgcg gccgcccacg ccgatgcggg cgtggtagta gcggcccgat tggccgtgca     89580
     cgcggatttc gcgcatggct tgcgccagct cgtcgtcgtt ggtgaacagc gcgccgccgt     89640
     cgccgtagca gcccagcggc ttgctcggga agaagctggt gcagccgatg gtcgacaggt     89700
     tgcagctctt gcggcccttg taggtggcgc cgaagctctg cgcggcgtct tcgatgaccg     89760
     gcaggccgtg cctggccgcg acggcgttga cttcgtccat gtcgccgcat tggccgtaca     89820
     gcgacaccgg gatgatggcc ttggtgcgcg gggtgatctt cgcttcgatc tcggacacct     89880
     tgatgttgca ggtatccggt tcgacgtcga cgaacacggg cttggcgccc agcagcgcga     89940
     tgacttcagc ggtggccacg aaggtgaacg aggtggtgat gacttcgtcg ccggccttca     90000
     cgcccagcgc catcagcgag atcagcagcg cctcggtgcc cgaggccacg gtgatgcagt     90060
     gcttggcgcc ggtgtaggcg cacaaggcgg cctccagttc cttgacttcc gggcccatga     90120
     tgaactggcc gtggtccagc acggcctgga tgcgcgggtt gatggtgtcg cgcagcgctt     90180
     ggtattgggt tttcaggtca atgaattgca tgtctcactc gcccagtcgg cagacgccgt     90240
     tttccaggat ataaaggtcg cccgtatggg ggcagcgcgc ctggccgttg ccggccaggg     90300
     gcaggtcgag ctgttcgccg tggcggctca tccagccgat ctggcgcgcc ggcacaccga     90360
     ccaccagtgc gaaatcgggg acgtccttgt tgacgaccgc gccggcgccg acaaaggcgt     90420
     agcggcccac tgtcgcgccg cagacgatgg tgcagttggc gcccagcgtg gcgccctggc     90480
     gcaccagcgt gtcgcggtat tcgttcttgc gttcgatggc cgcgcgcggg ttgtagacgt     90540
     tggtgaacac catgctcgga ccgcagaaca cgtcgtcctc caggaaaacg ttgtcgtaca     90600
     ccgacacgtt gttctggatt ttcacgcggt cgccgatccg cacacggttg ccgacgaaga     90660
     cgttctgccc cagcgagcag cctgcgccga tctcggcgcc gccgcagatg tggacccagt     90720
     gccagatgcg gctgttggcg ccgatgcggg cgccttcatc gacaatggcg gtcggatgga     90780
     tggtggtcat gcgtcagtcc agcggcaggg ggatgcgcac gccgtcgcgc gcggagcggt     90840
     agatggcggt cagcagggcc agcgattgca ggccttcgcg gccgtcggtt tcgggttcgc     90900
     agtcgccgcg caggcaattg atgacattgt cgtagtacag cgggtgcccg aaaccgtaga     90960
     ccgacgtggt ttcgtaattg gcttcgcgga tcttgtcgtc atccggatgc ggttcggcaa     91020
     acttccattc gtcgatgcgg ttgaccgcaa cgccgcccac gcgaaccgtc cccttttcac     91080
     cgagaatggt gatggagcct tccaggttct gcggataggt cagcatggtg acgttgatcg     91140
     agcccatcgc gccgtggcgc cagcgcagcg ccgccacgcc ggtgtcctcg gcttcgatgc     91200
     ggcgcgccag cgtggccgtg taggcgtaga cgctttcgac cgggccgacc agccagtcca     91260
     gcaggtccac gtagtggctg gcctggttca tgaatgcgcc gccgtcccat tcccacttgc     91320
     cgcgccagcg ggcggcgtcg taatactcct gcggccgggt ccagaagacg ttgaccgtca     91380
     ccatgtagat acggccgaag cggccctgct cgatggcctt cttgaccagt tgcagggtgg     91440
     cgttgcggcg gttctgcttg accacgaaca ggcgcacccc ggcttcgtca caggccttga     91500
     ccatgcgctt gccgtcttcc cagcgggtag ccatgggctt ctcgctgacc acgtggcgac     91560
     cggcctgggc cacttcgatg gcttgccagg ggtgcaggcc ggacggggtg gccagcacca     91620
     gcgcgtcggc attgccttgc gccagcatgt cgctgagcga ggagaacggc cgcgccccgg     91680
     tggccgcctc ggcagcctgc agcgcctcgg ggttggtatc gcagatttcg accagctcgg     91740
     cgcggtcgcc gtgctgcgcg atcgcgccga tatggttctt ggaaatgcgg ccgcaaccaa     91800
     ctaagccgaa acggattttt cgatcggtga tgggaagtga gctcatgaac gccgagggat     91860
     tgaggtaaat tgccgaaatt cttcttatgc cgccccggac agcagcgggc gaaaataagc     91920
     ggcaataata ccgcgaatcc cgtagggatt ttcctgacaa atctcgttgg ttattgatgc     91980
     caaatcgtat tctcatcgtt cgcacctcgt cgcttggcga tttggtgcat atgctgcctg     92040
     ctatttccga tatcgcccga tacgttcccg atacccagat tgactgggtt gcggaagagg     92100
     cttttgccga tatcccgaaa tggcatccgg cggtcaatga ggtgatcaag gtggcacacc     92160
     ggcgctggcg caaggcctgg tggtccgagc cggtgcgcca ggaacgccgc gcgctggccg     92220
     agcgcctgcg ctcggtgtcc tacgatgtcg tgctggatat gcaggggctg ctgaaatcgg     92280
     cctggctggt gcggcagacc cgcggggtgc gccacggcct ggactggcgc tccgcgcgcg     92340
     agccgttggt gtcgctgttt tacaacgtcc ggcaccgggt ggagttctgg cagccggccg     92400
     tggtacgcca gcgcaagctg gccgcgttga cctttggcta caactacgcg ggatcgcccg     92460
     atttcggatt gcaggcattc ggccgggccg cgcaggccga cgatgcgccg gccgatccgg     92520
     gccgccgcat gctgcacctg gcggccgacc ggggttatgc ggtgatcatg ccgtcggcca     92580
     gccgcgacga caaactgtgg cccgaggacg attggcgcgc cgtattccgg cggctgcagg     92640
     atgccggctg cgccctgcgc ctgctggccg gcaacgagca ggaggccgag cgcgcccgcg     92700
     tgctggttgc cggcatggag ggcgtggaag tgctgccgcg catggatttg acgtcggtgg     92760
     cgcaggtgct ggccggcgcc cgcctgatgg tggggctgga cagcggcctg acgcatctgt     92820
     cggcggcgct gggccgtccg accatcggca tctatcgtgc ctcgacgccg gtgcgtacgc     92880
     cgctggtggg gcccagctat acggccagcc tgggcgaccg tggcgcctcg ccatcgcgcg     92940
     aggccgtgct ggcctcggtc gagcaggccc tggcggcggc ctgacatggg ccgcggcgtc     93000
     tataccctgg cgttgcgggg cctggcgccg ttgatctggc tatggatgtg gcgccgcgcg     93060
     cggcgcgcgg gcggccagtg ggagttgttc gcgccggccc gcttcggtcg cgccggcgcg     93120
     cgcgcgcccg cgccgctggc cgcgccggtc tgggtgcatg cggtcagcct gggcgagacg     93180
     cgcgcggcgc agccgctggt ccaggccctg ctggagcgtg gcctgcccgt cctgttgacc     93240
     cataccaccg ccaccggccg ggccgagggc gagcgcctgt tcggtgcggc gatcggacgc     93300
     gggcaattgc agcaagcctg gctgccctac gattttcctg gcgcgacgcg gcgcttcctg     93360
     gcgcgccatg cgcctcgctg cggtttgctg atggagcggg aagtctggcc caatctgctg     93420
     gcggcggcgc gcgcgcaggg ggtgccgatg gcgctggtca gcgcgcgctt ttccgcttcg     93480
     tcgctgcgcc aggccggctg gctgggccag gcgctgcgtg aggccctggc gggcctggac     93540
     cgggtgctgg cgcagaccga cgaggatggc gcgcgcctgt gccaggccgg tgcgaatgcc     93600
     tacacggtga ccggcagcct gaagttcgac gtggcgctgc ccgaggcgca attgcgggtc     93660
     ggacacgcct gggccggggc gacgggccgg cccgtgattg cgctggcgag cacgcgcgag     93720
     ggcgaggacg ccatgttcat cgaggcgatc ggcgccttgc aggcgcatcg cgccgccacg     93780
     ccgcggccgc tgatcctgct gattcctcgc catccccagc gtttcgacga ggcggccgcc     93840
     cagttgcagg cggccggcct ggcctatgcg cggcgctcgg ccggctcggg cgagcccgga     93900
     ccgcatatcg acgtactgct gggcgatacc ctgggcgaga tgccgttcta ctacgcggcc     93960
     gccgatgttg ccatcgtggg gggcagcttc gccaggctgg gcgggcagaa cctgatcgaa     94020
     gcctgcgcgg ccggcacgcc ggtcatcgtc ggcccgcata cgttcaattt caaggatgcc     94080
     gcccgggacg ccattgcggc gggggcggcg ctgcgtgcgc ccgacgcgcg caccgcgctc     94140
     gattgggcgc tgcagctgct ggccgagccg gcacgccggc aggccatgag cgaggccgcg     94200
     cgcgcctgga ccgccgcgca tgccggcgcc acgcggcgca cgctggacgc gctggaggat     94260
     tggctgggat agcccgccgt gcggttcgtc agggccgcag caccttgacc tggtcggcct     94320
     tcatttcctg gttcaggcga gcggcgtcgc gtccttcgtc ggcgggacgc aggcccagcc     94380
     agccctggcc cagcgcatag acccacaggt tggccgcgac gatcaggagg aacaggatgc     94440
     gcatgggaaa tccgccgggt gtggggggtc aggccgttgg cgcgccttgc gcggcgagcg     94500
     ccgccaggcc gtcgagcacg gggctgtcga ggtaagtggg ctgcggcgtg gcgccgaagg     94560
     cggcgccggt gaccgccagc aggcgctcgg cttcctgccg cacttcgggc cacccgccgc     94620
     cggcgacata gatctccggc gcctggccgt agcgttggcg gccggccagc cattgccgca     94680
     cgatcgcgcc ggcctgggcg gcggcgatgc cgctggcgat ggcctgatgg gtgtcgatgg     94740
     ggtagtcggc caccaggccg tcggccaggg gcaggtgggc ggtgccgtag gccagcgcgc     94800
     cgcgcatcat ggcggggccg ggcaggatca gcccgccggg aaagacattg tcgggcccga     94860
     tggtgtccag cgtggtggcc gtgccgaaac tggccaccag cagcggcggg tgcacggacg     94920
     gctggcgcgc cagcacgccc accatgcacg cccagcggtc ggcgcccagt tggtcgggat     94980
     tgcgatagcc gttgcgcagc cccatggcca ggggctgggc ccgcagccac cggatgtcgc     95040
     aaccgcccgc gcgcagcgtg gcggcaatgg cttcgccgcg ggcaagcccg gcgacgttca     95100
     cgcccagcgc ccgttgcggg cgcctgggca gggtggccag ccagcggccc agcgcgtcca     95160
     ggtcgagatt gtcgaaggcg acgggggcgg gctcgcgcgc cgcctgcggc gcgtccgggt     95220
     caaaccagcc gactttgagg cggctgttgc cggagtcgat gaggataatc atgcttgggg     95280
     ccggatcgaa atttcgccga cggagacggg ccgcattcca tcggcagcct gcaccagcaa     95340
     gcggccatgg tcgtccacgc cgctggccgc gccggtgtag aggatttcgc cgcgatcgat     95400
     cacgttgacc gggcgcccgg ccagggcatc gacccgggcg aagcgcgcgc cgaaggcgcc     95460
     aaagccctcc tgctgcagcg tatgcgcggc gtcttgccag gcccgcgcca cggcggcgac     95520
     caggtcggcc gccgcgtccg gacctttttc gccggggccg gcgacgtcat tccagtcggc     95580
     cacggaacgc tgcagcgcct gcgacagcgc atcgccgcca tgcaggttca ggcccatgcc     95640
     gatgacgacg gcgtggcccg tgccggccgg gttgcggacc gattcgacca gcacgccggc     95700
     cagcttcgcg tcgtgccact gcacgtcgtt gggccacttc accagcaggc cggcgggttg     95760
     gccgaccagt tggcgcagcg cttcgcaggc agccatgccg gccagcggcg acagcgcggg     95820
     cagttgcgac ggcggcaggt ccacgtcgaa ggcgcacgag aacatcaggg ccgcgcccac     95880
     ccggttttgc caggggcggc cggcgcggcc gcgtccggtt tcctgcaggt gcgcgccgag     95940
     caggcacggc cgcgccccgc cgccggcgcg tgcgcgcgcc agcaggtcgg cgttggtcga     96000
     gccggtgctt ccgacccagg agatatcccg gaatgcaggc aggcgagcgg cgatggcccg     96060
     ggccagcgca gcgggctcgg gcagcgagag ggaacggact tcggctgaca tgggcgcgat     96120
     tgtaatggca cccattgcgg gggcgggacg tatatcattc gttacgatcg ttcgaatttc     96180
     tgtgtatccg tgcatttccg cgattgccta tgcctagttt gccgagtacc gccggcgccg     96240
     ccacattgtc gttgacgcta gaccatggcg tctgccatgt gtcgggcgac tggtccatgc     96300
     aggcgctggc tgctccgggc gaagtggagc gccgccgcgc cgcgctggcc cgcgtcgacc     96360
     ccgaccagcg ctgggacttg cgcggggtcg agcggctgga caccatcggg gcccacctgc     96420
     tgtggggcgc ctgggggcaa cagttgcccg agcgggtgcg ctggtccgac ggacagcgcg     96480
     aggtgtttca gacgctgcag cgcaaccgcg gcgaggcgct tcccgcgccg gcgccggcgg     96540
     accgctgggg ctggctgcgc gcgatcggcg acgccgtatt cgacgccggc cgcaatggcc     96600
     gcgcattggt catcatgttc ggccaactgg tgctggatct gggcgccttc ctgcgccgcc     96660
     cgtcgcgcgg gccgtggcgc gagatttcgg cgcaggtcta ccgcaccggc gcgcaggcgc     96720
     tgggcattac cgccctggtc ggcttcctga tcggcgtcgt gctgtcctat ctgtcggcgc     96780
     agcagctgca gatgttcggc gccgaccgct tcatcgtccg tttgctgggc gtttccatcg     96840
     tgcgcgagct ggggccggtg ctggcggcca tcctggtggc ggggcgatcc ggctcggcca     96900
     tcacggccca gatcggcgtg atgcgggtga cgcaggaact ggacgccatg ctggtgatgg     96960
     gcatttcgca tggccagcgc ctgatcctgc cgcgcgtgat cgccctggcg atcaccatgc     97020
     cgctgctggt ggtctggacc gatgccatgg ccctgctggg cgggatgctg gcggcgcaga     97080
     tgcagctggg cgtttcggcg caatggttcc tgacctcgct gccggacgcc atttcgctga     97140
     ccaattactg gatcggcatg ttcaagggcg tgtcgttcgg catcctgatc gcgctggtgg     97200
     cctgccattt cggcctgtgc atccagccca ataccgaaag cctggggcgc ggcaccacca     97260
     cgtcggtggt gacctcgatc acgggcgtca tcctggtcga cgccctgtac gccgtcattt     97320
     tcagctcgat aggcatctga tgggcagcgt ggcacagcaa aacctgttca gcgcgaccga     97380
     cctggccgtg gcgccggtca tcgcggtacg cggcttgcgc acggcgttcg gcgaccatgt     97440
     cgtgcacgac aatctggacc tgtcggtcta cccgggcgag atcctggcgc tggtgggcgg     97500
     ctcgggcacg ggcaagacgg tgttgctgcg ccagatcatc ggcctggagc ggccggccgc     97560
     cggcaccatc gaggtgctgg gccgccgggt ccaggagctt gagccggccg agcggcggcg     97620
     cctgtcgcac cgctggggca tgttgttcca ggccggcgcg ctgttttcgt cgctgtcggt     97680
     gttcgacaat gtggccctgc cgctgcgcga gctgcgcacc gtgccggaag acctggtgtg     97740
     cgacgtggtg atgtgccggc tggcgatggt gggtctgacg tccaaggacg ccgacaagcg     97800
     accggccgac ctgtccggcg gcatggtcaa gcgggtggcg ctggcgcgcg ccctgtcgct     97860
     cgaccccgaa ctgctgtttc tcgacgagcc gacggcgggc ctggaccccc tgcgctcgga     97920
     cgaattcgtc gacctggtgc gcagcctgca tcgccagctg ggattcacgg tggtcatggt     97980
     gacccacgac ctcgatacct tgctggcgct ggccacgcgc gtggcggtgt tggccgacaa     98040
     gcgtgtgatc gtctgcgata ccgtgcggga agtgctcaag gtcgatcatc ctttcatccg     98100
     cagtttcttt ctgggcgagc gcggccgccg cgcgctggga gatcttgcac ctaaggaaac     98160
     gggcaatgga aaaccgtagt catgccctgc tggcggggct gttcacgctg gcgttgctgg     98220
     ttgccgccgc gctggtggcc atatgggtcg ggcgcgatcg cgccgccctc aagccttatg     98280
     tcatcgtctc ggctacctcg gtcagcgggc tgtcggccca gtccaccgtg cgctaccagg     98340
     gcgtgccggt gggcaaggtg cagtcgctgg gcttcaaccc cgacaagccg gcccaggtgc     98400
     gcatcagcat cggcgtggcg cccgatactc cgattaccga gtccacctgg gccgagctgg     98460
     gcgtgcaggg cgtgacgggg ctgggcaata tcgagctgcg cgacgacggc acctcgaccc     98520
     gccggctggc gtccagcgcc gccatgccgg ccaccatccc gctgcggccg ggttttttcc     98580
     agcgcttcga gcagcgcggc ggcgagatcc tgcacaacgt cgagcaggtg tccgcgcggc     98640
     tcgagcgcct gctcagcaat gagaatgtgc tggccacgac ggccacgctg cagaacatcg     98700
     ccgccatcac caccgacctg cgccaggcgg cgaccgacct gcggccggcg ctggcgcagg     98760
     tgccgccgct ggtcgattcg ctgcaggcga tgtcgcgcaa caccggccag gcggcccagg     98820
     agatcgccgg cctggcacag tcggcccggc acgctggcgc ggctggatgc gcccgatggg     98880
     ccgctggcca tggccacgcg cagcatgcgc gatattgcct gggcggccgc ccgcctcgat     98940
     gcgcagaccc tgccggcggt ctccggcatg gccagcagca tcgattcggc ggcccgcagc     99000
     gccacgacca cattgcggcg cgtgggcgat acgccccaat cgttgctgtt cggcccgccg     99060
     cccaccgtgc ccgggccggg cgagccgggt tttgccggat tcgggaggta aatggatatg     99120
     aagaaggcca tcatcgtgtt gtcggccctg ctgctggccg gctgcggcgc cggccgcatg     99180
     gccgcgccgc cggcgctgtt cgacctgggc gccgacgtgg cggccacgcc cgccttgccg     99240
     gcgcgtcagc cgatcgtgct ggcgttcgag gcggtgccgt atctgtccga taccggcgtg     99300
     atctggcggg tgggcgacag cgccagcccg catgcctacg cacgctcgcg ctgggcgagc     99360
     gcgccggccg agctggtgcg ccagcgcctg gtcgagcgcc tgtcgcacca ggggccggtg     99420
     ctgggcgccg gcatgggcgc gggcctggcg caggtgcagg tcacgctgac gttcgagcaa     99480
     gtcttcgccg ccgacgggca ggccagcgtc ggccatgtgg cgatgcaggc cgtgttgctg     99540
     caggatcgcc aggtggtcgg ccaggtgcgg atcgcgcgcg aagcgccggc cgccacccag     99600
     gatgccgccg gcggcgtgca ggccttgcgc caggccaccg atgccgcggc cgacgagctg     99660
     gccggctggc tggccggccg cgtcgcggcc gccggcgcgc gcgccggcag ttaacatggc     99720
     cttttgttcc acttagttcc gtcatgtccg cacgtaccga aacccaagta ttcactggcg     99780
     ccgccggcag catcgactgc gccatcgatt ggcccgccca tgcgccgcgc ggctgggcgc     99840
     tggtgttgca cccgcactcg ctgcaaggcg gcgcgcgcga caacaaggtg gtcaccaccg     99900
     tggcgcgcgc ctgcgtgcag catgggctgg ccgcggtgcg gccgaatttc cgcggcgtgg     99960
     gcgagtcggc cggcgagttc gacaagtcga tcggcgagac cgaggacatg ctggcgctgg    100020
     tggcgcaggt gcgcgaacgc tacccggaat tcgccgcgtc gccgtgggtg ctgggcggct    100080
     tctcgttcgg caccgcggtc gcggcgcaga cctatgcggc cctggccgcg tccggcgatc    100140
     cgtcgctgcc gcgcgcgctg atgctgatgg ggccggcggt caaccgtttc gagcgttcgg    100200
     ccaccgaggt gccggccgat accttgctgg tgcatggcga agtggacgac gtggtgccgc    100260
     tggccgaagc cctggaatgg gcgcggccgc gctccctgcc ggtggtggtc gtgccggggg    100320
     cctcgcactt tttccacggc aagctgctgg tgctgcggca actggtgcag gaccgccttc    100380
     gcattgcgct ggattgaccc ggcccgcgtt gcatcacgtt gcatgtttgt aagcgcaacg    100440
     gaacgttctc gtcagggacg tgtcggatac gctgcctata attgtgggcc tctacctgcc    100500
     ctggcgggcc ctacctgaac tcctagccga tgaagacctt gcctgatact gctattgccc    100560
     ccgtcgttct ttcccgtcgc gtattggcca gcgccgtgct ggctgccatg ctggccgctg    100620
     cggcgccggc cggggcccag cagcaggcgg cgcccgccac gcctgtcgcc gccgccgcgc    100680
     ccgcggcggg cggcgcggta ggcgccgtgg gagacctggc ggccgtgccg gtgccgacca    100740
     tcgccgccaa ggcgtggatc accgtggacg tcaacagcgg ccaggtgctg gcagcctcca    100800
     acgccgacat gaaggtcgag ccggcctcgc tgaccaagat catgaccgcc tatgtggtgt    100860
     tcaacgcgct gcaggaaaag cgcctgaccc tggagcagca ggttccggtc tccgagcacg    100920
     catggcgcac cggcggttcg cgcatgttca tcgagccgcg caagccggtg acggtcgacg    100980
     aactgaacca gggcatgatc gtccagtcgg gcaatgacgc atcggtcgcg ctggccgagg    101040
     ccgtcggcgg cagcgaaagc gcctttgcgg ccctgatgaa ccaggaggcg cagcgcctgg    101100
     gcatgcgcaa tacgcatttc atgaactcca ccggcctgcc cgatccgcag cacgtcacca    101160
     cggcgcgcga cctggccacg ctggcggcgc acctgatctc ggattacccg gactactacc    101220
     actactacaa gcagaaaagc tacacgtaca acaagatcac ccagcccaac cgcaaccgcc    101280
     tgttgtgggc cgatccgtcg gtcgacggca tgaagacggg gcacaccgat tcggccggct    101340
     actgcctggt ttcgaccgcc atgcgcggcg accgccgtat cctgaccgtg ctggtgggcg    101400
     ccgacagcga agccacgcgc gccgaggaaa gcctcaagct gctcaactgg agcttccaga    101460
     acttcgatac ggtcaagctg tacgaccaga gccagcccgg gctggacgcg cgggtctggg    101520
     aaggcaaggt cgagaacgtc aagctgggtc cgcccaaccc ggtgtggctg gcggtgccgc    101580
     gcggcaaggc ggccgagatc aagccggtcg cgcagcgcac cgacccgctg gtggcgccgc    101640
     tgaccaaggg acagcaggtc ggcacgctgc agctcacgct cgacggcaag accttgcgcg    101700
     tcgaaccgct ggtggtccag gaagacgtcg agcgcgccgg cttcttcggc cgcatggccg    101760
     acaccgtgaa gcgctggttc cagtaacgat gaaagccgcg ccggaggcgg cgcggcggca    101820
     ccggtgggct gccatgcccg cccctatcct ctccaaggag ctccccatga ttccgggcat    101880
     gccgggcgac agccaggtat atctcaacgg cgaattcacg cgcctcgacg aagccaagat    101940
     ttccgtgctc gaccgcggtt tcatcttcgg cgatggtatc tatgaagtcg tgccggtcta    102000
     tgacggcaag gtgttccgca tgaccgaaca cctgaatcgc ctggatcgca gcctggcggc    102060
     gctgcgcatc gccgcgccga tggaccgcgc gggatgggag tcggtgatcg ccgggttgat    102120
     cgcccgctcg gcccagccca cctgcatcat ctacctgcag gtcacgcgcg gcgtctgcaa    102180
     gcgcgatcac gcctttccca ccgagccgat cacgcccacg gtgttcggca tggccgcggc    102240
     cttcagtccg ccgggggccg cgcagcgcac ccagggcctg agcgcgattg ccatcgacga    102300
     cgagcgctgg ctgcattgcg agatcaagtc ggtttcgctg ctgggcaacg tgctggccaa    102360
     gcagcaggcc gtggacgccg gcgtggacga ggtggtgcag tttcgcgatg gctggctgac    102420
     cgagggctcg tcgaccaata tctgggtggt ttccggcggc aagctgctgg ccccgcccaa    102480
     gaacaacctg atcctggaag gcatccgcta cggcctgatg ggcgagctgg ccgaggcggc    102540
     cggcctgccg ttcgaggcgc ggcggatctc gcgcgaggaa gtgctcgccg ccgacgaatt    102600
     gatgctgacc tcggccacca aggaagtgct gcccatcgtg cgcctggacg gcaaggcggt    102660
     gggcgcgggc aagcccggcc ccgtttatga gcagttgcgc gcgggttatg atgcgcgtat    102720
     cgccgccctg tagcggccgg caggcgggcg gccctggcgc cgcccgcgtt tcgcgtccct    102780
     cgcgacgccg ccacccaggc agacgcagat gcacaatatt cccccggaag agtccctgat    102840
     cgagtatccg agcgacttcc ccatcaaggt aatgggcaag cagcatccgg aattcgccca    102900
     gaccctcact gaagtcgtgc tgcagttcga cccgggtttc gatccggcat cggtcgagat    102960
     gcggcccagc aagggcggca actacctggg gctgaccttc acggtgcgtg cgacctcgcg    103020
     cgaacagctc gattcgctgt accgcgccct gcacggccac cccatggtgt cgatcgtcct    103080
     gtagccccgt catgatcaag tggcttgcgc gcccggccga ctacgcttcg gtctgggacg    103140
     ccatgaagac gttcaccgcc gcgcgcggtc ccggcaccgc cgatgaaatc tggctgtgcg    103200
     agcatgcccc ggtctatacc ctgggccagg tcgggcggcc cgaacacctg ctcaatcccg    103260
     ggctcatccc ggtcgtgcat tgcgaccgcg gcggccaggt cacctatcac ggcccgggcc    103320
     aggtactcgc ctacaccttg ttcgacctgc gccgcgccgg gctgtacgtg cgcgagtacg    103380
     tcgacatgct cgaacaggcg accctggcca cgctgcgcga gctgggcctg gagcaggcct    103440
     gtcgcaagcc gggcgcgccc ggcatctatg taccccagcc cggcggcgaa ctggccaaga    103500
     tcgccgccct gggcgtgaag gtgcgcaatg gctatgccta tcatggactg gcgctgaaca    103560
     tcgatatgga tctgtcgccg tttctcggta tcaatccctg tggctacgaa ggcctgcgca    103620
     cggtcgatct ggctgcctgc ggcgtgcgca ccagcgtgga gcgggccggc gaattgctgg    103680
     ccgcgcagct ggcgcgcgcc catggccagg cggtgcagca gcgcgccgcg gcgctggcgg    103740
     gcgtgccggg atagtagaat ggcttttttg tctcgaaccg gagcgcgcct ggcgttccgg    103800
     ttgtgaaggt gctcaatgtc cacgctcgtc gagtcccccg ttccctcgaa cgactcgcag    103860
     gccgccgcgc cggccgccta cgatcccacc cagaagcaga aatcgcaggc caagaccgcg    103920
     cgcattccga tcaaggtggt cgcggccgag aagctgaaga agccggaatg gatccgcgtg    103980
     cgcgccgccg ccccggggtc gcgcttctac gacatcaagc gcatcctgcg cgagcacaac    104040
     ctgcatacgg tgtgcgaaga ggcatcctgc ccgaacatcg gcgaatgctt cggcaagggc    104100
     acggccacct tcatgatcat gggcgacaag tgcacgcgcc gttgcccgtt ctgtgatgtg    104160
     ggccacggcc gtcccgatcc gctggacacg caagagcccg aaaacctggc gcgcaccatc    104220
     gccgcgctca agctgtccta cgtggtcatc acctcggtcg accgcgacga cctgcgcgac    104280
     ggtggcgccg cccacttcgt cgaatgcatc gccaaggtgc gcgagtattc gcccgatacc    104340
     cgcatcgaag tgctggtgcc cgacttccgc ggccgcctgg accgtgcgct gcacatcctc    104400
     aacagcggcc cgccggacgt catgaaccac aacctggaaa ccgtgccgcg cctgtacaag    104460
     caggcacgcc cgggctcgga ctacgcgcat tcgctcaagc tgctggccga gttcaagaag    104520
     ctgcaccccg aggtgcccac caagtcgggc ctgatgctgg gcctgggcga gacggacgag    104580
     gaaatcctgc aggtcatgcg ggacatgcgc gagcataacg tcgacatgct gaccatcggc    104640
     cagtatctcc agccgtcgga gcaccatctg ccggtgctgc gctacgtgca tccggacacc    104700
     ttcgcgatgt tcgagcgcga ggcctacgcc atgggcttca cgcatgcggc cgtgggcgcc    104760
     atggtgcgct cgtcgtacca cgccgaccag caggcgcacg ccgccggcgt caactgaaga    104820
     cgcgcgggcc gctacgcata ggtatcggcc cgcgccagcg ccacgccctg gcggtctttc    104880
     accgacagga tgggcgcttg gccctgcagc ggccagtcca ccttgagttg cgggtcgtcc    104940
     cagcgcacgc agcgctcatg ttcgggcgcg tagtagtcgg tggccttgta caggcactcg    105000
     gtatcgtcgg acaacgccag gaagccgtgc gcaaatcctt ccggaatcca cagctggtgc    105060
     cggttgcgcg ccgacaggta ggcgccggtc cagcgcccga aggtgggcga accgcggcgc    105120
     aggtccaccg ccacgtcata ggcttcgccc gccaccacgc gcaccagctt ggcctgcgga    105180
     tgcaggatct ggtagtgcag gccgcgcagc acgcccgcgc gcgagcatga gtgattgtcc    105240
     tgcacgaagc ggatgcgccg ccccagttgc gcgtccaggc ggtcctggtt gaagctctcg    105300
     aagaagcagc cgcgctcgtc gccgaacacc tggggttcga tcagcacgac gtccgcgatg    105360
     gccaaggggg tgagtttcat gacgcctccg aattcttgcc tggcgggttt actgtaatcc    105420
     tggcgccggg cgcggcgcta cagggtatgc gcccgcgcgg ccagggcatc cacgaccgca    105480
     tccaggtcga cttgccagtc gggcagctcg ggctccaggg catcgcgtag cgcgccgcag    105540
     tccagccgcg aattggccgg ccgtggcgcc ggcagcgggt attgcgccgc cgtgacgggc    105600
     cggatgtgcg ccgggtccag gctcagcgcc agcccggcgc gccgggcccg cgccacgatg    105660
     tggcaggcca gcccgtgcca gctgacatgg ccgcccgcgc tcaggtgcca caggccgtcg    105720
     ggcaggcggc ggcgccggtg cgcatcgatc gcctgccagg tgacggcggc gatacggccc    105780
     gcccagatcg gggcgccgtg ctggtcggcg accacggaca gctcggcgcg ggtgcgcgcc    105840
     aggcgcagga tggtcttgac gaaattggcg ccatggctgg cgtagaccca gctggtgcgc    105900
     agtatcaggt gcgggcagcc gctggccgcg atggcctgtt cgccggccag cttggagcgg    105960
     ccgtaggcgt tcagcggatg tgcggcgtcg gtttcccggt aggcgcgggc gcgcttgccg    106020
     tcgaacacgt agtcggtgga atagtgcacc agcaatgcat tgttgcggcg cgcatagtcc    106080
     gccatgaccg ccaccgcctg ggcattgatg cgcagcgcca gctccggctc ggcctcggcg    106140
     cggtcgactt cggtataggc ggcggcgttg atcagtatgc gcggcgcgta ggcatcgagc    106200
     acggcggcca gccggcccag gtcgcgcagg tcggcctggc ggcggtccag cgcggccagc    106260
     cgcgcccatg ccggcgggtg cgccagcagc gcatcgccga tctgtccggt gcggcccagc    106320
     agcaggatgt tcatgtgccg taatgcgtat cgagccagtg gcgatacgcg ccgctggcga    106380
     tgtccgccac ccactgcgga tggtccaggt accagcgtac cgtctcgcgc aggcccgcct    106440
     cgaacgaggt cgcggcccgc cagccgagtt cgcgctgtat cttgccggcg tcgatcgcgt    106500
     agcgcctgtc gtggccgggc cgttcgggaa tgaaggcgat gccgccggca tgcggctgcc    106560
     catccgggcg ggcgcgccat tggtccagca gggcgcagac cgcgtgcacg acttccaggt    106620
     tggtgcgctc gcagtgcgcg ccgatgttgt aggtctgccc cggctggccg tcgcgcagca    106680
     cgcattccag cgccgcgcaa tggtcgacca cgtagagcca gtcgcgcacg tgcatgccgt    106740
     cgccatacag gggcagcgcg cggccggcca gcgcatggtg gatcaccagc gggatcagct    106800
     tctcggggaa ctggcgcggg ccatagttgt tgcagcagtg cgtggtgatg gcgggcagcc    106860
     cgtaggtgtg gcggtacgag cgcaccatgt ggtcgctggc cgccttgctg gccgaatacg    106920
     ggttgttcgg ctggtaggga tgggtttcgg tgaagggggc ggcctggggc gccagcgatc    106980
     cgtacacctc gtcggtggac acatgcagga agcggaaggc cgccgccgca gcggcgtcct    107040
     gttcggtgca ataggcgcgc gcggcctcca gcagggtgaa agtgcccacg acgttggtct    107100
     gcacgaaggc gtcgggggcc cggatggcgc ggtccacatg cgattcggcg gcgaaattga    107160
     cgatggcgcg gggccggtgt tcgcgcagca accggcgcac cagcggcgcg tcggcgatgt    107220
     cgccatgcac cagcagatgg cgcgggtcat cgcgcagtgc ggccaggttg gccgcgttgc    107280
     cggcgtaggt cagcaggtcc aggttgatca ccggctcatc gccgctggcc agccagccca    107340
     gcacgaaatt cgaaccgatg aagccggcgc cgccggtgac gagaatgctc atgcgccgat    107400
     tttacggccg gcatgccggc cgtggggcta gttgtgaact gtcaataggt tgtatttgtc    107460
     caggttgagt ctggagatgg gtacagcgcg cccgatgcct tggtggggtc gatgccagtt    107520
     gtagtggtgt agccaggatt tcatggcatc ggctcggtgt tgggagttct ggtaggtgtg    107580
     agcgtaagcc cactcacgca aggccgactg gatgaagcgt tcggccttgc cattggtctg    107640
     tgggcggtaa ggtcgggtaa agcggtgctt gatgcccagc tcatggcaca gcgcggcgaa    107700
     ggcgcggctg cgaaaggccg agccattgtc ggtgagcaag cgctggatgg tcacgcccag    107760
     gcgctggtag taggccactg cgtccttgag gaactggacg gcgctgggga agcgctcgtc    107820
     ggggtggatg tcggtgaagg ccacgcgggc gtggtcatcg atggccacga agacgaagtc    107880
     ccagccggcc ccctcaacgg tatcgcgtcg gttgcccgtg acccggtggc cagggcgctg    107940
     gatacgtccc agcttcttga tgtcgatgtg cagcagatcg ccgggggcct gatgctcgta    108000
     gcgcaccacc ggctcggccg gctccaggtc ggccaggtgc gacagaccgg cgcgggccag    108060
     gacgcggctg acggtgctgg ctgacacgcc cagcgcctga gcgatgcgcg cttgggtcag    108120
     ccgcttgcgg cgcagctcca cgatagccag cgccttggcc ggcgcaatcg ctcggggcga    108180
     gaccgtcggg cgcgaggacg catcggccaa gcccgcctgg ccctgagcca ggaagcggcc    108240
     cagccatttg cgcacagtcg gcgcggtgac cccataggcg cgggccgctt caggcacaca    108300
     aacttgatgg gcgatcaatt gctggaccat ttcgagtcga cgtaggaagg tcaatcgggc    108360
     atgcttatgg gtgttcatcc ggccgggctc cttgagtgaa ctgggggggt ggcgatttcc    108420
     agtttctcaa atccggttcg gatgaaccat gcatacaacc tattgaatct tcacagctag    108480
     cggctggcgg ttgccagccg cagcgccagg ccgatgaata ccagcccggc caggcggttg    108540
     agccagcgct gggcgcgcgc cgagcgctgc agcaagcggc cgaagccgcc cgagaacacg    108600
     gcgatcgcgc cgaacaccag cagcgtggcc agcatgaaga ccgcgcccag ctcgacgatc    108660
     tgccagccca tgggcccggc ctcgggccgc gtgaactggg gcaggaacgc gaagaagaac    108720
     aacagcacct tgggattggt gaggttcatg atgatgccgc gccggtacag cgcgccgcgc    108780
     gccagcggct cgggccgctg tccgccgccg ccgcccgcgg gcgcgcgcaa tacctgccag    108840
     gcgaggtagg ccaggtaggc ggcccccgcc agcttcagcg ccgtgaaggc ggccggcgag    108900
     gcggcgaata cggcggccag cctgaccgcc accgcggcgg tgtggccaag caggccggtg    108960
     catagcccca gcacgacgaa cagccccgcg gcccggcccc agatggccga ttgcatcagc    109020
     acgaacagat tgtccgggcc ggggcgtcag cgccagcagg acggcgatgc cgaaaaacgc    109080
     ggtcaaggtg tcgaaaggca gcatggtggc ggctcgaggg caagcgcccg cccgtggcgg    109140
     gccgtcactg gcatcatacg ggcaaacccg ctgccgcatg agctaattgc ccgcggtaat    109200
     gacggggtgc ggtacgcttc gcattcaaag gccggccgcc gccgccctcg tcccgcccgc    109260
     tacttgccta cccgaacatg accgacgaat cccgccacat cgacaccctg ctccagcacc    109320
     tgggcaccgc gcccttcgac cccgataccg gcgccgcccc ggtcaacctg ccgtcgatgc    109380
     gcgccagcac ggtgcgcttt cgtgacctgg ccgcgctgga acaggcgcag cgccgcaagg    109440
     ccggcggcga ccgggccgtg acctatggcc ggatgggcat ggatacgcat gcggcgctgg    109500
     aacacgtgtt caaggagctg gaagccggca cgcactgcta cctggcgtct tcgggcatgg    109560
     gcgccgtcac gatggcgttt ctgtcgctgc tgtcggccgg cgagcatgcg ctggtggccg    109620
     attgcgtcta tggcccggtc tacgaactgg acaacgcggt gctcaagcgc atgggtatcg    109680
     agctgacctt cttcgcgccc ggcgacgacc tgcaggcgct ggtgcgtccc aacacccgcc    109740
     tgctgtatgt cgagtcgccg gggtcgctgc tgttccagat gctggatctg cccgcgctgg    109800
     ccgagttcgc gcgccgcaac cagctggtgc tggccaccga caacacctgg ggctcgggct    109860
     acatctatcg cccgctggaa ctgggcgcgc aggtttcggt gatcgccggc accaagtacg    109920
     tgggcggcca ctccgacctg atgctgggcg cggtggttac caatgacgag gccgtggcgc    109980
     agcgcctgaa ccgcacgcag tacgccatgg gctactcggt cagcgccgac gatgcctggc    110040
     tggcgttgcg cggcgtgcgt acgctgccga tacgcatggc ccagcacgcg cgccacgccc    110100
     agcgcgtgtg cgagttcctg cagggccgtc ccgaggtcgc gcgcatctac catccggcct    110160
     ggcctcagga ccccggccac gcgctgtggc tgcgcgactg ctccggctcc aacggcatgc    110220
     tgacggtcga gctgcgcctg tcgcagcccg cggcgcgcgt gttcgtcgag tcgctgcagc    110280
     tgttcgacat cggcttctcg tggggcggct tcgaaagcct ggtgcagctg gtcacgcccg    110340
     gggagctggc ccgccaccgc tattggcagg gcggcggcaa tgcgctggtg cggctgcata    110400
     tcgggctgga gtcgcccgag gatgtcattg ccgacctgac ccaggcgctg gcgcgcgcag    110460
     cctcggcctg agaacggcgc ggccccatca acgacaaagc ctccgcatgg acggaggctt    110520
     tgtggcgtcg ggggcggccg gggccgccct gcctacttgc gggactggac gatgagctgg    110580
     tccaccacct tcagggcgcc ggcgtagtcg ttgccggcca gcacgggcga agtcatgtag    110640
     cggccgccca cggcaaaagc cggggtgcca tcgatatggg cggcctcggc cagctgggag    110700
     gcgtgctgca cctgcgtctg cacgctgaac gaatcgaata ccgaatcgaa cttggcgcgg    110760
     tccacgccct ggctggcggc ccattcgccc atggctttct tgtcgaacag gcgcttgcgc    110820
     tcggtgtgga tggcggtaaa gaccttggga tgcaggtcgg ggcgctcgag cgcctgcagc    110880
     gtgtagtaga gctgttgcag cggcttcatg ccggcgttga aggcgatggg cacctgcttg    110940
     agcaccacgt cctggggcgc ggtcttggcc cagtcctcga ccatgggttc gatggcggcg    111000
     cagtgcgggc aggtgtaggc gaagaactcc aggacttcga tcttgcccgg ggtgtcggac    111060
     ggcatcggcg ggttgatgtt cacgtactgc tgcgcgccct gggcctgggt ggcgggcgcg    111120
     aacagggtcg tcgcgcccag ggcggcggcg gccaggagac gggtaaacgt ggtcgactgc    111180
     atctcgaatt cctgagttaa agcgttacag actgcggatg ccgcggggaa gttccatggc    111240
     gattcattgt cgcaccaccg cggatttgat gtcgttctcg cccagcctgc tgcgggcgcg    111300
     attcatgtcg tccaggcgtc cgaatggacc gacgcgcacc cggttgacct gtacgccgtt    111360
     gacttcggcg cgctgcatga ccaccggcaa tcccagcagg atgatgcgcg cccgcagggc    111420
     ttcggcgtct tcgagcaccc gataggcgcc ggcctgcagg aaataggtgc cggatgccgg    111480
     cgcggccggc gttgcgctgg ccgcgggggc ggccggcttg gcggacttgg ccgccggggc    111540
     gggcgtggcg gcgggggcgg gagcgcggtc caggttgggc agggtggcga tcagcgcacc    111600
     caggtcgtcc ggttgcctgg acggcgcgcc gggcgttacg ccaggcagcg gcgacggcgc    111660
     ggtggcggtc ggtccggtgg gcggcgtgcc ggctgccccg tcccgtccgt acaacccctg    111720
     gttggggtcg ggcgcgttgc gcggatcggg cagcttgcct tggtcgggct ggcgggtggc    111780
     ccggtcgacg aacggcatgg gcgccttggt cacgtagaac gcgacagcgg cggcgacgat    111840
     caggccgatc agcaggccgg ccagcacacc gtacatggtg ctgccgcgct ccttggagcg    111900
     ccgggtcgat ttacgcttgg tggccatgtg cgggggttac atccggtccg gggccgagac    111960
     gcccagcagg gccaggccgt tggccagcac ctggcgcgtg gtcgcggcca gccgcaggcg    112020
     cgccagcttc agggctggtt cgtcgaccag cacccgttcg gcgttgtacc aggcgtggaa    112080
     gtcggaggcg caatcgcgca gccagaacgc cacgtggtgc ggcgccagct cttgcgcggc    112140
     cagcgccacc acctggggaa actcggccag gcgctgcagc agcgcgtatt cggacggcgc    112200
     ggtcagcagc gccgtgtcgg cctgcgcgat ctctgcggcg ctcgcgcccg aattgccgat    112260
     catggtgcag atgcgggcgt gcgcgtactg gatgtagtag accggattct cgtcgctctt    112320
     ggacagggcc aggtcgatgt cgaacacgaa ctccgtatcg gcgcggcgct ggatcaggaa    112380
     atagcgcacc gcgtcgcggc cgacccagtc gatcaggtcg cgcatggtga cgtagctgcc    112440
     ggcgcgcttg gaaatcttga cctcctcgcc gccgcgcatc accttgacca tcttgtgcag    112500
     cacgtaggcc gggaaatcct tggggatgcc ggccagcccc tgcaggccgg cgcgcacgcg    112560
     cgccacggtg ccgtggtggt cgctgccctg gatattgacc gcgtggtgaa agccgcgctc    112620
     ccacttgacc ttgtgatagg ccacgtcggg cacgaagtag gtatagccgc cctcgctctt    112680
     gcgcatcacg cggtctttgt cgtcgccggt gcccagctcg gtggtgcgca gccacagcgc    112740
     gccgccttcc tcgtaggtgt ggcccttggc gaccagcgtg tcgaccgttt cctggacgcg    112800
     gcccgaggcg tacaggctgc tttccaggaa gtagttgtcg aaggccaggc cgaaagcctg    112860
     caggtccagg tcctgctcgc ggcgcaggta agcgacggcg aaggcgcgga tatcgtccag    112920
     gctgtcgaga tcgccggtgg ccgtgaccgg ctgtccgtcg gaggcctgca ccgacttgcg    112980
     cgccgcgaaa tcgcgcgcga tttcgacgat gtagtcgccc ttgtagccgt cggcggggta    113040
     gtccggcgcg tccggcgcga tgccgcggcc gcgcgcctgc acgctgatgg ccaggttgtc    113100
     gatctggttg ccggcatcgt tgtagtagaa ctcgcgagtg acgtcccagc cgctggcgtc    113160
     atacaggcgg cagatggcat cgcccagcgc tgcctggcgg gcatggccga cgtgcagcgg    113220
     gccggtcggg ttggccgaga cgaactcgac cagtactttc tcgccattgc gcggcgcgcg    113280
     gccgtaggcg tcggcctggc tggccactgc ctgtaccacc gcctgccggg cagctggggt    113340
     gaggcggaaa ttgatgaagc ccgggccggc gatctcggca tcctggatca gttcgcgcgc    113400
     ctgcggctgc gccatcagcg catcgacgat gccctgggcc agctcgcgcg ggttgcggcg    113460
     cgccggcttg gccagctgca tggccacgtt ggtggcgata tcgccgtgcg ccgcgacctt    113520
     ggggcgctcg agctggactt gggcttgcgc ctcgggcagg cattgcgcga cggcggcctg    113580
     gatcagggaa atcagttgtt tttgttgctc gaggagcatg ggtaatcggc agaatggtaa    113640
     gtggcggcgg caggtctggc gcgccgcggg gcgggcggac ccgccgggcg gccgccctgg    113700
     cgtctggcgg aggtgtccgc gcaagcggga cggtcggcga cgcgggacgt accggcagtc    113760
     atgacggtca tggaagatgc ctagatcata gctgaattgg gctgcaatcc ggccgtccgg    113820
     gaccgcatcg gggtgtcggg ccgtgcagtt ggcagtccgc gcagcttgcg gtagtgtatg    113880
     aaattatccg tatgggagtc cgcaacatgc tcattacatt ccattccaag gtcgcggccg    113940
     aggttctcat gcgcaccgac gatgctgcgc ccctgctgcg cgccgccggc aagagctttc    114000
     gcgacgccat tccggagcgc ggcgtgttca ccgcggacca gctgcaatcg gccatcaccg    114060
     ggctggagcg cgccattgcc gccgccgatc gcagcccgcc cgacgatgac gagcctcatc    114120
     ccgacaagga gccggtgcat ccgatcgagc tcgccgtggg cctgcaccag cgcgcctttc    114180
     cgctgctgga catgatgagg aagactgccg cggccggggc cgacctgacc tgggaagtct    114240
     cgcgcggctg gtagcgcaat atcgcaagcc tgacattttc cgcgcgggtt cttgcgcata    114300
     ctgtgcgcag ggatgccccc gcgccaccac caggagatcc gtcgatgcgc agcgaagtga    114360
     ccgttgtttt cgatgcccgc cgcaccgtcg acctgagcgt cgacgtcgaa ccctcggtgc    114420
     aggcggccgc cgccgcgcgc gactggttcg acagtgcctg ggaaatgctc ggctgcgagc    114480
     cgctgcgccc cagcggcaag gtgctgttgc tggacaagat cctgggcgtg gccgatgcgc    114540
     tgggctacga caccctgtcg ggcgacgcca aggaaagccg cgagttcgcc gaacaggccg    114600
     cgctggccct gggcaaggcc cgcatcgtgg tggatctgcc cgggctgatg gtaggccatt    114660
     aaccataccc gggagcctgt ccccgcaggg ggactggctc ccgcaaactt ggggagcctg    114720
     tgtccgcagg gggactggca ccggccaaat ccgacctccg gtgccttgta tctttcctcc    114780
     ggtggtgatt agctatcacc accgcgcgcc gatgaccgcg agttggtgcc caaagcgagg    114840
     actttgtggg acagatagcg gctcggcagc gcactgctgg gccggcgaga cactggacgg    114900
     tatcgtaggg cgaggaccct gtatgtacaa ggcaagtggg cgcagtggct gatagcagtt    114960
     tgttatctgc aggaggccaa gtccatgttt tcataggtat tgatgtatca aaggccaagc    115020
     tggattgcac gttgctgacg gctgaggctg acaagtgtaa gaccaaggtg gtggtcaaca    115080
     ccgccgcggg cgtacaagcc ctgctggcgt ggtgcgccaa acacggcgca cagccggcgc    115140
     agttgcacgc catcctggag cctacgggtc tgtatcacga gcaagcggcc acggcgctgc    115200
     cccaggtccg ggtctctttg gtcaatcccg cccaggcccg ggactttgcc aaggccttgg    115260
     cgctgcgctc caaaaatgat gcgctcgaca gctacgtgct ggctcgctat ggacagacgc    115320
     tgagcccggc gctgtggcac ccggcgccct tgcatgcgcg tcaactgcgc gccttgttga    115380
     cgcgacgcga ggcgctgagc aaggatctgt tgcgtgagct caatcgcaaa gagaagagcc    115440
     agttcagccc ctcggcgccc ttggtcgatg gttccatcga caaggccatc gcgttcttgc    115500
     gcgaacagat caaacaaatc gagcgggcga tcgatcagca catcgacaac caccccgacc    115560
     tcaagcaaga ctgcgagctg ctgaactcca tccccgccat cgggcctcag gccggcaacg    115620
     ccatcctggc cgtcatgcac aatcggcata tcgactccgc ccagagcctg gccgcctatc    115680
     tcggggtggt ccctgtgcag cgccaatccg gcagcagtct gaacagctgc gcacgcctgt    115740
     ccaaagccgg cccctcccag gtgcgcgcca cgttatacat ggcggccctg gttgggaccc    115800
     gccacaaccc ccacatccgc gccctttacc agcgcctgct caaagcagga aaaagcaaaa    115860
     aggccgcgct gggcgcggcc atgagaaaac tggtgcatct gtgcttcggg gtcctcaaaa    115920
     accgcatccc ctaccagccc aattacgcca tgaatggttg actgccaaga cggtatctgt    115980
     cccccttccg gggacaggca cccatgctcc atccggggac aggcacccgt cctccttcag    116040
     cgtatccccg cgcgcatgaa cgattgcacg aactggcgct ggaacagcag gaagccgacc    116100
     agcagcggcg cggccgacag cagcgtggcg gcggtgatga ccgaccagtc gatgccctgg    116160
     tcggtcgacg agaacacctg caggccgacg gtgagcgggc gcgattcgac cgagttggtg    116220
     atgatcagcg gccacaggaa gttgttccag tggtggctga ccgataccag gccgtaggcc    116280
     acgtagatgg gacgcgccag cggcacatag actttcatga gcacttgcca ggggctggcg    116340
     ccctcgaccc gcgccgcttc ctccagttcg cgcggcacgg tcttgaaggt ctggcgcagc    116400
     aggaagatgc cgaaggccga ggcgaagtac ggcaagccga ccgcgaacac cgtatcgcgc    116460
     acccccagca ggctcatcga gcggtagttc tccaccagca gcacgtccgg catcaccatc    116520
     agctgcagca gcaccagcat gaacacgaag tcgcggccgc ggaactcgaa gcgcgcgaag    116580
     gcgtagcccg ccaacgtgga cagcaccagc tgcgcggcca gcaccatggt gaccagcagg    116640
     aaggtgttga gaaaatagcg cggaaacggc gcggcgttcc aggcacgcgc gaagttctcc    116700
     agcgtcagcg gggccagcag gtcgaagcgc gtggcgtagg ccggcggatg aaacgccgcc    116760
     caggccgcgt aggccagcgg cagtatccac agcaggccca gcagccaggc cccgagcgta    116820
     tccagcgtgc ggttcattga tagtgtgtcc tgcggtccag ccagcggaac ttgatgagcg    116880
     cggtggccgc cagcacggca agcagcacca cggtcagcgt ggccgcgtag gcggtgtccc    116940
     agaagctgaa accgacctga tagatgtaga acagcagcag cgtgctggca ttatcggggc    117000
     cgccgcgtgt catgaccacg acgtggtcga ccagccggaa cgcattgatc agggcgttga    117060
     ccagcacgaa cagcgtcgtg ggcatcagca gcggccacag cacgcgccgg aaatactgcc    117120
     agcgcgaggc gccttcgagc atggcggcct cgcgcagcga gggcgacacc gtctgcaggg    117180
     cggccaggta gaagatcatg aaaaagcccg actccttcca cacggtcacc atcatcaacg    117240
     ccggcaaggc ggtgtcgcgg ctgcccagcc agttggggcc ggccaggccg aaccactgca    117300
     tgacttgcgc aatcagtccg tactgcggcg tgtagaagaa cagccagata ttggccaccg    117360
     ccaccatggg cagcacggtg ggggtgaagt acgccatgcg caggaagccg cgaccgtgca    117420
     gcttgccgtt gacccacagc gccatggcca gcgcgatggc gatcgaggtc gggatcgtac    117480
     ccagcgcgaa ccacaggttg ttccacagcg actgccagaa caccgggtcg tcgcgcagca    117540
     gcgcgtagtt ctccagcccc acgaagcgcg ccggccggct gcccttggga gtggagaaga    117600
     agctgtgcca cagcgtggcc agcgccgggt agtgggtgaa ggcggccagc aggacgacgg    117660
     ctggcagcaa cagcagccag ccgtacaccg cttgcgtcgt gcggctcata cgctgcgcat    117720
     cacttgtacg agcgcagcac gcgatcggct tcgcgctgcg cgtccgtcag ggcctgctgc    117780
     ggcgtcttgg agccggtcag cgcggcctgc agcgcatcgt tgagcacctt ggtcacgcgt    117840
     tggttctcgt gggtggagaa ctcggccacg ctgacctcca gttggtcgcg cgccatcgtg    117900
     gctgccggca cttcctgggc gtacttcttc atgcgctcgg tctgccaggc ggcgggcgtc    117960
     accgccacgt aaccggtggc gatgctccag tcggcggcgc gctcgggcgt ggtggcccat    118020
     tgggcgaact tcagcgcggc ctgctgctgc gccggcgtgc cgctcttgaa gatgtagaag    118080
     ttgccgccgc cggtggggct gccgccgcgt tttttcttgg gcatcatcgc cacgccgaac    118140
     gggaagtcgg cgttcttgcg gatgttggtg agattgcccg tggtggtcca gacgatggcg    118200
     gctttcttct cgaggaagtc cttgggcgtg gtgccccagt cgatggtgcc cttgggcatg    118260
     acgccgtgct tgaccgacag atcctgccag aactgcgccg cctcgaccac ggccggcttg    118320
     tccaggtaca cctggctgcc ttcctcgttc atgaggatgg cgtcgttggg cgtggtcagc    118380
     gcctggaaca gccaataggc gaaggcgccg cccgacggga tcttgatgcc ccactgcgag    118440
     acgttgccgt tggcgtcctt cttggtcagc ttcttgccgt actcgaccag ttcgtcccag    118500
     gtggccggcg cgcgctcggg atccaggccg gcctccttga acaggtcctt gttgtagtac    118560
     atgacgatgg tcgagcgctg gaacggcacg ccccacacgt ggccgccggt gcggctgttc    118620
     tgcatgaagg cgtcgtagaa gccgcccagc catttcttgt cggcatcgct cttggccagg    118680
     ccgtcgacgg gcacgatggc gtcttcgtcg atcagcgtga acatgtcggt cgacagcagc    118740
     acggccagct gcggcggcgt gccgcccttc aacgcggtca acgccttggc gatcgaatcc    118800
     tggtaggtgc cggcgtagat cggcttgatg cggatatcgg gattttcctt gtggaaatcc    118860
     gccaccatgt cgtcgacgat cttggtgatg gggccgccca cggccaccgg atagtagaac    118920
     tcgacttcga cgggctgttg cgcctgcgcc ggcagcgcca ggaaggcacc ggccaggccg    118980
     gcggcgaggg ttttgagaac aatgcgtcgc atgggggctt tcctaaaaaa tcggcgcgct    119040
     gtgcgtccgg tggttcacag aaccgccgcg tcggcggcga agaaatgctg tcgttcgtcg    119100
     ggccaggcca ggccaaccgc cgtgcccggc gcgctgcgca ggtggccatt gacccgcacc    119160
     gccacgccgc cgcacgaacc caagcggcat accgccaccg aatcggcgcc gaaatattcc    119220
     acgctttcga tgacggccgg catgccgtcg gcatcgatgc ggatgtgttc gggccgcagg    119280
     cccagcgtga cggcgccggc cggcgcgttc gccagggccg gcccctgggt gccggcgacg    119340
     acgggccggc cgtcgtgcgt gtccagggcg atcaggttca tggggggcgt accgatgaag    119400
     cgcgccgcga attcggtggc cggccgcgcg tacaggccat ccggcgtatc gagctgctcg    119460
     atgcgcccgc cgcgcatcag caccacctgg tcggccatgc tcatggcctc ggtctggtcg    119520
     tgggtgacgt agaccatggt gatgccaagc tcctgctgca gcgcgcggat ttcgcgccgc    119580
     atgtcatggc gcagctgtgc gtccaggttc gacaggggct cgtccatcag gcataccggc    119640
     gcctccgaga ttaccgcgcg ccccagcgcc acgcgctgct gctggccgcc cgacaactgg    119700
     gccggcttgc ggtccagcaa ggcttgcagg cccagcagcc cggccacgcg cgcaagccgc    119760
     cgttcgtagt cgcgcgcggg ctccttgcgc accttcaggc cgaacaggat gttctcgcgc    119820
     acgctcaggt gcgggaacaa tgcgtacgac tggaacacca tcgagatgcg ccgcttggct    119880
     ggcggcaggt cggtgacgtc acggtcgccg atgcggatcc ggccggaggt gggcgtatcc    119940
     agcccggcga tcatgcgcag cgtggtcgac ttgccgcatc ccgagggacc gagcagaacc    120000
     gtgaagctgc cggccggcgc cgtgaagctg acgccggaga tcgccgcggc ttcgccgtat    120060
     tgcttggtaa ggtcgtccag aacgagatga gacatgccat ttcttgtttg ttgcgcggaa    120120
     gctcaattct ggccgcaaat gaaatccttt tcattctgcg gtgcaaacat gacgccgcca    120180
     tgtcagcggc ggcgcttgtt tcactcgtcg atcagttccc cgccctcgtg gaacggatac    120240
     ggccccggat agctctcgat ataggcatgg tgcgtcacga gcgcgccatc gcgccattcg    120300
     tgcaggtgaa agccgggcgg ttccatgacg aacgccgacg ggccgtcggg ccgcagatcc    120360
     agcgcgacct ggtgggccgg gctggggcag gtggaagcga tcgtgccgcc gaaacgctgg    120420
     aaaatggtgc ggtgcaaatg gccgcacatg atgcgttcga cgttggaatg gcgtgcgacc    120480
     agggcctcca gctcgggcgc gccggccagc aggccgatgg catccatgtg ggcgatgccg    120540
     gtgcgaaacg gcggatgatg catcacgatg acggtcggac ggccgggttg ttcggccagc    120600
     cgttgcgcca gccattgcag gcggcgttcg cacaatgcgc cgtggctttg ctgcggcacc    120660
     accgtgtcga gcacgatgaa gcgcagcggc tggtcctcga tggtgtattg cacgaactcg    120720
     ccggcctcgc gcaagtaagg gtgatcggcg aaggtggcgg caagctggac gcggtcgtca    120780
     tgattgccgg gcagtacatg gtaaggcacg cgcagcgcgt cgagcatctg cttgaggtgc    120840
     gcgtattcct gcgggcgccc gaagtcggtc aggtcgccgc tgacgatgac caggtccggc    120900
     gctggctcca ggcggttgag cgccgccacg gccggcggca ggtagcggtc ggtctcgacc    120960
     acgcgatagg ccttctggcc cggcatgcgg atgtgcaggt cgctgatttg ggcgataagc    121020
     atggcgttcg atgttccagg aaattcaatg ggccgccagc accacgctga cggactggcc    121080
     ggtctgatag gtgctgtcgg gcgccgcgat ggcggcgaac tgctagctgt gaactgtcaa    121140
     taggttgtat tcgtccaggt tgagtctgga gatgggtaca gcgcgcccga tgccttggtg    121200
     gggtcgatgc cagttgtagt ggtgtagcca ggatttcatg gcatcggctc ggtgttggga    121260
     gttctggtag gtgtgagcgt aagcccactc acgcaaggcc gactggatga agcgttcggc    121320
     cttgccattg gtctgtgggc ggtaaggtcg ggtaaagcgg tgcttgatgc ccagctcatg    121380
     gcacagcgcg gcgaaggcgc ggctgcgaaa ggccgagcca ttgtcggtga gcaagcgctg    121440
     gatggtcacg cccaggcgct ggtagtaggc cactgcgtcc ttgaggaact ggacggcgct    121500
     ggggaagcgc tcgtcggggt ggatgtcggt gaaggccacg cgggcgtggt catcgatggc    121560
     cacgaagacg aagtcccagc cggccccctc aacggtatcg cgtcggttgc ccgtgacccg    121620
     gtggccaggg cgctggatac gtcccagctt cttgatgtcg atgtgcagca gatcgccggg    121680
     ggcctgatgc tcgtagcgca ccaccggctc ggccggctcc aggtcggcca ggtgcgacag    121740
     accggcgcgg gccaggacgc ggctgacggt gctggctgac acgcccagcg cctgggcgat    121800
     gcgcgcttgg gtcagccgct tgcggcgcag ctccacgata gccagcgcct tggccggcgc    121860
     aatcgctcgg ggcgagaccg tcgggcgcga ggacgcatcg gccaagcccg cctggccctg    121920
     agccaggaag cggcccagcc atttgcgcac agtcggcgcg gtgaccccat aggcgcgggc    121980
     cgcttcaggc acacaaactt gatgggcgat caattgctgg accatttcga gtcgacgtag    122040
     gaaggtcaat cgggcatgct tatgggtgtt catccggccg ggctccttga gtgaactggg    122100
     gggtcggcga tttccagttt ctcaaatccg gttcggatga accatgcata caacctattg    122160
     aatcttcaca gctagccgtc gtcgaggccg atttcgtagc gtaccgagcc gcccaggaag    122220
     aagcgggcca gcacgcgagc gtgcagcgct ccgtcgcacg gcgcctgcag gcgggcgtga    122280
     tgcgggcgga atgccagcgg ttcgtcgccg gcaaccagca ggccgtcgcg cgtggccgcg    122340
     cggacgcggc acagcgtgcc caggaactcg ccgacgaatt cggtggcggg ctcgcggtac    122400
     agcgtttcgg catggccgat ctgttccagc cggcccgccg acatgaccgc gatgcgatcg    122460
     cccagcatca tggcctcgtc ctggtcatgc gtgacgatga tggtggtgat gtccaggccg    122520
     cgcagcatct gcgccagttc gacgcgcagg tgctcgcgca gcttggcatc cagcgcggtc    122580
     aggggttcgt ccagcagcag cacgcgcggc tcgatggcca gcgcgcgcgc cagcgccacg    122640
     cgctggcgct ggccgccgga aagctgcgag atgcggcgtc cggccagggc ctgcagctgt    122700
     accagttcca gcatctgccg cacgcgcgcc gtgcgcgccg cctcggccat gccgcgtacg    122760
     cgtaggccat agccgacgtt gtcggccacc gtcatgttgg gaaacagcgc atagctctgg    122820
     aacaccacgc caactccccg cgcttccggg gcgagcgcgg tgacgtcttc gtcgccatag    122880
     aggatgcggg tgccggcgtc gggctgctcc aggccgcaga tcagccgcag cagcgtggtc    122940
     ttgccacagc ccgagggccc cagcagtgcg agaatctcgc cgcccggaat gtgcaggtcc    123000
     agcgcctgca gcgcgcgcga gccgcccggc caggtcttgg cgcagttttc cagcgtgatc    123060
     gatacagagg cgctcatgtt gcggtcttct cgttggtaat gggagcattg gcggcattgc    123120
     gttcgccgcg ggcggccagc cattgcaggc cgaccagcag cggcatcagc atcagcagga    123180
     acaccagggt ataagccgag gcgatctcca gccgcatgga cgcatagctg tcggccaggc    123240
     cgaccggcag cgtcttggtc aacggcgtgt gcaacagcca ggtgagattg aattcgccga    123300
     tcgacagcgt cagcacggtc agcgcgccgg tcacgatacc cggcgccgcg ttgggcacga    123360
     ccacggtcag gaagcggcgc agccgcgacg cgccgagcgt ggcggctgcc tcgtccagcg    123420
     tggcgagatc ggcgccggcc atgctggcgc gggtggcccg caccatgaag ggcagcgtga    123480
     aaagcacgtg gccgatcacg atgaaccaga tgctgccgcg caggccgctg accgtgcccc    123540
     aggacacgat cagcgccagc gccgaggcca gccccggcac ggccaccggc agggtcagca    123600
     gttcctcgag cgcgcgcgcc atccggccgt ggtgcagcgt caggacccag gccgccggca    123660
     ccccggtcag cgtacagacc aacagggtca gcagcgccac ggcgaacgag cgccagatcg    123720
     tatcggcgta cagatcccag acttcgatca cccagcgcag ggtcaggccg ctttccaggc    123780
     ccacgaagta gttgcgcgtc aggccggcca gcacggacag caccaccggg ccgatcagga    123840
     acgcggccac cgccagcgtg acggtcaggc ccaggcgggc gtcggtcttg gaatacatcg    123900
     cggacatgcc ggcctccctc aagcgcccgc gccggcgcgc gcgccggcca ggctgtgcgc    123960
     ggcatacagc accgcccagg ttgccaggcc cagcacgatg gacagcgccg ccgccaccgg    124020
     aatattggcg tagttggtga attcgttata gatcgtcaaa ggcagcacgt cgatctgcgt    124080
     ggccagcgtg aacgccgtgc cgaaggcccc atgctggtgg cgaagctcat ggcgccggcg    124140
     cccagcagcg cgggcgtgag cgcgggcagc tcgatatcga cgaagcggcg ccacggccgc    124200
     gcgcccagcg tgcgggccgc ctccagcagg ctgacgtcga tctgctgcgc cgccgcggaa    124260
     atcatgccga tggtgcgcgg cagcgaaaaa tacaggtagc ccaggaacag cccgcccatg    124320
     ccgtaggcga acaccatggg ctcgccggtc atccattcgg tcagcgagcc gatgacgccc    124380
     tggcggccgg ccagcaggat gatcaggaaa cccaccacca cgccgggaaa cgccagcggg    124440
     aacatcagca gcgcgaccag cgcgcggcgt ccggggaact cgcggtgcca ggccaggaag    124500
     cggccgatcg gcagcgacag caacagcgtg gccagcgtgg ccagcgtggc gaccagcgac    124560
     agcgccacgg tattgaacag gctgcgccag tactgcgggc tggtgaccac gatgtaatac    124620
     gccgagtggc cttcctcgac ggtggcgccg gtcagcacca ggctggccat gggcagcagc    124680
     cagaaggcca ggaacagcgc cgcggccggc gcagcgaaca acagccatcc gcggcgctgc    124740
     atatcaattc acctctttgg cgtagcgttc ggagaagccg cgctgggcca ccgacatctt    124800
     cacgtagtcc accgtaccgg cgcgcgcgta ttcgctggcg ggcaggaact tcttctgcgc    124860
     ctcggccgag atcgcctcgg cacggaccgg gcgcaggaag gcattggccc agatggcctg    124920
     tccgcgttcg gacagcgtga aatccagcac cttgcggccg ttgtccgcat gcggcgcgtt    124980
     ggccaccagg ctcatcacgt acgggacggc gatggttcct tcggccggga tgacgaagtc    125040
     gacgttggcc tcgtccttgt acttggcgcg ataggcgttg aagtcatagt cgatcaggat    125100
     cgggatttcg cccgacagca cgcgcgcata ggcggtctgc ttgggcacga tgggccggtt    125160
     ggcgcgcatc ttcttgaacc agtcgatggc gggatcgaag ttgtccagcg tgccgcccag    125220
     cgcgcggttc agcgccacgg cgccgacata gccgacgaag gccgaggccg gatccaggta    125280
     gcccaccatg ccgcggtact cgggcttttg caggtcggcc cacgacttgg gcaccggctt    125340
     gccgcgcaag gcgtcgacat tgaccatgaa gcccagtgtg ccggagtgga tggcgaacca    125400
     tttgccgtcg ggatccttca tgccgtcggg gattgcgtcc caatgcgccg gcttgtagct    125460
     ttgcaccagc ccgtccttgt cggcctggat gccgaacgtg acgccgtagt acaccacgtc    125520
     ggccaccggg ttggcctttt cggcggcgat cgacgccaat gcctgccccg agttcttgtt    125580
     gtcgccgggc accgtaatgc cggtggcctc cttgatggcc ttgagctggg tggcccagtc    125640
     ggcccattcg ggcggacagt tgtagcagat ggcgttctgc gcctgggcgg cgccggcgcc    125700
     gatcgccaac gccagcagcg tgccgcgcaa cgcggcctgg atgatgcgtt tcatggtgag    125760
     ggttcctctt cggggcgtgg ggcggcggcg acggtgccgc cagggaagat gcgatagggc    125820
     aggcgcgccg attcgatcgg cacgccctgt tccatgtggg ccagcaggcg ggcgcacgcg    125880
     gccgcgccga tgtcgcggct cggttgcgcg acggtgcaca gcgtgggcac catcaatgcg    125940
     ccgatcgcca cgccgtcgaa gccgcacacc gagatgtcgc gcggcacgcg caggcccagt    126000
     tcgaccagat gcgcgatgac ggccgtggcc agcagatcgt tggagcagaa cagcgcggta    126060
     ggggcatggg cggcctgcac ggcctgctgc agggtggaca ggttcgaggc ggtgtgcgtg    126120
     ggcatggcca ggtgcgccac aggttccagc cccagcgtgc gggccgcggc gcgcgccttc    126180
     gaggcggcgc cgcgcccggt ccgaggcggc cagcggcccg gtcaccagcg cgatgcggcg    126240
     gtgtcccaga tcggccaggc gttgcaccat gtcgcgcgcg gcggcgcggt tgtcgaccga    126300
     cacaaaaggg tgcgaccccg attcgttata ggccagcaca tgcggcacct gcgcctgttc    126360
     gagggcttgc agcgtggcat tgcgggcagg gttgccgacg gtcaggatca ggccgtcgat    126420
     ctggtggtcg atcagcgcct gcacggcgtc ggcctcgatc gcgggctggt agttggtcgt    126480
     cgccatcatg acgctgtagc cggcgcggcg tgcatactgt tcggcgccct cgaagcaatc    126540
     ggcgaatacc gggttggtca gcgtgagcag cagcaggccg atggtgcgcg agcggccggc    126600
     gcgcaggctg cggcccacgc ggttgggccg aaagccgctg cgttgcgcga ccgcttcgat    126660
     atgcgcgagc gtatcgggct tgagcagcgc gggctggttg aaggcgcgcg ataccgtggc    126720
     gggcgatctc gatgatagat ggtcggcctg gcggcttgcg gctcacagcg tgcctcgcga    126780
     ggaattgtca cgatgaaaac gatttcattc taggcatgca gcatgacaac gatgtgtcac    126840
     ggcgccacct tagtcgaaat ttcccaaagc gccaacgaca ttgcatcgtg cagtgccgca    126900
     agttttgcgc catgcgccgg gttgcttcta cactcgaagc gcggcgcgcg cgttccgaaa    126960
     acaaatattg cggcgccgcg catattgcaa tccgagtcgt gcataaagac atcattgggg    127020
     aatggggaaa gcgatgaacc tgaatcgcat cagcgcgtcc gaggccgcgc gcctgctgaa    127080
     tcggcgcgac ctgacggccg agcaattggc gcgggcctgt ctggctcgca tcgagcagcg    127140
     cgagccggag gtccaggcct ggaccgcgct gcgtccggac gccgtgctgg ccgccgcgcg    127200
     cgaactcgac cgtggtccga tacgcggcgt gctgcacggc ctgccgctgg gcgtgaagga    127260
     tatgttcgac acagccgatc tgcccaccgc ctatgggtcc ggcatctacc aatcgcatca    127320
     gccgcgcgcc gacgccgccg cggtcgcgct gtgccgcgac gcgggcgcgt tggtgctggg    127380
     caagaccgcc accaccgagt tcgccaccta ccaccccggc cccacgcgca atccgcgcaa    127440
     cacggcctat acgccgggcg gctcgtccag cgggtcggcc gcggccgtgg ccgacgacat    127500
     ggtgccgctg gcgctgggca cgcaaactgc cggctcggtg atacggccgg ccgcgtactg    127560
     cggcgtggtg ggctacaagc ccagtttcgg acgcatttcg cgcgccggcc tgaaatcgct    127620
     ggccgaaacg ctcgataccg tcggcatgtt cgcgcgcagc gtcgacgacg tggccttgct    127680
     ggcctcggcc ttgatgcgcg acgcgcggct gcgcgaattg cgctatgacg gcaccccgcg    127740
     cgtggccatg ttccgcagcc cgcaatggcg ccataccctg cccgaaacgc gtccagcgtt    127800
     cgagcgcgcc gcgcgcgcgc tttcgcaggc gggcgccgtc gtggaggaac tggcgccgcc    127860
     gcccaacgag gattgcgggc tggcgcagct gcatagcgat gtgatggcct acgaggccgc    127920
     gcaggcgctg gctttcgaac gcatccacta cccatcgcaa ctgagcacca agctggcggc    127980
     gatgctggag gccggcgccg cgctgaccgc cgagcaatac ctggcccacc tggcgcaggc    128040
     ggggcaggcg cgcgcgaaag tggccgaatg gctgcagcgc tacgacgtgc tgctggcgcc    128100
     cagcgctacc ggcgatccgc tgttctgccg ggcctggacc ttgttcggcg taccgtgcgt    128160
     gcacctgccg ttcgcgcaag ggccgcaagg cttgccggtg gggttgcagg tcgtgggagg    128220
     gtttcgcgac gaccagcgcc tgctggcgat cgcgcgctgg atgaatggcg tgctggcggc    128280
     ggattgacgc tgccggggta gcgggtgccg gtccccgcac ggggagcgac tcctgcggca    128340
     agggtgcctg tccccgcggg gacaggcacc cgaggggtta cgcggcgacg gcttcggttt    128400
     cggtggcttg cgtagcggcg acgtgatggc ggttgacggc gcccagcaca gccttgaagg    128460
     aggcagtgac gatgtcgcgg tcgatgccta cgccgaagcc ggtgggcgaa tcgccaacgc    128520
     gcacttccac gtagcaggcg gcgcgggtgt cggtgccgat ggcgtgctcg tggtagtcca    128580
     tgatgcgcac aggcacgtcc agcgccgcca cgaaggccga gatcgcgccg tcgccgctac    128640
     ccttcacgat gcggcgctcg ccgttgaagc tgagttcggc ctcgatgctg aagtgcttgc    128700
     cctcgccggc cgacggatcg ccgtcgatac ggtggcggac cagctgccag ggctgctgct    128760
     gcgccaggta ttcgctgtcg aagatcgtgt agacgtcgtc cgaggatacc tcgcggccgg    128820
     tttcgtcggt aacgcgctgg atggcgcggc tgaattcgat ctgcaggcgg cgcggcaaga    128880
     ccaggccgtg ctcctgttcg agcaggtagg acaccccgcc cttgcccgac tggctgttga    128940
     cgcggatgac ggcgtcatag ctgcggccca ggtcggcagg gtcgatcggc aggtaaggca    129000
     cttcccaggg agcgtcggcc tgctgttgcg cgaagccctt cttgatggcg tcctggtgcg    129060
     agccggagaa tgccgtgaag accaggtcgc ccgcgtacgg atggcgcgga tggaccggca    129120
     actggttgca gtactcggcg cagcggcgca cttcgtcgat gtcggagaag tccaggccgg    129180
     ggtgcacgcc ctgcgtatag aggttgagcg ccagcgtgac caggtcgacg ttgccggtgc    129240
     gctcgccgct gccgaacagg cagccctcga tgcggtcggc gccggccatc acggcgaatt    129300
     cggcggccgc cacggcggtg ccgcggtcat tgtgcgggtg cacgctcaac acgatgctgt    129360
     cgcggcgcgc gaggttcttg tgcatccact cgatctggtc ggcgtacatg ttgggcgaag    129420
     tcgcctcgat ggtggccggc aggttgagca ccatcttgcg ctggggcgtg gcgtcccatt    129480
     cgtcggccac cgcgttggag acgtcgagcg cgaattcggg ctcggtggtg ctgaagactt    129540
     cgggcgagta ctcgtagcgc cattgcgttt gcgggtactt cgccatgtac tgcttgacca    129600
     tgcgcgtgcc ggtgaccgcg atgttcttga tttcgtcgcg gctcatgttg aacacgatct    129660
     tgcggaaagc cggagcgcag gcgttgtaca ggtggatcat ggcctgcctg gcgccggcgg    129720
     cggcctcgac ggtgcggctg atgagatctt cgcgcgactg ggtcaggacg atgatggtga    129780
     cgtcgtccgg gatgcgcttt tcatcgatca gcttgcgcac gaagtcgaag tcggtttgcg    129840
     acgccgacgg gaagcccact tcgatttcct tgaagccgat cttcaccagc tgctcgaaaa    129900
     aacgcacctt gcgttcgacg ctcatgggct cgatcagcga ctggttgccg tcgcgcaagt    129960
     cggtgctcat ccagatgggc ggctgggtga tgcggcggct gggccaggtg cgctcggcga    130020
     agtcgcgcgc aaagggttgg aacggtacgt atttggtggc ggggttggcg agcatcatca    130080
     gtacacctcg atcggtttct tgtgaatccc gtagagccag cggtaatgac gtcggccatg    130140
     gtgacggccg cgcatggggc tggcccactg cattgcgttg gtcgtttcgc gggcagtttg    130200
     gccgtaaatc ggccggattc agtttaataa aacgggggaa aacgcgtgtg gcgagcgtac    130260
     ggctgccgag ctaccacggg gcactaggcc cggcaaccga tcggtaggcg tagtagcgat    130320
     agggcggtgg gggacaccgc gaggcgcagg ccggccacgg ccgcattgga gcggtcgtag    130380
     gcaatcgcga ggaaggtgcg ttgggcggcc ataacctata gtcaaacaca tttcccggcg    130440
     cagcgcaaat gtaaacggcg cgccagggcg cgccgtcagg ccggtccggg atgcgcccag    130500
     gcgctcagcg cgccggcccg atatgcggct cggcgagcct gggctcgacc gcgcgcggtt    130560
     cggtaatccg cggctcggca tggcgcgccg cgcagtggcg ctcgtcgggg cccggccggt    130620
     gcgccggcgc atccaggatg ccggattgct cgcgcaccag cgcgatcttg ccgatgtggt    130680
     tatgccgcag ttcggtgtgg gcgcgttgca gatcgcccac ggtgagcggt tcttcgcgct    130740
     cgccccacac ccagcgcagc acgtccagga cctccggcga gagccgcggc gccaggtcgg    130800
     acagcacgtc ggtggggacc acggcggcgc ggccggcggc gatgctggat cccagccagg    130860
     cgcgtatgga gaaaaacacg atcagcgacc agatcgccac cacgccccac cagaagtagg    130920
     ggttgacgcg ggtcagcatg tcgacggcct gctggcccag ggcatgcatg ccctcgaacg    130980
     acagcgactt gccgaaggcc agcagccagg cggccacgag cagccagatg acggcggcga    131040
     tggcgaccac cacgacccgg aatatcaggc gggggagcgc cagtttcaac aaggcctggc    131100
     cgatcaggcg gccgtcctgg cggatgcgtt cgggcgaagt gggattcatc atgcaaaata    131160
     ttgtacctat gactcgtccc gcgctagaac ttcgtcctgg tcaacatttg acgttgaccc    131220
     ctcaactgca acagtcgatc cggctgttgc agctgtcgtc gctggagctg gaggccgaac    131280
     tgtcgcaggc gctggccgag aatccgttgc tggaacgcga cgaagatccg gcgcgcgagg    131340
     agcaggccga ccccgagcgc gaggcctcgg tcgaggccga cgaggcgccg gataccgaac    131400
     tgcgcctgga cgagatgccc ggttcgggcg gcgttcttcc cgacgacgac agcgacctgc    131460
     cgcaggcggc gcgcccggat accctgcgcg aacacctgct ggggcagctg gcgctgacgc    131520
     gcgccgcgcc gcgcgatgcg gcgctgtgcg gtctgctgat cgacgaactg gacgagaacg    131580
     gctacctgga ttcgcccctg gaagagatcc tgacctggct gccggccgag gtgcaggccg    131640
     acctggacga gctgcgcgcg gcgctggcat tgctgcagtc gttcgatccg gcaggcatcg    131700
     gcgcgcgcga catggccgaa tgcctgcagc tgcagttgcg ccagcccgat ccggcgcgcc    131760
     tgcccgaggc ggccgatgcc gaggtgctgg cctgtgcgcg gcgcatctgc gcgcagcatc    131820
     tgcccttgct ggccaccggc aacgtggccc gcgtgcgcga ggccgtgcaa tgcgacgagg    131880
     cggtcgtgcg cgccgcgcat gcgctgatcc cgcgcctgga accgcggccg ggccgcgcct    131940
     ggacggtgcc ggcggccgat tacgccattc ccgacgtgat cgtgcgccgt acccgccagg    132000
     gctggcaggc ggtgctcaac agcgccgtcg tgccgcggct gcatgtcaat gccgtctatg    132060
     cgcaagtgct gggcggccag cgccagggcg gcaacgccgg cctgcaggcg cagctgcaac    132120
     aggcgcgctg gatgatacgc aacgtggagc agcgcttcga caccatcctg cgcgtggcgc    132180
     aggcgatcgt ggcgcatcag caggcgttct tcacccaggg gccggcggcc atgcggccgc    132240
     tgatcctcaa ggacatcgcc ggcgaactgg atctgcacga atcgaccatt tcgcgcgcga    132300
     cgacgcagaa gtacatgctc acaccgttcg gtacgctgga gctcaagcgc ttctttggcg    132360
     cgggcgtgtc caccgatggc ggagacgcca cctcggccac cgcggtgcag gcggtgatcc    132420
     gccagatggt ggccgacgag gatcgcgcca agcccttgtc ggacagccag atcatgcagc    132480
     gcctggccga ccagggcatc gtcattgccc gccgcacggt ggccaagtac cgcgaggcgc    132540
     tgcggattgc gccagcgacg ctgcgcaagg cccacgccgc gggtcgttag gacgcctcct    132600
     aatttgttcc tgatttcagg tagttagctg tgggattcgt tgcaaatttg ccgctcggag    132660
     cagcttgcgc gtgacagaat aattgccgat aattgttctc atgtacattt gcatatgtaa    132720
     tgccgttacc gaacgccaag tccgcgcctg cgtggacgcg ggcgcggcta cgctgggcga    132780
     tctccagttc gaactgggcg tggccacgtg ctgcggctgc tgcgcggcaa ccgccaccga    132840
     gtacctgccc ggcgggcggg cctcgagcgt gtgcgaagtg cggtcggtcg ccgttccggt    132900
     caacccgccc gcggcgctcg agcccgtagg cacgccccaa ccggcggcca acggctttcc    132960
     gattcccctc gtcgccgtcg cctgagcgac gcggcgcctt gcgccagccg gctcatgctg    133020
     cctggcgcaa tttatcgtcc ccacagaagt ccatgatcag gcgggccagt tcgtgcaccg    133080
     cccgcgagcc cgtatcgctc atgcacagcg ccagctcgct gggcgccggg cgcggcagca    133140
     aggcgtcgca gcgcgccatt gcgggcgtct gacagcgctg ctccagcaag gccacgccca    133200
     atccgccctc caccgccgcc tgcagccctg acaggttggg actttcgtat gcgatgcgcc    133260
     agcgccggcc ggcgctctcc agcgcatgga tggcgcggtt gcggtactgg cagccctgcg    133320
     ggaacgcgac cagggcaatc gggtcgggca gcgtggcggg gccgccggcc gcgcacagcc    133380
     agtgcaggcg ctcgggccac gccgcccggc tcgggccggc gccgggctca cgcttgagca    133440
     ggaccaggtc cagttcgccg cgggcctggg cccggtgcag gttggcgctg agatcgcagc    133500
     gcatcgacag ccgtacctgc ggatgccggc gggcgaagtc ggccaccatg tgcgtcagcc    133560
     gggtgaccgc caggtcgtcg ggcaggccca gccgcacgac ctccagccgc cgctcgccgc    133620
     tgaccacctc gcggatttcg ttggaaagcg ccagcatgcg ccgcgcatag cccagcagcc    133680
     gctcgccgtc ctcggtcagc cgcacgccgc gcccttcgcg gatgaacagc gcacatccca    133740
     gcgcgtcttc cagcttgcgg atctgctggc tgacggtcga ttgggtgcgg tgcacgcgtt    133800
     cgcccgcacg ggtgaagccg ccggcgtcga cgacggaaac aaagctgtgc agcaggtcca    133860
     ggtccacggc ggttcgctcc ggaaaatgca tcggtttttc aaatactttt gatccaaata    133920
     aagaatttgt caatggatcg ggccgctcgc agaatgcagg ctagggtcgc cgctggcggc    133980
     cggcaacggg aagccatcat gaagaccaca tcggccgcgg cagcggcagg cgcctggcgc    134040
     ggcgcgccgg accgcgcggc cacgccctgg ggcgccatcg ccgtgttctg cctcttgtgg    134100
     agttcggcct ttgccgcggc caagatcgcc gtgcacgatg gcccgccact ggtgttgctg    134160
     agcgcgcgct tcctgcttgc cggcgtgctg ctgctggcgg tggcgcgcct gggcgcggga    134220
     tggcgcccgc ccgcgccgcg cgagctggcc gtgctggcac tgctgggcgt gctcaacaat    134280
     gcgctctacc tggggttgag ctggacgggc ttgaccaccg tgtcatcggc cttcatggcg    134340
     gtgctgatca gcaccaatcc cttgttgatc ggcattctgg ccggaccggt gctgggcgag    134400
     cggcttggct ggcgcaagct ggcgggcctg tgcctggggc tgctgggcgt ggcgctggtg    134460
     ttgcgttcgc gcctgtccgg catgcacgaa gacctgcacg gcaccctgct ggccggcggc    134520
     gcgctgctcg cgctggtcgc cggaacgtgc tgtacaagcg catggcgcca gccgccggcc    134580
     tgtggacggc aaccggcgtg cagtcgctgg caggcgggct ggcgctgctg ccagtggcgc    134640
     tgagcctgga aagcgtggcg gacgtgcgcc tgacggtggg cctggtcggc agcatggcct    134700
     acatggtcgt ggcggtgtcg atgggtggtt actacctgtg gttcctgatc ctcggccgcg    134760
     ccagcgctac gtcggccagc gccctgcatt tcctgatgcc acccctgggc ctgctgttcg    134820
     gctgggcctt gctgggcgag ccggtctcgc gcctggacct gctgggtatc gtgccgattg    134880
     cgctggggat ctggcttgcg acacggcgcg ggcgggcccc gggctgattt gtggccgcgc    134940
     gccaacggcg cgcgcgagcg atcgtgcgcc atgcgcgggc accgcattcg ggcgggcccg    135000
     cggcgcgcgc cacggcgcaa ttcgcggcgc gcatggcgcc gcaagccgca tcaggcatgg    135060
     cgcatgcatg cggcctgtcg aatacgcata ctcattctca ttgtcttgac gctttcagat    135120
     tgcgcttgca tcgctgttca tcaaatgcgc tcttgggcta gctgtgaact gtcaataggt    135180
     tgtattcgtc caggttgagt ctggagatgg gtacagcgcg cccgatgcct tggtggggtc    135240
     gatgccagtt gtagtggtgt agccaggatt tcatggcatc ggctcggtgt tgggagttct    135300
     ggtaggtgtg agcgtaagcc cactcacgca aggccgactg gatgaagcgt tcggccttgc    135360
     cattggtctg tgggcggtaa ggtcgggtaa agcggtgctt gatgcccagc tcatggcaca    135420
     gcgcggcgaa ggcgcggctg cgaaaggccg agccattgtc ggtgagcaag cgctggatgg    135480
     tcacgcccag gcgctggtag taggccactg cgtccttgag gaactggacg gcgctgggga    135540
     agcgctcgtc ggggtggatg tcggtgaagg ccacgcgggc gtggtcatcg atggccacga    135600
     agacgaagtc ccagccggcc ccctcaacgg tatcgcgtcg gttgcccgtg acccggtggc    135660
     cagggcgctg gatacgtccc agcttcttga tgtcgatgtg cagcagatcg ccgggggcct    135720
     gatgctcgta gcgcaccacc ggctcggccg gctccaggtc ggccaggtgc gacagaccgg    135780
     cgcgggccag gacgcggctg acggtgctgg ctgacacgcc cagcgcctgg gcgatgcgcg    135840
     cttgggtcag ccgcttgcgg cgcagctcca cgatagccag cgccttggcc ggcgcaatcg    135900
     ctcggggcga gaccgtcggg cgcgaggacg catcggccaa gcccgcctgg ccctgagcca    135960
     ggaagcggcc cagccatttg cgcacagtcg gcgcggtgac cccataggcg cgggccgctt    136020
     caggcacaca aacttgatgg gcgatcaatt gctggaccat ttcgagtcga cgtaggaagg    136080
     tcaatcgggc atgcttatgg gtgttcatcc ggccgggctc cttgagtgaa ctggggggtt    136140
     ggcgatttcc agtttctcaa atccggttcg gatgaaccat gcatacaacc tattgaatct    136200
     tcacaggtag ccgacggttt tcgcgccaat tcgtacatga tcggcgccac cgttccgctg    136260
     ggccgctcgt cggtgttcgg ctcatggcaa cgcgccacgc ccagcaacga caagctgacc    136320
     ggcgacgacg ccacgttcaa cgtctacagc ctgggctaca cgtacgactt caccaagcgc    136380
     accaacctgt acgcctacgc ctcgtacggc aagaactatg cattccagcg cgacgccaag    136440
     gacacggccg tggcgatggg gatcagacac agattctgat actcgggtgc ctgtccccgc    136500
     ggggacaggc acctcctccc cccggcctac aggaacagcc tgtacgccgg gttgtccgtt    136560
     tcgttccagt gcgggtagcc cagttcggcg acgaaggtct tgaacagttt cttgtcggtg    136620
     ggcggaacct ggatgccgat caggatgttg ccgtagtcgg cgccctggtt acggtagtgg    136680
     aacaggctga tgttccagtc ggggttcatg gcgttgagaa agcgcatcaa cgcgcccggg    136740
     cgctcgggga attcgaagcg gtagagcagt tcgttgcgcg ccagcgccga atggccgccg    136800
     accatgtggc gcaggtgcgt cttggccagt tcgtcgtgcg tcaggtccag ggtgtcgaag    136860
     ccgtgccggc ggaagttggc ggcgatcttt tccggctcgg ctggcgtgga gacctgcacg    136920
     cccacgaaga cgtgcgcacg ctcggcatcg gagatgcggt agttgaactc ggtgacgctg    136980
     cggttgccga ccagctcgca gaagcggcgg aagctgccgc gctgctcggg catggtgacg    137040
     gcgaacaccg cctcgcgcat ttcgcccact tcggcgcgct cggccacgaa gcgcagccgg    137100
     tcgaaattca tgttggcgcc gcatgccacc gcgaccaggg tcttgccctt gagcttgtgc    137160
     tcggccgcgt actgcttggc gccggccacc gccatggcgc cggcgggctc cagcacgctg    137220
     cgggtgtcct ggaacacgtc cttgatggcc gcgcagatcg cgtcggtatt gaccaccacg    137280
     aagtcgtcca cgtactggcg cgccagccgg aacgtttcgg cgcccaccag cttgacggcc    137340
     gtgccgtccg agaacaggcc gacatcgctg agctgcacgc gccggccggc gcgtacgctg    137400
     cggaccattg cgtcggagtc ttcggtctgc acgccgatga tcttgatttc cggccgcaac    137460
     tgcttgatgt aggcggccac gccggcgatc aggccgccgc cgccgatggc cacgaagatc    137520
     gcctcgatct cgcccggatg ctggcgcagg atttccatgc cgatggtgcc ctggccggcg    137580
     atcacgtcgg gatcgtcgaa gggatgcacg aaggtcagct tttcgcgctt ttccagttgc    137640
     tgcgcgtgtt cgtaggcgtc ggtgaagctg tcgccggcca gcacgacctc gccgccgagc    137700
     cggcgcacgg cgtcgacctt gacctgcggg ctggtggtgg gcatgacgat gaccgcgcgg    137760
     cagcccagcc tggtggccgc cagggccacg ccctgggcat ggttgcccgc cgaggcggcg    137820
     atcacgccgc ggctgcgcgc cgccggcgtc aggttggcca tcttgttgta ggcgccgcgc    137880
     agcttgaagc tgaataccgc ctgggtgtcc tcgcgcttga gcagcacgtt gttcgcgatg    137940
     cgctgcgaca gcaggggcgc gcgctccagc ggcgattcga cggcgacgtc gtagaccttg    138000
     gaggtcagga tgcgtttgag gtagtcggtg gacatggcgg gacggcggcg cgggaaaaaa    138060
     aggcgtcggg cagattacca cagggacatc cggggcgact ggccctacac taccggccat    138120
     catggaacaa agcctgctcg atgccgttca ttggctgctc gctctcctgg ccctgcccaa    138180
     ggtgggcctg agcgcggttt tcctcgtcag cctgctgtcg gccaccctgt tgccgctggg    138240
     gtccgaggcg gcggtgtacg gattcgtcaa gctggcgccc gatatgttct ggcccaccgt    138300
     gctggtggcg accgtcggca atacggccgg cggggccatc agctactaca tggggctgtg    138360
     ggcgcaccgc gccgtcgagc gctggcgcgc ccgccacccc cacgagcggt aggacggctt    138420
     ccagtcgcgc ctgggcgggc gctggaacgc gcgcgcgcgg atctggctgc accggatggg    138480
     gccgccggcg ctgctgctgt cctggctgcc ggcggtgggc gacccgctgt gcgcggtggc    138540
     cggctggctg cggctcagct tctggccttg cgtggcctac atggccatcg gcaagtttct    138600
     gcgctacgcg ctgctgaccg gcgccctgct atgggcgctg ccggagctcc atatgtaaca    138660
     atgcgccgtc tgccttccga cccatatctg gcgcggtttt gcgcgcggat gtgggggtat    138720
     tcgggagatt gggttgccaa tgtcttaaaa tggctcttta agggcccctc ttgttgcttc    138780
     catgaacgcc cccctcgcca gccaaatcct gaccgcggcg ataccgcccg cacccggcgc    138840
     gcgtttgcgc gaaatcccgt acaactacac gtcgttctcc gaccgtgaga tcgtcagccg    138900
     cctgttgggc gaagacgcct ggcagctggt cagcgacctg cgcggcgagc gccgcaccgg    138960
     ccgttcggcg cgcatgctgt acgaggtgct gggcgatatc tgggtggtac ggcgcaatcc    139020
     ctacctgcag gacgacctgc tcgacaaccc caagcgccgc aagctgctga tcgaggcgct    139080
     gcaccaccgc ctgggcgaga tcgacaagcg ccgcgagccg gccgccgtga ccgaggccgg    139140
     ccatgatccg cgccgcgacg ccaaggtggt cgagctgctg gcgcgcgccc gctcggcggt    139200
     ggccgcgttc gagggccagt tcgaccagac cgcgcagttg cgccggcagg cgcagcgggt    139260
     gctgggtcgc atcaccgcgc gcgacaacat caagttcgac ggcctgtcgc gcgtatcgca    139320
     cgttaccgac gccaccgact ggcgggtcga atacccgttc gtggtgctca cgcccgacgc    139380
     cgaggacgag atcgccgcgc tggtgcgcgc ctgtatcgag ctgggcctga ccattgtgcc    139440
     gcgcggcggc ggtacgggct acacgggcgg cgcgattccg ctgacctgga agtcggccgt    139500
     catcaatacc gagaaattcg aggccctggg cgaggtcgag tcctgtgtgc tgccgggcat    139560
     gaccgagccg gccgccgtga tccgcgccgg cgccggcgtg gtcaccaagc gggtggccga    139620
     ggccgccgag cgcgccggct tcgtgttcgc tgtcgatccg acttcggccg aggcatcctg    139680
     cgtgggcggc aacatcgcca tgaacgcagg cggcaagaag gccgtgctgt ggggcaccgc    139740
     gctggacaac ctggcctggt ggcgcatggt ggatccggac ggcaactggc tggaagtgac    139800
     ccggctggcg cacaacctgg gcaagatcca cgacgtcgac gtggccagct tcgaactgaa    139860
     atggttcgac ggcgccggca agcccggcga gaagctgctg cgcaccgagc gcctggatat    139920
     cgaggggcgc aagttccgca aggccggcct gggcaaggac gtgaccgaca aattcctggc    139980
     cggcctgccg ggcgtgcaga aggaaggctg tgacggcctg atcacgtcgg cgcgctgggt    140040
     gctgcaccgc atgccgcgcc acacccgcac ggtctgcatg gaattcttcg ggcaggcgcg    140100
     cgacgccatc ccgtccatcg tcgaggtcaa gggctacctg gacggcgagg gcaaggcgcg    140160
     cggcgccatc ctggccggcc tggagcacct ggacgagcgc tacctgcgcg cggtgggcta    140220
     tgccaccaag agcaagcgtg gcatgctgcc caagatggtg ctgatcggcg acatcgtcgg    140280
     cgacgacgag gatgccgtgg ccaccgccgc cagcgaagtg gtgcgcctgg ccaatacgcg    140340
     ccacggcgag ggcttcgtgg cggtcagcgc cgaggcgcgc aagaaattct ggctggaccg    140400
     ttcgcgcacg gccgccatcg cccgccacac caacgccttc aaaatcaacg aggacgtggt    140460
     gattccgctg gatcggatgg gcgagtacac cgatcacatc gaacgcatca acatcgagct    140520
     gtccacgcgc aacaagctgc gcctgctcga cgagctggat gcctatctgg ccgagccgct    140580
     gcccatgggc aaggtggagg acgccgagga tgtcgcgctg acgcgcgccg aggtgctggc    140640
     cgagcgcacg cgccaggcca tcgaacacct ggcgcgcacg cgccggcgct ggcagtggct    140700
     gctggacaac ctggacctgc cgctggccca ggcgctgccc gagctcgacg gcctggacat    140760
     ggccgcccag cgcgaggcgc tggccgagcg cgtgcaggca cagccgcagg cccgcgtctt    140820
     cgacgtggtg caggaccaca cggtacgcat ttcgtggaag accgaagtgc tgccggcgct    140880
     gcagggggtg ttctcgggca acgccggcaa gctgatcctc gaggggctgg tcgccgtcca    140940
     cgcccgcgtg ctcaagagcc gcgtgttcgt ggcgctgcac atgcacgccg gcgatggcaa    141000
     cgtgcacacc aacattccgg tcaactcgga cgactacggc atgctgcgcg aagccaacca    141060
     ggcggtcgag cgcatcatgc agatcgcccg cgacctagac ggggtgatct ccggcgagca    141120
     cggcatcggc ctgaccaagt acgagttcct gaccgaggcc gagctggcgc cgttccagga    141180
     atacaagcgg cgcgtcgacc ccaacggcca cttcaacgcc ggcaagctga tgccgggcgc    141240
     cgacctgcgc catgcctgga cgcccagctt caacctgatg gggcacgagt cgctgatcat    141300
     gcagcaaagc gacatcggcg cgatcgccga ttcggtcaag gactgcctgc gctgcggcaa    141360
     gtgcaagccg gtgtgctcga cccacgtgcc gcgcgccaac ctgctgtatt cgccgcgcaa    141420
     caagatcctc gccacctcgc tgctggtcga agccttcctg tacgaagagc agacccgccg    141480
     cggcatcagc ctgaagcatt gggaagagtt cgaggacgtg gcggaccact gcacggtgtg    141540
     ccacaagtgc tatacgccct gtccggtgga catcgatttc ggcgacgtgt cgatgaacat    141600
     gcgcgcgctt ttgcgccgca tgggccgcaa atcgttcaat ccgggcacgg ccgcggccat    141660
     gttcttcctg aacgccaagg atccggccgc gatcaatgcg acgcgcaagg ccatggtggg    141720
     cgtgggctac aaggtgcagc gcgccgcgca cgacctgctg gccagcgtct cgcgcaagca    141780
     ggccgcgcat ccgccggcca cggtcgggcg cgcgccgctg cgcgaacagg tggtgcattt    141840
     cgtcaaccgc aagatgccgg gcggactgcc caagcagacc gcgcgcaagc tgctggacat    141900
     cgaggacgcc aactacgtcc cgatcatccg cgaccccaag acgaccacgg ccgataccga    141960
     ggcggtgttc tacttcccgg gctgcggctc ggaacggctg ttctcgcagg tgggcctggc    142020
     cacccaggcc atgctgtggc atgccggcgt gcagaccgtg ctgccgccgg gctacctgtg    142080
     ctgcggctat ccgcagcgcg gcaacggcat gacggacaag gccgagcaga tcatcaccga    142140
     caaccgggtg ctgttccacc gggtctccaa tacgctgaac tacctggata tcaagacggt    142200
     ggtggtcagc tgcggcacct gttacgacca attggccggc tatgaattcg agaagatatt    142260
     ccccggctgc cgcctgatcg acatccacga gtatctgctg gagaagggca tcaagctgga    142320
     cggcgtgcag ggcgtgcgct acatgtatca cgacccctgc cacaccccca tgaagctgca    142380
     ggatccgatg aagaccgtcc gttcgctggt gggcgagggc gcccagaaga gcgaccgctg    142440
     ctgcggcgag tcgggcaccc tggcggtgag ccgtcccgac gtgtcgaccc aggtgcgttt    142500
     ccgcaagcag gaagaactgg accaaggcca ggccgcgatg cgcgccgacg gcttcagcgg    142560
     cgacgtcaag gtcctgactt cgtgcccgtc gtgcctgcaa ggcctgtcgc gctatgaagg    142620
     cgagaccggc atggacgccg actacatcgt ggtcgagatg gcgcgccaca tcctgggtga    142680
     aacctggatg gaggattacg tgcgccgcgc caacacgggc ggtatcgagc acgtgctggt    142740
     ctgaggccgc gatcccgcgg ggccgcggcc ccgcgggacg gatccagggc gccgcattgc    142800
     gctatttatg tttcaatgtt tatctagtat tatcttatat ttgcaaactc cggcgccctg    142860
     cggccaagga attcatattg gacgtcaaag cgcccgccac gatcccgtac ttcctgaaag    142920
     agcagatacg ggaactcatc gtcgacggca ccttcaggcc ggggcagccc ctacgtgaac    142980
     aggacctcga acagcgcttc ggcaccagcc gcagcccgat tcgcgaggcc ttgcgcctgc    143040
     tcgagcgggg cgggctggtg gtgcacctgc agcgcaaggg tttccgcatc cgccgctaca    143100
     gccagactga aatccggcag gtctacatgc tgtacgccga actggaggcc tacagcatca    143160
     tgcaattgtc ggaggccgcc gactcgcccc tgctcgatga cctgcgccgg cacgaggcgc    143220
     gcatcgcgca ggcgcaggcc gatgccgacg tgcgcggcta tatcggcgcg ctgcgcgact    143280
     tctacctggc cagcgcgcgc tttaccggca acgttccgct tgccgacacc ttgagccgcc    143340
     tgtacgagca ggtcgagccg ctgcgctaca acctggtgcg gcgcacgctg gcggccacgc    143400
     ccgccgacca gtaccaccgc ggcatcgtcc cggcgctggc gcagcgcgat ctggccggcg    143460
     cggcgcgcca ggcgcacgtc ctggtgcgcg aaatgctgcc gcgcatcctc agcgcctacg    143520
     aacaatgggc gggcgacgcc ggcgacgagc cgggcgacga ccgcctgcgc gtcgcgtagg    143580
     cctttctcct cacgacatcc ccggaccgcc cgggacctgc gcaccctgcc ggcgcgaggg    143640
     agcgcacgcg acggccagcc tgggcctcag acgatgccgc gcgcgcgcag cgcgccgatc    143700
     gccgccggcg ccatgccgag ctccgattgc agtacgtcgt ccgtatgctc tcccaggcag    143760
     ggcgcggccc tgccataggc gatgggcgtg gccgagtagc ggatcgggct ggcgacgccc    143820
     ggcgcgtcca cgcccgagcc atgcggcagc gacagcttga gtccgcgatg ctgcacctgc    143880
     gggtcctcga acacctgctg cagattgttg atgggcccgc acggcacgtt ggcggcctcg    143940
     agcagggaca cccattcctg catggtgcgc gcctgcatgg cctgggcgat gatgggaatc    144000
     agcgtttcgc ggttgcggct gcgttgcgcc atggtcgaga agcggctgtc ggtggccagc    144060
     tgcggcatgc cgatcaatcc ggcgaacgtc acgaactggg tgtcgttgcc gaccgccacg    144120
     atcacgtcgc cttccttgca acggaacacc tggtacggaa ccatgttgga gtgcgtgttg    144180
     cccagccgct gcggaatcct gcccgacagg aagtagttca tgacggcgca gccggtgacg    144240
     ttgaccaggc aatcgagcag cgagatgtcg atggcctgtc cttcgccgct gaggttgcgg    144300
     tgctccagcg cgcccaggat cgccgtcgag gcgtagatgc ccgtgaccac atcggtgatc    144360
     gggatgccgg tcttgagcgg accgccgccg ggctcggcgt ccggcaggcc ggtgatgctc    144420
     atcagtccgc ccatgccctg gaatatgtag tcgtagccgg gcaggtgggc gtgcgggccg    144480
     gtctggccga acccggtcac cgagcaatac acgagccgcg gattgatctt gcgcagcgac    144540
     tcatagtcca ggccgaagcg cgccagcgtg ccgaccttgt agttctcgac cagcacgtcc    144600
     gcgtccttgg cgagctggcg gacgatctcc tggccttcgg cgctggagat gtccagcgtc    144660
     accgactcct tgccccggtt ggtgctgagg aagtaggcgg catcggtggt ttcctcgccg    144720
     tgcgcgttct tcaggaacgg cggcccccag ccgcgcaggt cgtcgcccgc gccggggcgc    144780
     tcgatcttga tgacccgggc gcccatgtcg gccaggatct gcgtggccca ggggccggcc    144840
     aggacgcggg tgaggtccac gaccttgatg tgctcaagtg cttgtttcat gacggggctc    144900
     ggcgccggtg ggggcgcgca atgggtgatt gatgaaatcc gcgagttccg cgatggcggc    144960
     atcggcggca tccagccgtg cggcgaaaag ctggaataca tgcggcatgt cctgccacac    145020
     gctcaggcgc accgcgacgc cgcttgctgc ggcgcgcgcg gccagcgccc gcgcgtcgtc    145080
     gagcagcgcc tcggccgagc cggcctgcac gagcagcggc ggcaacccgc gcagatcggc    145140
     gtgctgcgcc gagacggcgg gcgcttcggg gtcgccgtcg cggccgaggt aggcgcgcgc    145200
     catgcgcagc acggtggcgc ggttggcgat ggggtcggac gcggcattgg cggtgtagct    145260
     ctcgccccgg gcctgcaggt cgatccaggg cgacatcacg gcgcatgcgg cgggcaatgc    145320
     ggcgccgcgc gcgcgcagcc gcgcaagcag cagcacggcc agcgcgccgc cggcggagtc    145380
     gccgcacaag gcggtctgcc gcgcagacca gccctggccg gccagccagg catgggccgc    145440
     gtcgacgtcc tcgagcgcgg ccggacagcg cgcctgcggc gccaggcggt atccgatgct    145500
     cagcaccgcc cggccggacc aggcggacag ccgcgccatc aggttgtggt gcgagcgatg    145560
     cgagccgatc tggtagcccc cgccatggat gaagacgacc acgcgatcgc gggtcgatgc    145620
     cggggcttcg atccaatggc acgggacgcc gccggcatcg accggcgtga cgcgcgcggg    145680
     caggcgcacg gcgccaaaga aagcgtccca gtcgcgccgt atccgcgcga tgtccgtgtt    145740
     cgggtcccag ccggcgtaca gttgccggac ctgggccgag agcgtcgcca gctgtgccga    145800
     tgctatggcc gtcagcggct gccggcggcg gccgcctgga tggcattgcc caggccctgg    145860
     gcgcgcgcgc ggttgaagcc ttccgacaga tggctgagct ggtgcgtgtc gaagtgcgcg    145920
     tcgatcgcgc tgcgcaagcc ctgcatttcc aggccgcggt tgatcgagcg cttgaccagg    145980
     cgcagcgcga acgggtcgca cgcggcgatg cgttgcgcca tgcgctcggt ctcggcctgc    146040
     agctcggcgc gcgcgacgac cttgttcacc atgccgatgg ccagcgcttc ccgggcgctc    146100
     atgcgttcgc ccaggaacag gaattccttg gccttgcggg ctcccatgac ccaggggtgg    146160
     atcatgacct cgaccgccgc ggtggcgagc gtctggcaga ccgggtcgga gaagaacgcg    146220
     tcgtcggagg cgacgatgag gtcgcacatg ttggccacca tgaatccgcc cgcgatgcac    146280
     gctccgctta cctgcgcgat cgtcggcttg gggcagtcgt agatgtgcat cgcgtagccg    146340
     aggtagtagc gttgctcgaa ctcccagcgc tgttccaccg tgaaattgct gcgcttggcc    146400
     gcggcctcct tgaggtcgtg gcccgccgag aagtggtcgc ccttgccgga gatcacgatg    146460
     gccttgaccg aggcgtcgcg cacggccagg ccgagcgcct ggtccagttc ctcgagcagc    146520
     ccctggcttt ccgcgttgcg cgcctgcggg cggttgtggg cgatgcgcgc gatgccgtcg    146580
     gccgcctggt actcgatgag ttcgaaagag tcggatttgt tcatggttgc tctcgtgtgt    146640
     cgggttacca ggcgcgcagg gcgcgccagg cgtcgtcggt gcccagggcc gccttgtcgg    146700
     cgtcgtatcc gaacagccat tcctgctgcg gcaggaaggt gccctgatac tgggcgtcgt    146760
     agtggaggaa cttctggttg cgccgcgcga cctgttcggg atcgctcatg tgaaagcgtt    146820
     tttccgccag ctgcgattgg gcctgcacgc gggcggtgcg gtccttgcgc agggactggt    146880
     agcgctcgag cgcgggcggg atgtcgccgc cggactgctg cagcgtgcgg gccagcaccc    146940
     aggcgtcctc catgctctgc accgcccctt gggcgtgata cggcagcatg gcgtgggcgg    147000
     agtcgcccag cagcgcgatg cggccgttga tccaggagtc cagcggcgcg cggtcgtaca    147060
     gcgcggtgac gaagggcttg tcggtcaacc ggatgagccc ggtgacctac tcgttccagc    147120
     cggcatactc gcgcagcacc tcgtccacgg tggtggtcgc cgaccacgat tccttgcggt    147180
     cgcccggacg gctgccgatg cagatccagt tgatcttccg gccgcccgag acgtagtaga    147240
     tgacggcgct gcgctcgggc ccgagccaga gatgggcgct gggcgagatg tccaggtgcc    147300
     gggcggcgtc cgcgtcgacg atgccccgcc aggcgatgca gccggaggcc tggggctggt    147360
     cggcctggaa aaagcggccg cgcaccaggg agtggatgcc gtcggcgccg accaggatgt    147420
     cgccctgtac ccgggtgccg tcggcgagcg tggccgtgac ctgtcgcgcg tcctggtcga    147480
     tgtcgacgat ccggctgccc agccgcagct tggccgggtc caggcgctcg gtcagcacgc    147540
     ccagcaggtc ggcccggtgc gcgtggtaat agggcgcgcc gaagtgttcc ttgatcgtcg    147600
     gcatcaacgg gttgcgcatc agcacctggc ccgactgcca gtcgcggtag agcagctccc    147660
     ggggctcgaa ggcgaccttg ctcaaggcct cgtgcacgcc caggtgctgc agcacggcca    147720
     cgccgttggg gctgagctgt acgccagcgc cgacctcttc gaggcggggg gcctgttcca    147780
     gcacgacgtg atcgatcttg aatttttcca gggcgacggc cagcgcggcg ccgccaatac    147840
     cgcatcctgc gatgatgact cgcatagtct tgtcctgttg tgtgtggggg gggggggggg    147900
     acggcccggc cgggccgccg cgcgggcgca gtcgccctat tggggctgca ggccgatttc    147960
     ctggatgatg ggcccggagc ggttcagctg atcctggatg aagcgcatca ggtcctggtt    148020
     cgacggattc cagggctcca cgccgttgtt gtgcaggaat tccacgaacg cgggcgcggt    148080
     gctggccgag cgcgtggcgc tttccagttt gcgcatgacg gcgtcaggcg tgccgggcgg    148140
     ggcgaagaag gcgatccaga ccggcatgcc cgagttcttc gagccgactt cgacggtggt    148200
     ctggatgtcg ggaaaggccg tgaggcggtc gttctgcagc acccccagcg ccttgaattc    148260
     tccggcccgg atgcgcgcct gggccgagaa cagcgtgata taggcgatgt ccacttcctt    148320
     ggccttcagg gccagcaggc cctgcgcatc gccgcggtag gggatatgca tgatgttcag    148380
     gcccagatcg ctcttcatga tctccatgcc cagatgcgcg ctggtgccga tgccgaacga    148440
     gccatagttc agcttgccgg ggttgtcctt gatgtactgg atcagctcgg tcaggttgtt    148500
     ggcggggaag tcgggcctgg ccagcagcac cgtgggcgcc gtgttgatcg gcgcgatcgg    148560
     ctgcagtgtg tcgatccgga agggcaggtt cttgtacatg tgcggggcga ccgtaaaacc    148620
     ggtgttcgaa cccagcagga tcgtgtagcc gtcgggcgtg gcctgggcca ctgtctgcat    148680
     ggccacgatg tggccggcgc tgggcttgtt ctcgatgatg accggctgcc ccagtttctc    148740
     cgccatgccc agcgcggcct ggcgcgcgat gaggtccgtg atgccgcccg ggccgaatgg    148800
     cacgatcagc cggatcggcc ggctggggaa ggtatcggcg tgcgccgacg aggccgccat    148860
     gagcagtgca atcgtggcga tacggcgcag caagctgaat ggtttcatgg tttgtctcct    148920
     cgaaggcccg aatgctaatc cggcctgttt agaatgggag acaaaccttg ctatgctgca    148980
     cactgttttg acatgcaaaa cacccagggc ggcacaggag acaagaatga gcgcgccgaa    149040
     agcaagtcgc ccagcgcggg acaggcagtt cgccagcacg ctggcccatg gcctgcagtt    149100
     gctcagatgc ttcacgccgg aggcggcggt cctgagcaac cgccagttgt ccgagctgtc    149160
     ggggctgtcc aagccgacgg tgtcgcgcta cacctacacg ctgatcgaac tgggctatct    149220
     caaggtcgac ccggtttccg gcaagttcca gctgggcaat gccgtgctca cgctgtccta    149280
     tccgctgctg gccaacatcg cgctgcggca ggtcgtgcgc tcgccgatgc gcgaactggc    149340
     cgaacggctg ggctgctcgg tgtcgctgtg catgcgggaa cgcctgagca tggtgtatgt    149400
     ggagaccagc cggtcgcgct cgctgcgcgc gcagcgctac tccgacatcg gcatgtcgca    149460
     ccccatcatc gccacgtcca atggccgcgc ctatctcgcc gcgtgcagcg cggacgagcg    149520
     caatacgctg ttcaaccaga tccgtgtgaa gacgcccgag cactgggagc gctggggcga    149580
     atcggcgctg gacatgatcc agttctgggg gcggcacggg ttctgctatt cgcatggcga    149640
     ataccggccg gacgtcgcga cggtcggcgt gccgtaccgg ccgtcgtccg gcggcgagct    149700
     ctatgtattc aactgcgtgc tcggctcgca gttcgtcaag cccggccaat tggaaaacga    149760
     ggtcggaccc gccctgctgg agatgacctc ggtcctgccg tacgcgtgac ggcgcggccc    149820
     tacgccgcct ggatggcgat gccgtcgcgt tcgagcgcca ggcggatgcc gcgggcgaat    149880
     accagcgcat cgggctggtc gccgtgggat gcacagcgta tcggcctgca aggccacggt    149940
     ctgtccgtcg ggcgtgcgca cgctgccgtc gcgcaccatg cccagcacct gggcgatggc    150000
     ctggtccagg tcggtgatca tggcgtcggg ctggctgcgc ggcgtcaatt ggccgtcggc    150060
     ctggtaggtc cggtcggcga agacttcctg cgccgcgcgc aggccgatgg cgcgggcagc    150120
     gtcgatcaag gcgctgccgg ccagcccgta cagcaccagg tcgctgtcga catcgcgcac    150180
     cgcctggcag atcgcgcgcg ccagcgccgc atccttggcc gccatgttgt agagcgcgcc    150240
     gtgcgccttg acgtgatgca ggcgcgcgcc ttgcgaggcg gccacgccgg ccagcgcgcc    150300
     gacctggtag accaccaggt cgtaggcttc ctgcggggtg atctgcatgg cgcggcgccc    150360
     gaagccggcc aggtccggca ggctggggtg agcgcccagc gccaccccat gggccagcgc    150420
     cgcggcgacg gtctggcgca tggtggatgg gtcgccgccg tgaaagccac aggcgatatt    150480
     ggccgacgtg acgaactgca gcacggcttc gtcgttgccc atgcgccagg cgccgtagct    150540
     ttcgcccatg tcgcaattca ggtcgatggc gggattcatg gcgtgggctc ctggaagtcg    150600
     cgcagcaggc cgcgcaaggc gtcgagctgg ccggtcaatt gggcgaaggc ggcttcgcgg    150660
     gccgcgtcca gccgttgcgc ctgcgcaagc tcgatgaggg caaagcgcag cgcctgcccc    150720
     ggcatggctt gcgccagctt gggatagccg ccggtggtct ggcggtcggc catcagcacg    150780
     atgggcgcgc cgtcggccgg cacctgcacc gtgccgaagc aggtggcctc cgacagcatc    150840
     tcgcgcggct cggacagccg cagccgcggc ccttccagac gatagcccat gcggtcggat    150900
     tgcgcaccga tacggaaggc ctggtccagc aaggcctggc gcgaggcggc gtcgaaagcc    150960
     gcccagtggg gcccgggcag tatgcgcagc acgtcgcgcg gcgggctgct cagggtggcg    151020
     gcaagataga agcgcagttg ccacagctgc tgcgccagcg cgtccaggcg cgccgcgtcg    151080
     tcggccaggg gccggcgcag gccgacctgg tcgcccttgg ccagggcgcg tccgtggtag    151140
     ccgccgaagg cgctacgcag gtaggtgctc tggttgccca tgaccatggg caggtcgtag    151200
     ccgccgtgca ccgccagata ggcgcgcgcg ccctggccgg gccgggcgaa ggacagcacg    151260
     tcgccggcgc gcgccaccag cgggcgcagc acgggcgcgg gcaggccgcc gagcgtggcg    151320
     cccaggtcgg cgccgcccag cgccacgcag gccggcgcct cgaagcgcag cgtgggaccg    151380
     gccacggtga tctccagcgt ggcggtgtcg gcggcgttgc cggccagcag gttggccagc    151440
     cggtgcgcgc gggggtccat ggcgccggcc accggaatgc cctggtgctg gtagccgtgg    151500
     cggccgccgt cctggaaggt ggacagcatg ccgggcttga tgacggccag gctcattgcg    151560
     cctcccgcag gcgatcgaac tcggcggcgt cgatcggcac gaagcggatg cggtcgccgg    151620
     gttgcagcag cgcggcgggt tcgcggcccg ggtcgaacag gttcagcggc gtggcgccga    151680
     tgatgttcca gccgccgggc aggcgcgcgg gatagatgac ggtctgccgg ttggcgatgg    151740
     cgaccgagcc ggccggcacc gccgtgcgcg gcgtggcgcg gcgcggcagg tccaggcgcg    151800
     cgtcgtgcac gccgatatag gaatggcccg gcgcgaagcc cagcatgtag accatgctgc    151860
     cgggcgcgcc atgcagcgcg accagcgcct cgggcgtcag gcccgcggcg cgcgcggctt    151920
     cttcgaggtc ggggccatgc tcgccgccgt agcacacggg gatttccatt tcccgcccgg    151980
     cgctgtcgtc gaccgggatg ccgccggcca gcaggcgttc gacttgcgcc gccagcgtgg    152040
     cgtagtcggg cgcgccgtcc gggccggggc gatagtgcac cgccaccgcc gcgaacgagg    152100
     gcaccacgtc ggtcacgccc gccaggccgg cggcgcgcag caggccggcc gccgccaggc    152160
     aggcgcggcc gacgccggcg tcgatctgcg cgccgaacca cacgatcagg cagcggtcgc    152220
     cctgcggcag gatgcgccag ccggcgggcg ccgaagaagg aggcgagggc gatgcggtca    152280
     acggcgatac ctgctgcgaa gaaagttact tggcaaacag ggattctatg ttcttgaagg    152340
     ccttgaactc cagtgcgttg cccgacggat cgaggaagaa catggtggcc tgctcgccca    152400
     cctcgccctt gaagcggata tagggttcga tcacgaactc ggtgccggcg tcggtcagct    152460
     tgccggccag ggcttcccac tggtccatgg acagcaccgc gccgaaatgg cgcaccggca    152520
     cgttgtgcgc gtcgaccgcg ttggtggcgg ccgagccgca tgcctggggc gccaggtggg    152580
     ccacgatctg gtggccatag aaattgaagt cgatccactc gggcgagctg cgcccttccg    152640
     gacagcccag caaggcgccg tagaaatcac gggcttcggc caggtcgcgg accgggaagg    152700
     ccaggtggaa cggaggaatg ggggacgggg tggacatgcg agctcctgac ggcattgaag    152760
     attcagggca tagtgtatta gttgtttttg tgatagaaaa acgataaata ttcgggctga    152820
     gcatcaataa aatcgattgt gatccgggaa ttcaaaacct tcatcgccgt ggcgcgcggc    152880
     ggcaccttca cgggagccgg gcgccggctc ggcctgacgc agtcggccgt cagcgcacag    152940
     atcaagcgcc tggaagaaca cctgggcgtg gcgctgttcg aacggaccgg caagtcggcc    153000
     gccttgaacc accatggccg tagcctgctg ccgcaggccg aggtgctggt cgccatggcc    153060
     gaccgcgtgg tgggcatggc cggcgccggc cggatcagcg gcctgttgcg cgtgggcgcg    153120
     attgcgtcgg tgcagcagga tctgctggtg cgggccctgg cggccctgcg cgccgagcac    153180
     ccggatgtgc gcgtgcgcat cgtgccgggc gtgtcgctca cgctgctggg ccatgtcgat    153240
     gccggcgaag tcgacctggc ggtgctgatc cgcccgccgt tcgcgctgcc gccggagctg    153300
     gaatggcagc ccctgctgca cgagcccatg gtgctggccg tgcccgaggc ggcgccggag    153360
     gggccctggc gcgagctgtt ggccggccag cccttcatcc gctacgaccg cgcctcgttc    153420
     ggcggccggc tggtggacat gttcctgaag cggcatcggc tggatgtgcg cgaagccatc    153480
     gagctcgacg aaatcgacgc catcgccaac ctggtgcgcc acggcctggg cgtggccctg    153540
     ctgccgcata cgcggcacct ggatgcgcgc ggcctgcgcc tgctcgaatt ggacgaccag    153600
     gtccgcttcg cccgtgagat cggcctcatc gtgcgccagc cgctggggca gtcgccgctg    153660
     gcgcaacggc tggcgcaatg cctgcgggcg gcggtgagtt tcggggaagc gtgagggggg    153720
     gggggggatt ggtgccagtc cccgttcggg gacaggcacc caggggttac agcttttcgc    153780
     acctcacggt gaccgggtgg ctgcgcaggt cggccaggac ggtgtcgctg acttcgccgt    153840
     cgacgtcggt gacggcgtag ccgatctggc ccttggtctg caggctctgg ctgacgatgt    153900
     tcaggccatg ctgggccatc aggttgtcca gcgcgcccag cgcgccgggg gcgttgcggt    153960
     gcacgtggat gatgcgcgag ccgcccacgg gcgcctggta cgacagctcg gggaaattga    154020
     cggcgctctt ggtggtgcct gcttgcagga agcgcaccag tttctcggcc acttcgcggc    154080
     cgatgttttc ctgggattcc tgggtgctgc cgccgatgtg cggcgtgagc acgacgttgg    154140
     gcatgccgat cagcgggctg gccagcggtt cgtcggcgct cttgggctcg gtcggaaaca    154200
     cgtccagcgc cgcgccggcc aggtggccgc tggccagggc gtcgtgcagc gcctggatgt    154260
     ccaccaccgt gccgcgcgag gcgttgatga gaatcgcgcc gcgcttcatg cgcgccaggg    154320
     tgtcggcgtt gacgatgttc tgggtggact tgccgccggg cacgtgcaag gtgacgacat    154380
     cggcctgctc cagcagctcg gccagcgagc cggcggcgcg cgcgttgccc agcggcagct    154440
     tggcctcgac gtcgaagaac accacgcgca tgccgatggc ctcggccagg gtgctgatct    154500
     gcgaaccgat gttgccgtag ccgacgatcc ccagcgtctt gccgcgggcc tcgtaggcgc    154560
     cggcggcgct cttgtcccaa tgccccaggt ggacgcgggc gttcttctcg gggatccggc    154620
     gcagcagcag gatggcttcg cccagcacca gctcggccac cgagcgggtg ttggagaacg    154680
     gcgcgttgaa gaccggcacc ccgcgcatca tggcggcgtc caggtcgacc tggttggtgc    154740
     cgatgcaaaa gcaccccacc acgcgcaggt cggggttggc cgccagcagg tcggcgtcca    154800
     gatgggtccg cgagcggata cccaccacct cggcgccgcg cagggcctcg cgcagctcgc    154860
     ccgaaggcag cgccgccgcg tgggcgacga tgtcggtata gccggccgcg ctgaagacgg    154920
     cgcgggcgct ggggtggata ttctcgaaca gaacaatctg ggccatgttg ggttgcctgt    154980
     acaacaaggg ttgaaaaccc cccccccatt gtggaccaga tcgggcggcg cccgggcagt    155040
     gcccatagcg ccggtgtggc gaaatgcgcg tcagcggtac gcctggaaca cccggaccga    155100
     gccgtcgggc tgcaccagca gcacatcgta ggcgtcgcgc cgcccgccgt aggccgggcc    155160
     gtccatgccg ggcgagccga tgggcatgcc gggcgcggtc agtcccacgg cgcgcggctt    155220
     gtcgcgcagc aggcgacgga tgtcggccgc cggcacatgg ccttcgacgg tatagccctg    155280
     cacgcgcgcg gtgtggcacg agccgtaccg ggccggcatg ccggcctggc tgcgcaccgg    155340
     cgcggtgtcc tcgaccatgt gggcgcggac ttcgaagccg ttgctgcgca ggtgctgcag    155400
     ccagtcttcg cagcagccgc aggtgggcgt gcgccagacg tcgatgggga tcggtgtgtt    155460
     ggccagggcc gcggccggcg ccaggagcaa ggcccccagc agggcgcggc gaagcgtgga    155520
     tacgtgcgac atgaaagcct gtatagcgga ggttcaaggg gggcagcgcg ccggccaagc    155580
     gtagcatgcg tgcgggggcg cgaaagtacg gccgacgata gcagggcggg actgacctca    155640
     gtctgtcgcc cggattacgc gtttgtcatc ttgcgcgggc ctcgccccga gggaaaagcc    155700
     gatctcggta cctgccgggc cgctggccgc cgtcacgccg ccgttgtgca tgcgcgcgat    155760
     ggcgcgcacg atggccaggc ccaggccgtg gccttcgccg cgcggcggcc gggcgccgcc    155820
     gctgcggaag aagcgatcga agatgcgcgg caggtccgcg gccgggatgg gcgggcccgg    155880
     gttgtgcacc gtcaggcgcg ccgcgccgtc gggcagggcg gcgcagcgca cggtgatggt    155940
     ggcgccgcgc ggcgtggcgc gtatcgcgtt ggccagcagg ttggccaggg cgcggcgcac    156000
     cagcccaggg ttggcggcgc acgtggcgct gccttgcacc gccacgtgca gcgcctgcgc    156060
     ctccagcgtg gcttcgaaat actccgccac gcgcagggct tcctgttcga gccgtgcggg    156120
     cgccaggtcg gcggcctgct cgccgcggtc ggcgcgtgcc aggaacagca tgtcgttgac    156180
     cagcgtcttg aggtcttcga gctcctcgag gttggaggtc agcgcttcgc gcagctcttc    156240
     ggccgagcgg ggcgacgaca gcgtgacctg ggcgccgttg atcagggtgg ccaggggcgt    156300
     gcgcagctcg tgcgcgacgt cggcgttgaa gccctccatc ttctggtacg cctcctgcag    156360
     gcggtccagg gtgcggttga acgaggccac caggtcgctc aattcccggt cgatgcccac    156420
     caccggcagg cgcacgtcca ggtgctcggg ctggatgctg gccgcctggc cggagagccg    156480
     ccgcaccggc gccagcgtgc ggcgcacggc ccaggccgcc agcaccacgg tggcgccgat    156540
     ccacagcgcg cagatcagca gcaacgcggt gccataggca tagagaaagc gcgcgttggc    156600
     cagcgtattg accgccacgg tcagcgtggc gccggcctcg ggcgggcccg gcagggtcag    156660
     ccgcacgccg cgcatgcggg tgtcatctgc gttgcgcagc agcacttcgt cgtcgtccgt    156720
     gacgctcagc acctcgggcg tggcgttgcc atagcgcagc gtgccgtccg ggctggtgat    156780
     ccagatgccc aggtggccat ggccggcctg gatgccgtcg agcatgtcgc tgagcgcccg    156840
     cgacgtatgg gactgcatgc ccaccaggtg ctcgatgagt tcggccttgc cgcgcgcctc    156900
     ggtgatttcc tggcgctgca cttcctgttt cagcgtccag aacagcagcg ctccggccag    156960
     gctggacgcc agcagggcga tgacgcccag ccacagcgtc agccgccgtt gcatcgacgg    157020
     cgtgcgcagc ctcatgacgg gcgcgattcc agcacgtagc ccatgccgcg cacggtatgc    157080
     agcagcttgg cgtcgtaggg gtcgtccagc ttgccgcgca gccggcggat ggcgacgtcg    157140
     atgacgttgg tgtcgctgtc gaagttcatg tcccagacct gctcggccag cgtggtgcgc    157200
     gacaggatct ggccctggcg gcgcagcagc agcgccagca gcgaaaactc cttggccgtc    157260
     aggtccaggc ggcgtccgcc gcgctgcgcc ttgcggctgg ccaggtccag ctcgaggtcg    157320
     gccaggcgca gcagggtgga ttcctggctg cgcccgcgcc gctgcagcgc atgcacgcgc    157380
     gccaggagct cggagaacgc gaacggcttg accaggtagt cgtcggcgcc gccttccagc    157440
     ccgcgcacgc ggtcctcgac ccggtcgcgc gccgtcagca tcagcaccgg cgtgttgcgc    157500
     gcggccgcgc gcagcgccgc caggacggcg aagccgtcga tgtcgggcag catcacgtcg    157560
     aggatgacca gttcgtagtc gccctcgagc gccaggtggc ggccgttgac gccgtcgcgc    157620
     gcgacgtcga cgatatggct ttgctcggac aggcccttgt gcagatagtc ggccagcttg    157680
     ggctcgtctt cgataacgag gatgcacatg ggggcggatg cagaatgtcg agatcctgca    157740
     ttatgcgctg gatcgcccgc cgcctcagcg gtccggatct tcgccggtca cgcgctcggc    157800
     gggaaagcgc agcgtgaagg tgctgccctt gccgagctcg ctgtcgatca gcaggtcggc    157860
     gtcgtggcgc atggcgatgt gcttggtgat ggccaggccc aggccggtgc cgccggccgc    157920
     gcgcgagcgg ccccggtcga cccggtagaa gcgctcggtc aggcgcggca ggtggcgcgc    157980
     cggaatgccg atgccggtgt cctgcacgct gtagagcgcc tcgccgtcgg cgccgcgccg    158040
     ccagcgcacg atgatgcgcc cgccgtcggg ggtgtagcgc accgcgttgg tcagcaggtt    158100
     ggacagggcc gaagccagct cggtgccgct gcccagcaca tccagcccct cctcgatctg    158160
     ccactcgaac acatgccggc cgttcgacag cgcctcgacc tgctggcggg cagtgcgcag    158220
     cagcgcgccg acatcgacgg ccagcgggtc ggcctcgggc gaggattcga gcgtggacag    158280
     ggtcagcagg tcttccacga tggcctgcat gcgccgcgcc tgctcgtgca tcatggccat    158340
     gtactggtcg cgctgttcgg cgggcagcgc ctcggccggc agctcgcgca gcgtctccag    158400
     gaagccggcg agcactgtca gcggcgtgcg cagctcgtgc gagacgttgg cgacgaaatc    158460
     gcgccgggtg gtttccaggc gctcgatctg ggtgacatcg cgggaaatca gcaggcgctg    158520
     gttgctggcg tagccggcca ggtggatcat catgacccgc tcctggccgt tcaggctcag    158580
     gcgcaccagg atgggttcgg gccagtgccc gcgatgcgca taggcgacga attcgggggc    158640
     gcgcagcagg ttcagcaggt tgtggccgcg gtcggccggc aggcgcaggc ccaggtggcg    158700
     ccgcgccatg cggttggccc agtcgatctg gaaatcttcg ttgagcgtga ccacgccgtc    158760
     gggcagcgcc tgggcggcgg ccagcatgct ttgcatggtt tcgcgcgttt cggccagttc    158820
     gcgtgcgcgc gcccgcgtgt agcgatacag cggcgccagg atgtcgtccc aggggccgac    158880
     ggccgccggc ggcgccgatt cggggtcatg ggcccagcgc gacaccaggt gcaggcgcca    158940
     gctgcgccac agcagcatgg ccgccgtggc cgcgccgaac agcagccagc cggccgggtc    159000
     gccgatcagc cattgggcaa gcagggccat gaccgcccag aaggcgatca tgaaaagggt    159060
     gcgcagccag atcatcgtgc ggttttttag cgcgccggca cctgtgctgt aaaccggtag    159120
     ccgctgccgc gcaccgtctc gacgtgcgcg tcatggccgc tgggttccag cgccttgcgc    159180
     aggcggcgga tatgtacgtc caccgtgcgc tcttccacga agacgtggtc gccccacacc    159240
     tggtcgagca gctgcgagcg ggaaaacacc cgctccgggt gggtcatgaa gaagtgcagc    159300
     aggcggaact cggtgggccc gatggacagc gactggctgt ggcccgacag gcggtgggtg    159360
     accgggtcca gcttcagccc ggcgacgtcg atgatgtcgt cggtcagctg cggggcgcgg    159420
     cggcgcagca cggccttgat gcgcgccatc agctccttgg gcgagaaggg cttggtgatg    159480
     tagtcgtcgg cgcccgcctc caggccgtcg accttgtcct gttcggcgcc cttggccgtc    159540
     agcatgatga ccgggacggc gcgggtgcgc tcttcgtcgc gcagcttgcg ggccagcgac    159600
     aggccggagg cccccggcag catccagtcg agcaggatga ggtcgggcag ctcggcgcgg    159660
     atcagggtct gggcctgttc ggcatcgaac gcgcgcagga ccttgtggcc cgcgaacgaa    159720
     aggttcacgg cgatcagttc ctggatggcg ggttcgtctt caacgacaag aatggtgctg    159780
     gacatggtag gcaatggata cgcagcatgc gccggcgcgg cgcgaacatt gcgatagtat    159840
     ggccgcaata tttcacgtat gtgaccgtag ccacatccgg gccaggccgt ccacggcggc    159900
     gggccgcttc cgatcggcta ccattggacc atataccggg acttcaccat gcaaactcct    159960
     cattcccagc ccgaatcggc gccgcagggc gagcaatcca cgcatttcgg cttccagtcc    160020
     gtgcccgaag ccgacaaggc ccgcaaggtc gccgaggtct tccattcggt cgcctcgcgc    160080
     tacgacgtca tgaacgatct catgtcggcc ggcctgcacc gcgtctggaa ggctttcacg    160140
     atcgggcgcg ccgcggtccg gccgggcatg aaggtgctgg acatcgccgg cggcacgggc    160200
     gacctggcgc gcgccttcgc caagcgcgcc ggccccagcg gcgaagtgtg gctgaccgat    160260
     atcaacgaat ccatgctgcg cgtcggccgc gatcgcctga ccgacagcgg cctgctggtg    160320
     cccaccgcgg tctgcgacgc cgagcgcctg ccgttcccgt cgcagtattt cgaccgcgtc    160380
     agcgtggcct tcggcctgcg caacatgacc cacaaggacc gcgccctggc cgaaatgacc    160440
     cgcgtgctca agccgggcgg caagctgctg gtgctggaat tctcgcgcgt ggccaagccg    160500
     ctggcgccgg cctacgactg gtattccttc aatgtgctgc cctggatggg caagaaggtc    160560
     gccaacgacg aggccagcta ccgttacctg gccgaatcga tccgcatgca ccccgaccag    160620
     gaaaccctgg ccggcatgtt gcgcgacgcc ggcctggacc gcgtccagta cttcaatctg    160680
     accgccggcg tggcggccct gcacgaaggc gtgcggctgg gctgaaacgc acgtcctgcg    160740
     cggcgccacg gggaacttgt ggcgtgccgg cttgtccgtt atgcttagat tgttcagttg    160800
     cctgtaaggt ttgccgcgca ggccccaacc ggggcctttc cagccgctcc cgcgggggag    160860
     tggcggcgcg tacgcgagga gcacaaaagc atgtcccgat cccgtttttc ccgattttgc    160920
     gccatggcgc tggtcgccgt cgccggcacg gcgatggtgg gcgcgtcgtt tgacgcggag    160980
     gcccgccgca tgggcggtgg ctccagcttt ggccgccaat ccaccaatat cacccagcag    161040
     cgccaggccg tgacgccgcc ggccgccggg gcgggctcca ccgccggcgc caccagcgcc    161100
     gcgcgtccgg ctaccgccgc cgcaggcacg gccgccgccg gcaccgccgc caagagcggc    161160
     atgtcgcgct ggctcggccc catcgccggc atcgccgccg gcctgggcct ggccgcgctg    161220
     ctgtcgcacc tgggcctgtc cggcgcgttt gccgagttca tggccagcat gctgctgatc    161280
     gccctggtgg tgttcgccgt catcttcatc gtgcgccggc tgcgcggcgg cgcgccgcgc    161340
     caggccatgc agggcgcgta cggcgcggcg ggcggcaacc gtcccggcca accgtcgcag    161400
     cagcccatgt ggcgcgaaag cctgaacccg gcgcctgccc agcagcccgc cgcggcgccg    161460
     gtcgctgccg cggcgcccgc cgcagcggca gccgcgctgc ccaaggccgg cgacgacggc    161520
     aactggttca tcccgggtga tttcgacacg ccgcgtttcc tgcagcaggc caaggaccag    161580
     ttcgtgcgca tccagggcat ctgggacagc ggcgaggtcg aaagcctgcg cgacttcctg    161640
     accgacgacc tgatcagcga actcaagccg caactggaag cgcgcggcgc cgccgccaac    161700
     aagaccgaag tggtgctgct caacgccgag ctgctcggca tcgagacggt ttccgatggc    161760
     cacctcgcca gcgtgcgctt ctccggcatg ctgcgcgaag ccccgggcac cgaggcgttc    161820
     cgcttcgagg aagtctggaa tctgttcaaa ccggccgacg gcggctggct gctggcaggt    161880
     atccagcaga ttccggtcga acacgccagc tgaccgccac ggcgggatgg ccagggcccg    161940
     ttcccgcgtg aaccggcccc gcggtcccgg cccgacggcc gggctgcacc gtgaaccggc    162000
     ccgccagggc cggttcgctt atgggccggt cttgcgcggc atcaatggcc agccggcaca    162060
     cggtgctttt gaacccgtta cactgcgctt ttgtctttgt tgctgcggac accccgcggg    162120
     tggtccgcgc ctgtcgattc catgctgcct tttgctgccc tgcccacctt gccgaggatc    162180
     gccgcgcgcg cgctgaacgc gctgctcgag cgcgaatcct gggcgcgcga ccggctggcg    162240
     cgccacgccg gcaagaccgt gcggttcgcg ctgggcgggt tcgcgctgtc gctgaccatc    162300
     gatagcgagg ggcgggtgca ggaggccgat tcggcggtgg tgccgaacgt cacgctgtcg    162360
     gcggccgaat cctccagtct ggctcgcctg ctgcccggcg acggccgcgc cgatttcgcc    162420
     gatctgacgc atatctcggg cgacgcggcg ctggcgcagg tggtggcgga cctggcgcgc    162480
     gacctgcgct gggacgccga ggacgagctg gcccgcgtgg tcggcgacat tccggcggcg    162540
     cgcctgttgg gcggcgcgcg tgcgctggcc ggcggcgccc gcgaggccgg cggccggctg    162600
     gcccgcaacg tttccgaata cctggccgag gaaagcgcgg tgctggtggg ccggccgcaa    162660
     tgggagcaat ggcgcctgga cctggcccgg ttcggcgccg acagcgacgc gctggcgcgc    162720
     tcggcggcgg cgctggaagc gcgcctggcc cgcctggacg caaggcgggg cgcatgaatg    162780
     ccatgctgac gttcctgcgg ctgctgcgca tcctgctggt ttccctgcgg tatggactcg    162840
     acgagctggt gctgtcgagc ctgaaccacc cgctggccac gtgcctgctg cggatcatgc    162900
     ggctgggtac ccggccgcgc gcgccgcgcg gcgcgcggct gcgcatggcg ctggagtcgc    162960
     tcgggccgat cttcgtcaag ttcggacagg tgctgtcgac gcgtcgcgac ctgattccgg    163020
     ccgatatcgc caacgagctg gcgctgctgc aggatcgcgt gccgccattt ccgtcggcgc    163080
     aggcggctgc ctgcatcgag gcggcgctgg gcgcgccgcc ggcgcaattg ttcgcccagt    163140
     tcgacgtcga tccggtggct tcggcctcga tcgcccaggt gcacttcgcc gtgctgcacg    163200
     acggccgcga ggtggcggtc aaggtgctgc gtccgggcat gctcaacgtc atcgaaaagg    163260
     acctggcgct gctgcgcgtg gtggccggcg tgatcgagcg cctgggcgcc gacggccggc    163320
     ggctgaagcc gcgcgaggtc gtggccgagt tcgacaaata cctgcacgac gaactcgacc    163380
     tggtgcgcga ggcgtccaat tgcagccagt tgcggcgcaa cttcggcccg gagtcgggcc    163440
     gcggcgagat gctgatcgtt cccgaggtgg tatgggagta caccgccagc acggtgttca    163500
     ccatgcagcg catgtacggt atcccggtcg gccaggtcga ccgcctgcgc gccgccggta    163560
     tcgatatccc gacgctggcg cgcagcgggg tggaaatctt cttcacccag gtcttcaccg    163620
     acgggttttt ccacgccgac atgcacccgg gcaatatcta cgtgtccgat gcgccgcaga    163680
     cgctgggccg ctatatcgcg ctggacttcg gcatcgtcgg ctcgttgtcc gagttcgaca    163740
     agaattacct ggcgcagaat ttcctggcct ttttccaccg cgactatcgc cgcgtggccc    163800
     agctgcatat cgagtcgggc tgggtgccgc ccgaaacccg cgaggaagag ctcgaaggcg    163860
     cggtgcgcgc ggtgtgcgaa ccctatttcg accgtccgct ggccgagatc tcgctgggcc    163920
     aggtgctgct gcggctgttc cagacctcgc gccgcttcaa tgtcgagatc cagccgcagc    163980
     tggtgctgct gcagaaaacc ctgctcaacg tcgaaggcct ggggcgccag ctcgatccca    164040
     acctggatct ctggaaaacc gccaagccct atctcgagca ctggatgcgg cagcgcatcg    164100
     gcctgacggg gctgcgccag agcctggcca aggaggccgg ccaatggtcg cagatgctgc    164160
     catcgttgcc gcgcctggtg cacgagcatt tcagccgtcc caacctgacg ccgcacctgc    164220
     tggccgagat gaaccgcctg cgccgcgccc aggagcaggg caatcggctg acggccgccc    164280
     tgaccgcggt gctggccgtg gcggtggccg tggccctgtg ggccttgagc cggtagcgaa    164340
     tcatgatttg agtcctcctg tcatggtttc gtcaccgaac tgtcattaca gcttcgcggt    164400
     aaccggcgat aactagtaga actcgccagg tccgtgttcg acgcggccga cccgaaccga    164460
     ttttcaccat cctatgagcc ccaagcggga attctgaaca agggccgact atgctttacc    164520
     ctgaactctt caaaaccatg gaagcggtgc gctggaatat ggcgtccgat atcccatggg    164580
     acgacttcga cggcagcaag ctgtcggacg agcaagccca caccatcaag atgaacgcga    164640
     tcaccgagtg ggcggccttg ccggccaccg agatgttcct gcgcgacaac cgcggcgaca    164700
     gcgatttctt ctgcgcgttc atgtcggtct ggtttttcga agagcagaag cattcgctgg    164760
     tcctgatcga atacctgcgc cgcttccggc cggaactgat gccgaccgaa gaggagctgc    164820
     acaaggtccg tttcgagttc gacccggccc cggagctgga gacgctgatg ctgcatttct    164880
     gcggcgagat ccggctagat gtgaactgtc aataggttgt attcgtccag gttgagtctg    164940
     gagatgggta cagcgcgccc gatgccttgg tggggtcgat gccagttgta gtggtgtagc    165000
     caggatttca tggcatcggc tcggtgttgg gagttctggt aggtgtgagc gtaagcccac    165060
     tcacgcaagg ccgactggat gaagcgttcg gccttgccat tggtctgtgg gcggtaaggt    165120
     cgggtaaagc ggtgcttgat gcccagctca tggcacagcg cggcgaaggc gcggctgcga    165180
     aaggccgagc cattgtcggt gagcaagcgc tggatggtca cgcccaggcg ctggtagtag    165240
     gccactgcgt ccttgaggaa ctggacggcg ctggggaagc gctcgtcggg gtggatgtcg    165300
     gtgaaggcca cgcgggcgtg gtcatcgatg gccacgaaga cgaagtccca gccggccccc    165360
     tcaacggtat cgcgtcggtt gcccgtgacc cggtggccag ggcgctggat acgtcccagc    165420
     ttcttgatgt cgatgtgcag cagatcgccg ggggcctgat gctcgtagcg caccaccggc    165480
     tcggccggct ccaggtcggc caggtgcgac agaccggcgc gggccaggac gcggctgacg    165540
     gtgctggctg acacgcccag cgcctgggcg atgcgcgctt gggtcagccg cttgcggcgc    165600
     agctccacga tagccagcgc cttggccggc gcaatcgctc ggggcgagac cgtcgggcgc    165660
     gaggacgcat cggccaagcc cgcctggccc tgagccagga agcggcccag ccatttgcgc    165720
     acagtcggcg cggtgacccc ataggcgcgg gccgcttcag gcacacaaac ttgatgggcg    165780
     atcaattgct ggaccatttc gagtcgacgt aggaaggtca atcgggcatg cttatgggtg    165840
     ttcatccggc cgggctcctt gagtgaactg ggggggtggc gatttccagt ttctcaaatc    165900
     cggttcggat gaaccatgca tacagcctat tgaatcttca cagctagcgc gccgtcgaac    165960
     tgctgcgcca ggtcggcatc gacgagccgg aactgcgggt caagcagtat ccgcaccaat    166020
     tctcgggcgg catgcggcaa cgggtggtga tcgccctggc gctgtcgtgc gggccggaag    166080
     tcatcatcgc cgacgagccg accaccgcgc tggacgtgtc gatccaggcg cagatcctcg    166140
     acctgttgcg caagctgtgc agggagaaac aggtcgggat gatcatcatc acgcacgaca    166200
     tgggcgtgat cgccgacgtc accgaccgcg tggccgtact gtaccgcggc aagctggtcg    166260
     aacaggggcc caccgccaag atactcggca acccggacca cccctacacg cgcagcctga    166320
     tctccgccgt gccgcgcccc gacgtcaagc tgcggcgctt ccccgtggtg acctatatcg    166380
     aggacgtcaa gcgcccgacc gtggaactgg acatcgccac ccactggctg ggccagcggc    166440
     gcgagttcgc ccggcgcgcc gcagggccgc tggtggaagt ggaagacctg ggcatgcgct    166500
     tcgtgctgcg caacgccttc ctggcgcgca accggcgcac gctggacgcg gtcaagcagg    166560
     tcaacctgtc gatcaacgag ggcgaagtgt tcgggctggt gggggagtcg ggttcgggca    166620
     aatccaccgt ggcccgcctg atcgccggcc tgtacacgcc cacgaacggg cgcgtgctct    166680
     ttaacggcgt cgacctgacc ggcctgaagg acgagaagcg gatgaacgcg ttcaggcgcc    166740
     agatccagat ggtgttccag gatccctatt cgtcgctcaa cccgcgcatg cgggtgcagg    166800
     aaatcgtggc cgagccgatc cgctttcacc gcctggctga aggcgaggcg cagacccgcc    166860
     gcgtggtggc cgacctgctc gacgtggtcg gcctgggcgc atccgccgcg cagcgctatc    166920
     cgcacgaatt ctccggcggc cagcgccagc gcatctgcat cgcgcgcgcg ctggccaccc    166980
     ggccgcgctt cctgatctgc gacgaaccga cctcggcgct ggacgtgtcg atccaggcgc    167040
     agattctgaa tctgctcaag gatctgcagg aacagctggg cctgaccatg cttttcatca    167100
     gccatgactt gccggtcatc cgccagatgt gcgaccgggt cggcgtcatg ctgcacggcc    167160
     aactgctgga aacggcggcc accgagaccc tgttcacgca tccggagcac gattacaccc    167220
     ggcacctgct cagcctgatg ccgcggctgc agtcgctgca gccggtgccg tcgccgggta    167280
     gccggcctac cagcggcccg aggcgccgcc tccgccgctg cgcccgccgc ccccgccacg    167340
     aaagccgccg aagccgccgc tgcccgaccc gccgcgccag ccgccgaaac cgcccccgcc    167400
     gctgccgccg cctccgccac ctccacctcc accgccgctg ggcaaggcct tgatgatgac    167460
     cttgatgccc agcaccagca gcgccatagc caggccggcg gaaatgctct gcatgtagat    167520
     cgccacgccc acgccggcca gcgccgccgc gatcggcccc ggcaggatga gcagcaccac    167580
     cagcgccgcg atgccgttct cgcccagcca gccgcgtatg ccggccagcc gcgagccctc    167640
     gtcgcgcccg ctggcggcgg gcggcggcaa ctcctcgcct tcgatgcgcc gctcgagcgc    167700
     cgtgacgccg gcctgcaccg cgccgggcca gtcgccggcg cgcaggcgcg gcacgatgta    167760
     ttcattgatg atgcggccgg ccgcggagtc cggaatcgcg ccctccaggc cgtagcccac    167820
     ctcgatgcgc agcgcgcggt cgtcgctggc catcagcaac agcacgccgt catccacttt    167880
     gtcgcggcct atcttccact tctcgaaggc gcgcgtggcg tactgctcga tggtttccgg    167940
     ggcagtgctc ggcacgatca gcaccgccac ctgcgcgccc ttgcgctgtt ccagcgccgc    168000
     cagctgggcc tccagccgtt ggcgctgcgc cgcgtccagt acgcccgatt ggtcgacgac    168060
     gcgggcgccg aactccggca ccggcgccag ctgctgcgcc tgcgccagca gcgcccagcc    168120
     cgccagccac gcgcccagcc acagcgtccg caggaagcgc caggcgttac tgggccggac    168180
     gtggggcact gccgccctcg ttgctgaact tcacctccgg cgcgcgggtg atctcggcct    168240
     cgttgtccac gccgaaattg gccttgggcg catagccgaa gaccttggcc gtgatcactt    168300
     cggggaactg ccgcaccagc acgttatagg cctgcaccga gcgcacatag cgctcgcgtt    168360
     cgaccgccag ccgattctcg gtgccggcca gctcggtctg cagatcgcgg aacaggccct    168420
     cggccttgag ctgcgggtag ttctcggtca ccaccagcag ccgcgacagg gccgaggaca    168480
     gctcgccctg cgcctgctgg aagcgctgca ccgcggccgg atcgtcgagc tggtcggccg    168540
     tcagctgcac gcggcccacc ttggcgcgcg cctcggtcac ttcgaccagc acctggcgtt    168600
     cgtgcgtcat gtaggcatcc accaccttga ccagccgcgg caccaggtcg gcgcggcgct    168660
     ggtactggtt gagcacctgc gaccaggacg ccttgacctg ctcgtcggcg gcctggatgg    168720
     cgttgtatcc gcagcccgac agcaacgtgg tcagcagcgc cagcaggccg gcgcccagcc    168780
     aacgggtaat cgtcatggca tgtcttcctg taacaatgga tcgccggcat tacaacaggt    168840
     cggagccggc ttgcctatga ctggacgcgg ccgagctgtt acaggttatg gccaaacagg    168900
     gcgcctcccg gggccggcat gggatacaat cattctccgt gtgcatagcc aatcggcaca    168960
     cgtctgctgg cgctttcacc gccatgcccg tgaaaacggg tttcctgtat ctcctcacat    169020
     tcgtccgcct ggattggagt ctctcaactt tgagcgacag gctaccgctg gagttgtttt    169080
     gactacctct atttcctttg ccgacctcgg gctggccgat tccctgttgc gtgcgatcgc    169140
     cgataccggc tatacggcgc ccacccccat ccaggcgcaa gccatcccgc tggtgctgca    169200
     aggcggcgac ctgctggccg ccgcgcaaac cggcaccggc aagaccgcgg ggttcaccct    169260
     gcccatcctg caccggctga tgcagaccaa gcccgccgcg cgcaagcctg gccgcccgcg    169320
     ctgcctgatc ctcaccccca cccgcgagct caccgcccag gtggccgaat cggtgcagac    169380
     ctacggcaag tacgccagcc tgagctccat ggtgatgttc ggcggcgtca acatcaatcc    169440
     gcagatcagc gccctgaaaa agccgctcga catcctggtg gccacgcccg gccgcctgct    169500
     cgaccatgcc ggccagaaaa cggtcgacct ctccggcgtg gaaatcctgg tgctggacga    169560
     agccgaccgc atgctggata tgggcttcat ccgcgacatc cgcaaggtac tggcgctgct    169620
     gcccaagcaa cgccagaacc tgctgttctc cgccaccttc tcggacgaaa tccgctcgct    169680
     ggcgcgcggc gtgctcaacg atccgggcga agtctcggtc acgccgcgca acaccgccac    169740
     cgaactggtc acccagacgg tgcacctggt cgaacagcac cacaagcgcg acctcgtcag    169800
     ccacctgatc cgcgaaagcg gctggcacca ggtactggtg ttcacccgca ccaagcacgg    169860
     cgccaaccgg ctggccgaga agctggtcaa ggacggcctg agcgcggtcg ccatccatgg    169920
     caacaagagc cagtcggcgc gtacccgcgc cctgtcgggc ttcaaggacg gcagcgtggc    169980
     cgtgctggtt gccaccgaca tcgccgcgcg cggcctggac atcgaccaac tgccgcaagt    170040
     ggtcaacttc gaactgccca acgtccccga ggactacgtg caccgcatcg gccgcaccgg    170100
     ccgtgccggc gccaccggcg cggcggtctc gctggtggac gatagcgaga tcaagctgct    170160
     caaggccatc gaacgcctga tcaagaagcc catcgaacgc cgcgccgtcg acggctggac    170220
     gccgcctgcc ggcggcccga ccgccgagga ccgcgccgat cgcggccaac gcgccggcgg    170280
     cgacaaccgc gccccccagg cgcgcgacgg ccagcgccgc gccacgggcg cccatccgca    170340
     aggcagcgcg ccgcgcaacg ccgccggtcc gcgcgccgac gccaagcgca acgacgctgg    170400
     ccgcccccag gggcgtgccc ccggcgaaac gggtgcgacc cgcgcgccgg ccccggcgcg    170460
     caaccggccc gtcggcaacg gcacgcgcgg cgtgttgctg ggcaagtaat cccgctcacg    170520
     cggcatcgac aggagccagc gcatgacgct ctcgacgtgg ttgacctttt tcgtcgcatc    170580
     atgggcgatc tcattctcgc ccggggcggg cgccatttcg gccatgtcct cgggcctgaa    170640
     gtacgggttc gcgcgcggct actggaacac ggccgggctg atcctcggca tcctgttcca    170700
     gttcctgatc gtcgccgtcg ggctgggcgc ggtgctggcc acctccgagc tggccttcac    170760
     cctcgtcaag tacgccggcg tggtctacct gatctacctg ggcatgcgcc agatccgcac    170820
     cgacgccgcg ccggtgacgg tcgatgccgg cgatccgcat cgcgcctcga ttcgcgaact    170880
     ggtgggccgc ggcttcctga tcaacaccat gaaccccaag ggcacggtgt tcctgctggc    170940
     ggtcgtgccg cagttcgtcg accccgcgca gccgctgacc cagcaatacc tggcgctggc    171000
     cggcacgctg gccttcaccg acctggtggc catggacgtg tatacgctgc tggccgccaa    171060
     ggtgctgcgg atgttgcgca aggcgcacca catccgctgg atgaaccgcg tcttcggttc    171120
     gctgttcatc ctggccggcg tattcctggc tacattccgt cgccactcgt aaagacaccc    171180
     cgctggcgcg cccgcggtgc gccagtacaa tccacccgcc atgaacattc cccaagaagt    171240
     cgcgcggcga cgcaccttcg ccatcatttc ccacccggac gccggtaaaa cgacgctgac    171300
     cgaaaaactg ctgctgttcg caggagcgat ccagatcgcc ggcagcgtga aggcgcgcaa    171360
     ggcctcgcgc catgcgtcgt cggactggat ggaaatcgaa aagcagcgcg gcatctcggt    171420
     ggcatcgtcg gtcatgcaga tggagtaccg cgactgcgtc atcaacctgc ttgacacccc    171480
     gggccaccag gacttctcgg aagacaccta ccgggtgctg acggcggtgg acgccgcgct    171540
     gatggtcatc gacgccgcca atggcgtcga accgcagacg atccgcctgc tgcaggtctg    171600
     ccgcgcgcgc aacacgccca tcatcacctt catcaacaaa ctcgaccgcg aagtccgcga    171660
     gccgctcgag ctgctgtcgg aaatcgaagg ccacctcggc atggacaccg tgccgttctc    171720
     gtggccggtg ggcatgggca aggcgtttgg cggcgtgttc gacatccggc gcaaccgcat    171780
     gcgcattttc cgcgccgggc aggagcgccg cggcgaggac gacgaattca tcgacggcct    171840
     ggacaacccc gagatcccgc gccgcttcgg cgccgccttc gcgcaggcca gcggcgagat    171900
     cgagctgatc aacgaagccg cgccggcgtt cgaccgcgag gccttcctgg ccggcaagca    171960
     aacgcccgtg ttcttcggtt cggccatcaa caacttcggc gtgcaggaag tcctggacgc    172020
     gctggtcgac caggcgccgg cccccggccc gcgccaggcg ctggagcgcg aagtccgccc    172080
     cgacgaaccc aagttcaccg gcgtggtctt caaggtgcag gccaacatgg atccggcgca    172140
     ccgcgaccgg gtcgccttcg tgcgcgtgag ctcgggccgc ttcgaacgcg gcatgcgcct    172200
     gaaggtcgcg cgcaccggca aggaaatgcg gcccaacaac gtggtgtcgt tcctgtcaca    172260
     gcgccgcgag ctgctcgacg aagcctatgc cggcgacgtc atcggcattc ccaaccacgg    172320
     cgtgctgcag ctgggcgacg tgctgaccga aggcgagagc ctgcgcttta ccggactgcc    172380
     gttcttcgcc ccggaactgt tccaggcggt ggaagtcaaa gatccattgc gtaccaagca    172440
     attgcgcgtg ggcctgacgc agctgggcga ggagggcgcc atccaggtgt tccgccccga    172500
     ggccgccggc ggcgcgctgc tgctgggcgc ggtgggccag ctgcagttcg aagtggtcgc    172560
     gcaccggctc aagaccgagt acggcgtgga cgcccggatg atgccttcgc gctacaccag    172620
     cgcgcgctgg atcacctccg acgacccgcg cgcgctgcgc aagttcatgg atgccaatgc    172680
     agcccatatc gcctatgatg tggtcgatgc ggcggcgttc cttatcactt cgcccgcgca    172740
     attgcgcgtg gccgaagacc tgtatccgaa tgtgaaattc cacgccttgc gcgagcatgg    172800
     cggcaaagtc ttcggagaca aggcgtaagc cgggtcggag accgcacggc agatgagggt    172860
     agcaatgtct tggcgtttat tgatcgcaac gcttctggtc gccctgggcg cagccgcctg    172920
     gggcggtatt caactgggtg actggctggt ggcgcatgcc ccgcaggccg cgcccgcgcc    172980
     tggccaggaa ggcgacgcat cgcagcaacc cgtcctcgac gccaatggcc ggtcgtatgt    173040
     cgcgcagcct ccccagccgc gcgtcgacgg cacgctgggc gtgccggacc aacccgccag    173100
     ccgcgactgg gcggtgaaca ccgtctcgct gttcgacacc accggcgacc cggcggtaca    173160
     gatctcccgc gacagcatca ccatggaccg cgcgcgcgag atcgccgcca attccgatgt    173220
     gccgctgcct tcgggcaact ccgacatcac cacgctggac ttgcaggcgc tgggcggcca    173280
     ggcgccgatc gtgccgcagg aagccatccc cgcgtccggc atgcagcaga atcccgcggc    173340
     ggtcgcgcag gtcgcgccgc aaaccaaccg cgccggcggc ggcaactggc aggacgcgct    173400
     gcgccgcgaa ctggcccact gcgccacgca gggctttttc gagcgcccca gttgctcctg    173460
     ggcggcacgc aacaagtact gtgcgcccaa ccgcgcatgg ggcaccatgg ccgagtgccc    173520
     gcgccgtccc gactgaccgc acccagccgc aatgcaaagg gcgcaccgca tggtgcgccc    173580
     tttttcatgc catggccgcc gaagcggcca cgatgcctca gccgtcgact tccatctggc    173640
     tttgcaggta gttctgcagc cccacctggt cgaccaggcc gatttgcgtt tcgaggtaat    173700
     cgatatgctc ttcggtgtcg tccaggatgt cctggaacag atcgcgcgac acatagtcgc    173760
     gcaccgattc acagtgcgcg atggcttcct tgacggtcgc ctgcgcggcc tgttccagct    173820
     tcaggtcaca ggccagcagt tccggcacgt cctcgccgat cagcagcttg tgcaggtctt    173880
     gcaggttggg caggccatcg agcatgaaaa tgcgttcgat gagacggtcg gcgtgcttca    173940
     tctcgccgat ggactcttcg tattcatgct tgcccagttt gttgaagccc cagtggcgca    174000
     gcatgcgggc atgcaggaaa tattggttga ttgccgtcag ttcgttggtg agttgcttgt    174060
     tgaggaactg gatgacggtt ttatcgcctt tcatgatgta ctcctggcag acaggcgcgt    174120
     aaagctggcg cgcagtgacg cgcatgcgcc cagcacatgc gcaaccccgg cagactacca    174180
     tcgcttgcgc cttgactgct agctgtgaag attcaatagg ttgtatgcat ggttcatccg    174240
     aaccggattt gagaaactgg aaatcgccac ccccccagtt cactcaagga gcccggccgg    174300
     atgaacaccc ataagcatgc ccgattgacc ttcctacgtc gactcgaaat ggtccagcaa    174360
     ttgatcgccc atcaagtttg tgtgcctgaa gcggcccgcg cctatggggt caccgcgccg    174420
     actgtgcgca aatggctggg ccgcttcctg gctcagggcc aggcgggctt ggccgatgcg    174480
     tcctcgcgcc cgacggtctc gccccgagcg attgcgccgg ccaaggcgct ggctatcgtg    174540
     gagctgcgcc gcaagcggct gacccaagcg cgcatcgccc aggcgctggg cgtgtcagcc    174600
     agcaccgtca gccgcgtcct ggcccgcgcc ggtctgtcgc acctggccga cctggagccg    174660
     gccgagccgg tggtgcgcta cgagcatcag gcccccggcg atctgctgca catcgacatc    174720
     aagaagctgg gacgtatcca gcgccctggc caccgggtca cgggcaaccg acgcgatacc    174780
     gttgaggggg ccggctggga cttcgtcttc gtggccatcg atgaccacgc ccgcgtggcc    174840
     ttcaccgaca tccaccccga cgagcgcttc cccagcgccg tccagttcct caaggacgca    174900
     gtggcctact accagcgcct gggcgtgacc atccagcgct tgctcaccga caatggctcg    174960
     gcctttcgca gccgcgcctt cgccgcgctg tgccatgagc tgggcatcaa gcaccgcttt    175020
     acccgacctt accgcccaca gaccaatggc aaggccgaac gcttcatcca gtcggccttg    175080
     cgtgagtggg cttacgctca cacctaccag aactcccaac accgagccga tgccatgaaa    175140
     tcctggctac accactacaa ctggcatcga ccccaccaag gcatcgggcg cgctgtaccc    175200
     atctccagac tcaacctgga cgaatacaac ctattgacag ttcacagcta gtgcctgccg    175260
     cgcgcgccgg cctcgtcggc cacttcggcg gcgaacatat agccccagcc atgcagggcg    175320
     cggatcggca ggggcatctg gtgatgcgcc gccttgcggc gcaaacggct gatcatcacg    175380
     tccacgaaac ggctgcgttg tgcgccctgg tccgctgcgc cgggggcgga caggtcgtcg    175440
     gcgatcagcg cctcgcggct gatcttgcgc tcgggcgcgc gcatcaggcg cgacaggaac    175500
     tcgcgctcgc ccgtggtcag gcccagcgtg cgcccgcccg ggctgaccag cgtccatccc    175560
     tggttggtca aatgccattt gctgtcgggc ggcgccatgg ccggctccag ggcgagcgcc    175620
     tccatgccca ggtcgatgcc cggctcggag ccgcgcgcaa gctcggcggt ctcgggcaga    175680
     ggcgccagcg cgacgatgcg gcgcagcagg gcctgcagca cggccgccag ctccagtccg    175740
     ctgacgtccg tgggcaggcg cgtcggcgcc gcacagcagg gtgcggatac ggctttcgct    175800
     gtcggcgaac gcttccatcg cgatgatccc cacccgccgg tcgatggcgc gcagccgcgc    175860
     cgcggcgata tggatgtcgg caagcggcgc gctcagtatc accagggggc aggcgtgcgc    175920
     cgcgcagttg tcgtagacct cgatcagctc cgtgcaggct cggatcttga agccgagata    175980
     ggcaaggtgt tccagctgtt tttggtgcgc ggcatcgtct ctgaccagaa agatgacatc    176040
     gagcgtactg ttcatgagtg gtgcttccga atcgactgaa ggccgggcgc gcggaaaggc    176100
     gtggcgcacc ggcggcgccg tcaagccgca cgcgcgcaac ccgcgccggg acgcggcacc    176160
     aatgttgcat ttaaacatgc atgttttcat ttgtgaatat atatttcaaa acatccctgc    176220
     acgcgggatg ctcccgtgcg tggccgccac gcagcgcccg tgccgccgcg tatagcctgc    176280
     ttaccaagcg gccgggcaaa gggggccgaa tggggcgcac gggcggttac agtaacggtt    176340
     gtgagataag cccggagacc tccctcatgc cgatccgccc gttcacgcgc gcctgcctgg    176400
     ttgcggcatt gggcgccgtc ctggccggct gcgccagcaa caccggccag gcgcaggccg    176460
     aaggcgccgc ggccgccaac gccgccacca gcgccgattc cttcgcccag acgacctggg    176520
     agctggtgcg ctggaccaag gccgatggcg gctaccgggt catttcccac ggcgacaacg    176580
     gcgagccgat cttcctgacc tttttcgcgc agggcaagca gtaccgggtc agcggctttg    176640
     ccggctgcaa ccgctacacg ggcgcctacc ggctgcgcga cggcaagctg cagatcaccg    176700
     cgccggccag tacccgcatg gcctgcccgc agcccgagcg cgcccggctc gaagccgact    176760
     acctgcgcgc gctggcgcag atccgctcgt tcacgctgga cagcggcggc gccccgcgcc    176820
     acctgacgtt caacgtgcag ggcggcgacg tgctggattt catgcgccgc caggatcctc    176880
     ccacgccgga ataagccgcg gcgcgggcgc gtgccgcgcg ggcaggccct aaaatcgctc    176940
     ccgtggcgcg gcccggctgg gccgccggtt cccaggagtc ctgtcatgtc cgcaatctcg    177000
     ccggggcgcg tggcgctgtc tttttccctc ttgctggccc tggccgcctg cgctgccgat    177060
     ccggccggcg gcggcgccag ccgggcgcag gcgcccgagc ggcacagcga catgctggcc    177120
     cagaccaatt gggagctggc ccgctggacc cgccccggcg gcgcgctgcg gccggttccg    177180
     catggcggcg ccggcaagac ggcgccgatc acgctgtcgt tcacgcacca gcgcggcgcc    177240
     gcccggctgg ccggctttgc cggctgcaac aattactcgg gccagtacac catcgccaac    177300
     ggcctgctga tcgtcaccgc gccgccggtg agcacccgca tggcctgcgc gaatgccgac    177360
     ctggcccgcc tggagcagga ttacctggcc ggcctcaccg ccgtgaccgc cagccggctc    177420
     gaccatgaca cgcggccgca gcggctgacg ctggcgctgc gctcgggcga cgtgctggac    177480
     ttcgcgcgcc gcgccgatcc gctggccggt ggccagcccg gcgcggccaa gctggtgtac    177540
     gtcgcgtcga gcaaggcgcc ttgcagcgcc ggcgcgggcc gggcccagtg ctaccaggtg    177600
     cgcgacagcg cctcccagcc ctggctgctg tggtacgggg acatcaccgg tttcgccttc    177660
     cagcccggca tcgaataccg gctgcgcgtg gtggaagtgc gcgaccccaa tccgccggcc    177720
     gacgcgtcgg gggtgcgctg ggtgctcgac agcgtggtcg agcagcgcgt ggcggcgccg    177780
     cgtccagccc ccgcgccgta gcgccttggc ggggctgttt actattacgc cctgtttttc    177840
     cttcgttcgt gcttttccgc catgaccgcc gtcgtcaata tcgccgccta taaattcgtc    177900
     agcatcgcca acccggccga cctgcgcgag cccatgctcg aacaggccgg ccagcgccag    177960
     ctcaagggca cggtgctgct ggcgccggag ggcatcaacc tgttcctggc cggggcggcc    178020
     gacgctatcg aaggctttct gcgctggctg cgcgccgacg cgcgctttgc cgacctgcag    178080
     gccaagtaca gcgaatccgc gcgcatgccg tttcgcaagc tgctggtcaa ggtaaagcgc    178140
     gagatcattc gcatggacca cccggccatc cggcccgaag cggggcgcgc gcccgcggtc    178200
     gacgccgcga cgctgcggcg ctggctggcc cagggccgcg acgaccaggg ccgcgagctg    178260
     gtgatgctgg atacgcgcaa tgcgttcgag gtggaggtgg ggacgtttcg cggcgcgctg    178320
     gactggcgca tcgagcgttt cacgcagttc ccgcaggcgg tgcgcgacaa ccaagccgcg    178380
     ctggcgggca agacggtggt cagcttctgc acgggcggca tccgctgcga aaaggcggcc    178440
     atctacatgg ccgaggccgg catcgagcat gtctaccagc tcgaaggcgg catcctgaaa    178500
     tacttcgaag agaccgatgg cgccggcttc gacggcgcct gtttcgtatt cgacgagcgc    178560
     gtcgcgctcg acgcggcgct ggcgccgcag gcctgaaacg gccggcccgc gtggcgggcc    178620
     ggcggcggcg cgctcagcgc acccgcatgc cgggctgggc gcccggccag ggttcgagca    178680
     cgtagatccc gggttcggcc ttctcgtcgg cgtggctggc ggccagcacc atgccctcgg    178740
     acacgccgaa tttcatcttg cgcggcgcca ggttggccac cagcaccgtc agcttgccga    178800
     ccaggtcctg cggctggtag gccgacttga tgcccgagaa cacattgcga tggcgtccct    178860
     cgcccacgtc cagggtcagg cgcagcagct tggtcgagcc ttccacttct tcgcaattga    178920
     cgatgcgcgc gatgcgcagg tcgatcttgg cgaagtcgtc gatggtgatg gtgtcggcca    178980
     gggcctcgcc gcccggcagg gcggccggcg cgctggcttc ggcggcgggc ggctcgaaca    179040
     ggtcgtccag cagcttggga tcgacgcgct gcatcaggtg cttgaacggc gccacccgct    179100
     gcggcagctg ttgcgcgtcg ccccaggcga agtcggcgtt cgcgccgaac agctcgcgcg    179160
     ccacgcggct ggccagcgcg ggcagcaccg gcgccagcat caccgacagg gccttgaagc    179220
     cggccagcgc gcgcgagcag atgtcctgca ggcgggcgcg cgtggccgcg tcggcggcgc    179280
     cgatgccctt ggccatcacc cagggctgcg ccgcgtcgaa cgcctggttg atgcggtcgg    179340
     catgggccat gatttcgcgc accgcgcggt tgtactcgcg cgcctcgaag gcggcgcgga    179400
     tcgattcggc ctgctgcgcg aactcggccg ccagcgcgtc cgtgtcgccg tcgtacgcca    179460
     gttcgccgtc gaagtggcgg gtaatgaagg cggcggcgcg gctggcgatg ttgacgtact    179520
     tgcccaccag gtcgctgttg acacgcgcca cgaagtcttc ggggttgaag tccatgtcct    179580
     cgacgcgcgc gttcagcttg gccgccatgt agtagcgcag ccattcggcg tccatgccga    179640
     tttccaggta gcgcagcggc gagatgccgg tgccgcggct cttggacatc ttctcgccgc    179700
     tgacggtgat gaaaccgtgc acattcagct ggtcgggcgt cttgcgcccg gcgaacttca    179760
     gcatcgccgg ccagaacagc gcgtggaagt aaatgatgtc cttgccgatg aagtgcacct    179820
     gctcggtcgg gccggccggg tcgagcagcg cgtcgaagtc caggcccttg gccgcgcaat    179880
     aggatttcag cgaggccagg tagcccaccg gcgcgtccag ccagacatag aaatacttgc    179940
     ccggcgcgtc gggaatctcg atgccgaaat agggggcgtc gcgcgagata tcccagtcgc    180000
     ccagcttggc ctcgccgtcg tcgccgacca gccattcgcg cgtcttggcc tgcacttcgg    180060
     cctgcaggtg cttgacgccc tggcggttgg cgccggtggt ccattgctgc aggaactcga    180120
     cgcagcgcgg atcggacagc ttgaagaaga agtgatcgga cgacttcagt accggcgcgg    180180
     cgccggtcag ggccgaatag gggttgatca gctcggtggg cgcatacacg gcgccgcaca    180240
     cttcacacga atcgccgtac tggtccttgg cgtggcagcg cgggcattcg cccttgatgt    180300
     agcggtcggc caggaacatg cccttgaccg ggtcgtagaa ctgctcgatc gagcgtgtct    180360
     cgatcagtcc ctcgctcttg agcgcgcgat agatttcctg cgagagcgcc acgttctcgg    180420
     gcgtatcggt gctgtgccag tggtcgaagc ggatatggaa gccgtccagg tagcgcggcc    180480
     gctcggcggc gtagcgggcc accagcgcct gcggcgtgat gccttccttt tcggccttga    180540
     gcatgatcgg cgcgccgtgc gcgtcgtcgg cacccacgaa atgcaccgtg tggcccgcca    180600
     tgcgcatcga acggacccag atgtcggcct ggatgtactc catgatgtgg ccgatgtgga    180660
     acgatccgtt ggcgtagggc agggcagtgg tgacgaagag cgtgcgtgac atgtcgtagg    180720
     aggctcaggg ggaaggaacg gacaagccgg ctattttagg gcctttccgc gcgggcgccc    180780
     gggcgcggcc gcgccggcgc tcgactggag ggggaaaggt atggcccgtg ccggggggcg    180840
     gcgtgcgcgg gctggcctca ggccgggcca ggccggctgg gcatgacggg gggctcaggc    180900
     atgaaaacgc gccgccaggc cgtgccacgg cggcgctgca ggggccggcg ggacgccggc    180960
     gtcagcgcac ttcgcgggct tcgacgtcga tgacgtcgcc gcgtggctgg ccgaacgggg    181020
     cgctggcggc ctggaacgga cccggccggg cggcctggcg ctggctccag taggcgcgca    181080
     cgccgaacgg cttgccgcgt accttggcga ccaggtacag cacgcccacc gcgatggccg    181140
     tggaggccat gaacaccagg gccatcatca tcccgatgag gccgaggagg gcaaatagcg    181200
     cggcgctgaa aaagcggaac agtgtattga ccatgtagat atggatgtaa aaccaggcta    181260
     aaggttcccg cgtatccgct atccttcgag taacggctcg cgtaatggcg cgatgaccct    181320
     gggaaccata gtgtgatgag tataacgata gaacaaatcc gcggcgcgtt ggcgggcgtt    181380
     gccgatccgc agaccggcct ggagctgaat gtttgtgtaa aagatcgtga catccatctg    181440
     gccgcggacc cggccgccct cacgatagag ctgggctatc cggccggcgg cgtggccgat    181500
     tccgtgcgcg cgctggccgg cgccgcgctg gccgccgcgg gcctgggcgc ggtgcgcgtc    181560
     gcggttacct ggaacatcat cgcgcacgcg gtgcagcctg gcctcaagcc cttgccgcag    181620
     gtgcgcaaca tcatcgccgt ggcgtcgggc aagggcggcg tgggcaaaag caccacggcg    181680
     gtcaacctgg cgctggcgct ggcggccgag ggcgcgcggg ccggcctgct cgatgccgac    181740
     atctacggcc ccagcgtgcc cgccatgctg ggcctggccg gccgtcccga aagccgcgac    181800
     aacaagacca tggagcccct ggtcgggcac ggcctgcagg ccaattccat cggcctgctc    181860
     atcgacgccg acgcgccggc gatctggcgc ggcccgatgg tcacccaggc cctggagcaa    181920
     ttgctgcgcc agaccaactg gcgcgacctc gattacctgg tcgtcgacat gccgccgggc    181980
     accggcgaca tcgcgctgac cctggcgcag aaagtcccgg tcgcgggcgc ggtcatcgtc    182040
     accaccccgc aggacatcgc gctgctcgat gcgcgcaagg gcctgcgcat gttccagaag    182100
     gtgcatgtgc ccatcctcgg cgtggtcgag aacatggcgg tgcacatatg cccccaatgc    182160
     ggccatgccg agcacatttt cggcgcaggc gggggccgcc gcgtggccga gcagtacgag    182220
     gtgccctggc tgggcagcct gccgctgcag cgcgccatcc gcgagcagac cgacgccggc    182280
     aaccccaccg tggcggccga gccggagagc gaggttgccg gcatctatcg cgacatcgcc    182340
     cgccgggtgg cggcgcgcat tgcgggcctg ccgcgcgaca tggcgggcaa gctgcccgcc    182400
     gtggtggtcc ggcccgcctg acgcatgcgt cggatattgc gtgtctgccc cgctctcctg    182460
     ttcgcgcttg ccgcgggaca ggtccatgcc aagctgccgg aggtgatcgt cgatcccggc    182520
     ggcgtgccgc cggccgcgct gcaggccatc aacagcgcgg tcgacgccat cgcgcgcctg    182580
     tccgaggacc aggacggcgg cgaaatcgac cgcctgcgcc gccgggcgcg cgacgcgacg    182640
     ctggccgcgt tggcgacgca gggttatttc acgcccaccg tcaccctgac gccgggcacc    182700
     gacgtgggcg gcgaaacctg ggacatcgcc atcgagccgg ggccgcgcgc ccgggtcgcc    182760
     agcgtcgacc tgaaattcac cggccgggtc gcgcgcccgg aatacgccgc gcgcatccag    182820
     aagtggcgcg acgactgggc cctgaaggcc ggccagccct tcatcaacgg cgactggaac    182880
     aaggccaagt ccggcctgct cgacgccgtg tccacgcgcg acttcctgct ggcgcacatg    182940
     acccattcgc tggccgaggt ggacgccgaa accgcccagg tgcgcctgtc ggtggagatc    183000
     gacagcggcc cggcggtgcg catgggcgcc ttgcagaccg acggcctgca gcgcgtgccg    183060
     gaaagcctgg tgcgccgcta tgtgaagtat tccgagggcg cggcctacga ccaggacaaa    183120
     ctcgaccagt ggcagcagga gctgcagtcc acggcgttct tccgcggcgc gttcgtcacg    183180
     ctggaccagg gcgcgcgcgg cggccaggac gacgtgaagg tgaccgcgcc gggcgcgagc    183240
     gcccgcgcgc ccggctccag cggcctggcc tcggtggcgc cggccggcga tgccgaggtg    183300
     gcgggcgggc cgacggccgc cgcgcccgtg ctcgactcgc aaggcgagat caccctgccg    183360
     gtggacgtgc gcgtggtcga ggccccgccc aagcgcctgg cggtatcgct gggcgtggac    183420
     gacgaggccg gcgtgcgctt cgagaccatc taccggcaga acgtcgtgtt cggccagccg    183480
     gtcaccatgg aaaccggcct gggcgtggac cggctgcgcc agcgcgccta tctggacttc    183540
     aacctgccgc ccgacgagcg cgggcgcaag gattccttcg gcctgctgtt cgaccactcc    183600
     gacgtgcagg agctggacgt cacgcgttat gcgctgggtg tcacgcgcct gcaggagcgc    183660
     aagggcgccg gcgacagccg ggtcgaatac gagacgcgct ggggcggcct gctggcgcac    183720
     gaccacgtca agatcgatgg cggcgacgag tacgacctgc ccaccgccac gctcacggcc    183780
     gagtggctgc ggcgcgacgt caacagcaag tacgacccgc gcgagggcaa cctgatcgcc    183840
     gtcggcggcg gggtgggcgc cacgctcgac gatggccagc cctacatgcg cctgcggctg    183900
     cgcggccaga aatggtggcc gatcggcaag ctggacgtgc tgaccctgcg cggcgaggtc    183960
     ggccggctct ggtccaacgg ccgcacccgc gtgcccgacg acttcggctt tcgcaccggc    184020
     ggcgcgcgtt cgatccgcgg ctaccgctac cagagtatcg gcgtggagca ggacgacgcc    184080
     atcgtcggcg cgcccacgct ggccgtggcc agcgtggaat acgaccacta tttcaatgaa    184140
     cgctggggca taggcgtgtt cgtcgacgcg ggcgacgcgg ccgaatcctt cggcgacatg    184200
     gacatcgccg tgggctatgg cgtcggcgcg cgcgtgcgca cgccggccgg cccgctgttc    184260
     ctggacgtcg cgtacggcca gcgcgaacgc gacctgcggc tgcacttctc gttggggatc    184320
     gcgttttgag caagatatgg ggcgtcgtgc gccacatcct ggtctggtgg gtgccgggcg    184380
     tggccatgct ggccgcgctg gcgtgcgggt tcgtgttctg gaccgtggcg tcgcaaaacg    184440
     gcacgcgcct gctgctcgac accgtggccc ggcagctcga cggcgagatc gcgggcgtgc    184500
     gcggcagcgt gctgcgcggc ctgcgggtcg accgtatccg cctgtcggtg gccgacgtgg    184560
     atgtggccgt cgacgacctg cggctggacg tggcgtggcg ggcgctgggc cagcggctgc    184620
     tgcatgtgcg cgagctggcg gccacgcgcg tcgaggtcgg cctgcatacg ccggccacgc    184680
     cgccgcccga cagcgacgag ccgttcgccc tgcgcctgcc ggtggagctg gcgctggacc    184740
     gtctcagcct gggcgaattc gtcctgcgcc aggatggcga gccgctgccc gtgagcgcgg    184800
     gcgagctgca ggccagcctg gcggcgggcc gccacggcgc gcgcctgacc ctggacagcc    184860
     tgcgcgtgac ccatgccgtg ggcacgctgc gcgcgcaagg ccgcctcgat gtggcgagcc    184920
     tcgcccagcc gtggccgctg acggccagcc tggatttgca ggcgcagggc agcggccccg    184980
     aatcgccgct gtgcctggcg ccgctgctcg acgccaggga caaaacggcc aaggacaagg    185040
     ccgccaagga caagggcaag gacaagggca aggacaaggg caaggacaag ggcaaggaca    185100
     agggcaagga caagggcaag gacaagggca aggacaaggg caaggacaag ggtaaggacg    185160
     acgccgggga aaagccggac gagccggccg acccgtgcgg cctcgcgctg caggtccagg    185220
     cgcagggcac gctcgaacag ctggaggccg aactgaccgg cgccggccag gggctggccc    185280
     tggaggcgcg cgccggcctg ttgccgcagg cgccctttcc gctgcgcacg gccagcctga    185340
     aactgacgcg ggaggacaag tccagcctgg ccgccacgct ggattggcag ccgcagcccg    185400
     gccagcccgg ccgcgaccgc gtcgtcgcca cgttcgaggc cgagcggctg gacctgcagc    185460
     gcctggccgg cgaggccatc ccgccggcga tgctgagcgc gcgcggcggc ctggacgccg    185520
     aagtcgacga tctcagcagc ctgcaccgcg ccacgctgac gctggacgtg accaagggca    185580
     gcagctggaa ccgccacccc ctggccggca aggtcgccgc cagcgtgagc gcgctgggcg    185640
     atcccccggg ggctttcgcc acggccgcgc cggcgcagcc gcacgcgctg ccgggcgggc    185700
     tgtgggtcga ccagctcgac gtcgacctgc aactgggccc gaaccgggtg cgcgcccagg    185760
     gcaagctgga cgaacgcgcc ggcgcgctca agctggacgc gcaggcgccg cgcctggacg    185820
     cgttctggcc cggcattccg ggcgcggcca gcgtcaaggc cgcgctcgat ggcgccctgg    185880
     cccgtcatcg cggccgcatc gaggccgcct atacgccggc cgacgcccgc gcgcgcgtgc    185940
     tgggccgcgc gcgtgcgcag gcgcagctgg agttcagcgg cggctggggg gcggggccgg    186000
     ccgccgaggg cgccgccgcc ggctggcgcg gctcggtatc gcgcctgacg gccgacagcg    186060
     ccggcttcgc gctggccctc gagcgtcccg tcacgctggc ctacgtgccc gaggcgcttg    186120
     ccccgcaatg gcagtggcag gtcggcgcca ccaccctggc gctgaccttc cccgacaagc    186180
     agcgcgtcgc gctggcgcat gccgcctcgc gcggcggcgc cgggcgctgg gaaaccgcgg    186240
     gccgcgccga cgcgctggtg atcaccgcgg ccatggtgcg ccagatactg gtggcgctgg    186300
     atcccgaggc cgtggcgcgc gccgagcgcg acagcggcag tccggtcaac gccccggtgc    186360
     cggcggcgca gcgccgcatt tcgctcgacg cctcgtggga cctcaaattc gccggcgcgc    186420
     tggccggcaa ggtccgggtg gcgcggcgcg acggcgacct gcgcattccg ggcgatccgc    186480
     cgatcccgct gggcctgcgc acgctggtgc tcgaggccaa cgccacgccc accggcgggc    186540
     aggccagccg cctcgacgcg cggctggaca tggcgaccgc caggatgggc gccatcaacg    186600
     gcaccgccag cgccacgctg ggcggcctgg cgctggaccc gcgccagccg atccgcgtcg    186660
     ccctcgatgc cgacgtgacc gacctggcct ggctgggtct gttcgtcggc gacacgctgg    186720
     aggtcggcgg catgctcaag gccaatgtgc gcgcgcaggg ctcgctcgac ggcaaatgga    186780
     acgccagcgg cacggtcaac ggcgacaagc tgcgcgtggt gcgcatcgac gacggcgtgc    186840
     ggctgatcga cggcatgctg cgcgcgcgcc tgcaggacga tcgcgtcatc ctggattccc    186900
     tgcgttttcc ggcctcgctg cgcgtcatgc cggccgaatg gcgcacgcgc gagtgggtca    186960
     gcaccaatcc cgacgccaag ggcggctacc tggaggccac cggccaatgg gagctgtcgg    187020
     ccgcgcgcgg ccaggtgcgg ctgcaactgc atcgcttccc ggcgctgcag cgctcggacc    187080
     gctacggcat ggtgtccggc gtggtgacgc tggatgccgc gctgccgcgc atctccatca    187140
     atggcgacat caccgccgac gccggctggg tcagcctgga gatcctgcag ggcgtgccga    187200
     ccctggacga cgacgtcaag gtggtgcggg ccggccagaa gaacgcccaa ggcgacggtc    187260
     cgccgctgca gatcgacatg aacctcaagg tcgacatggg gccgcgcttc tacatcaccg    187320
     gcatgggcct ggatgccggc ctgctgggct cgatccagat ccgccttcag gagggaaggc    187380
     tgaccggcta tggcgcgctg cgcacgcgcg gcgggggcat cgaggcctac ggccagaagc    187440
     tgcgcctgcg gcgcggcacg ctgaccttcc agggccggct ggacaacccg ctgctcgaca    187500
     tcgaggcctt gcgcaccggc gaacaggtcg aggcgggcgt gcgggtggcc ggcacggcgc    187560
     agcggccgcg catcgacctg gtgtcctatc cggatgtcag cgacgtcgag aagctgtcgt    187620
     ggctggtgct gggccgcggc ccggacgcca gcggcggcga cacggcgctg ctgctgtcgg    187680
     tcggcacggc gctgctgggc ggcgggcagc cgttctacaa gcagttcggc ctggacgacg    187740
     tcagtgtgcg gtccggcgcg atcggcagct ccggcagcct gctgcccgac cgcaccgtgg    187800
     ccgccggcgt caaccgcgac agcgacgccg acctggcgac gcagttcctg gtggccagca    187860
     agcgcttcgc caacggtatc acgctcagcg tcgagcaggc gctggccggc agcgaaacgg    187920
     tcgggcgcgc cagctaccgc ctggcgcgcg gcctgtcgct ggacctgaag gccggctcgg    187980
     tcaacggaat cgcgctggta tatcggatct tgctggatga ctgagcgcca aggcggcggc    188040
     cggcggcggg tagaataccc ttcattcaat cgaggcgccc aaccatgagc atcaaaagcg    188100
     accgctggat ccgccgcgcg gccgaagccg gcatgatcga acccttcgag ccgggccagg    188160
     tccgcaccgc gggcggcaac cgcatcgtca gctacggcac cagcagctac ggctacgacg    188220
     tgcgctgcgc ggacgaattc aagatcttca ccaacatcaa ttccaccatc gtcgatccca    188280
     agcagttcga cgagaagtcg ttcgtcgact tcaagggcga tgtctgcatc atcccgccca    188340
     actcgttcgc gctggcgcgc acggtcgagt acttccgcat cccgcgcagc gtgctgacga    188400
     tctgcctggg caagagcacc tacgcgcgtt gcggcatcat cgtcaacgtc acgccgctcg    188460
     aacccgaatg ggaaggccac gtcacgctgg agttctccaa caccacgccg ctgccggcca    188520
     aggtctacgc cggcgagggc tgcgcccaga tgctgttcct cgaaagcgac gaggtgtgcg    188580
     agacctcgta tcgcgaccgc ggcggcaagt accagggcca gcgcggcgtc accctgccgc    188640
     gcacctgagc ggcggctatt gccaggggtc gtacgagccg acgctccaga tatgcccctc    188700
     cgggtcgcgg cacgaaaagc cgcggccgcc gtaatcggcg tcggcaatat cgatcagtat    188760
     ctcggcgccc gcggcctgcg cgtcccggta ggcctggtcg gggtcggcca ccaccaggta    188820
     cacgctttgc gtctccacgc cgccgacctc gtcgggctgc ttcatgtagc gggaaaacgg    188880
     tgtgtccgtc accgacgcca gcatgatcat gccgctgccc agcgtcagct gggcatgcac    188940
     gatggtatcg gccgggccgg gcacgatgcg ttgcgcctcg aacccgaacg cgtgcaccag    189000
     ccattcgatg gcggcgctgg cgttgcggta gcgcaagcag gtcacgacgg gtgaggcgac    189060
     ggtggctggg gctggcatgg cggtctccgg ttcggcgcgg cgcgttcagg gcgccgcggc    189120
     ggcgagggcg tcgtagccct cgcccaggaa ctgcaggatg cacacgccgt tgccgtaggg    189180
     gtcggacaga tgcgcgatgc ggccccaggc gtggctgtgc ggcggatctt ccagcatagc    189240
     gccggcggcc accgccgtgg cgaccgccct gtcgcaatcg tccaccacga aatccaggtg    189300
     caccggcgtc cagtggcgcg cgtagtcgcg cccctggctc gtgcccgtgg ccgcctgcga    189360
     gccggttgcc ttctccagca ggtagatggg cacggcggcg cccgccatct cgatggcctg    189420
     cggccccagc cggcgctgcg gacgcaggcc gaaggcgcgt tcgtagaaca gcgcggcccg    189480
     cgccgcgtcg ggaacgtcga tattgatcag tacctgtgcc tgcatggtgt cggctccagt    189540
     ccgggaccgg ccctcagcgc gcggccagcg ggcggatcat gagaatattg gccagcaggc    189600
     ggccgcccac cagcatcgcg tcgggctcgc ggccatactc ggcgaagccc aggctggcgt    189660
     acagcgcgtg cgcggcgccg ttgtcggcgc ccacgctcag cagcacgtgg cgtaccccgg    189720
     tcatccgggc cgcccgtgcc agcagcgcct cggtcaattg gcgcgccagg ccgccgcggc    189780
     gttgcgcggg tacaacgtaa ataccccaga tttcagcctt gtgacgttgt ttcattgtgt    189840
     gcccgcgcgc cacgccgccg accccggcca gggcgccgtc cacgaaggcg cccagcagca    189900
     cgtaaccctc gcgcggggca aggcgggcgc gccattgcgc gattgtgtca acgctttctt    189960
     cttcgtaact ggacccgaag gcttcgggcg cctcgcgcag ggcggccagg cgaacgcgtt    190020
     gaaaaattct gcagcatcct cgggcgtcaa agggcgtatg gtggaaagat tcacgtctgg    190080
     ctccgcagcg tacgcgcagg gtggcggcag ggttgcgcca aatataatga agatacgtga    190140
     aaagcgcggc tgtttcgcgg cgcaggagcc ccagatgttc ggtttccgca ggaaagacac    190200
     gcagcagtac gaccaggagg cgcaggacgc cttcgttgaa cgggtcgccg cggcggcgcg    190260
     cgatttcgtg gccgccgtcc ccgccggggc ggggctggac tactcgccgg ccagcatcgc    190320
     cgcgctcgac gccgtgctcg aacaggccca cctgggcgcc ctggcgctgg acccggtgca    190380
     acgggtgggg gcggccgcct acctgtacga ggtggcgcgg cgtcgccacg gcgggctgta    190440
     cgaggtctgc gacgatgacg atccggtggt gctggtgacc ggcgagcccg agttcgacgt    190500
     ctgcctgtgc gccatcgcca aggtcgagcg ccgcatcgac gccggcccgc aggaagacct    190560
     gcggccgttt ttcggccgct acgagcaggc cgtcgcggcg cgccggcccg acatcattcg    190620
     ctgacgccgc gcgccggcgg gcgcacccgc tttcaatccg tcctacaatt ccccgaggtc    190680
     ggcccgctcg tcgggccggt tgcttttttg tcaccagccc gaccccgtct ggcagtacac    190740
     tcgcgtccgt tttgccttgc ccgcccagga gcgcccgcat gaaattccgc ttccccattt    190800
     tcatcatcga cgaagactat cgctccgaga acgcctcggg gctgggcatt cgcgcgctgg    190860
     cttcggcgat cgaggccgag ggcgtggagg tcatcggggt gaccagctac ggcgacctga    190920
     gctcgtttgc ccagcagcaa agccgcgcca gcgccttcat cctgtcgatc gacgatgagg    190980
     agttcgacgt cgattctccg gaagacgtgg cgggcgcgat caagaacctg cgcacgttca    191040
     tcggcgagct gcgtttccgc aacgccgaca tccccatcta cctgtacggc gagacgcgca    191100
     cgtcggaaca catcccgaac gacatcctgc gcgagctgca cggcttcatc cacatgttcg    191160
     aggacacgcc ggagttcgtg gcgcgccaca tcatccgcga agcgcgcagc tacgtggacg    191220
     gcctgccgcc gccgttcttc cgcgagctgg tcaaatatgc ccaggacggt tcgtattcct    191280
     ggcactgccc ggggcactcg ggcggcgtgg cgttcctcaa gagcccggtg ggccagatgt    191340
     tccaccagtt cttcggcgag aacatgctgc gcgccgacgt ctgcaacgcg gtcgacgagc    191400
     tgggccagct gctggaccac accggcccgg tggccgagtc cgagctgaat gccgcgcgca    191460
     ttttccatgc cgaccactgc ttcttcgtca ccaacggcac ctcgacgtcg aacaaggtcg    191520
     tctggcatgc caacgtggcc gccggcgacg tggtggtggt ggaccgcaac tgccacaagt    191580
     cgatcctgca cgccatcacc atgaccggcg cgatcccggt gttcctgcgc cccacgcgca    191640
     accacctggg catcatcgga ccgatcccgc tcgacgaatt cgacccggaa aacatccgcc    191700
     gcaagatcga ggccaacccg ttcgcgcgcg aggcgctgaa caagaagccg cgcatcctca    191760
     cgctgacgca gagcacctat gacggcgtca tctacaacgt cgagatgatc aaggaaaagc    191820
     tgggcaccta cgtcgacacg ctgcatttcg acgaggcctg gctgccgcac gcggccttcc    191880
     acgagtacta ccgcgacatg cacgcgatcg gcccggaccg cccgcgcagc caggacgcca    191940
     tggtgttcgc cacgcactcc acgcacaagc tgctggccgg catctcgcag gcctcgcaga    192000
     tcatcgtgca ggagtccgag agccgcaagc tggaccgcaa cctcttcaac gaggcctacc    192060
     tgatgcatac gtcgacctcg ccgcagtacg cgatcatcgc gtcgtgcgac gtggccgccg    192120
     ccatgatgga gccgccgggc ggcaccgccc tggtcgagga aagcatccgc gaggccatgg    192180
     actttcgccg cgccatgcgc aaggtggcct ccgagttcgg caaggacgac tggtggttca    192240
     aggtgtgggg ccccaaccgc ctcgcgcccg agggcatcgg ccatcgcgac gactgggtgc    192300
     tggagtcggg cgaccactgg cacggctttg gcgacctggc gccgggcttc aacatgctcg    192360
     acccgatcaa ggccaccatc atcaccccgg gcctggacat gtcgggcagc ttcggcgaaa    192420
     gcggcatacc ggccgcgctg gtgtcgaagt acctggccga gcacggcgtc gtggtggaga    192480
     agaccggcct gtattcgttc ttcatcctgt tcaccatcgg tatcaccaag ggccgctgga    192540
     acaccctgct gaccgcgctg cagcagttca aggacgacta cgaccgcaac cagcccctgt    192600
     ggcgcatcct gcccgagttc tgccgcggtc accgccgcta cgagcgcatg ggcctgcgcg    192660
     acctatgcca gcagatccac gaggcctatc gcgaacgcga cgtggcgcgc ctgaccaccg    192720
     agatgtacct gagcgacatg gtgccggcgc tcaagccctc ggacgccttc gcccgcatgg    192780
     cgcaccgcga agtcgagcgc gtcgagatcg accagctcga aggccgcgtg accggcgtgc    192840
     tgctcacgcc gtacccgccg ggcattccgc tgctgatccc gggcgagcgc ttcaaccgga    192900
     ccatcgtgca atacctgcag ttcgcgcgcg agttcaacga gcgcttcccc ggcttcgaga    192960
     cctacatcca cggcctggcc gacgaagagg gccccgatgg cgccaagcgc tattacgtcg    193020
     actgcctgaa ggacgccggc gagcagtaaa tccgacgcgc cgcgccgcgc cgcccgaggg    193080
     ggcggcccgg cgcggcgttg tcttcgaggg agtatcccgt ttcgatgttc gatgtcgccg    193140
     tcatcggcgc cggggccgcc ggcatgatgt gcgccgccgt ggcgggccag cgcggcctgc    193200
     gcatggtgct gatcgatcat gccgccaagc tggccgagaa aatccgcatc tccggcggag    193260
     ggcgctgcaa cttcaccaac ctgggcgccg gcccggccaa tttcctgtcc gacaacccgc    193320
     atttctgccg ctcggcgctg gccggctaca ccccgcagga tttcctcggc ctgttgcgcc    193380
     gccatcgggt gcattggcat gaaaagcatc gcgggcaact gttctgcgac gacagcagcg    193440
     aaaccatcat cgaggtgttg cgcgccgagt gcgggcaggg cggggtggcc tggcgcatgc    193500
     cgtgccgcgt ggacgagatc gcccgccgcg agggcggcgg cttcacgctg cgtaccagca    193560
     ccggcgcgat cgacgcgcgc gcggtcgtgg tagccaccgg cggcatggcg atcccgcaac    193620
     tgggcgcgac cgactacgcg ctcaaggtgg cgcgccagtt cggcctgaag gtcgtcgagc    193680
     cgcggccggc cctggtgccg ctgaccttcg atcccgcgca atggcagccg ttcgccgcgc    193740
     tgtcgggcgt cgccctggaa gtcacgctgt cgaccgggca gggcaagggg cgcgcggcgt    193800
     tcctggaaga cctgctgttt acccaccggg gcctgtccgg ccccgccatc ctgcagatat    193860
     cgagctactg gaagccgggc gagcccatcg tgctggacct ggcgcccggc cgcgacctgg    193920
     ccgccgaact gataggcgcc aagccgggca accggcagca gctgcatacc gtgctggccg    193980
     gcctgtggcc ccggcggctg gccgatacct ggctggacgt ggccgggcgc gccgtcggcg    194040
     cggacctggc cgccgcgcgc ctggccgacg tgccggaccg cacgctgcgg gcgctggcgg    194100
     cgctgatcca tgactggcgc ctggtgccca gcggcacggc cggctacaag aaggccgaag    194160
     tgatgcgcgg tggcgtcgac acgcgcgccc tggaccagaa gtccatgcag gcgcgcggcg    194220
     tgccagggct gtacttcatc ggcgaggcgg tcgacgtgac gggctggctg ggcggctaca    194280
     acttccagtg ggcctgggcg tcggggtacg cctgcggcaa cgccctctag ctgtgaagat    194340
     tcaataggtt gtatgcatgg ttcatccgaa ccggatttga gaaactggaa atcgccaccc    194400
     ccccagttca ctcaaggagc ccggccggat gaacacccat aagcatgccc gattgacctt    194460
     cctacgtcga ctcgaaatgg tccagcaatt gatcgcccat caagtttgtg tgcctgaagc    194520
     ggcccgcgcc tatggggtca ccgcgccgac tgtgcgcaaa tggctgggcc gcttcctggc    194580
     tcagggccag gcgggcttgg ccgatgcgtc ctcgcgcccg acggtctcgc cccgagcgat    194640
     tgcgccggcc aaggcgctgg ctatcgtgga gctgcgccgc aagcggctga cccaagcgcg    194700
     catcgcccag gcgctgggcg tgtcagccag caccgtcagc cgcgtcctgg cccgcgccgg    194760
     tctgtcgcac ctggccgacc tggagccggc cgagccggtg gtgcgctacg agcatcaggc    194820
     ccccggcgat ctgctgcaca tcgacatcaa gaagctggga cgtatccagc gccctggcca    194880
     ccgggtcacg ggcaaccgac gcgataccgt tgagggggcc ggctgggact tcgtcttcgt    194940
     ggccatcgat gaccacgccc gcgtggcctt caccgacatc caccccgacg agcgcttccc    195000
     cagcgccgtc cagttcctca aggacgcagt ggcctactac cagcgcctgg gcgtgaccat    195060
     ccagcgcttg ctcaccgaca atggctcggc ctttcgcagc cgcgccttcg ccgcgctgtg    195120
     ccatgagctg ggcatcaagc accgctttac ccgaccttac cgcccacaga ccaatggcaa    195180
     ggccgaacgc ttcatccagt cggccttgcg tgagtgggct tacgctcaca cctaccagaa    195240
     ctcccaacac cgagccgatg ccatgaaatc ctggctacac cactacaact ggcatcgacc    195300
     ccaccaaggc atcgggcgcg ctgtacccat ctccagactc aacctggacg aatacaacct    195360
     attgacagtt cacagctagc ctggcgggca cggcgcatgc gggcagggcc gcgcgcctat    195420
     tgttttggta aatggaaatg actatcattt gtctttacca aatgcaaatg ccggagaccg    195480
     catgccatac gtcctgcctg ccctttcgta tgcctacgat gcgctcgagc cgcatatcga    195540
     tgcacgcacg atggaaatac accatacgcg ccatcaccag acctacgtca acggcctgaa    195600
     cgccgcgctc gaaggcgccg gcctggacag cgaggagccg gtcgagcaac tgttgcgccg    195660
     catcccggcg ctgccgccgg gcatccacgg cgcggtgcgc aaccacggcg gcggccatgc    195720
     caaccacagc ctgttgtgga ccgtcatgtc gccgtcgggc ggcggccgcc cggatggacg    195780
     gctggcggcc gacatccagg cccagctggg cgggcacgac gccttccagg cggccttcac    195840
     gcaggccgcg ctgggccgat tcggcagcgg ctgggcctgg ctgaccgtca cgcctgccgg    195900
     ccgcctgcgg gtcgacagca gcgccaacca ggattcgccg ctcatggagg gcaacacccc    195960
     gatactcggc ctggatgtct gggagcacgc gtattacctc cagtaccaga accgccgccc    196020
     cgaatacatc gaggccttct accgggtggt ggactgggcc gaagtggcgc gccgctacga    196080
     gatcgccctg gccgagctcg gccgggaggc cgcatgaata cccacagccg ccaccgcgtc    196140
     cgtccggcgc tcaccagcgt cagcgccatg accctggcgg tgctggtggc ctgcctggcc    196200
     tgctaccagc tgtgggagtt cctcgaccgg cgctggccgc acgtcgccct ggccatggcc    196260
     ggcggcatgg tggccgccgg cgccaccgcc ctgggcgcgg tgccggtgct cttctcccag    196320
     accctgtcgc agcgcgtgca ggactgcatg ttcggcttcg gcgccggcgt catgctggcg    196380
     gccagcgcct tctcgctggt ggtgccgggc atcgccgcgg ccggcgcgca gggctacggc    196440
     ccctgggggg cgggcatcct ggtgggggcg gccatcctgc tgggcggcgc ggtcctgctg    196500
     gccagcgaca ggctgctgcc gcacgagcac ttcatcaagg gcaaggaagg gcgcgcctcg    196560
     cgcaccctgc gccgcacctg gctgttcgtc ttcgccatca tgctgcacaa cgtgcccgaa    196620
     ggcctggcca tcggcgtggg ctacgcgggc agcgacagcc tgcgcggcgc ggcgctggca    196680
     accggcatcg ccatccagga cgtgcccgaa gggctggtgg tggcgctggc cttgctggcc    196740
     gccggctaca gccgtgcgtt ctcggtggcg ctgggcatgc tgtccggcct ggtcgagccg    196800
     ctgggcgcca tcgtgggcgc ggcggtggtg ggctggtcgg cggcgatgct gccgtggggg    196860
     ctgggtttcg cggccggcgc catgctgttc gtcatcagcc acgagatcat ccccgagtcg    196920
     caccgcaagg ggcatgaggt gccggccacc gccggcctga tgctggggtt cgtgctgatg    196980
     atgctgctcg ataccgcgct gggctgaggc gccgaaacag gggcggatcg gcgcccatcc    197040
     ggacgctttg cggcatggcg ctttcgatgt atgctttgcg cgctgtcacg catgtcgcgg    197100
     gagagagcgg ccgattgcgg ctgccgccga aggcgcaatt cgcccggaat cgctcaggta    197160
     acccataccg cgactgcatc gagtagcgcc tggcgcgctc gaaacagcac tctggagaga    197220
     cctggcgcgg ccaccttcgc ggtgcgcaag cagcccaggc gccgaaggtg caaacccgct    197280
     cgcgcggggc aactctcagg caaaaggaca gaggggcgga aaattcgacc ggttcccgga    197340
     cgctttccgc atcggggccg gcattccgta atcctggcaa tgctgccgct ggagccctcg    197400
     catgtccgca ccgctcaaac gcaccccctt ggccgaagaa catcttgccg ccggcgcctg    197460
     tatggtcgac ttcggcggct gggacatgcc gctggcctat ggctcgcaac tggaagagca    197520
     ccacgcggtg cgccaggacg ccggcatgtt cgacgtctcg cacatgctca acgtcgatgt    197580
     cggcggcgcc gacgccaccg ccttcctgcg ccgcctggtg gccaacgacg tggcccgcct    197640
     ggccacgccg ggtaaggccc tgtacagctg catgctgaac ccgcagggcg gcatcatcga    197700
     cgacctcatc atctactact tcgcgcccga ccaatggcgc gtggtggtca acgccggcac    197760
     ggccgacaag gacatcgcct ggatgcagcg cgtggccgcc gccgacggct tcgatgtcgt    197820
     gatcgcgccg cgccgcgacc tggccatggt ggcggtgcag ggccccaacg cccgcgccaa    197880
     ggtgtgggcg gcccgtcccg cgtggcaggc ggcgtccgag ccgctggcgc cgttctcggc    197940
     cgcggccgtc gaggctggca cgctggtggc gcgtaccggc tataccggcg aggacgggtt    198000
     cgaaatcgtg ctgcccgccg acgcggtggt ccagctgtgg cgcgacctgc tggcgcaggg    198060
     cgtgcggccc tgcggcctgg gcgcgcgcga cacgctgcgc ctggaggcgg gcatgaatct    198120
     ctacggccag gacatggacg aactcgtcca tcccgaccag gccggcctga gctggaccgt    198180
     tgcgctcaag gacgaggcgc gccgcttcgt ggggcgcgat gccatcgagc agttcgccgt    198240
     gccgcgcgcc ttcgtcggcc tgaagctgca ggagcgcggc gtgatgcgcg cccacatgcc    198300
     ggtgcgctgc gcgcagggca tgggcgagct caccagcggc accatgtcgc ccaccctggg    198360
     cgtgtcggtg ggctttgccc gcatgccggt gggcgtgcag cccggcgacg ccgtcgaggt    198420
     ggaaatccgc ggcaagtggg tgcccgccct ggtatgcaaa ttgccgttcg tgcgtcacgg    198480
     caaagccgtc gaacactcgt aaactcgagg cttccgcgcg gccgttggcc gccggaggcg    198540
     cgcaaacttt ctccattccc actgaattgc cagaggagct cccatgagcc tgcccaccga    198600
     tcgcaagtac accgagtccc acgaatgggt ccaagccgaa ggcgatgtgt tcgtcgtcgg    198660
     catcaccgac aacgcccagg agcagctggg cgatctggtc ttcgtcggcg acgtcaaggt    198720
     cggcgccacg ctgaaggccg gcgaaaccgc cggcgtggtc gagtcggtca aggccgcctc    198780
     ggacatttat gcgccggtcg acggcgagat cgtcgcgttc aacgacgaac tcgaagccaa    198840
     ccccagcctg atcaacgaat cggcctatac cgcctggatc ttcaagatca agccggccaa    198900
     cgcggccgac ctggacaagc tgcttgacgc ggccggctac caggccgtcg ccggctgaca    198960
     ggccgcaacg ggccggcccg cgggccggcc ccgcctcccc gttatttcga gaaaaccatg    199020
     tcgcgcgccc ctgacaccca ttccgatttc attccccgcc atatcggccc ctccgacgag    199080
     gaccaggcca cgatgctggt cgccatcggc gcagccagcc tggatgccct gatcgacgaa    199140
     gtcgtgccgc cccgcatccg cagccgcgcg ccactggcgc tgcccgccgc gcgcagcgaa    199200
     accgatgtgc tgcaggacct gaagcggatt gccgcgcgca accagatcta tcgcaactac    199260
     atcggccagg gttactacgg cacgcacacg cccaacgtgg tgttgcgcaa tgtgctcgag    199320
     aacccggcct ggtacaccgc ctacacgccg tatcagcccg aaatctcgca gggccgcctg    199380
     gaggcgctgc tcaattacca gaccatggtc gccgacctga ccggcctgga catctccaac    199440
     gcctcgctgc tggatgaagg caccgccgcg gccgaggcca tgacgctggc gcgccgcggc    199500
     agccgttcgt ccagtccggt gttcttcgtg tcgcagcact gccacccgca gacgctcgaa    199560
     gtggtgcgca cgcgcgccga gggcctgggc atcgaactgg tgatcggcga cgagtcgcgc    199620
     gggctgcccg aatgcttcgg cgtgctgctg cagtatccgc acagcctggg cggcgtggcc    199680
     gattaccgcg aactggcgca agccgcgcac gcgcagggcg ccgtggtcgc ctgcgtgacg    199740
     gacctgctgg cgctggcgct gatcgagccg ccgggacaat ggggcgccga catcgccgtg    199800
     ggttcggcgc agcgcttcgg cgtgccgttc ggcttcggcg gcccgcacgc cggcttcatg    199860
     gcctgccgcg atgcgtacaa gcgcaacatg cccggccgcc tggtcggcgt ctcgaaggac    199920
     gcccagggca acccggcgct gcgcctggcc ctgcagacgc gcgagcagca catccgccgc    199980
     gagaaggcga cctccaacat ctgcaccgcc caggtgctgc tggccgtgat ggccggcctg    200040
     tacgccgtgt ggcatggccc gcgcggcgtg cgccgcatcg ccgagcgcgt gcaaagcctc    200100
     accggcgcgc tgcgcgccgc gctggccggg ctgggcgtga aagtcgccaa cgacacctgg    200160
     ttcgacacgc tgtcgctgga aaccggcgcg gccaccccgg ccatcctggc cgccgcggat    200220
     tgcgcccgga tcaacctgcg ccaggtcgat ggcgcgcgcc tggcggtgtc gctggacgaa    200280
     accgtgaccc tcgccgacct gcaggccttg gtcaatgtgt tcgcggccgg cctgggcaag    200340
     gacgaggtgg cgctggcgcc gccgcaggcg tcgctggacg gcatccccgc ggcggtacgc    200400
     cgccaggggc ccatcctgtc gcatccggtg ttctccagcg tgcagtccga gaccgacatg    200460
     ctgcgctacc tgcgcaagct ggccgacaag gacctggcgc tggaccgcac catgatcccg    200520
     ctgggctcgt gcaccatgaa gctgaacgcc acggccgaga tgatccccat cacctggccc    200580
     gagttcgcgc tgatccaccc gttcgcgccg gcctcgcaga cgccgggcta tcgcgagctg    200640
     atcgagggcc tgtcggcgca gctgtgcgag atcaccggtt acgacggcat cagcctgcag    200700
     cccaactcgg gcgcgcaggg cgagtacgcc ggcctgctgg cgatccgcgc ctaccaccag    200760
     gccaatggcc agccccagcg caatgtctgc ctgatcccgg cctcggcgca cggcaccaac    200820
     ccggcgtcgg cccagctggc cggcatggac gtggtggtgg tggcgtccga cgccaacggc    200880
     aacgtcgacc tggccgacct gcgcgccagg atcgcgcaag tgggcgaacg cctggcggcg    200940
     ctgatgatca cctatccctc gacgcacggc gtgttcgagg aagccgtgac cgaaatctgc    201000
     gatgcggtgc acgaggccgg cgggcaggtc tacctggacg gcgccaacat gaacgccatg    201060
     gtcggcgtgg cgcagcccgg caagttcggc tccgacgtct cgcacctgaa cctgcacaag    201120
     accttctgca ttccgcacgg cggcggcggg ccgggcgtgg gcccggtggc ggtgcgcgcg    201180
     cacctggcgc cctacctgcc gggcgtgctc gacgcccggg gccgcctgga ccccgaggcc    201240
     aaggtcggcc cggtctcggc cgcgccgtac ggctcggccg gcatcctgcc gattccctac    201300
     gtgtacatcg cgttgatggg cgccgagggc ctgcgccgcg ccaccgaggt ggccatcctc    201360
     aacgccaact acatcgccac gcgcctgcgc ggccactacc cggtgctgta tgcgggccgc    201420
     aacggccgcg tggcgcacga gtgcatcctg gacgtgcggc ccctgaagga aaccagcggc    201480
     atcagcgccg aggacatcgc caagcgcctg atggactacg ggttccatgc gccgaccatg    201540
     agcttcccgg tggccggcac gctgatggtc gagcccaccg aatccgaagg cctggccgag    201600
     ctggagcgct tcatcgaggc catgatcgcc atccgcgccg agatcgcaca ggtcgaaagc    201660
     ggcgaacgcg accgcgacga caacgtgctg cgcaatgcgc cccatacggc ccagatgctg    201720
     ctggccgagg aatggcacca cgactatccg cgccagcagg ccgcctatcc ggtggcgtcg    201780
     ctgcgcgaga acaagtattg gccgccggtg gcgcgggtgg acaacgccta tggcgaccgc    201840
     aacctggtgt gcgcctgcct gccggtggaa gcctacgcgt aagcggtgcg cgctcatggc    201900
     gcatgacgag gtgcctgtcc ccccatgggg actggcacct gcaagatttc atggcgtctg    201960
     cccgtgcgtg cgcctgtccc cgctgggaca ggcacattgc cgtacgccat cgacgcttgc    202020
     cggcgatcac gccgaaggcg tgaggcccag ccgctcgtag tgttcctggt agccggcgac    202080
     gtggcgctcc atgcggcggc gggcggccgg cgcgtcgccg gcgatgacgg cttcgaccac    202140
     gcggcggtgc gactgcagga tgaggcgccg ggtgggttcg ggcgtttgcc cttcgcggct    202200
     ggtcgccgtc aggatcaggc cggcgatgga cacgatgaac gcgcgcaaca ggtcgttgtg    202260
     gcaggcgtcg gccagcgcga agtaccagcg cacgttgaga tccaggaact gctccacgtg    202320
     cggcagggcc tcctgcagca ggtcggtcgc ctgtatcagc gcctgcaggt cttcgggcgt    202380
     gcggcgcagc gcggcgagtt cggcgatggt cggctcgatg gcgacgcggg cttcgatcat    202440
     ctcctgcagc gagatgccgc gcgcgcgggc aaacagcgcc acggggcggg ccagcgcgtc    202500
     gttggccggc agcttgacga ccgagccgcc atagcgcccc tggcgggttt cgatcaggcc    202560
     ttcgctttcc agcacacgca gcgcgtcgcg gacggcggcg cggctcaggc cggtctcttc    202620
     ggtgagctcc cgttccgaag gcaaggccac gccgctgggg cgggcgccgc tgaggatctg    202680
     ttcgcgcagg gcgtcggcca gcaggtcgcg cgaacgcacg gccttgatcg gacccagcgg    202740
     attagggttt gtctctacgg ttttcatcgc tgcagccatt gtacagcgtt tggttatcca    202800
     tataatggtc aaccattgaa cttttaatcg agcatcatgg ctgcagtctc ttcttccgtg    202860
     ccgcccactc cgctgggcgg cgtgcgcgtg ctggacctgt ccaaggtcct ggccgggccg    202920
     ctgtgcacgc aatacatggc cgacatgggc gccgacgtga tcaaggtcga agcggccggg    202980
     cagggcgacg atacgcgcgg ctggccgccg ttccaggatg gccaggcggc ggtgttcctc    203040
     agctgcaacc gcaacaagcg cagcatcgcg ctggacctga aatcggcgca cgggcgcgcc    203100
     gtggtgcagc ggctggccgc ctgggccgac gtggtggtcc acagcttcgg tccgggcgtg    203160
     gcgcaaaagc tgggcgtcga ttgggaggcc ctgtccgaaa tcaatccccg cctcgtgtac    203220
     tgcgccatct ccggcttcgg cccggtcggc agcctgagcc acggcaaggg gttcgatgtg    203280
     gtgctgcagg cgttctgcgg catgatctcg atcaccggcg agaccgaggg cggcgcggtg    203340
     cgcagcccgt tctcgccggt ggaccaggcc accggcctgc atgccctgat cggcatcctg    203400
     gcggccttgc gccagcgcga cgccagcggc cgcggcgtca ccgtggacgc ctcgctgttc    203460
     gataccgcgc tcggtttcat gggctacttc atgcagggtt actgggcccg cggcaccgag    203520
     ccggcgcgcg cgggcgccgg gcacgagtcg ctgtgcccgt accaggattt cgcgaccgcc    203580
     gacaagccca tcatcctggg catcgccaac gatgcgctgt ggcgcgcctt ctgcgccctg    203640
     gccgagcgtc ccgaactggc cagcgacccg cgctttgcca ccaacgcgca gcgcgtggcc    203700
     aaccgcgcgc agaccctggc ggccacgcgc gcactgctgg cggcgcgcac gcgcggcgaa    203760
     tggctgcccg cgctcgagca ggccggcatt ccctgttcgc ccatccatac gctggtcgag    203820
     gtcgatgcgc atccgcacac gcgcgaatcg ggcatggtgt tcgactaccc cgagaccggt    203880
     accgatgccg ggccgctcaa gggcgtggcc cagccggtgc gctttgacgg catgcgcctg    203940
     accacgccca agcggccgcc gagcctcaat caggactggg cgtcggtgct tgccgacgcc    204000
     ggctactccg atccggaagt ccgggatcta ttgcaacaga tggcctgaaa gagccatccc    204060
     actcgtacaa ggagacatga tgaatgtttt gatacgccgc gccctgtgcg ccgccatcgc    204120
     ctcgctggcg gcagccgccg cgcacgccgc ctatcccgaa cagccggtcc gcatcgtggt    204180
     ggcgttcgcg cccggcagcg gcaccgacaa cgtcgcccgc tactacgcga cgcgcctgag    204240
     cgaggaactg aagcagccct tcgtcgtcga gaacaagccc ggggccaacg gcagcatcgc    204300
     ggccacgcag gtggcccgca cgcagcccga cggctacacc ctgttcctgg ggtcgaactc    204360
     cacgttgtcg gccgcgccgt tcctgttcaa gaagctgccg tacgagccgc tcaaggattt    204420
     cacggccgtc gcgcgcctgt ccgatatccc gtccatgctg gtggtcggcg ccgactcgcc    204480
     gatccgcgac ttcgaccaat tcatcggcaa ggcgcgcgcc gagccgggca gggtgacctg    204540
     ggccaacgcc aatacggccc acctcgccgc cggcatggcg ctgaccaagc aggcgcagct    204600
     ggacatgatt tcggtgccct acaagagcag cccccaggcg ctgaccgatg tgatcggcgg    204660
     ccaggtcacg gccatggtcg tcgatacgtc cgcgggcacc gcgttcgtgc agcagggcaa    204720
     ggtgcgcgcg ctggccgtga ccacggcccg tccggtggcg gccatgcccg gcgtgcccag    204780
     catgagcgag cgctttcccg gcatcgacgt ctattcctgg ctgggcatcg tgggccccgc    204840
     cggcatgccc gacgaggtgg tgaccgtggt caacaaggcc atcctgaaga tcaacgccag    204900
     cgaggacacg gtccgcttcc tgcgcgagaa cgccggcgcc gagccgccgc cgtcctccag    204960
     cccggccgag ttcacgcagt tcatgcacgc gcagctcgag gtgtggcgca agctgttgcg    205020
     cgacgccaac gtggaaccca tgtgacccgg caggagagcc gcatgtccgc acccgcctgc    205080
     gtgtccgagt tcgtccgcta cgacgtcgac gcgggggtgg cccgcatcac gctcgaccgg    205140
     ccggatcgcc gcaacgccat cgacgttccc atgcgcgcgg ccctgctggc cgcggtccag    205200
     gccgccacgg ccgacccggc ggtgcgcgcc gtcgtcctgg ccggggcggg cggccatttc    205260
     tgcagcggcg gcgacgtctc gaccatgcgc ggcgcgtcca tgagcgccga gcagggacgc    205320
     gaccggatgg cgccgatcgg cgcctgtgcg cgggccttgc tggaaatgcc caagccggtg    205380
     atcgccgccg tcgacgggat cgccttcggc ggcggcttcg gcctgtgcct gtgcgccgac    205440
     ctggtgctgg ccacgccagc ggcgcgcttt tgcctgtcgt tcatgcggat cgggctggtg    205500
     cccgatttcg ccgcggcgtt caccttgccg cgcctggtcg gcctgcagcg cgcgcgctag    205560
     ctgtgaagat tcaataggtt gtatgcatgg ttcatccgaa ccggatttga gaaactggaa    205620
     atcgccaccc ccccagttca ctcaaggagc ccggccggat gaacacccat aagcatgccc    205680
     gattgacctt cctacgtcga ctcgaaatgg tccagcaatt gatcgcccat caagtttgtg    205740
     tgcctgaagc ggcccgcgcc tatggggtca ccgcgccgac tgtgcgcaaa tggctgggcc    205800
     gcttcctggc tcagggccag gcgggcttgg ccgatgcgtc ctcgcgcccg acggtctcgc    205860
     cccgagcgat tgcgccggcc aaggcgctgg ctatcgtgga gctgcgccgc aagcggctga    205920
     cccaagcgcg catcgcccag gcgctgggcg tgtcagccag caccgtcagc cgcgtcctgg    205980
     cccgcgccgg tctgtcgcac ctggccgacc tggagccggc cgagccggtg gtgcgctacg    206040
     agcatcaggc ccccggcgat ctgctgcaca tcgacatcaa gaagctggga cgtatccagc    206100
     gccctggcca ccgggtcacg ggcaaccgac gcgataccgt tgagggggcc ggctgggact    206160
     tcgtcttcgt ggccatcgat gaccacgccc gcgtggcctt caccgacatc caccccgacg    206220
     agcgcttccc cagcgccgtc cagttcctca aggacgcagt ggcctactac cagcgcctgg    206280
     gcgtgaccat ccagcgcttg ctcaccgaca atggctcggc ctttcgcagc cgcgccttcg    206340
     ccgcgctgtg ccatgagctg ggcatcaagc accgctttac ccgaccttac cgcccacaga    206400
     ccaatggcaa ggccgaacgc ttcatccagt cggccttgcg tgagtgggct tacgctcaca    206460
     cctaccagaa ctcccaacac cgagccgatg ccatgaaatc ctggctacac cactacaact    206520
     ggcatcgacc ccaccaaggc atcgggcgcg ctgtacccat ctccagactc aacctggacg    206580
     aatacaacct attgacagtt cacacctagg cgggtcaatc gcgcatgctt atggttgttc    206640
     atccagtgtc ctgccctgag ttgcgatggc gtggtaacca cagcatccca ggtccggcct    206700
     ggatgaacaa cctattgaga catcacagct agctgtgaac tgtcaatagg ttgtattcgt    206760
     ccaggttgag tctggagatg ggtacagcgc gcccgatgcc ttggtggggt cgatgccagt    206820
     tgtagtggtg tagccaggat ttcatggcat cggctcggtg ttgggagttc tggtaggtgt    206880
     gagcgtaagc ccactcacgc aaggccgact ggatgaagcg ttcggccttg ccattggtct    206940
     gtgggcggta aggtcgggta aagcggtgct tgatgcccag ctcatggcac agcgcggcga    207000
     aggcgcggct gcgaaaggcc gagccattgt cggtgagcaa gcgctggatg gtcacgccca    207060
     ggcgctggta gtaggccact gcgtccttga ggaactggac ggcgctgggg aagcgctcgt    207120
     cggggtggat gtcggtgaag gccacgcggg cgtggtcatc gatggccacg aagacgaagt    207180
     cccagccggc cccctcaacg gtatcgcgtc ggttgcccgt gacccggtgg ccagggcgct    207240
     ggatacgtcc cagcttcttg atgtcgatgt gcagcagatc gccgggggcc tgatgctcgt    207300
     agcgcaccac cggctcggcc ggctccaggt cggccaggtg cgacagaccg gcgcgggcca    207360
     ggacgcggct gacggtgctg gctgacacgc ccagcgcctg ggcgatgcgc gcttgggtca    207420
     gccgcttgcg gcgcagctcc acgatagcca gcgccttggc cggcgcaatc gctcggggcg    207480
     agaccgtcgg gcgcgaggac gcatcggcca agcccgcctg gccctgagcc aggaagcggc    207540
     ccagccattt gcgcacagtc ggcgcggtga ccccataggc gcgggccgct tcaggcacac    207600
     aaacttgatg ggcgatcaat tgctggacca tttcgagtcg acgtaggaag gtcaatcggg    207660
     catgcttatg ggtgttcatc cggccgggct ccttgagtga actggggggg tggcgatttc    207720
     cagtttctca aatccggttc ggatgaacca tgcatacaac ctattgaatc ttcacaacta    207780
     gcgccaggcg cgcctaggcg cgcgcatcgt ccagttgcag ggtcagctgg cgctgcgccc    207840
     cgcgcatcag gtccacgcgg gcctggatct tcttgctgac cagcagttcc gcaatggcct    207900
     gctcgcggct gagaccgcgt atgcgctgcg cctcggcgtc ccagtgggcg atctcgtcgt    207960
     cgaactggcg ctgcagcagc tggcgccgcg cggcatagct gtcgcgcagc gcctgctcgg    208020
     tctggcccgc caggcgggcc accagctggt tcagcccatg ccagtactga cgcgcctctt    208080
     tccaggccgc cgtatcctgg cctgcgcgcg tgcctgcgta ctcccacagc ggacgataat    208140
     cgcggccggg ctggtggtgc cgcaccagga atgccagttg ctcgaacgac agcagcagca    208200
     cattgttgtc aatcgcctgc gcgtacagct ggctgcggct caacggatac tggaacgacg    208260
     gcgccagcag caccgaataa tcggcgctgt agccggcacc ctggcgccac ttcttcagcg    208320
     acggcacctt gtagtccttg ggattgaggg ccgtgcggct caggcggaag atcttgccat    208380
     cgcccacgat gcgctggtcg ccgcattccg catagacgtc cgcggcatcg ctgcgctcgg    208440
     ccagcacccg ggcctggaaa ccgagctcgc ccagcgcgca cgccagcagc acatcgctgt    208500
     acttggccag cagtttctct tccgacgaat cgtggccgat gcattcggaa atcacgccgc    208560
     cgtgctgcag gtgctcgatg atctggtcgc gcgtgcaggc gcggatggcc gcttccaggc    208620
     gggcgcaacg cgcgggaaag tcgagggtgg cgtcggcgca cagccgcacc acggccgcca    208680
     cgacgccatc gtgcagcaag ggatggggca agggatgggg caagggatca gaggtggtaa    208740
     gcataggggg gcactgtaca acacgctcgc cgacgccatg gcgggcgacg ggcacggccg    208800
     ccccacggct tgcccatcca tgaaaaaggc agccccgcaa ggctgtcccg gttgcgccgg    208860
     ccggccgcga acggccggcc cgggctcaag gcttgggagc cggcttgggg gccggcgcgg    208920
     ccggcacgcc ggccgcgggc gcgccggcgt cgccacggat cttggcggcg atttccgagg    208980
     ccgccttggc cgacggcacg ccgaaggcca gcacgccgcg gttcaggggc tcggcgatgc    209040
     gcggggcggc gaccagttcg cgatcgatca ccaatgccag catattgccg atattcttgc    209100
     tgctgatgtc attcagcttg cgggcgcccg cctcggtgaa acgcaggccc acgaagttct    209160
     ggccctggcg gtcgaccagc gcggccgcct cggtgagatc ggcgcgagtc aggaccggct    209220
     gccgttgcat gtagagcgaa ccatccggca ccttgacttc catcaggccg tcgccggcct    209280
     tggcctgagc cacgtagaac tcgaccgacg ccgcgctcgc ctgctgcgag gaagcctggt    209340
     ccgccggcgt ggccgcctgg ccgtcggtct tcttggacgc ggtggtgcat ccggccagca    209400
     ccagcgtgga aaaagccagc gtgtaagcca gtttgcgaat ggtcagttgc atgatggttt    209460
     ccttcttcag tttgcagaga ggctgacgcg ccggacgcgc tggccacggc gttacaaaaa    209520
     agtgtacagg tccccacgca aggccgatag tcgagactgc ttccagatgt aaagacgcaa    209580
     tacggcctat actccaggat cacgcagggg tactcgctgt cccgccttca aggccggcag    209640
     cgtgttgaga gagtcccttc gtaccagtac ggataatgcc gatgctggga gcgtattcca    209700
     gttgccggcc cttgcgccag cgcggaatcc atcccgattc ggctccaaac cttcttgatt    209760
     ggagctttcc atgaacgcca accccacgtt cctggccgcc acggccgagg tcgacgcagc    209820
     cgccgtcgcg ccgttgccca aatcccgcaa agtctacgaa accggctcgc gcccggatat    209880
     ccgcgtgccg tttcgcgaga ttgagcaggc cgacacgccc accatgttcg gcggcgagaa    209940
     gaacccgccc ctgaccgtct acgataccag cggcccgtac accgacccgc aggccagcat    210000
     cgacatccgc cgcggcctgc cggccctgcg ccgggcctgg atcgaagaac gcggcgacac    210060
     cgaagtgctg gatggcccga ccagcgacta cggcaaggag cgcctgaccg atccgaagct    210120
     gacggcgatg cgcttcgacc tgcagcgccc cccgcgccgc gcgcgcgccg gcgccaacgt    210180
     gacgcagatg cactatgcgc gccgcggcat cgtcacgccc gaaatggaat tcatcgcgct    210240
     gcgcgaaaac ctgcgccgcg aacactacct ggaaacgctg cgcgccagcg gcccggatgg    210300
     cgagaaactg gccaagcgcc tgctgcgcca gcaccccggc cagtcgttcg gcgccgccct    210360
     cccgtcggcc atcacgcccg aattcgtccg cgaggaagtc gcgcgcggcc gcgccatcat    210420
     cccggccaac atcaaccacc cggaaatcga accgatgatc atcggccgca atttcctggt    210480
     gaagatcaac gccaacatcg gcaactcggc cgtcagctcc ggcatcggcg aggaagtcga    210540
     gaagatgacc tgggcgatcc gctggggcgg cgatacggtc atggacctgt cgaccggcaa    210600
     gcacatccac gaaacgcgcg aatggatcat ccgcaattcg ccggtgccga tcggcacggt    210660
     gccgatctac caggcgctgg agaaggtcga cggcaaggcc gaggaactga cctgggaaat    210720
     cttccgcgat acgctgatcg agcaggccga gcaaggcgtg gactacttca cgatccatgc    210780
     cggcgtgcgc ctgcccttca tccccatgac ggccgaccgc atgaccggca tcgtctcgcg    210840
     cggcggctcg atcatggcca agtggtgcct ggcgcaccac aaggagagct tcctgtacga    210900
     gcgcttcgag gaaatctgtg aaatcatgaa ggcctacgac gtcagcttct cgctgggcga    210960
     cggcctgcgc cccggctcgg gctacgacgc caacgacgag gcgcagttcg ccgagctcaa    211020
     gaccctgggc gagctgaccc aggtggcctg gaagcacgac gtgcaggtca tgatcgaagg    211080
     ccccggccac gtgccgatgc agatgatcaa ggaaaacatg gaactgcagc tcaagcattg    211140
     cgacgaggcg ccgttctata ccctgggccc gctgaccacc gacatcgcgc ccggctacga    211200
     ccacatcacc tcgggcatcg gcgcggccct gatcggctgg tacggcacgg ccatgctgtg    211260
     ctacgtgacg cccaaggagc acctgggcct gcccaacaag aaggacgtca aggacggcat    211320
     catcacctac aagatcgccg cccatgccgc cgacctggcc aagggacatc cgggcgcggc    211380
     catccgcgac aacgcgctgt cgaaggcgcg cttcgagttc cgctgggacg accagttcaa    211440
     cctgggcctg gatccggaca ccgccaagga gttccacgac gagaccctgc ccaaggactc    211500
     gatgaaagtg gcgcacttct gctcgatgtg cgggccgcat ttctgcagca tgaagatcac    211560
     gcaggatgtg cgcgactatg ccgcggcgca gggcgtcagc gaaaaggacg cgctgcagca    211620
     gggcatgcag gaaaaggcgg tggagttcgt caagaagggc gccgaggtct atcaccggac    211680
     ctgagcgccg ggcatggccc ggctcgccga gccgggccat gcgggtcagg ccgccgtgta    211740
     ggcggtcttg accgaggtgt agaactcggc cgcatggcgg ccctgttcgc gcggcccgta    211800
     gctggacccc ttgcggccgc cgaacggcac gtgatagtcc acccccgcgg tggggcagtt    211860
     gaccatgacc atgccggcct gcgattcgcg cttgaaatgc gtggcgtgcc gcagcgaggt    211920
     ggtgacgatg cccgacgaca acccgaactc cgtatcgttg gccacttcca gcgcctgctc    211980
     gtagctgtcg accggaatca ccgccgcgac cgggccgaag atctcctcgc gcgcgatgcg    212040
     caggctgttg tcgcaatcga cgaacaaggc cggagccagg taatacccct cattggcgcg    212100
     cttgagcggc tcgcctcccc aggccagctg cgccccctct tctcgtccga tggcgatgta    212160
     ggccaggttc tggtcgaact ggctgcggtc gaccaccggc ccgatgtcgg tgcccggcgc    212220
     cagcgcatcg tcgaccttca ggccctgcag gcgctcccgc accgcctcga cgaaacgcgg    212280
     gtagatgcct ttctgcacga tgagccggct cgacgcggta cagcgctggc cggtggaaaa    212340
     gaacgcgccg ttgaccgcgc agtcgacggc caccttcagg tcggcgtcgt tcagcaccac    212400
     cagcgggttc ttgccgccca tctccagctg caccttggcc atgcggccga tggcggcctc    212460
     ggccacgcgg cggccggtcg ccaccgagcc ggtgaagctg atggcattga cgcgccggtc    212520
     gtccaggatc gcctggccca ccacgctgcc gcgccccatc accaggttga acacgccggc    212580
     gggcaggccg gcgcggctga ggatctcggc cagcgcccag gcgctgcccg gcaccaggtc    212640
     ggccggcttg aacaccacgg tgttgccgta ggccagcgcg ggcgcgatct tccaggccgg    212700
     gatggcgatc gggaaattcc agggcgcgat gatgcccacc acgcccaccg gctcgcgcgt    212760
     gacgtcgacc tcgatgccgg ggcgcgtcat gggcagcttc tcgccctgga tgcgcaaggc    212820
     ctcgccggcg aagaatttga agatgtggcc cgcgcgggtg acctcgctta cgccttcggg    212880
     cagggtctta ccttcttcgc gcgacagcag ccgccccagc tcttccttgc gcgccagcaa    212940
     ctcggtgccc acggcatcca gcacgtcggc gcggcgctgc ccggtgctgc gggcccatgc    213000
     atgggccgcc gcgctggcgg ccgcgatcgc catgccggcc tgggcggcgt cggcctgggc    213060
     gtagtcgccg accacgtcgg ccagattgga ggggttgata ttgggccgag cgtcgacgcc    213120
     gtccagccag gcgccgtcaa tgaagttcgc gtgcatggat ctcttccaag gtaagggcta    213180
     cgggtaggac aacgggcgcc ccaaggggcg cccggcacag caaagtcgta cgacggccgc    213240
     cgcccgcatg cgggcggctc gcgcggggct acagcagctt gcccggattc atgatgccgg    213300
     ccggatccag cacccgcttg atctcgcgca tcagccgcag ttcgagcgga tccttgctgt    213360
     gcaggaagtg gtcgcgcttg agctggccga tgccatgctc ggcgctgatg ctgccgccat    213420
     agcgcagcac ctcgtcgagc accaggtcgg tcacggcatc gccctgctcg gccgcccact    213480
     cgcgcggcgc gcccgccgga cgcgacaggt tgtagtggag attgccgtcg ccgaaatggc    213540
     cgaagatgaa cggccgaata tcgggatagc gttcgcgcac gcgcgccgcg gccgtttcca    213600
     tgaattcggg aatgcgctcg atcggcagcg acacgtcgtg cttgaggtgc ggcccgtcgg    213660
     cgcgctgcgc ctccgagatt tcctcgcgca ggcgccacag cgtctgcaat tgcgccagcg    213720
     aagccgacac ggccgcatcc aggcacaact cgcgctccag cgccgcaccg atcacctcct    213780
     cgaccagggc gttgagcgcg gcctcgtcga tcgtgtcggc cagctcgacc agcacgtagg    213840
     cgggatagcg ctgcgcgaac ggctcgtgca agccgtcgac atgcgtgagc accaggtcca    213900
     ggcaatcgcc gctgaagtac tcgaaggcct gcaggcgcgc gccgcattgc tcgaacagca    213960
     gctcgtacag ctgcagcgcc tggcgcggcg actcgaccgc cgccagcacc accgtgcgcg    214020
     tgtcggcgcg cggaaacagc cgcagcgcca ctgcggtgat cacgcccagc gtgccttcgg    214080
     agccgatcag cagctgcttg aggtcgtagc cggtgttgtc cttgcgcagc gtgcgcaggc    214140
     cgtgcaggac ttcgccgttg ggcagcaccg cctccaggcc cagcaccagt tcgcgcgcca    214200
     tcccgtagcg caccacgttg acgccgccgg cgttggtggc gacgttgccg ccgatctggc    214260
     tagaatcctc ggccgccagc gacaacggca gcaggcggtt ggcgtcctgg gcggcgcggc    214320
     gcaggttgcc cagaatgcag ccggcctcgg ccaccatggt gttggccacg gtatccagcg    214380
     cgcggatcgc gttcatgcgc tccaggctga gcaccacgtt ggcctgcgcg gcgtccggcg    214440
     tggcgccgcc gcacaggccg gtattgccgc cgcgcggcac caccggcacg cccgcctgct    214500
     ggcacagcgc caggcagcgc gccacttcgt cggtcgtgcg cggccgcacc accgcctggg    214560
     cctggcctcg gtagatgccg cgccagtcgc tcagccaggg ttcgatatcg gccgggctgg    214620
     tcgccaccac atcggcgccc agcgcctgcg tcaatcgttg cgaaaattcg gatgcactca    214680
     tggtcggggc cgcacggtca aaggttcatg tcgagctgca ggcgcgccgc cgcgcccagc    214740
     agatggtgtt gcgccgccgc gcgcgccgcc tcgggctcgc cgcgttcgat ggcgcggtag    214800
     atcgccaggt gttcttcgtg caccgcgtgc acagggtcgc cctggcgccg cgtattggcg    214860
     cgcgcggtct ccaccgcctg gcgcaattgc aggttgaggt attgcagcaa ctgcaggtaa    214920
     tagggattgg cggtcgccgt ggcgatggcc acgtggaaac ccacgtcgtg gaccacgccc    214980
     tgctcgggtt cgatgggctc gcgctgcagc gcctgcaagg cctgccgcat gcggtcgagg    215040
     tcggcggcgc cgcgacggcg cgccgccagt gcggccgccc cgccttcgag ctccatgcgc    215100
     agctcgtaca cccgcgccag atgcgcgcgg tccaggccgc ccgcgggcac ctgaaagccg    215160
     ccggccggcg tgcgggccac cacggtacag cccgagccct gccggctttg caccaggccc    215220
     tgggcgcgca ggcgctcggt cgcctcgcgg atgaccgcgg cgctcacgcc gtactgctgc    215280
     gccagcgcac ggccggtcgg cagcttggcg cccacggcgt aggcgccatc ggcgatggcg    215340
     cgggccagtt gtccggcgac ctggtcggta agcgtggggg tgggctggag catgcgggga    215400
     ttataggccg atttctcagg ttatatgaaa actttttcgg ccagtatgcg cggatcggcg    215460
     cgccgccgcg ccggtatgcc tgccattgaa tcaggaagtg gcggcccggc taggtgtgaa    215520
     gattcaatag gttgtatgca tggttcatcc gaaccggatt tgagaaactg gaaatcgccg    215580
     atcccccagt tcactcaagg agcccggccg gatgaacacc cataagcatg cccgattgac    215640
     cttcctacgt cgactcgaaa tggtccagca attgatcgcc catcaagttt gtgtgtctga    215700
     agcggcccgc gcctatgggg tcaccgcgcc gactgtgcgc aaatggctgg gccgcttcct    215760
     ggctcagggc caggcgggct tggccgatgc gtcctcgcgc ccgacggtct cgccccgagc    215820
     gattgcgccg gccaaggcgc tggctatcgt ggagctgcgc cgcaagcggc tgacccaagc    215880
     gcgcatcgcc caggcgctgg gcgtgtcagc cagcaccgtc agccgcgtcc tggcccgcgc    215940
     cggtctgtcg cacctggccg acctggagcc ggccgagccg gtggtgcgct acgagcatca    216000
     ggcccccggc gatctgctgc acatcgacat caagaagctg ggacgtatcc agcgccctgg    216060
     ccaccgggtc acgggcaacc gacgcgatac cgttgagggg gccggctggg acttcgtctt    216120
     cgtggccatc gatgaccacg cccgcgtggc cttcaccgac atccaccccg acgagcgctt    216180
     ccccagcgcc gtccagttcc tcaaggacgc agtggcctac taccagcgcc tgggcgtgac    216240
     catccagcgc ttgctcaccg acaatggctc ggcctttcgc agccgcgcct tcgccgcgct    216300
     gtgccatgag ctgggcatca agcaccgctt tacccgacct taccgcccac agaccaatgg    216360
     caaggccgaa cgcttcatcc agtcggcctt gcgtgagtgg gcttacgctc acacctacca    216420
     gaactcccaa caccgagccg atgccatgaa atcctggcta caccactaca actggcatcg    216480
     accccaccaa ggcatcgggc gcgctgtacc catctccaga ctcaacctgg acaaatacaa    216540
     cctattgaca gttcacagct aggtgtgaag attcaatagg ttgtatgcat ggttcatccg    216600
     aaccggattt gagaaactgg aaatcgccac ccccccagtt cactcaagga gcccggccgg    216660
     atgaacaccc ataagcatgc ccgattgacc ttcctacgtc gactcgaaat ggtccagcaa    216720
     ttgatcgccc atcaagtttg tgtgcctgaa gcggcccgcg cctatggggt caccgcgccg    216780
     actgtgcgca aatggctggg ccgcttcctg gctcagggcc aggcgggctt ggccgatgcg    216840
     tcctcgcgcc cgacggtctc gccccgagcg attgcgccgg ccaaggcgct ggctatcgtg    216900
     gagctgcgcc gcaagcggct gacccaagcg cgcatcgccc aggcgctggg cgtgtcagcc    216960
     agcaccgtca gccgcgtcct ggcccgcgcc ggtctgtcgc acctggccga cctggagccg    217020
     gccgagccgg tggtgcgcta cgagcatcag gcccccggcg atctgctgca catcgacatc    217080
     aagaagctgg gacgtatcca gcgccctggc caccgggtca cgggcaaccg acgcgatacc    217140
     gttgaggggg ccggctggga cttcgtcttc gtggccatcg atgaccacgc ccgcgtggcc    217200
     ttcaccgaca tccaccccga cgagcgcttc cccagcgccg tccagttcct caaggacgca    217260
     gtggcctact accagcgcct gggcgtgacc atccagcgct tgctcaccga caatggctcg    217320
     gcctttcgca gccgcgcctt cgccgcgctg tgccatgagc tgggcatcaa gcaccgcttt    217380
     acccgacctt accgcccaca gaccaatggc aaggccgaac gcttcatcca gtcggccttg    217440
     cgtgagtggg cttacgctca cacctaccag aactcccaac accgagccga tgccatgaaa    217500
     tcctggctac accactacaa ctggcatcga ccccaccaag gcatcgggcg cgctgtaccc    217560
     atctccagac tcaacctgga cgaatacaac ctattgacag ttcacaacta gcgcaacgca    217620
     ggccgggcgc caggctcagt cgcgcggcga tgcctggagg cggaccaagc tgcccgtttc    217680
     gagcgccgcc caaacgcacc catgcgggtc gatggcgata ccgtgcggct ccgacccggg    217740
     agccgcaagc tcatagcccg ccgtatcgcc cgcttccgaa atgcggccga tacggttggc    217800
     gccccactcg gtgaaccaga ggttgccggc ggcatcggcc gcaagcgcat gcggcctggc    217860
     tgcacggctg tgcaacggga attcggtaat gcgcccgccc gcgtcgaacc gggcaatggc    217920
     cccattgcca gcctgcgcga tccagagcgc gccctgggca tcggatgcga tgcctaccgg    217980
     cgccgcgtcg gccgcgccaa gcgggaaaat ccgcggcgcc gccgtcgccg atatgctgcc    218040
     tatggcgccc gcctgattca aggtgaacca catcagcccg tcgcgcccgg cggccatgca    218100
     ggacggatat ccgcccttca cgggcagatc atattcctcg atatcgccgt cgatcgtgat    218160
     gcggccgata cgatcccccg ccatctccgc gaaccaaagg cagccatcgt ggccggcggc    218220
     aatgccaaag ggacgagaag ccgggcgggg cagctcgaac atccgcaagg cgccgtcggg    218280
     cgacaggcgg ccgacggcat tggccgacga gagcgtgaac cagggccggc cgtccgggcc    218340
     gcaggtgatc gtggtgggct ggccatcggc gtgcggcaat gggaagcgcg acacttctcc    218400
     gtccggcgac agccgcccta tggcattgcc ctttgccagc gtaaaccaca gcgcgccgtc    218460
     gggagtcgaa gcgacgccat aaagcgcctc ctcgggcttg cctacgggaa actccgtcat    218520
     ctcgacttgg ttcatgaagc ggcctcatcg aactgcacgc ggcgtgcctg tcccagcggg    218580
     gacaggcgcc cgagcaccaa attttttctt gtacgaacca tgaaaccgac catcttccct    218640
     tatcgatcgc ggcggcgcac actagggcgg cctctttcga ccatgcgcca tgaccgcctc    218700
     cacgcccacc gcaatcctga tccgtgacag ccgcgacgcc gacctgccgg ccatcgccgc    218760
     gatctacgcc caccatgtcc tgcacggcac cgcgtcgttc gagctggagc cgcccggtct    218820
     ggaagccttg cgcgaacgcc gcgcggcggt gctggcgcat ggcctgccct acctggcggc    218880
     cgaatgcggc ggcgagatcg tcggctacgc ctacgccacg ccataccggc cgcgcccggc    218940
     ctaccgccat acggtggaag actcggttta tgtccgcgcc ggacacgccg gccagggcat    219000
     cggcggcaag ctgctggcgg cgctgatcga ccgctgcgcc gccggcggat ggcgccagat    219060
     gctggcggtg gtgggcgaca gcgccaacac cgcctcggtg gccctgcatg cgcgccatgg    219120
     cttcgatacg atcggcacct tccgctcggt gggctacaag cacggccaat ggcgcgacac    219180
     cgtcctgatg cagcgggcgc tgggcgaggg cgacgccacc ccgcccagcc gcccgtgacc    219240
     cctgcccgcg cgatcaccag gggcggcgcg ccgtcctcaa tccgcgtgcg ccgcgccggc    219300
     cacccagcgc tcccaaccgt tcttgcgcaa ggcgcaggcc gggcaatggc cacagccgta    219360
     gccccagtcg tggcgctggc cgcgctcgcc caggtagcag gtatggctgt gctcgatcac    219420
     catgtcgacc agcgcctgcc cgcccagccg gtcggccagc tcccaggtct gggccttgtc    219480
     cagccacatc agcggcgtct cgatggtgac ccgcgtaccc agccccaggc ccagcgttac    219540
     ctgctgcgac ttgatggtgt cgtcgcggca gtccgggtac ccggaaaaat cggtttcgca    219600
     catgccgccc accagcacgt cgagctggcg gcgataaccg agcgccgcgg ccagcgtcag    219660
     gaacagcagg ttgcggccag gcacgaaggt attgggcagg ccgttggcct gcatctcgat    219720
     ctcgcggtcg ctggtcatgg cggtgtcgcc cacctgcgcc aggatgccca ggtcgagcag    219780
     atgatcgtcg cccaggcgct gggcccagtc gggaaagttg gcgcgcagtt cgcgcagcac    219840
     gacctggcgg gcatccagct cgacgcgatg ccgctggccg tagtcgaaac ccagcgtctc    219900
     gacgtgggca tagcgctcca gcgcccaggc caggcaagtg gtggaatcct gtccgcccga    219960
     gaacagcacc agggcgcgtc gttgatggtt ttgcataaga caccggaaca aataaagcgc    220020
     ggcgcggccg ccacggcctg actgtaccgc agcccgcgct tgtaaggatg gctgcgtaca    220080
     atgccccggt ctcgaattgc cagttccgcc ttacccacat ccttcccatt ccccagcgcc    220140
     acggcgcccc gacggatccc tttcagatga acgcaatccg ccagcagtcc gactcagcag    220200
     aacccctacg tcacgatatc cggctgttgg gccggtgcct gggcgaagtc atccaggctt    220260
     gcgagggcaa gcgggtgtac gacacgatcg aaaccctgcg ccgcaccgcc gtccggtttc    220320
     gtcgtgccgg cgacccggcc gacgacaagc tgctgcaggc ccgcgtcaag caattgcgag    220380
     gcaacgaccc caactcggtg gcgcgcgcgt tcagctactt cctgcacctg tccaacatcg    220440
     ccgaggaccg cgaccagaac cggcgccagc gcgagcgcgc cctggccggc gccggtccgg    220500
     agcgcggcag cctgcgccag gccatcgaat cgctcaaggc gcagggcgtg aacaatgccc    220560
     ggatccgccg cctgctgagc gaggcctgcg tgatgccggt gctgaccgcc caccccaccg    220620
     aagtgcagcg caagagcacg ctggacgtgc atcgcgaaat ctcttccctg ctggtgcagc    220680
     gcgagcgcga actgaccgcc gacgaactgt ccgaactgga cctggccctg atcggccagg    220740
     tcgccacgct gtggcagacg cgcatgctgc gctacacgcg gctgaccgtg gccgacgaga    220800
     tcgagaacgc gctgtcctat taccgcagca ccttcctcaa tgtcatcccg cgcgtctacg    220860
     gcgacctggc ccggctgctc aaccgcgagc ccgtcaagcc gttcacgccg ccgcccccac    220920
     cgctcgaacc gttcctgcgc atgggcagct ggatcggcgg cgatcgcgac ggcaatccca    220980
     atgtcgacgc cgccacgctg gaacgcgcgc tgctgcggca ggccacggtg ctgttcgagc    221040
     actatctgca ggaagtccac gcgctgggcg ccgaactgtc ggccagcaca ctgctgatcg    221100
     aggccgaccc ggcgctgctg gcgctggccg acgcgggcgg cgacgactcg ccccaccggc    221160
     gcgacgaacc ctaccggcgc gcgctgatcg gcatctacgc caggctggcg gccaccgccc    221220
     gccacctgac cggccagaag ctggcgcgcc gcgccaccgt gcccgccgcg ccctacgaca    221280
     cgcccgacgc gctggcggcc gacctggcgg tcatcgccgc gtcgctatcg gcgcgccacg    221340
     gcgcgcccat cgcccgcctg cgcctgagcg gcctgcagca ggcagtgacc gtattcggct    221400
     ttcacctggc taccgtggac ctgcgccaaa gctcggatgt gcacgaacgc gtgctggccg    221460
     agctgttcgc gcgcgccggc gacggcatcg acggccaggc ggtggactac ctggcgctgg    221520
     acgaggcggc ccgcgtggcc ggccgcgagc tggcgcatgc gcggccgctg gcctcgccgt    221580
     ggatcgccta cagcgaagag accgcgagcg aactggcggt gctgcgcgcc gccgccgccg    221640
     ggcgcgcccg ctatggcaga caggccgtgc tgcagagcat tgtgtcgcac accgaaaccc    221700
     tcagcgacct gctggaagta ctggtcctgc agaaagaggc cgggctgatc gcgccgcctg    221760
     gcgaaaccat cgcgcccggc gacggcctga tggtggtgcc gctgttcgaa accattcccg    221820
     acctgcagcg cggccccgag atcatggcgg cctggctgga cctgcccgaa gtccgccagc    221880
     gcgtacggct ggcgcagggc gatacccagg aagtcatgct gggctactcc gacagcaaca    221940
     aggacggcgg cttcctgacc tcgaactggt ccctctacca ggccgaacgc gcgctggtcg    222000
     acgtattcag cgcccgctcg gtgcgcctgc gcatgttcca cggacgcggc gactcggtcg    222060
     gccgcggcgg cggctccagc tacgacgcca tcctggcgca gccgccgggc accgtggccg    222120
     ggcagctgcg cctgaccgaa cagggcgagg tcatccagag caagtacaag gatgccgaag    222180
     tcggccgttg gcacctggag ctgctggtgg ccgccacgct ggagtcctcg ctcgcgccgc    222240
     aggccgccgc cacctcggcc gaagacgccc acatgcagca gcacgcgccg gccatgtcgt    222300
     tcatgtcgga actggcgcaa cgcacctatc gcggcctggt ctacgacacg ccgggctttg    222360
     ccgattattt cttcgccgcc acgcccatca gcgaaatcgc cgggctgaac atcggctcgc    222420
     gcccggcctc gcgcaagaag ggccagcaca tcgaagacct gcgcgccatt ccgtggggat    222480
     tctcgtgggc gcaatgccgc ctcatgctta ccgggtggta cggcatgggc tcggccatcg    222540
     aagcctatct ggaaaccggc gcccaaggcg cgccgcgctc gcgccgcgcc cggctggcgc    222600
     agctgcgcga gatggccagc gactggccgg ctttccgcac cctgctgtcg aacatggaga    222660
     tggtgctggc caagtccgat ctcgccatcg ccgccggcta tgcccaactg gtgccgcggc    222720
     gcggcctgcg cgagcgggtg ttcggcgcca tcacggccga gcacggccgc acgctggcca    222780
     tgctgcgcct gctgacccgg cgcgacctgc tggccgacaa ccccggcctg atggcctcgc    222840
     tgcgcgaacg cttcgcctat atcgacccgc tgaactacct gcagatcgag ctgatcaagc    222900
     ggcaccgcgc cgcgcagcgg cgcgccggcg atgacgccga catccgcgtg ccgcgcgcca    222960
     tccacctgac catcaacggc attgccgccg gcctgcgcaa ctcgggttga gccgtgcgct    223020
     cagcgtagga aacaacgctt catagcagca tatttctcca gaaaaactct gagatgctgc    223080
     cctgaagcgt tgaagctact gcgatttttt atagggaatt ttcctaaacc atctcaatcg    223140
     ccctcggcgc gctacggcac cgtgcattac gtatccgccg acgcccggac gatagcttcc    223200
     tacaagcccg gaagcctccc aacattttga ggcgctgcgt cccaggatga tttgtttttg    223260
     atcatccccg tttcgcacca tgcctgctca acgcactcct cgcaccgcgg tttgtgaggc    223320
     caccgtccgt tcatcgccac gttggatcca ttgcaccgga ttcgtgctgt gcgcgctgct    223380
     ggcggcatgc ggaggcggtg gcggcggagg tggcggcgga ggcggtggcg gcagcccggg    223440
     cggccgtgcg ccatcggcgc cgcaacccgc cccttcgcca cgccccgaac ctgcacccga    223500
     gccggcaccc aatcctgcgc ccaggcctgc tccgcaaccg ccggcgcccg cgcctggagc    223560
     gccccgtcct cccgcgccgc caccggaggc tcccccgccc gtgatgccgc cgccggccgt    223620
     gccgcctcag ctgcccgaag tgccggccgc agacctgccc cgcgtgcgcg cgccgctgtc    223680
     gacataccgg cggccgcaac gcaccgactt cgtcacgccc accggcgggc cgttcttcgc    223740
     caagcaggac aaagccctca acaccatcga cctgaagatg gcgcacgacc tgaagctgcg    223800
     gggctaccgc gtcaaagtcg cggtcgtcga cgaaggcgtg cgcagcgacc atccgctcct    223860
     gaacgtcgag aagaaatacg gtggcgatta catggccgac ggcacccgca cctaccccga    223920
     ccccaagcgc cagggcaggc acggaacctc ggtcgccctg gtactggccg gacaggacac    223980
     cgacacgtat cgcggcggcg ttgcgcccaa tgccgacctc tattcggcca acatcggcac    224040
     gcgggccggc cacgtctccg acgaagccgc attccacgcc tggaacgacc tgctcgggca    224100
     cggcatcaag atcttcaaca acagtttcgc caccgaaggt ccggaaggcg agcagcgcgt    224160
     caaggaggac cgcaacgaat accatagcgc cgccaacaag cagaacacct acatcggacg    224220
     gctcgatcgc ctggtgcgcg acggcgcgct cctcattttc gccgccggca acggcaggcc    224280
     atcgggtcgc gcctacagtg aggtcggctc ggtcggacgc acccctcgcg tcgagccgca    224340
     cctgcaacgc ggcctgatcg tggtcaccgc ggtggacgaa aacggcaggc tcgaaacatg    224400
     ggccaaccgc tgcgggcaag cgcagcaatg gtgcctggcc gcgcccagca ccgcctacct    224460
     gcccggcctc gacaaggaca accccgacag catccacgtc gaacagggca cgtcgctatc    224520
     cgcgccgctg gtcaccggcg ccgccgtact ggtgcaggat cgctttcgct ggatggacaa    224580
     cgacaacctg cgcaccacct tgctgaccac ggcgcaggac aagggcccgt acggcgtcga    224640
     cccgcagtac ggctggggcg tgctcgacgt gggccgcgcc gtgcagggcc cggcgcagtt    224700
     cgccttcggc gacttcgtcg cccgggttac ggatacctcc acgttcggca acgacatctc    224760
     cggcgccggc gggctggtcg tcgacggccc cggcgcgctg gtcctggccg gctccaatac    224820
     ctatgccggc cgcaccacca tcaagcgcgg caccctcgac gtctttggca gcgtcacgtc    224880
     cgccgtcacc gtcgagcctg gcggcacgct gaccggcatc ggcaccgtcg gcacggtgac    224940
     caaccagggc acggtggtca acaaggaggc cggcctgcac gtcaagggag attactcaca    225000
     gaccgcgcag ggcctgctgg tcaccgacat cggctcgctg ctcgacgtat ccggcagggc    225060
     cagcctggcc ggccggctgc atgtggacga catccgcccc ggctacgtcg gcggcgacgg    225120
     gaaaagcgtc ccggtcatca aggccggcgc ggtgtccggc gtcttcgcca cgctgacgcg    225180
     cagtccgggc ctgctgctca acgcccggct ggactaccgg ccccaggccg tctacctgac    225240
     catgcggcgc gccgagcgcg tccatgccgc ggcgcagcgg ggcgcggacg acgggcgtcg    225300
     cgcgtcggtg ctggccgtgg ccgagcggct cgacgccgcg atgcgcgaac tcgatgccct    225360
     gcccgagtcg cagcgcgacg ccgcggcgcc ggcggccgcc atcggacgca tccagcgcgt    225420
     gcaaagccgc aaggtgctgc aggacaacct gtattcgctg gccggcgcca cctacgccaa    225480
     cgccgccgcg gtcaacacgc tggagcagaa ccgctggatg gaccgcctcg agaaccacct    225540
     ggcccaggcc ggcggcgagc gcgtggcggc catcgccgag tatcgccacg gccagttgcg    225600
     ctggcgcccc gatggcctgc aaggccgcca gcgcggcaac ggcatcatgc tgggcctggc    225660
     gcgcgaagtc tcggccggcc tgagcctggc cgcggcgctg acccacagcc gcacgcactg    225720
     ggacgagtcg tccggcgcgc cggcccgcga caacgccgcc atgaccacgc cgggcgtact    225780
     gctgggcgcg cgccgcgcct gggaggacgg ctggttcgtg cagggcgcac tgggctatag    225840
     ccgctaccgc aaccaggcca cgcgccacat ctcgctcggc gatgccggcc acaccgtcgg    225900
     cgccaccgcc cggggccacg tctggcaggc cgacgccggc ctgggacgcc agtggacgct    225960
     cgcccccgga cacacgctgg cgcctcgggc gggcctgcaa ctcacgcatc tgcgccagca    226020
     aggtttcagc gagagcggcg cgcaaggact ggggctgcgc gcccacgcct tgacgcgcac    226080
     cgtgcccacg ctgtgggcgc aactgcaaag ccgccatgcc ttcatgctgg gagccacgcc    226140
     catgacggcg cagctgcaac tgggcgtctg gcatgacctg cgcgcgcggc gctacgccgc    226200
     ctccggcggt ttcgccggcc tggcgcagga ccagggcgcc agcggctact ggcccgtgcc    226260
     gcgcacacgc gtacagggcg cgctcggcct gcgcgccgag ttcgcgccag gcctcgtgct    226320
     ggggctgggc tacacgggcc agcttgccac gcactgggtc gatcaccagc tcagcgccag    226380
     cctcacttac cgctactgac cctgcgcccg cctcggcaca ggggctgaca cccgccaact    226440
     ctccgaaggg cctgtccccg catggagagc gacaccagcg gcaagagcgc ctgtccccac    226500
     ggggacaggc gctctgtcat gcgccatgaa caccccagcg ctccgggtgc ctgtccccgc    226560
     ggggacaggc acgctgccgc acgccatcga cgcttgaccg cccgcaccgg tacaggctcg    226620
     cgatcacgtg atggcgcgcc cacctgatgg acgctccctt ggcctgattt gtccgccatc    226680
     tggattctta gtactatccc gaaataaatt ctatatgcgc acaaatgttc gtatgtaaaa    226740
     cacaaagatt tttctggctg cgacacagga aggcacccta cggaagagac gcccggcctg    226800
     ccggacgccg ccgggcagcc cgagacacgc cgcggcttca tccgagtgag catgcaatgg    226860
     ataaccccat ccagaatctg gcggtcgtcg gcgcgggcgc catgggcagc ggcatcgctg    226920
     ccctgttcgc ctccaagggc ttcgacgtgg tgctgatcga cccgatggaa ggcgcactga    226980
     cgcgcgccgc ccaggtcatc gaacggcaac tgggcgtgta cgcgccggac gccatcgcgc    227040
     cggccatgca gcgcatccgc atggacgccg gcctggaagc ggcctgttcg gcgcagctgg    227100
     tgatcgaggc ggtgccggaa aaactggcgc tcaagcgcga catcttcgcc cggctcgaca    227160
     ccctgtgcga tccgcaggcc atcttcgcca ccaacacttc cggcctgtcg atcaacgaca    227220
     tcgcccaggc cgtcacgcgc cgcgaccgct tcgtcggcac ccacttcttc acgccggccg    227280
     atgtgatccc gctggtggag gtggtgcgca acgacgatac gtccgagcag accgtggcgc    227340
     gggtcatgga catgctgcgc gccggcggca agcggccggt gctggtacgc aaggatattc    227400
     ccggcttcat cgccaaccgc atccagcacg ccctggcgcg cgaagccatc tccctgctgg    227460
     aaaaaggcgt ggcgagcgcc gaggacatcg acgaagtcgt caagtggagc ctgggcatcc    227520
     gcctggcgct gtccggcccg ctggagcagc gcgacatgaa tggcatcgac gtgcactacg    227580
     cgatcgccag ctatctctac caggatctcg aaaaccgcac cacgccgtcc gaactgctcg    227640
     agaacaaggt gcaggcaggc gaactgggcg ccaagagcgg ccagggcttc tatgcctggc    227700
     cgcccgagcg ccgcgagcgc gtgctgcgcg acaagagcgc cgcgctggcc gaactggccg    227760
     cctggctcga gaacagaaag ccggtttgac cgctgcatcc ccccagcctt gccgcccgca    227820
     ttccggggcc tgtccccgcg gggacaggcc ccccatacca cgcaaacgca acgccttacc    227880
     aagaatatgt aggaagcacc atgaataaac tcacgtcctt tttcacggag ctgatgcgca    227940
     agtatctgcc cgatccattc gttttcgcga tcgcgctgac cctgttgacc gtgctgatgg    228000
     ctttcggcat cgaaggccag ccgctggacc agatcacccg tgaatggggc aagggattct    228060
     ggagcctgct ggccttcacc acccagatgg ccgtcatcct ggccatgggc tatgtgctgg    228120
     ccaccgcgcc gctgaccgac cgcctgctcg accgcatcgt cagccacgtg caccagccgc    228180
     gcaccgccat cattgtcgcg accctggtcg gcggcgtcgg cagctacctg aactgggggt    228240
     tcggcctggt gatcggcggc gtggtcgcca agaaactggc gctgaaggtc aagggcgtgc    228300
     actacccgct gatcatcgcc gccgcctaca gcggcttcac gatgtacggc ctgggcctgt    228360
     cggccagcat cccggtgctg gtcaccacgc ccggccatcc gacggccgac cagatgggcg    228420
     tgattccgct gtcggaaacc attttctcgc tgcccatgct gatcaccagc ctggtgatca    228480
     tcgtcacctt gccgctgctc aacgcctggc tgcaccccaa gcagggcgaa caggtcgtcg    228540
     aagtggaccc ggccatcgac cagagcagcg cgccggccaa gaccgccgac gagctgaccg    228600
     ccgaggatac gctggccagc cgcctgaaca acagccgcat cctcagcctg ctgatcggcc    228660
     tgctgggcat cgcctatgtg gtgttctact tcatggacgg caagtcgctg gacctgaacc    228720
     tgatcaactt catcatcctg ttcctgggca tcatcctgct gggcaccccc gcggcctatg    228780
     tggccaagct gaacgaaggc atcaagacca tctccggcat catcctgcag taccccttct    228840
     atgcgggcat catggccatc atggccatca tggccggctc cgggctggtg gccaccattt    228900
     ccaaggtgtt cgtcgacgtc gcctcgccgg gcagcctgcc gttctggggc ctgatcagct    228960
     cgttcgtcat caacttcttc gcgccctcgg ccggcggcca ctgggtgatc cagggcccgt    229020
     tcatgatcga cgccgccaag gagatcggca gcgcgctcaa ccagaccacc atggccgtga    229080
     tgctgggcaa cgcctggaac gacctggtgc agccgttctg gatcctgccc gccctggcgc    229140
     tgtcgaagct gaaactgcgc gacgtgatgg gctataccgt catcatgatg ctgtgggtcg    229200
     gcgtcatcca cattgccgcg gtgcttgcct ggggttacct gacccactga cgccgccgcg    229260
     ccttccttac ggagcccagc catgaaaccc accgcctacc tggtcaccgg cgcctcgtcc    229320
     ggcatcagcg cggccatcgc ccgcgccctg ctcgatgccg gccaccgtgt cgtcaacatc    229380
     gattaccgcc tgcccgccga tgcgccgcaa ggcctggcgt cgtaccaggc cgacctgacc    229440
     gatgaagcgc agacgctggc cgtcgccagg gaagtgaccg aggcctacga cattgtcggg    229500
     ctggtcaaca acgctggcgc cacgcgcccg ggcaccgccg acaccgcgac cctggccgat    229560
     ctcgactacg tcgttgcgct gcatctgcgc acggccatga tcctggtcca ggcggcgctg    229620
     ccggccatgc gcgcggcggg ctacggccgc atcgtcaaca tgtcctcgcg cgcggcgctg    229680
     ggcaagcccg aacgggtggt ttattcggcg accaaagccg ggctgatcgg cctgacgcgc    229740
     accctggcca tggagctggg aggcgacggc atcacggtca acgccatcgg cccgggcccc    229800
     atcgccaccg agctgtttcg caacagcaac cccgaaggcg cgccgcgcac gcagcgcatc    229860
     atcgacagca tcgtggtcaa gcggctgggc acgcccgagg acgtggcgcg cgccgcgatg    229920
     ttcttcctgt cgccggacaa cggcttcgtg accggccagg tgctctatgt gtgcggcggc    229980
     accacgctgg gcgtggcgcc cgtctgaacg cggccatggc tcctgcccgc ctgctcgcgc    230040
     atcgcgcgcg cgccgcctca gcggcgccgc agcgcctggt tgatgtgctc ggccgcgctg    230100
     cgcaacggcg gcaggaaagc ctgcagcatc tcttcgcgcg agtaccggtt ggcatggccg    230160
     ctgacgttca tcgcgccgat gacgcgcccg ccccggtcga cgatgggcac cgccaccgat    230220
     tgcaggccgg gctccagctc ctgcaccacg caggcgtagc cgtcggcgcg cacgcccgcc    230280
     aggatccgct tgagttcggc gcggtcgacc acggtggccg gcgtgtaggg ttggatctgg    230340
     ctttcgtcca gcaggcgatc ctgctcggcc tcgggcagcc cggccagcag cacgcggccc    230400
     atcgaggtga cccaggccgg cagccggctg cccaccgcca ggttgatggt catgaccttg    230460
     tgcgtcgaca gccgcaggat gtagacgatg tccaccccat cgagcaccga gactgagcac    230520
     gattcgcgcg tggtctcggc cacctcttcc atatagggca gggccaggtc ccacagcggc    230580
     gtagccgaca ggtaggcata gcccagctcc aggatgcgcg gcgtcagggt gaagcgccgg    230640
     tcttcctggg cgacgtagcc caggcttgcc agcgtcagca ggatgcggcg cgccccggcg    230700
     cgcgtcagcc ccgtggcggc ggccacctcc gacagggtca tctgcgggcg ctgcggaccg    230760
     aaggcacgga tcacggacag gccgcgcgca aacgattgca catagctgac gccgggttgc    230820
     tggggtactt gctcgaccat ggaacctgta tgcagaaggt ggaaatgcag ccgctcggaa    230880
     cgcgcgccat tgtagaggcg cgaggccatt tcgccggccg gccgcgccgc ggccaggcgc    230940
     cttgacaccc cctgaccacc atgaaacgat gttcttcaga agaacggttg ttctgatata    231000
     gaacaaatta tcacacgcca cctctaccga cgatacccat gatttccaag ctcgttgcta    231060
     ccgcggccga cgccctggcc gacgtcccgg acggcgccac cgtcatgatt ggcggcttcg    231120
     gcaccgccgg ccagcccatg gaactgatcg acgccctgct cgagcagggc gccaaggacc    231180
     tggtcatcat caacaacaac gccggcaacg gcaccaccgg cctggccgcg ctgctgggcg    231240
     ccgggcgggt gcgcaagatc atctgctcgt ttccgcgcca ggtcgattcg cagatcttcg    231300
     acggcctgta ccgcgccggc aagctggagc tcgaactggt gccgcagggc aacctggccg    231360
     agcgcatccg cgccgcgggc gccggcatcg gcgccttctt cacgcccacc ggctacggca    231420
     cgccgctggc cgacggcaag gaaacccgcg agatcaacgg ccgccagtac gtgctggagt    231480
     acccgctgca cgccgactac gccctgatcc aggccgaacg cggcgaccgc tggggcaacc    231540
     tggtgtaccg caagacggcg cgcaacttcg gccccatcat ggccagcgcg gcgcgcgtgg    231600
     ccgtggcgca ggtgcggcag gtggtcgagc tgggacagct cgaccccgag gccgtcgtca    231660
     cgcccggcat tttcgtcaaa cgagtggtgc aaatcgacgc cccgcgcggc gccaaggagc    231720
     agtaatgagc agcaagctga cccgcgacga aatcgccgcc cgcgtcgcgc aggacatccc    231780
     cgaaggggcc tatgtcaacc tgggcatcgg cctgcccacg ctggtggcca accacctgcc    231840
     cgccgaccgc gaagtcatcc tgcacaccga gaacggcatg ctgggcatgg gcccggcgcc    231900
     ggccaagggc caggaagact acgacctcat caacgccggc aagcagccgg tcaccgaact    231960
     gcccggctgc tcgttcttcc accatgccga ttcgttcgcc atgatgcgcg gcggccacct    232020
     cgacatctgc gtgctgggcg cgttccaggt gtcgcagcag ggcgacctgg ccaactggca    232080
     caccggcgcg cccgacgcca tccccgccgt gggcggcgcc atggacctgg ccatcggcgc    232140
     caaggatgtc ttcgtcatga tggaactgca gacccgcgac ggccagagca agctggtgca    232200
     ggcctgcacc tacccgctga ccggcgtgcg ctgcgtctcg cgcgtctata ccgacatggc    232260
     ggtgttcgac ctgcgggccg gccagatcac cgtgaccgac ctgttcggcg acaccacgcg    232320
     cgagcagttg ctggcgctga ccggcctgcc gctgaagttc gccgactgaa cgcccattgc    232380
     gccccggccg gcggccgggg cttttaccga tcgaaggagt tccccatgct gttcatggtt    232440
     caaatgcaag tcaacctgcc gcccgacatg cccgccgagc gcgccgacaa actgaaggcc    232500
     gacgaaaaag ccctggccca gcagatgcag cgcgacggca agtggcgcca cctgtggcgc    232560
     gtggccggcc gctacgccaa cgtcagcatc ttcgacgccg ccgacaacga cgagctgcac    232620
     cagatgctgt cggcgctgcc gctgttcccg tacatggaca tccaggttac cgcgctggcg    232680
     cgccacccgt ccgcgatctg atcgcccact ccctcaggaa accgccatgc cctacatcat    232740
     cgagaccttc gacaagcccg gcagcctggc cgtgcgccag cagcaccgca atgcgcacct    232800
     gcagttcctc gaccagcaca agcacctgct gctggcctgc ggcgccaagc tggacgacga    232860
     cggcaaggac ctcggcggcg gcctgtacgt agtggatgtc gacacgcgcg ccgccgccga    232920
     gcagttcatc caggccgacc cgttccacct ggccgggctg ttcgagcggg tcgcgatcac    232980
     ccgctggcgc aaagcctacg tcgacggcac ctcctatctg taattgtctg cctgcccagg    233040
     gcgggcaggc cccgcttcag gaatcaccat gtcttacgcc gacctcagcc aggcgcgcct    233100
     gtattacgtc atcgacggcc ccgccgacgc ccccgtgctg gtactgtcca actcgctggg    233160
     tacctgcgcc gatatgtggg cgcgccagat ccccgaactg agccgccgct tccgcgtcct    233220
     gcgctacgac acgcgcggcc acggcaaatc gtccgtaccc gatggcgagt acagcttcgc    233280
     gcagctgggc ggcgacgtcg ccgaactgct ggaacacctg cggatcgaac gcgcgcactt    233340
     ctgcggcctg tcgatgggcg gccccaccgg catgtggctg gcgctggaac gccccgagct    233400
     gatcgaccgc ctggtcctgt gcaataccgc cgcgcgcatc ggcagcgccg agggctggag    233460
     cgcgcgcatc gccgcagtgc gccaggacgg gctggaaacc atggcgcccg ggctggtcga    233520
     acgctggctg acgccgcaat accgcgccgc cgaacccggc ctggtccagg tcctggtcga    233580
     catgctgcgc cgcatccccg acgccggcta catggccaat tgcgcggcgc tgcgtgacgc    233640
     cgacctgcgc gaacgcgtcg ccgccatccg cgcccgcacg ctggtcatca gcagcaccca    233700
     cgacctggcc gccacgccgc aggacggcaa ggcgctggcc gccgccatcc ccggcgcgcg    233760
     ctatgtcgag ctcgacacct cgcatatttc caactgggag caaccggaag ccttcacgcg    233820
     cgcgctgacc ggcttcctca cggagtgaac ggcatgcaac gctggaaaca acggccgccc    233880
     ggttcgaact ggggcgactt cggcccggac gaccaactgg gccgcctgaa tctgatcacg    233940
     ccggccgaag tgctcaaggc ggcgcaggaa atccgcgccg gccgcagctt ctgcctgtcg    234000
     ctgccgctgg acctgcccgg cggcaacgtg ctcaacccgc ggcgccatcc gccgcagctc    234060
     agccccacgc gcctgcagga cacgccatac gtgaacttcc cgctgcgcaa tatcaacccc    234120
     gacgcggtcg atgtgctcag cgacgaccag gtgctgctat cgatgcagta ctccacgcaa    234180
     tgggattcgc tggcccacgt cggcgcgctg ttcgacgccg acggcgacgg ccgcgccgag    234240
     ctgtgctatt acaacggcta ccgcgccggc atcgacatcg tcgggccggc cgacgccgac    234300
     cacgccggtt gcggctgcaa taccggcggc ccctcgtccg cgctcaagct gggcatcgag    234360
     aacctggccc agcacagcgt gcagggccgc ggcgtgctgc tggacctggc gcgccactac    234420
     ggcgccggac gcaccctggt gggctacaag gaactgacgc aggcgctggc ggcagacggc    234480
     atcgagatcg agtccggcga catgctggtg ctgcgcaccg gctacgccaa agccgtggtc    234540
     ggcatgaacg gcaagcccga cgccgacgtg ctgcatcaat atggcgccgc gctggacggc    234600
     accgacgccg aactgctgca gtggatcacc gacagcggca tcgccgccat ctgcgccgac    234660
     aactacgcgg tcgaggccta ccccgcgcgc gaacgccagg gcccgcgcgc catgctgccg    234720
     ctgcaccacc actgcctgtt caagctgggc ctgccgctgg ccgaactgtg gtacctcaag    234780
     gacctggccg aatggctgca cgccaacggc cgccaccgct tcatgctgac cgcgccgccg    234840
     ctgcgcctgc cccatgccat cggctcgccg gtgacgcccg tggcgacagt gtgaccatcg    234900
     ggtgcctgtc ccggtgggga caggcaccgc agtcagcgtc tgtctgaagt cggcgcgtgc    234960
     ctgtccccgt gcggggacag gcacgcgggg atgaggcttc agcttttccc cgaaaggcag    235020
     gtgctcatgt aggccttgcg cttcttgccg gtcagggcct gttcggaggc gcgcgagttg    235080
     cagtctttca tgcgctgctg ctgcggggtc agtttgttgg cgggctcttc gcccttgagg    235140
     caactgctca tgtaggcctt gcgctcgtcg ccggtcttgc cggttgccga cttgttgcat    235200
     tcggccatgc gtttttgctg tggcgtcagt tccttgctgg ccgaggcctg ggcccaggcg    235260
     gccgtggaac aaaacaggga cacaagagta caagcagcaa acttgctcac gcgggaaatc    235320
     atggattcct ccctggagcc gcccggctcg cacagccttg cgcggcggcc ctatgcgccg    235380
     gcgcccgtcg gccggcttcc aatgatctgc caaaccgatg cgcgtagcaa gttccctgct    235440
     ggcgcattgc ggcacaagtg gccaccaatg tttacggcct aggtgtgaac tgtcaatagg    235500
     ttgtattcgt ccaggttgag tctggagatg ggtacagcgc gcccgatgcc ttggtggggt    235560
     cgatgccagt tgtagtggtg tagccaggat ttcatggcat cggctcggtg ttgggagttc    235620
     tggtaggtgt gagcgtaagc ccactcacgc aaggccgact ggatgaagcg ttcggccttg    235680
     ccattggtct gtgggcggta aggtcgggta aagcggtgct tgatgcccag ctcatggcac    235740
     agcgcggcga aggcgcggct gcgaaaggcc gagccattgt cggtgagcaa gcgctggatg    235800
     gtcacgccca ggcgctggta gtaggccact gcgtccttga ggaactggac ggcgctgggg    235860
     aagcgctcgt cggggtggat gtcggtgaag gccacgcggg cgtggtcatc gatggccacg    235920
     aagacgaagt cccagccggc cccctcaacg gtatcgcgtc ggttgcccgt gacccggtgg    235980
     ccagggcgct ggatacgtcc cagcttcttg atgtcgatgt gcagcagatc gccgggggcc    236040
     tgatgctcgt agcgcaccac cggctcggcc ggctccaggt cggccaggtg cgacagaccg    236100
     gcgcgggcca ggacgcggct gacggtgctg gctgacacgc ccagcgcctg ggcgatgcgc    236160
     gcttgggtca gccgcttgcg gcgcagctcc acgatagcca gcgccttggc cggcgcaatc    236220
     gctcggggcg agaccgtcgg gcgcgaggac gcatcggcca agcccgcctg gccctgagcc    236280
     aggaagcggc ccagccattt gcgcacagtc ggcgcggtga ccccataggc gcgggccgct    236340
     tcaggcacac aaacttgatg ggcgatcaat tgctggacca tttcgagtcg acgtaggaag    236400
     gtcaatcggg catgcttatg ggtgttcatc cggccgggct ccttgagtga actggggggg    236460
     tggcgatttc cagtttctca aatccggttc ggatgaacca tgcatacaac ctattgaatc    236520
     ttcacaccta ggccgcggtc cagccgccgt cgatgggcag ggtggcgccc gtgatgtcgc    236580
     gtccggcatc gctgcacagg aaggcgacca gggccgccac gttttccatg gcgacgaagc    236640
     ggccggtggg ttggcgcgcg gccaggtatt cgcgttcggc ctgttcctgc gcgacgccgt    236700
     cgcgccgcgc gatctcggtg atgcggccga cgatggccgg cgtgggcgcg gttcccggcg    236760
     cgacggcgtt gctggtgatg ccgctggcgg cggtttccac ggccagcgcg cgggtcagtc    236820
     ccagcagggc ggtcttggtg gtgacgtagc cgacccggtt ggccgcggct cccgcgccat    236880
     agaccgacga cagattgatg atgcggcccc agccctgcgc cagcatgccc ggcagcgcca    236940
     ggcgggcgag gtggaacgcc gccgacaggt tgacggccag cgactcgtcc cagtgggcgc    237000
     gcggcagttc atgggccggc tcgaaatggc gcaccacggc gttgttgacc aggatgtcca    237060
     ggcgcggcag ctcggccagc gcctgggccg ccatggcctc gatctggtcc acgtcccgca    237120
     ggtcggcctg cagcagcagc acccgcacgc cgtgctcgcg cgccagggcg gcttgcgcct    237180
     ggcgggcgct ttcgttggcc tgcaggcagt gcatcacgat gtcggcgccg gaacgggcca    237240
     gcgtatcggc gatggccagc cccagtccgg cctcggcgcc ggtgatcagg gcgcagcgcc    237300
     cgtgtagcgg gcgggccggg ttcatgccgc ctccggcacg agcccgtcgg gcgtgggagc    237360
     gacgtccagc cgcaccacct tgccatgcag ctcgggcgaa ggcgcggggt agcgctgcat    237420
     cacctgtgga tcatggcccg gcacgatatg cgcctcggag tccgccagcc gccggacggt    237480
     gtggtagccc tccagcatgt cgcccacgtg gtagaccgcc gggaagggcg cgtcgtggcc    237540
     gatattgccg tagagatggc tggcatcgga agccagcacg ccagccgcgc tgcgtccaga    237600
     cgcgcacgat ctgcaggccg ccggtgtggc cgccgaccag gtgcagcgac agcccgggcg    237660
     ccagttcggt ctggccgttg tgaaagctga cccggccggc atagaccttg cgcacgaacc    237720
     cgaccacgtc ctcgacgtcg taggggtggc gcaacggccc atggcacatg cagcgcccgg    237780
     tggcgtaggc cggctcggcg tcctgcacat ggaaggtggc ggcggggaag tcgcccagcg    237840
     tgcccgcgtg gtcgtagtgc aggtgggtga ggatcacgtc gcgcacctgt gtcgcgtcga    237900
     tgccgatgag ggccaggccc tgcgccgggc gcatcagcag ctcgcggccg cgctggcgcg    237960
     ccgcgtcttc ggcgaagccg gtgtccacca catagacctc gtcgccgcgg cgcagcgccc    238020
     acacgtagta atcgagatcg gattcggcat cgtggaaatc caccttgccc agatagttgt    238080
     cggccgcgat ccggccgcta tggcgcgcgt agcggatggc gtacacgtca aaaggcgcac    238140
     agttcaaggt gtctcctcca ggctggatga cgtttgggat cttataaata taataggatt    238200
     gtattatagt agtacgaagt gcggtagcaa gtggatgttc caacgcgccg cttttcactc    238260
     aatggagaca caccatggca ttacggcctg agtttcaaac cgagcagttc caaaaaggcc    238320
     tggcagttcg ccgcgcggtg gtcggcgacg cgtatgtgga taaatcgctc aatagcgccg    238380
     atgacctcac ggcttccctg cagaagctgg tcaccgaata ttgctggggc gaagtctgga    238440
     cgcgtcccgg cctggagcgc aagacccgca gcttcctgaa cctggccatg ctgatcgctt    238500
     tgaaccggcc caacgagctg cgcctgcacc tgcgcggcgc gatcaacaat ggggtgacca    238560
     aggacgaaat cgtcgaggtc gtgctgcagg cggcgatcta ctgtggcgta cccgccgcgc    238620
     tggacgccat gaaggcggtg cgcgaagtgg tggagacgat ggagaaagaa ggggccttcg    238680
     cctgacgcgt tggcgaggac aggccagtgc ctggacgcgc tggccgacaa ggagacatca    238740
     tgcagaaaca caagatcgca tttctcggcc tgggcgcgat gggcctgccc atggcctgca    238800
     acctggtcaa gggcggccat gccgtcaccg gctacgacct gaatccgtaa gcgctggacg    238860
     ccctggcgca ggccggcggc cagcgcgccg ccagcgcgcg cgaggcggcg gccggggccg    238920
     ccctggtcat cgccatgctg ccaaccgcga cgcatatcca ggcggcgctc gaaggcgccg    238980
     acggcgccct gcagggcatg ggcccgggcg cgctgttcat caacatgtcc accatcctgc    239040
     cccaggaaac cgacctgatc gcgcagcgcc tggccgagcg cggcatgcgc atgctggatt    239100
     cgccggtcgg ccgctccgcc atggaggcgc agcgcggcac gctgctgatc ctcgccagcg    239160
     gcagcgcgca ggacaaggcg cgcgcccgcg atgcgctgct gtgcatgggc aaccaggtca    239220
     tcgattgcgg cgaagtgggc ggcggttcgc gcgtgaaggt ggtcaacaac ttcatgggta    239280
     tttcgctcaa tgccctgacg gccgaggccc tgaccctggc cgaggccagc ggcctgagcg    239340
     tcgagctggc cctggaggtc atgcgcggga ccatcgccgg cctggggcat atgaacatca    239400
     cctatccgaa caaggtgctg cgcggcgacc tgtcggcggg tttccaggtc gacctggcgc    239460
     acaaggacct gggcctggcg ctcgaactgg cggcgcgcag ccgggcctgc gtaccgatgg    239520
     gcagcgcggc attccagtcc tatacggcgg cgcgcgcgca gggccgtggc ggacaggatt    239580
     acagcgcgat ctacccggtc atgcgcagcc tgtcgggatt gcccgaggcg ttgccttacc    239640
     aggtggatac gccggtcgag gccgatccgt tcggggcggc ggcacgctga gcgcgccgcg    239700
     cggggcttac tcggccgtcg cggcagcgtc ggccagcgag tcctgcagga tggcgatggc    239760
     cacgctggcg gcattgcgca cgtgcaggct gcccgccttg cgggcagcct tgccgtcgcg    239820
     cgccaccagg gcctgcagca ggttcgacag ctcggccacg ctgtgcttgg cgcggcccgg    239880
     cgcctgcatg gacgtcgagc gcagcagcat gacgcgcgag ttgagcagac gcagggtggt    239940
     ggtcagcgcc tcgttgccgg ccccgtcgag cagctgctgg tagaacgcgt tcttggcggc    240000
     gatctgctcc agcggcgtgc cgcgcgtgag ggcgcgcttg agcgcctgga aggcctcctg    240060
     cagggcggcg agctggggtt cggtggcgtg ttcggcgaac agctggcagg ccaggccttc    240120
     cagttcctcg cgcacctggt agatgccgcg cgcctgttcg ggcgacagcc gctcgaccac    240180
     cgggccgcgg tgcggaatga cgacgatcag gccttcggat tcgagctggc gcagcgcttc    240240
     gcgcaccagg gtgcggctga cgccggtcat ttcgcagagt tcgcgttcgg gcaggcgttc    240300
     gcccgggcgg aaccggccaa ccaggatggc gttgcggatg ctctcggtca cgctatggcg    240360
     cagtacggaa gcgacacgct ggaccttgaa ttcaccttct ggcgctgcgg gagatgtcat    240420
     gcggttcgta ttgcaaaatg ggaaaggcat ccggtgcgtg cgagcgcacc ggacaccatt    240480
     ggacggcctg cgatcagttc gaggcgctct tgccgagcgt cgtgcgcacg cgatcgagat    240540
     aggccgggcc atcgaacccg acctgcttgg cgcgcttgtt ccacgcctcg taggaaggac    240600
     cgatatattg ctgctgcatt agtttagccc gttcctcctc gggggctacc cagaaggtca    240660
     cgcccttctt catcatctcc tgctgggcgt tgctgacgaa ggtgtcgtaa ttgccgaagg    240720
     cctcctgctg cagggcatcc atcgcgccct ggacctgctt ctgcacgtcg gccggcagct    240780
     tctgccagct gtcggggttg gccaggatgg cccagccgtt gatcgggccg aggctccagt    240840
     tctgcacgtt cttggcgatg cgccagaatt ccagcgagcc gcccacgcag gtcgagatga    240900
     acaggccgtc gatcacgcca cgctcgagcg cggggaagat ctccgtggtg ggcattgcga    240960
     ccggcttgcc gcccagcgcg ttgacgactt cggcggtctg cggattgtgc acgcgcagcc    241020
     gcttgccctt gaaatcctcg accttgtgga tcggatcctt ggagaagagc tgctgggtgc    241080
     accacgcgcc ttcggccagg acgatggcgt tccacttgtc cttccagatc ttgcgggtgt    241140
     cctcgcacca gaaggcgtcg cacacctgct tgtattcctg gatgttgttg atcaggccgg    241200
     gcaggttgaa gatgcccatg cgcggctcgt cggccgccag gtaggtgtgc agggcggcgc    241260
     tcatgtccac gcggccttcg cgcacggcgg tggcgatttg cgccggcggc acgagtgaat    241320
     cgctgaccgt gaccttgacc ttgccgtccg tggccttggc cacccgttcg ggcaccgagg    241380
     ccgtgaggat ggaatagccg tcgccgggcg aagtgatgac ggccatggtc aggtcatagg    241440
     tctgggcggc ggcggcgccg ctccagctgg ccgtgcatag ggcggccgct gccagggcgg    241500
     cctggaatcc gcgtggtagc gggaaacgtt gggacatgtt gctcctccta ggttggtgtt    241560
     gcggcgcggt gcgctgttaa aattccaagc attcaatcat acaatatgcc tataataccg    241620
     tcataacatc attctgggag gagcttgccg gctctctcag ggaaaacacc atcgcgcggc    241680
     cgcgccgcgt gtgtcgagga gacagctatg agcagtatcg agatgccggc acctgtcatg    241740
     ccgatcgagc cggcggagct tgcgggcgct tccccctacc ccctggcgat cgatcaggac    241800
     ttctgcctga tccgctggat ggcggcgatc tcgcgcgcct gcggcgcgct ggcgacggtg    241860
     gcgctgctgc ttatggcctt gtcgatgtgc tatgagatct tctcgcgcta cctcttcaac    241920
     gcgcccacgg catgggcgac cgagatctcc ggctacctgc tcgtggccac cgtgttcttc    241980
     ggcctggccg cggcgcaggc ctccaactcg catgtccagg tcgaactctg gatcgaccgc    242040
     ctgtccgcgc ccgtgcgcct gcgggtggaa ttgctgtgcc agtggctggc gttgctgttc    242100
     tgcgtggtgc tgggctggca gatggccagt ttcaacgtgc gcgagtacct caacgacacg    242160
     cgcgactggg gcttgctttc cacgccgcag tggatgcccg agctggcggt gtcggtggga    242220
     atggtggttt tctgcatgtc catcctggtg gacatctatc gcctgagccc gcctgcccag    242280
     gcctggcggc gctggctgac gccggcgctg ctggccttgc tggcggccgc gctggtggcc    242340
     ctgggcgcca atgcggtgcc gatggcggcc ggcggccgct tcgactgggg catggccctc    242400
     atcgtcgcgg ccctgctggc ctgcgcatgg gcgtggagcg gcgtgcgcac cctggcgcac    242460
     gtcgtgctgg tcgtcggcgg ctgcgccgtc ctgtatggcc tggcgcgcgg acagtcgctg    242520
     ggctgggtcg ccttcctgct ggtagccagc atgatgctgc tgctgtttct cggcgtgcgc    242580
     atcggggtcg cgttgggcct ggtgggcctg ttcggcgtgt atttcctgct gtcgcgtccg    242640
     caactgtcgc tgctggccga gcgcgcctgg agcagcacca ataccttcac gctgacggcc    242700
     gtgcccatgt tcatcttcat gggcggactg ttgctgcgca gcggcattac cgcgggcatg    242760
     ttcgacgcgc tggtgcgctg gttcggccgc gcgcccggcg gcctggcgca cgcgtcggcg    242820
     ggcgcctcgg ccgtgttcgc ggcggtgtcg ggctcgagcc tggccacggc cgccacgctg    242880
     ggcaaggtgg cctgcccgga catgatcgaa cgcggctaca gtccgcgcct gacctacggg    242940
     gtagcggcgg ccggcgcgac gctcggcatt ctcatcccgc ccagcatccc gatgatcatc    243000
     tatggcacga ccgtgggcgc gtcggtcacc catctctttc tggccggcat gttgccgggc    243060
     ctgctgctga tggcctgctt catgctgggc gcgctggtct gggcgctggc ggtgccgggc    243120
     tcggcgccgg tggcgcgcgc ctacacgctg cgcgagaagc tgagcgcgtc gcgcggcatg    243180
     gtgcctttcg tggcgatcat cggcgcggtg ctcggttcga tgtacacggg cgtggccacg    243240
     ccgaccgagg ccgccgccat cggcgccgtc agcgccttcg tgctgtgcct ggtgcgtcgc    243300
     cagttgagct ggcgggcgtt gttcgagatc gcgcacgact ccgccaaggt gacggcgctg    243360
     ttgctgctga tcgtcgtggg cgcgggcatc ttcagctggg tgttcgatta tctgcggctg    243420
     ccgcgcgagg tggtcaacct gatccagggc gcggatctgt cgccggcgct gatcgtcgcc    243480
     gccatggtgc tggcctatct ggtgctgggc atgttcgtcg agtccatcgc gatgatgctg    243540
     atgaccctgc cggtgacata ccccatcgcc atgtcgctgg gcctggaccc catctggttc    243600
     ggcgtcttcc tggtgctgat gatcgagctc gggctgatca cgccgcccgt gggcatggtt    243660
     ctgttcgtgt tgcgcagcat gaacgagaag gcgcgtttca cggatatcat ccgcggcgcc    243720
     ttgcccttcg tgctgatcat cctgctcttc ctgtgcctga tctacattta tccgcagatc    243780
     gtgatgtggc ttccccaaca agtgaaatga ccatgaatca agctgtctcg ccgctcgccg    243840
     gcacgcccgc ggtcagcgcg gaactggcgc gcttcgcggc caccagccgc tgggaggatg    243900
     tgccgcaggc ggtgcgccac gaaggccggc gcagcctgtt gaattacttc gccgtggcgc    243960
     tggcggccgc gcgcgatccc gtcctggata ccgccacgcg cacctatgcc cggttcgcct    244020
     cggacgcgcg ggcgtcgctg gtgggccgcg cgcggcgcct ggacatgctc aacgcggccg    244080
     cgctcaatgc catggcggcc aatgtctacg atttcgacga cacgcatcac cccaccatca    244140
     tccatcccac ggcgccggcg gcgccggccc tgttcgcgct ggccgaaacc cggccgctga    244200
     gcggcgcgca gctgctgcat gcgttcgtgc tcggcgtcga ggcgacctgc cgcatcggca    244260
     acgccatgtc gccggggcac tatgcgcgcg gctggcatat cacgtcgacc tgcggcgtat    244320
     tcggcgccgc gccgcgcgct gcctgggact gccgggcgac gccatggtgg cggcactggg    244380
     ttgcgcggcg gtgcaggcag gcgggcaggt ggaaacgctg ggcaccgcgg ccaagagcat    244440
     cagcgtgggc aatgcggcgc gcaacgggct gctgtcggcc ctgctggcgg cggagggttt    244500
     cgacggaccg ccgcaaccgc tggagggcgt gcgcggctat ctgcgcgtgg ccgccgacgc    244560
     gcccgatatc gctgcggtca gcgccggcct gggcgaacgc tgggaggtgc tgaacaacac    244620
     gtacaagccg tatccctgcg gcgtggtgct caatccggtg atcgacgcct gcctggcgct    244680
     ggcggccgat ccccgcatcg ccggcggcgg ctgggccgcc atcgagcgca tcgaactgac    244740
     cgggcatccg ctgttgaaac agcgcaccga ccggccgggc gtcgccaccg gccggcagtc    244800
     gcaagtcagt gcccagcatg ccgtggccgt ggcgctggtg cgcggccgcg ccgggctgcc    244860
     cgagttttcg gacgaggcgg tcgccgacgc cgggctgcgg gcattgggcc tgcggctggg    244920
     ctttcgcgac gatgccagca tgtcggtcga cgccgtgaag gtgcgcatcg cgttccagga    244980
     cggcacgctg ctcgagcgcg aggtgcaggc cgcgcacggg tcgcgggagc ggccgctgca    245040
     agacgacgag atcgaggaaa aactgcgcga actgtgccgc catggcggcg cgcgcgtgga    245100
     tgcggaccgg ctgatcgagg cggtctggac attggatgag gcgggcgatg ccgccgccgt    245160
     catgcgactg gcggcggaac agccggccgc ctgaatgcac gtgcaacata ggagacatac    245220
     gtgaagaaga gaatctgggg aacgctgctg gccgcggcga tgacggtggg aagcggcgcg    245280
     gcgcatgccg gctaccccga caaggcggtg cgcatcgtgg tgccgtttgc cgcgggcggc    245340
     ggcgtcgatg cgctggcgcg tcccttcgcc aaggagcttg gagatatcct gggtcagagc    245400
     atcgtggtcg agaacaagcc cagcaacacc gggcagatcg gcgccaccga cgtcgcgcgg    245460
     gccgcggccg acggctacac gctgctgctg agttcggccg ccttcgccac gacgccggcg    245520
     ttctatccgc aggtgccgta cgacccggtc aaggatttct ctccggtcat gatcatggcg    245580
     gcggcgcccc aggtgctggt ggccagcaac aggttcaagg cggcgtcgct gccggacgtg    245640
     ctggcgcagg ccaggcagtc ggaccgcatc aatttcgccc tgagcgccag caccggcatc    245700
     caggcgctgg ccaccgccat gctcgccggg cagggcgggg tgacgttcat gacgattccc    245760
     tacaaggggg cgggcgcggc gttcatggac ctgatcagcg gtgaagtgga cctgatgatc    245820
     gacaacccgg cttcgtccct ggtccacgtg cgcgcgggca agctgcgcgt gctggcgacc    245880
     acggggtcca agcgcatggc catcctgccc gacgtgccga ccgtggccga gaccctgccg    245940
     ggcttcgagg cccgcaactg gttcgtgctg gccgcgccgc agggcacgcc gccggcggtg    246000
     atccagaagc tgaacgaagc gtcggcgcgc gcgctgaaca cgccggccat gcgccagatg    246060
     ctcgagcgcg acggtatcga tctggtggcg gacagcccgg cgcacgcggc ggccttcctg    246120
     caggacgaga tcgccaagtg gggcaaggtg gtcaaggaag gcaatctgca gccctgacca    246180
     ggggagccgc tgccctcagc gcagcggctc gatggcctgg tcttccagcg cggccagcag    246240
     cgccgcgcag tcgccttgcg ccaggcgcag ggcggggacc agttcgcaca gcggcgccag    246300
     cacgaaggcg cgttcatgca tgcgcggatg cggcacgctc aggcggggat ggtcgatggc    246360
     ctgttcgcca tacagcagca ggtccaggtc cagggtgcgc ggcgcattgc ggtagggccg    246420
     ctcgcggcca tggcgctgtt ccagcgcctg caacaggtcc agcaggtcca gcggcgccag    246480
     cgtggtgtcg agcgcggcga ccgcgttgac gaagtcgggg ccctgggcct cgacgggcgc    246540
     cgtccggtac aggcgcgaag ccttgcaggc gaggatgcct ggcgcggcgg ccagttcggc    246600
     aagcacgctg cgcagcgtgg cggccgcgtc gcccaggctg gctcccaggc cgacgtatgc    246660
     cagggtggaa gccgggctgc cgttcattgc ggttcgcgcg ggcggttgga cgggcggcgg    246720
     cgcggacggc ggcgcttttg cgccggcgcg tcgcccgttt cgcgcggcag gtgggcggtt    246780
     tcctcgatca tttcggcgcg cgtggcatcg tcgccattgg ccaggtccat ccaccactgg    246840
     gccagcacgc tgtcgaactc gccggcggcg gcgcgcagct gcaggaagtc gcaggcggcg    246900
     cgaaagcgcg gctgctccag catgcggtag atggtcttgc cggcgcggcg ctcgaagcgc    246960
     ggctgcatga accagatctc gcgcatatcg gacgagaagc ggcgctggat ggccagtttc    247020
     tcggtctgtt cgtccagcac cgagtcggcg gcctgcacca gcgcggggat gttgtgctcg    247080
     ccctgggccc gcagctgttt ccagcgcacg tcgaccagtt gccacagcag cgccgcgaac    247140
     aggaagctgg ggctgatggt cttgccggcg cgcacgcgcg catcggtgcg ctccagcgcc    247200
     agttcgacga aattctcgcc gccgggctgc tcgagcacga cgtcgagcaa gggcagcagg    247260
     ccgtggtgca ggccgtcgtt gcgcaactgc cgcaggcagt ccatggcgtg gccgcaggtc    247320
     agcagcttga gcatttcgtc gaacaggcgc gaggccggca cgttctcgat caggctggcc    247380
     atggtgcgga tcggctgccg cgtggcggta tcgatgctgc cgttcagctt ggcggcgaag    247440
     cgcaccgccc gcagcatgcg cacggggtct tcgcgatagc gcttgaccgg atcgccgatg    247500
     atgcgcacct ggcgcttttt caggtcctgc acgccctggt ggtagtcgat gacttcctcg    247560
     gtgtgcgggt cgtagtacag cgcgttcatg gtgaagtcgc ggcgcgccgc gtcttcttcc    247620
     tggctgccga atacgttgtc gcgcaggatg cggccgtgct cgtcggtttc ctggtcgtcc    247680
     gaggccggcg cgcggaaggt cgaggtttcg atgatttcct ggccgaacac cacgtgcacc    247740
     agctggaagc gccggccgat gatgcgggcg cggcgaaaca gcggccggat ctgctcgggc    247800
     gtggcattgg tggccacgtc gaaatccttg ggctccaggc ccacgatcag gtcgcgcacc    247860
     gcgccgccga cgatataggc ttcgtagcca tgctggcgca ggacgtcgca gactttgatg    247920
     gcgtggcgcg agacattgcg gcgatcgatg ccatggcgtt ccgcgccgat gcgctgtggg    247980
     ccgcgcaggg ccggcgcgaa cagccggccg acaaattttc ttatggtttc ggtaatcatt    248040
     taggacttcg catcttcgag gtggtcgaac aggtcgatca cctgccatcc gcgcgcctgg    248100
     gcgatttcgc gcaggcccgg gctgggattg gcggcgatag gccgtgttac cgcttccagc    248160
     aagggaacat cgttgaccga atcgctgtag aagtacgact cggcgaaatc gcccagcgcc    248220
     aggcccatgc cggccagcca ctggttgacc cgcaccacct tgccttcgcg gaagctgggc    248280
     gtgccttcga tgcgaccagt gtaccggccg tcgcggtatt ccgggtcggt ggcgatcagg    248340
     tgctgcacgc cgaaggcgcg cgcgatcggg gcggtgacaa aactgttggt ggcggtcacc    248400
     agcgcgcaca ggtcgccggc cgccaggtgt ccgcgcacca cgtccaccgc ctggaccgtg    248460
     aggctggggc ggatcacatc gcgcatgaat tcctcgtgcc aggcggccag ctccaccggc    248520
     gagtgcgccg ccagcaggcc cagcatgaac tcggcggcct gctcggcggt cagttcgccg    248580
     cggttgtagc gctccatcag gtcgtcgttg cgccggcgcg cctcggcggg atcgccggcg    248640
     cggccggtgc gggccaggaa gtcggcccat tggtagtcgc tgtccaacgg caacagggtg    248700
     tggtcgaggt cgaacagggc taggcgtcgg gtcgtcatgt cgcttgcgag tgagggtctg    248760
     ccagcatggc gcgaagcagg ggaatggtaa tgggccggcc ggtggccagc gaatagcggt    248820
     ccagcgcgtc cagcaaggcg gccagcttcc ggatgtcgcg ttcgtggtgg gtgagcatcc    248880
     agttgatgac ctcgggcgcc agctgcaggc cgcgctcggc ggcctgggcg gtcagcgcgg    248940
     ccagtttgtc cgcgtcggac agggggtcga gccggaagac caggtcccag cccagccggg    249000
     tgcgcaggtc ttcgcgcagc ggcagcgaca tcggggcgcg gtcgccggag acggccagcg    249060
     cgaaggcccg gccggtggcg gccgattcgc gccagcgatt gtacagggcg aacaggccgg    249120
     cctgccgcgc gtcgtccatg cggtgcacgt cgtcgacggc caccagccgc ggcatgggcg    249180
     cggtggagtc ggcctcggcc agctcgcgca gcgactgcgc cgcgcgcgcg gcgtcgatgt    249240
     agatggcctc gggccgggcg ctcaggccgc gcagcaggtg cgtacggccg cagccggccg    249300
     gcccccacag gtagatggcc cgcccggccg tcagggcgtg cgcggccgcc agcgcctggc    249360
     cgttgggacc ggcaatgtag ttgttcagcg caggcgcagg cgcaggaaga acgtcaagca    249420
     gcagctggcg gttcatgtat ggcgataaaa caggctttcc ggatcgcggc gcgcggcgca    249480
     tggcatgccc cggcgcggcc aaccctgcat taaaccactg cgggccgggc agtgtcgcgc    249540
     aatggcgaac gcgcaggggc gaaacccggc gggcggagca tttcggagca tttccagggg    249600
     tttgcggcca ggatcgcgcc cggcgtcgta aaatcccgga cgtaccaccc aaaatcccgc    249660
     aattgttaca taccccacgg tttttcacat gactaatcaa cattccgctc ccttgaccta    249720
     tcgcgatgcc ggggtcgaca tcgatgcagg cgacgcgctg gtcgaccgca tcaaacccct    249780
     ggccgcgcgc accatgcgtc ccggagtgtt ggcaggcatc ggcggcttcg gcgccctgtt    249840
     cgaggtgccg aagaaattcc gcgagcccgt gctggtgtcc ggcaccgacg gcgtgggcac    249900
     caagctgcgc ctggcgttcg actggaaccg ccatgacacc gtgggcatcg acctggtcgc    249960
     catgagcgtc aacgacatcc tggtgcaggg cgccgagccg ctgtacttcc tcgactactt    250020
     cgcctgcggc aagctgtcgg tggacacggc ggccgcggtg gtgggcggta tcgcgcgcgg    250080
     ctgcgaactg gccggctgcg cgctgatcgg cggcgaaacc gccgagatgc cgggaatgta    250140
     tcccgacggc gaatacgatc tggcgggctt cgcggtgggc gcggtcgaca agtcggccat    250200
     catcgacggc aagtcgatcc agccgggcga cgtggtgctg ggcctggctt ccagcggcgc    250260
     gcactcgaac ggctattcgc tggtgcgcaa gatcctcgag cgcgccggcg cgcgccccga    250320
     ccaggacttc cacggccagc cgctggtcga cgtggtcatg gcgccgaccc gcatctacgt    250380
     caagcaggtg ctggcggccc tggatcgcca cggcccggcc atcaagggcc tggcgcatat    250440
     caccggcggc ggcctgctcg acaacgtgcc gcgcatcctg caacccggca tggccgcgca    250500
     attgcagcgc gacggctggg aaatgcccaa gctgttccag tggctgcagc agcagggcag    250560
     cgtggccgat gccgagatgc accgcgtgtt caactgcggc atcggcatgg tgctggtggt    250620
     cgcggcggac caggccgacg ccgtcgccgc cacgctgcgc gagcagggcg agatcgtcaa    250680
     ccggatcggc gaaatcgtgc cgcagcagga cggcatggcc cagaccgtcg tggtctgagg    250740
     cagggttcgg tgcctgtccc cgcggggaca gataccgtct tggccgtcaa gcgttcatgg    250800
     cgtatgacag ggtgcctgtc cccgcgggga caggcaccct tgctcagtcg ggcagcgccc    250860
     gcgccatcgc gtcgacggtg cgcgccacgg cgtcgccggc caggcaatcg atgatcacgc    250920
     gctccggctg cgcgcgcagc caggtaagct ggcgcttggc cagctggcgc gtggccgcca    250980
     cgccttgttc gcgcgcggta tccaggtcga tatcgccatc caggtacgac cacatctgcc    251040
     ggtaaccgac gcagcgcacc gacggcagcc ccgggtgcag gtccggtcgc gcgtgcaggc    251100
     cgcgtacttc ctcgaccagc ccggccgcca gcatggcgtc gaaacgctgc gcgatgcgcg    251160
     cgtgcagcgc cgcgcgctcg gagggctcca ggctgagcgt gacgtagcgg tagggcgatg    251220
     gcgcgtcgcc gcgccgttcg ccttgcagca gggccgacat gggttggccg gccaggcggc    251280
     agatttccag cgcgcgctgg atgcgctggc tgtcgttggg cgacaggcgc gccgcggtgg    251340
     cggggtccag caacgccagc tcggcatgca gcgcaggcca gcccagccgc gcggcgcgcg    251400
     cctcgagttc ggcgcgcagc gccggatcgg cctgcggcaa atcgtccagc ccttcgcgca    251460
     gcgccttgta gtacagcatg gtgccgccgg ccagcagcgg aatgcggccg cgcgcgtgga    251520
     tctctgcgat cagccgcagc gcgtcggcgc gaaattcggc ggccgaatac gattgcgccg    251580
     gatcgcggat atccagcagg tgctggggaa cctgggcgcg ctcggccgcc gacggcttgg    251640
     cggtgccgat gtccatgccg cggtagatgg tggccgaatc gacgttgatg atttcgagcg    251700
     gccagcgctg cgccagcgcg agggtcgaag cgctcttgcc ggccgccgtg gggccggcca    251760
     ggcagatgat ggcgcgcggg gtcattggcc gcgcaggaac agtttgtcga ggtcgttgac    251820
     cgaccattgc acccaggtgg ggcggccgtg gttgcactgg tcggcgcgct cggtgatttc    251880
     catctggcgc agcagcgcgt tcatttcctc cagcgtcagg cgccggttgg cgcgcaccga    251940
     gccatggcag gccatggtgc tcagcagctc gttgcgctgc tcggtcagca ggcgcgacac    252000
     gcccaccgcg cccaggtcgc gcagcacggc gcgcgccagg ctttcgatgt cgccgcgcgc    252060
     cagcagggcc ggcacgctgc gcaccgcgat ggaggcgggg ccggacgggc gcatctcgaa    252120
     acccagctcg ttcagctggg tctcgtgctc ttcgaccagc gccacgtcct tctcggcggc    252180
     gtggaacacg accggcacca gcaagtcctg gcgcggcagc gcccggtcgt ccagggcgcg    252240
     cttgagctgt tcgtagacca cccgctcgtg cgcggcgtgc atgtcgacca gcaccagccc    252300
     gcgcgagttc tgcgccagga tgtagatgcc gtgcagctgc gccagggcct gccccagcgg    252360
     atgctcgtcg gccgtcggca gcggcgtggc gggggcggcg cgcagtgccg tggcggccgg    252420
     cgccgcatct ccgggcaggg ggcggtacag gctttgccag tcggtcgcgg gtatgccggc    252480
     gggttcgccg tgcaggcgga acggcacctg cgtgtgcggc cgtgccggcg acccttgata    252540
     gggcgactgg cccggcgacg gatacgcagc gggatagggc gcgcgcggct cggccaggcc    252600
     gggcgcggcg gcggccggct cgccggcgta ggccgtgtcg ggggcggcgc cgtccgggac    252660
     gccggccggc accgcttcgg ccccgccggt ctgcgccagc gtctggccca ccacctgcga    252720
     aacgaaccgg tgcaccgcgc cgctgtcgcg aaagcgcact tcgtgcttgg ccgggtgcac    252780
     gttgacgtcg accgcgcccg ggtcgatgtc cagatacagc acataggcgg gttgccggtc    252840
     gccgtgcagc acgtcggcat aggcgctgcg caaggcatgg ctgacggtgc ggtcgcgcac    252900
     gaagcggcca ttgacgtaca ggtactggcg gtcggcgcgc gcccgcgcgg cggtgggccg    252960
     cgtcaccatg cccatcaggg cgatggcgcc ggcggccgcc agcaccggca gcacatggcc    253020
     gacgaattcg gcgcccagca cgtcgcggat gcgctgtcca tggtcggccg gcagccattg    253080
     gcgctgcgcg cggtcgtggt ggaacaggcg gaaagcgact tcgggatggg ccagcgcgat    253140
     gcgttccatg gcgtcgacgc aatggccgaa ttcggtggct tccgagcgca ggaacttgcg    253200
     ccgcgccgga acgcggtcga acagctggcg tacgtctatc gtcgtgcctg gcggccccga    253260
     ggccgggctg acctgcaggc tgccgccgtc gatctgccag gcgtgctcgg cgccgcgcgt    253320
     gcgcgagatg atggtgaggt cggccaccga ggcgatcgac gccagggcct cgccgcgaaa    253380
     ccccatcgag gccaccgact ccagttcgtc gagcgagcgg atcttgctgg tggcatggcg    253440
     cgtgagcgcc agcggcagtt cctcgggcgg gatgccgctg ccgtcgtcgg tgacggcgat    253500
     gcggcggatg ccgccgcctt ccaggcgcac ctcgatggcg cgcgcgccgg cgtcgatggc    253560
     gttttcaagg atttccttga gcaccgacgc cggccgttcg atcacctcgc cggcggcgat    253620
     ctggctgatc aacaggtcgg gcagggtagc aatcgggcgg cgatcggaca tggaggggcg    253680
     gcaaacggaa taggcaataa tggcgatttt agccctacgc taccgcccgg cggccggcct    253740
     cgtatccacg gaccctcatg ctcgacttct tcaatatggt gctccacatc gaccagaccc    253800
     taggcatctg ggtcgaacag tatggcgtgt gggtgtacct ggtgctgttt ctcatcgtgt    253860
     ttgccgagac cgggctggtg gtgctgccgt tcctgcccgg cgactcgctg ctgttcatcg    253920
     ccggcgcgtt cggcgccacc ggccacatgg acccggtgct gacggcagcg ctgctgatcg    253980
     tggcggccat cagcggcaat acggtcaact acacgatagg gcgctacatc gggccgcgcg    254040
     tgttctcgat gaacctgcgc ttcctggacc gcaatgcgct gatgcgcacg catgcgttct    254100
     acgagaagca cggcggcaag accatcgtca tgtcgcgctt cattcccgtg atccgcacct    254160
     tcgcgccgtt cgtggccggc gtggcggaca tgcgcctggc gcgcttccag ctgttcaaca    254220
     tcggcggcgc gctgctgtgg gtgatcagcc tggtggccgc gggctatttc ttcggcaaca    254280
     ttccgctggt gcgcgaacac ctgaacacca tcgtgctgat cggattgggc gcggccatcg    254340
     tgcccgtggt gatcggcgcg ctggtgcgcc tgctgcaggt acggcgcggg cagtgagaag    254400
     cgggcgcccg tccccgttgg ggaggagcga cacccgcggc aagggtgcct gtcccagccg    254460
     ggacaggcac cctgctgtac gccatcgacg cttgacggcc aaggcggtat ctgtctctgc    254520
     cggggcaggc gccctggctc agctcacgtc gcctacgcgc gccagcggcg ggttggcggt    254580
     gaagtagcgg tcgatgccgg tcatcatggc ctgcgccagc ttttcctggt gcgccgcgct    254640
     gcgcagcagg gcttcttcct tcggattgct gatgaaggcc gtctcgacca ggatggacgg    254700
     gatatcgggc gccttcagta ccgcgaagcc cgcctgctcg acccggttct tgtgcagccg    254760
     gttgatcttc ttgatctcgt ccaggaaggc gctgccgacc ttgagcgaat cgttgatctg    254820
     cgccgtggtg gacaggtcca gcagcacctt ggccacctgg cggtcgtggc tgccgaggtt    254880
     gacgccgccg atcaggtcgg ccgcgttctc cttgtcggcc agccagcgcg cctgcgtgct    254940
     ggatgcgccg cgttcggaca gcgcgaacac cgacgagccg ttggccgtgg gcttgatgaa    255000
     ggcgtcggcg tggatggaca cgaacaggtc ggcgcgcacg cgccgcgcct tctgcacgcg    255060
     cacgtgcagc ggcacgaagt aatcgtcgtc gcgcgtcaga taggcgcgca tgtacggctg    255120
     ggcgtcgatc agggtcttca gccgccgcgc gatgcgcagc accacgtcct tctcgcgcag    255180
     gcccgagcgg ccgatggcgc cggggtcctc gccgccatgt ccgggatcga gcgcgatggt    255240
     cagcatgcgc ttgcggctgg ccgagcggcc gggcgcggga agcggcttga tgggcggggc    255300
     gggcagcgcg ggcgccggct cctggccgcg ggccagcggc gcggccggct ggtcgggcgc    255360
     gggctggttg cgcgcgatct cgtcgagcac gcgcgccagc gggtcgtcga catcgggccc    255420
     ggactgcttg ttcaggatcg ccatcagcgg gtcctgcgcc accttcgggt acaggtccag    255480
     caccaggcgg tactggtagt cggccaccgg cttgagggtg aacacctggg gcgccaccga    255540
     ctgcttgagg tcgaatacca ggcgcaccac gttgggccgg ttctgcgcca cgcgcaggcc    255600
     ctggatgtac gggtcgtcgt gccgcacctt ggacacgagg tcgttgaggg cggcattgac    255660
     cgacaggcct tcgatgtcga ccaccaggcg gtgggggttc tccagcgtga agtgttccgc    255720
     cttgagctcg ctgtcgagct cgagcgtgac gcgcgtgtac tcatcggccg gccaggtgcg    255780
     cacggccagg atggtggccg catgcgccag gcggggaacg acagggagga cgagcagggt    255840
     cgcggcgacg ctgatcaggc gtcggcgggc ggcggcgcgg ggagagagcg cgccgtgggc    255900
     ggggggacaa tcgcgttcaa ccatgtttgt cctcgggcgg tatgggcggt caggctggcg    255960
     tcccgtccct ggtccgcgta agccagggag atcagcaggt ccggaggggg cagcaagcct    256020
     gccgcgcgct ccggccattc gatcaaaact accgcgtcgt cacgcagtaa atctcggaaa    256080
     ccggcgtcca gccattcgcg cgaatcgcta aacctataaa aatcaaggtg atagaagtat    256140
     aagttagaaa ctttatagga ttcaagcagc gcgtagctgg gactcttgat ccggccctgg    256200
     atgccgcatt cacgcaacag tgcgcgcgtg aaggccgtct tgccggcgcc caggtcgcct    256260
     tgcaggtgga tctgtccccc cggctggccg ccgcgccgcc cgtcgaccag cggcgcaagc    256320
     tggcgcgcca ggttttcggt ggcggcttcg tcgggcaggt gcaggcagag ggtggtcggt    256380
     ggggcggaca tggcgggtct cgagtggtaa aacgcaaggc gtggagcgga ttataggaag    256440
     cgtgctttct gctacgcttg ccgacaggat tgattctcgt tcacctgttg ccggatgcgt    256500
     ccggcaaccc gaccaattcg ccgcaaacgg agctgtaccg ccatgaaaac ccgcaccgaa    256560
     aaagacactt tcggcccgat cgaggtgccc gagcagcacc tgtggggcgc gcagacccag    256620
     cgctcgctgc atttcttcgc gatctcgacc gagaagatgc cggtgccgct ggtcgccgcc    256680
     atggcacgcc tgaagcgcgc cgccgccaag gtcaacgccg agctgggcga gctggatccg    256740
     caggtcgcag acgccatcat gcgggccgcc gatgaggtga tcgccggcaa gtggcccgac    256800
     gagtttccgc tgtcggtctg gcagaccggc tcgggcacgc agagcaacat gaacatgaac    256860
     gaggtgctgg ccaaccgcgc ctccgagctg ctgggcggcg agcgcggcga aggccgcaag    256920
     gtgcacccca acgaccacgt gaaccggggc cagtcgtcca acgatacctt tccgaccgcc    256980
     atgcacgtgg ccgccgcggt cgaggtcgag caccgcgtgc tgcccgccct gaaggcgttg    257040
     cgcggcacgc tggccgccaa gagcgcggcg ttctacgaca tcgtcaagat cggtcgcacc    257100
     catttgcagg acgccacccc gttgacgctg ggccaggaga tctccggcta cgtggcgcag    257160
     ctggacctgg ccgagcagca gatccgcgcg acgctggccg gcctgcacca gctggccatc    257220
     ggcggcacgg cggtgggcac cggcctgaac gcgcatccgc agttcagcgc caaggtatcg    257280
     gccgaactgg cccatgacac gggcagcgcg ttcgtgtcgg cgcccaacaa gttccaggcg    257340
     ctggcttcgc acgaggcgct gctgttcgcg cacggcgcct tgaagacgct ggccgccggc    257400
     ctgatgaaga tcgccaacga tgtgcgctgg ctggccagcg gcccgcgctc ggggctgggc    257460
     gaaatcagca ttcccgagaa cgagccgggc agctccatca tgccgggcaa ggtcaacccg    257520
     acccagtgcg aagccgtcac gatgctggcc gcgcaggtca tgggcaacga cgtggccatc    257580
     aatgtcggcg gggccagcgg caacttcgag ctgaacgtct tcaagccgct ggtgatccac    257640
     aatttcctgc agtcggtgcg cctgctggcc gacggcatgg tcagcttcga caagcactgc    257700
     gcggccggca tcgagcccaa ccgcgagcgc atcaccgagc tggtcgagcg ttcgctgatg    257760
     ctggtgactg cgctcaaccc gcacatcggc tacgacaagg ccgcgcagat cgccaagaag    257820
     gcgcacaagg aaaacctgtc gctgaaagag gcggcgctgg cgctggggca cctgaccgag    257880
     gcgcagttcg ccgagtgggt ggtgccgggc gacatgacca acgcgcgccg ctagagcggc    257940
     gccgggcgcg tcagttgggc gcgcccagcc ccgcggccgc ggtcagccag agcgggatgg    258000
     tcgcggccga ggccagcgtg cccagcgaga tcagcaccgc gaccatgcgg ccgtcgccgc    258060
     ccatgcgcat ggccagcaca tacgccgccg aggcggtggg cagggcggaa aacagcacca    258120
     gcatgcgcgt ctccagcgcc ggcagcccca gcgcccaggc gatgcccagc gccgccgacg    258180
     gcatggcggc cagcttgacc gccagcatcc agccgatcag ccggccatgg cccttgccgc    258240
     cttcccaggc gaggctggcg cccacgcaca tgatgcccag cgccagggcc gccgcgccca    258300
     gccgcgccat cacggtgtcg atgggcccgg gcaggctcag cccggcgagg ttgcaggcca    258360
     ggctcagcag ggtcgagacc agcagcgggt tgcgcgccag ctcgcgcagc aggccgttgc    258420
     cgctgtggcg cgccaggccg tacacggcgg cgacattggc catgggcacg gcaaagccca    258480
     cgatcagcgc catgatggtc tggccggggc cgccggccag gctggcggcc agggccaggc    258540
     cgatataggt attgaagcgg tagccgcatt gcgccgccga ggccagcgcc accggcgcgg    258600
     gcctgagcac ggggccggcc agccaggcca gcgccacgcc gcaggccatc agggccgcgg    258660
     tggcctgcag cagctgcatg gcatggccgg cgctgatggg ggtgcgcagg atggactgga    258720
     acagcagcgc ggggaacagc acgaaataca ccatgcgctc ggtgccggcg aagaattcgc    258780
     gggagaatcc cagtttgtgg cgcagggccc agcccagggc gacgagcatg aaatcgggca    258840
     aaaccagcag ggcaaccgac atggaacctg gaaggaaaat tgacaggagc ggcgcttccg    258900
     cgtcgcggcg caagctgcta ttctccgaca ttctggcagc gccttggcca taagcaatcc    258960
     tttgaaggcg cgcgccaaca ctcaaaaagg ccgccgcaca ccggtacgcc caccgcacag    259020
     ccggcccgtt acgcacggcg ccgaaatccc tggaggaaac aaactcatga ataaagtacg    259080
     caccctggtt caggccattg ccgtggccac cggccttgtc gccgccgctg gcgcgcaggc    259140
     cgccgatgcc tatcccagca aggccattcg cgtgatcgtt ccgtttgccc cgggcggctc    259200
     gaccgacatc atcgcccgcc tggtgacgca gcgcatgagc caggagctgg gccagcccat    259260
     ggtggtggaa aacaagggcg gcgccggcgg cgccatcggc gcgtccgaag ccgcgcgggc    259320
     cgagcccgac ggctacacgc tgtcgatcgc caccgtgtcg accatggccg tcaacccggc    259380
     ctgccgaccc aaggacctgc cgtacgaccc gatcaaggat ttccagccgg tcaccaactt    259440
     cgccaacacg gccaacgtcg tggcggtcaa tcccaagttt cccgccaagg atttcaaggg    259500
     cttcctggaa gagctcaaga agaaccccgg caagtactcg tatggcagct cgggcacctg    259560
     cggcgtgctg cacctgatgg gcgagtcgtt caagatggcc acgggcaccg atatcgtgca    259620
     cgtgccctac aagggttcgg gcccggccgt ggccgatgcc gtgggcggcc agatcgaact    259680
     gatcttcgac aacctgccgt cgtccatgcc gcagatccag gccggcaagc tgcgcgccat    259740
     ggccatcgcg tggccgaccc gcatcgacgc catcaaggac gtccccacgt tcgccgatgc    259800
     cggtttcccg gtgctgaacc agccggtgtg gtacggcctg ctggcgccca agggcacgcc    259860
     gatggatgtc gtgaacaagc tgcgcgatgc cgccgtggtg gccctgaagg acccgaaggt    259920
     catcaaggcc ctggacgacc agggctcggc gccgtcgggc aacacgcccg aagagttcgc    259980
     caaggaaatc aaggagcagt acgactgggc gcaggacgtg gtcaagaagc agaacatcaa    260040
     gctggactga tggctgcctg acaccgtgca cgccgaaagc gccccgcggg gcgctttttt    260100
     cttgcgcgcg ttgtttattc cggttgcggc gcgggctgcg cctgcagcac cgagcaggcc    260160
     tggcgcaggc gctcgatgaa gtcgtggtgc agggtcgaga gcgcgtcctg gctgcgggtc    260220
     atgacgctga tgggcacgcg cagcgccggc tccaggcgcc gcagcgccat gccgggacgc    260280
     agcatggcgc gcgcggtgat ggcgtcgacc acggcgtcgc cgcaaccggc ctcggccagc    260340
     gcgcaggcca cgtagtgggt ctgtacctgg attgccacgc ggggggccag cccttgcgcg    260400
     tccagcgcca tttgcagcag cgagcccgag gcatcgcggg cgtcgagcac gatgagggtt    260460
     tcgccgccga gttcctgcag gcgcgtcgtg ccggcgccgg ggaggcggct caggtgcacc    260520
     agttcggtat ggcccaggct ggtgcgcgtc aggccggggt ggttgttggc gtcgaaggta    260580
     atggccaggt cgagctcgtg cgccagcagg ccctgcacca gctcggcgct gtggtgggtg    260640
     tggatgtcga aggtgatgcc gggctgggcg tcgcggctgg cgcgcaccac gccgggcagc    260700
     aggcccaggc cgagagccgg cgcgcagccc agccgcaggt ggccgtgggg gcggtcgcgc    260760
     aggctggcgg ccagcctgcg cacgctgccg aggtcctggt tcaggcgcgc cacctcgggc    260820
     gccaggattt cggcttcgcg cgtggccacc aggcgcccct tgacccgctc gaacagcttg    260880
     aacccgagct gggcctcggc gtgcgccagc agcttgctgg ccgcgggctg agaaatatgc    260940
     agggccgccg ccgcctcggt cagcgacccg gtacggcgga tggcctcgaa gatctcgatg    261000
     tggcgcaggc gcatggctca aacccgggat ggaaaatgcg attctatgcc gaggcgggtt    261060
     cgccgctgcc ggacagcctg tttatcatgt gccgttggac cagcctgagg aggggagacc    261120
     atgccattgc ggacgctgtt ggcggcgctg tgcgccgccg ccatttgcca ggcgccggcc    261180
     tgggcgcgcg aggcgccggg cgtggcgcgc gaggacgtca atccggagat cgccagcgcg    261240
     cgcagcgagc gcgcgcaagc gcacgcccag cgctacatga tcgccaccgc caacccgctg    261300
     gccagcgagg ccggctaccg tatcctgcgg gccggcggca gcgccaccga cgccatcatc    261360
     gccgcgcaac tggtgctgaa cctggtcgag ccgcaatcct cgggcatagg cggcggcgcc    261420
     ttcatggtgc actacgaccg cggcgccggc gagctgcgcg tctacgacag ccgcgagacc    261480
     gcgcccgcgg ctgcgcggcc cgaccgcttc ctgcgcgagg gcaagccgct gtcgtatgcc    261540
     gaatcggtca acaacggccg cgcggtcggc acgccgggcc tgttgcgcgg cctggagctg    261600
     gcgcatcgcc agcacggcaa gctgccatgg caggccctgt tcgagccggc catcgcgatg    261660
     gccgagcagg ggttcgccgt gtcgccgcgc ctgcacgagt ccatcgccgg cgacaaggcg    261720
     ctggcggcgc agcccgcggc ggcgcgctac ttctacggcc ccgacgggca ggcctggccg    261780
     gtcggccacc ggctgcggaa tcccgagttc gcggccacgc tgcgcagcat cgcgcgcgag    261840
     ggggccgatg ccttctaccg cgggccgatc gcgcgcgaca tcgtggcggc ggtgcgtgcc    261900
     catcccacgc cgggcgacct ggccgaggcc gacttggccg gctaccgggc cgtggtgcgc    261960
     gagcctgtgt gtggcctgta ccggggctac cgcctgtgcg gcgcgccgcc gccgagcagc    262020
     ggcccgctgg cggtgctgca gatgctgggc gaactggaac agtacccgct ggcgcgcatg    262080
     cgtcccggca gtgtcgaggc cgtgcattat ttttccgagg ccgggcggct ggccttcgcc    262140
     gaccgagact tctacgtggc cgatccggcc tttgtcgatg ttccggtgcg ggcgctgctc    262200
     gatcccgcct acctgcgcca gcgcggcgcg ctgatccgcc ccgaccgcag catgaagacg    262260
     gccctgccgg gcgatccgca ggggctgctg gccgaacgcg cgcgcgacga cgccatcgag    262320
     gtgccctcga ccagccacct ggtggcggtg gatgccgcgg gcaacgtggt ttccatgacg    262380
     tccaccatcg aggccgcgtt cggcagcaag atcttcgtgc gcggtttcct gctcaacaac    262440
     gagatgacgg acttctcgtc ctcctaccgc gatccggaag ggcggctggt cgccaaccgg    262500
     gtcgagccgg gcaagcggcc gcgcagctcg atggcgccca tgatcgtgtt tcgcgccggc    262560
     aagcccgtgc tggcgctggg ttcgcccggc ggcagcgcca tcatcaacta cgtggccaag    262620
     acgctggtcg gcgtgctcga ttggaagctg gacgtgcagc aggcgatcgc gctgcccaac    262680
     ctgggcagcc gcaacaagga aaccgagctc gagcgcggca cggcgctgga agcgctggcc    262740
     ccggcgctgc ggcgcatggg ccatgaggtg cgcatcaccg attttcccag cggaatccag    262800
     ggcatcgtga tcgggccgca cggcctggcc ggcggcgccg atccgcgccg cgaaggcctg    262860
     gcgctgggcg actgagggcg gttcaggccc cggccggttc ctgcaaggcc ggcggcacgc    262920
     tgcgcaggcg cgcgggggtg cgcgacagct tgatgggcga ggcgatgccc cggtagtcgc    262980
     cggcttccag cagcatgccg cggtggcggg cgtgcggatg gtcgagcgcc tgcgccacgt    263040
     ccagcacggc cgcggccggc acgcccagcc gcagcaggcg ctcggccagc gaggccgctt    263100
     cgtgcggccg cagcagttcg gtcagcgcgg cgcacagggc gtcgcgatgc gccaggcgct    263160
     cggcgttgct ggcaaagcgc gcgtcctgcg ccagttgcgg ggcgcccagc gcgtcggcca    263220
     gcgccgcgaa ctggcggttg ttgcccaccg ccaggaagat cggcccggcg ccggtgggca    263280
     gggttttata cggcgcgatg ttcggatgcg cgttgccggt gcgcgtgggc acccggccgc    263340
     tgtagaagta gttcggcgcg tgcggatgca gcagcgacag cgcgcagtcg tacagcgtga    263400
     tgtccaggaa ctggcccagg ccgctgcgct ggcgctcctg cagggccagc agcacggcga    263460
     cggccgcgtt caggccggtc accatgtcca cgaccggcag gcccacccgc gtggccgggc    263520
     cgtcggcctc gccgttgacg ctcatcagcc cgcacatggc ctgggcgcag gcgtcgtagc    263580
     ccggcaggcc gcccagcggg ccgtcggcgc cgaagccgct gacgcggcaa tgcaccaggc    263640
     gcggaaaggc ctggctcagc gtgtcgtagc ccagccccca cttctccagc gtgccgggct    263700
     tgaaattctc caccagcacg tcggcgtcgg ccagcaggcc gcgcagcagc tcctggccgg    263760
     caggctgcga caggtccagc gccatgccac gcttgttgcg gttgacgccg atgaagtagg    263820
     aggcggtctg gccggagaac ggcggccccc agccgcgcgt ctcgtcgccg ccgggcggtt    263880
     cgatcttcag cacgtcggcg ccgtggtcgg cgaggatctg ggtgcagtac gggccgccca    263940
     gcacgcgcga caggtcgatg acgcggcagc cttgcagggc gccggggggc aatgcggcaa    264000
     cagccatggt ggatacgcct ttagtccagg gaaatctgcg cggcgcggat cagctcgccc    264060
     cacttgtcga cttcctcgtt gatgaagccg gccagggcct gcggcgtgcg ctcgggcgcc    264120
     ggcacgatgc cttgcttgcg cagcgtgtcg cgcacttcgg gcgcgtccag cgcggcgatg    264180
     aaggcggcgt tcagtttctg cacgatggcg tcgggcgtgc ccttgggcgc cacgatgccg    264240
     aagaatacgc tgacgtcgta gccggccagc ccctgttcgg caatcgtggg cagctcgggc    264300
     agggcctgcg agcgctgcgc gctggccagg ccgatggcct tcagcttgcc ggcctgtatg    264360
     tgcggcaacg cggtaaggat gtcggtgaac gacatcgaaa cctgcccgcc cagcaggtcg    264420
     ttcagggccg ggccggtgcc cttgtaggac acgtgcagga tgcgcgtgcc ggccatgcgg    264480
     ttgaacagca cgccggccag gtgcgaggag gcgccgttgc ccgaggacgc gtagctcagc    264540
     ttgtcgggat tggccttggc gtaggcgatc agttcctgca cgttgttggc cggcaccgag    264600
     ggatgcacca ccaggatgtt gggcaggtgg ccgatgcgca cgatgggcgc gaagctggtg    264660
     cgcgggtcgt agttctgttt cttgtacagg ctgatgttga tggccagcgg gcccgaggtg    264720
     ccgaacagca gcgtatagcc gtcgggcttg gcgtgggcca ccagttcggc gccgatattg    264780
     ccgcccgcgc cgccgcggtt ttccaccacc acggtctggt cgagttgcgt tttcaggcct    264840
     tcggccagcc ggcgcgccat ggcgtcggtg gggccgccgg gcgggaaggg aacgaccagg    264900
     gtgactggcc ggtcggggta gtcggccagc gccggcgcgg cggcgccgcc cagcaaggcc    264960
     aggccggcgg ccaggacgag gctgcgaatc agctgttgca tggtatgtct ccgtcgttgt    265020
     tatgtgggaa ccgccgctat agcgcggtct gcagcacggc gcggcacgcc gcgtcgtcgt    265080
     cggcgggcag cgcgcaaggg tcgcggggag cgagccggtg gcgcagcgcc aggtcggcca    265140
     gcgcggcgcg cgaggccagt cggggatcgc gcgccgcttc ccagcgcagc gcggcgatgg    265200
     cgacgacgtg gtacagggcc gaggccgcct ggcgcgccag gtcgtcgcgt tcatgggcgg    265260
     ccgcgtgcgc ggccagcgca taggcgccgt cgaaggcgcg cgccttcgac ggcgccagct    265320
     cgggcgggca cggcgcgccg gcggccagca aggcctgcac atggcgctgc agcgccggca    265380
     gggcgtcggc cttgcggata gcgcgcagta cgtccagcgc cacgatgttg ctggtgcctt    265440
     cccagatcga gccgagatgc gcatcgcgca tcaggcgcgg ctcgacccat tcttcgatat    265500
     agccgcagcc gccgcggacc tccatcgcgt cgccggtcac ctggcgcgcg tcgcggcagg    265560
     cgcggaactt gatcagcggc gtgaggatgc gcggcagcgc cgcctcgccc tcgccgcggt    265620
     cggcggcggc tagctgtgaa gattcaatag gttgtatgca tggttcatcc gaaccggatt    265680
     tgagaaactg gaaatcgccg accccccagt tcactcaagg agcccggccg gatgaacacc    265740
     cataagcatg cccgattgac cttcctacgt cgactcgaaa tggtccagca attgatcgcc    265800
     catcaagttt gtgtgcctga agcggcccgc gcctatgggg tcaccgcgcc gactgtgcgc    265860
     aaatggctgg gccgcttcct ggctcagggc caggcgggct tggccgatgc gtcctcgcgc    265920
     ccgacggtct cgccccgagc gattgcgccg gccaaggcgc tggctatcgt ggagctgcgc    265980
     cgcaagcggc tgacccaagc gcgcatcgcc caggcgctgg gcgtgtcagc cagcaccgtc    266040
     agccgcgtcc tggcccgcgc cggtctgtcg cacctggccg acctggagcc ggccgagccg    266100
     gtggtgcgct acgagcatca ggcccccggc gatctgctgc acatcgacat caagaagctg    266160
     ggacgtatcc agcgccctgg ccaccgggtc acgggcaacc gacgcgatac cgttgagggg    266220
     gccggctggg acttcgtctt cgtggccatc gatgaccacg cccgcgtggc cttcaccgac    266280
     atccaccccg acgagcgctt ccccagcgcc gtccagttcc tcaaggacgc agtggcctac    266340
     taccagcgcc tgggcgtgac catccagcgc ttgctcaccg acaatggctc ggcctttcgc    266400
     agccgcgcct tcgccgcgct gtgccatgag ctgggcatca agcaccgctt tacccgacct    266460
     taccgcccac agaccaatgg caaggccgaa cgcttcatcc agtcggcctt gcgtgagtgg    266520
     gcttacgctc acacctacca gaactcccaa caccgagccg atgccatgaa atcctggcta    266580
     caccactaca actggcatcg accccaccaa ggcatcgggc gcgctgtacc catctccaga    266640
     ctcaacctgg acgaatacaa cctattgaca gttcacagct agccgggcac tggcgcgtgc    266700
     gcggcggcct gggcgtgcag agcgcctcca tcgtccgcga caacaatggg caggccggca    266760
     agcgcgtgcg caacgtggcg cgcctcaacg gcagcctgtt tctgtcctac cggccgccac    266820
     agggctggta cggtgaaacc ggggtgacct tcgtgggtgc gcgctacgcc gacaatgcca    266880
     acgcggtccg cttgcccgac tatgggcgcc tggacgccat gctcggctac cgcaccggag    266940
     cctgggactg gcggctggcg gtgcgcaacc tggccgacaa gacttacttc gcctcggcca    267000
     ccagcgccgg ccagatccgc tacggcgagc cgcgcgtcgc gcttgccacg ctgcagtacg    267060
     ttttctgacg gcgcaagccc aagtcgaacc aggaaaacgc cgccgtcagg cggcgtttgc    267120
     gtttgcgcaa gcgcccgcaa ggctagggtc tgccaagatg gccgcggccg tggccttgcc    267180
     tttccattca ggaagttcga taatttcagg aatttctgaa atcaacgtaa caaatattgt    267240
     cgtggcactt tctccccaaa ccgaacggtt cgtgctgcat tttggcgaaa tgggtagccg    267300
     ctggggcgtg aaccgcaccg tggggcagat ctatgccctg ctgttcctgt cgcccaaggc    267360
     cctgcacgcc gacgacatcg ccgaggcgct gggcttttcg cgttccaacg tgagcatggg    267420
     cctgaaggag ctgcagtcgt ggcggctggt caagctgatg caccaggtcg gcgaccggcg    267480
     cgattacttc gagacgccca aggatgtttg ggaaattttc cgcatcctga tggaagagaa    267540
     gcgcaagcgc gaaatcgatc ccacccttac gctgttgcgc gacaccttgc tggagcggcc    267600
     ggccgacgag gcgcaagtct atgcccagca gcgcatgcac gagatgctgg agctgatcga    267660
     gctgtccacg ggatggttcg acgaggtgca gcgcctgccg ccagaaacgc tgcaaaatct    267720
     catgaaactg ggttcaaaag tgcagaaagt gctgggtttt gccggcaagc tgcgcggcaa    267780
     ggattgaatc tggctgttgt ttgttgagga tcatccctat gaagttgtac gtaacgccct    267840
     tatcatggcc tgcgagcgag ccgggaggcc atgtcggctg tccgggccgg cctaccgtct    267900
     gggagcgtct ccatgattga cctcgatgtc gtcaacctgt cgcgattcca gtttgccgcg    267960
     accgcgctat accacttcct gttcgttccc ctcacgctcg gcctgtcgtt catcctggcc    268020
     atcatggaaa gcgtgtacgt catgaccggc cgccagatct ggaagcgaat gacgatgttc    268080
     tggggcacgc tgttcggcat caacttcgcc ctgggcgtgg ccaccggcgt ggccatggaa    268140
     ttccagttcg gcatgaactg gtcctactac agccactacg tcggcgatat cttcggcgcg    268200
     ccgctggcgc tcgagggcct gatggcgttc ttcctcgagg ccaccttcgt cggcctgttc    268260
     ttcttcggct ggaaccgcct gtccaaggtc ggccacctgg tggtgacctg gctggtggcg    268320
     ttcggcacca acttctcggc gctctggatc ctgatcgcca acggctggat gcagaacccg    268380
     gtgggcgcga tgttcaatcc ggacaccatg cgcatggaaa tgaccgactt cgccgccgtg    268440
     ctgctcaacc cggtggcgca ggccaagttc gtgcatacgg tcagcgccgg ctacgtggcg    268500
     ggcgcgatgt tcgtgatgtc gatcagcgcc tggtacctgc tcaagggccg ccacatcgac    268560
     ctggccaagc gttcgatggc ggtggcggcc agcttcggcc tggcttcggc gctgtctgtg    268620
     gtggtgctgg gcgacgaaag cggttatctc accaccgaac accagaaaat gaagatcgcg    268680
     gccatcgagg ccatgtggca taccgagccg gcgccggcct cgttcaacct gatcgccatt    268740
     cccaaccagg aagagcgcag gaacgagttc gcgatttcca ttccgtacgt catggggctg    268800
     atcggtacgc gttcgctgac cacgccgctg ctgggcatcg acgacctggt gcggcgcgcg    268860
     gaggtgcgca tccgcgaggg cattaccgcc tacgaggcgc tgcagcgcgt tcgcgccaat    268920
     cccaaggacg tcgacgcgcg catgctgttc gagcgcacct ggccggatct gggctacgcc    268980
     ctgctggtca agcgctacca gcccgacctg tccaaggcca ccgacgaaca gatcgcgcag    269040
     gcggcgctcg acacggtgcc gaacgtggcg ccgctgttct gggcgttccg cgtcatggtg    269100
     gcggtgggct tctacctgat cctgttcttc ggcgtggcgt tctggctggc ttcgcgcggg    269160
     cgcctggaca gccggcccgg cctgctcaag gtggcgttgt ggagcctgcc gctgccatgg    269220
     gtggcgatcg agagtggctg gttcgtggcc gagtacggcc gccagccctg ggtgatcgag    269280
     ggcgtgctgc cgacctacta tgcggcatcc ggcctgacca tcaccgacct ggcgatcagc    269340
     ctggccattt tcctggtgct ctatacggtg ctgctggtga taggcgtcaa ggtgatgctg    269400
     catgccgtca aggccgggcc gaaaggcgag gcgagcgagc cggccggccg gcgcgccgat    269460
     ccggtccagg cggccgtcga tgcgtattga tgggggagaa cgcacatgga tagcttgatt    269520
     cctttcgact acgccaccct gcgcgtgctc tggtggctgc tgctgggcgc gctgctgatc    269580
     ggcttcgccg tgatggacgg tttcgatctg ggcgtggcgg cgcttctgcc gctggtcgcc    269640
     aagaccgatg tcgagcggcg cgtggtgctc aacgtggtcg gcccggtatg ggaaggcaac    269700
     caggtctggc tgatcaccgc cggcggggcg atcttcgcgg cctggccgct gctgtatgcg    269760
     gcctcgttct cgggttttta cctggccatg atgctggtcc tcatcgccct gatcctgcgg    269820
     ccggtgggtt tcaagtaccg cagcaagatg gagggcacgc gctggcgcag ccgctgggac    269880
     gcggtgctgt gcttctgcgg cgtggtggcc gcgctggtgt tcggcgtggc gatgggcaat    269940
     atcatcctcg gcgtgccgtt cggcttcgac gcggcgacgc tgcggcccga atacgaaggc    270000
     cacttctacc agctcttcaa gcctttcgcg ctgctggccg gcctggtcag cgtggcgatg    270060
     atggtgatgc atggcggcgt gctgctggcc tggcgcacgc atgacccggt gtcctcgcgg    270120
     gcgcgcaact ggggccgcct ggcggcgctg gccacggccg cgctgttcgt ggcgggcggc    270180
     ttctgggtgg cctatggcct ggacgggcac gtgatcacca gcgcggtgga catgcatgcg    270240
     ccgtccaacc ccatgctcaa gaccgtggag ctgcaggccg gcggctggat ggccaactac    270300
     gagaaatggc cgctgacctg gatcgccccg gcgctgggcg tgggcggcgc gctgcttgcc    270360
     ttcgtgctgc tcagcgcgcg cgccaacgta ctcgcctttc tcgcttcgtc ggtgtcgatc    270420
     gccggcatca tcctcacggt cggcttcgcg ctgtttccgt tcatcatgcc gtcgtcgagc    270480