(data stored in SCRATCH zone)

EMBL: BX640413

ID   BX640413; SV 1; linear; genomic DNA; STD; PRO; 349028 BP.
XX
AC   BX640413;
XX
DT   09-AUG-2003 (Rel. 76, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 9)
XX
DE   Bordetella pertussis strain Tohama I, complete genome; segment 3/12
XX
KW   complete genome.
XX
OS   Bordetella pertussis
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Alcaligenaceae; Bordetella.
XX
RN   [2]
RP   1-349028
RA   Sebaihia M.;
RT   ;
RL   Submitted (06-AUG-2003) to the INSDC.
RL   Submitted on behalf of the Pathogen Sequencing Unit, Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA, E-mail:
RL   ms5@sanger.ac.uk
XX
RN   [3]
RA   Parkhill J., Sebaihia M., Preston A., Murphy L.D., Thomson N., Harris D.E.,
RA   Holden M.T.G., Churcher C.M., Bentley S.D., Mungall K.L.,
RA   Cerdeno-Tarraga A.M., Temple L., James K., Harris B., Quail M.A.,
RA   Achtman M., Atkin R., Baker S., Basham D., Bason N., Cherevach I.,
RA   Chillingworth T., Collins M., Cronin A., Davis P., Doggett J., Feltwell T.,
RA   Goble A., Hamlin N., Hauser H., Holroyd S., Jagels K., Leather S.,
RA   Moule S., Norberczak H., O'Neil S., Ormond D., Price C., Rabbinowitsch E.,
RA   Rutter S., Sanders M., Saunders D., Seeger K., Sharp S., Simmonds M.,
RA   Skelton J., Squares R., Squares S., Stevens K., Unwin L., Whitehead S.,
RA   Barrell B.G., Maskell D.J.;
RT   "Comparative analysis of the genome sequences of Bordetella pertussis,
RT   Bordetella parapertussis and Bordetella bronchiseptica";
RL   Nat Genet 35(1):0(2003).
XX
DR   MD5; 5a22912f9ff648987bde4a14cea79e9a.
DR   ENA-CON; BX470248.
DR   BioSample; SAMEA1705933.
DR   EuropePMC; PMC3488263; 22965118.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF01850; beta_tmRNA.
DR   StrainInfo; 494022; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..349028
FT                   /organism="Bordetella pertussis"
FT                   /strain="Tohama I"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:520"
FT   CDS_pept        86..1168
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /gene_synonym="sueB"
FT                   /gene_synonym="uar"
FT                   /locus_tag="BP0678"
FT                   /product="peptide chain release factor 1"
FT                   /note="Similar to Escherichia coli peptide chain release
FT                   factor 1 PrfA or SueB or Uar or B1211 SW:RF1_ECOLI (P07011)
FT                   (360 aa) fasta scores: E(): 9.8e-89, 65.922% id in 358 aa,
FT                   and to Neisseria meningitidis peptide chain release factor
FT                   1 Nmb1686 TR:Q9JY93 (EMBL:AE002519) (358 aa) fasta scores:
FT                   E(): 2e-96, 71.989% id in 357 aa. Also similar to BP1104,
FT                   40.571% identity in 350 aa overlap."
FT                   /db_xref="GOA:Q7W023"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W023"
FT                   /protein_id="CAE40989.1"
FT                   /translation="MKPSMRSRLEQLAHRLIEVDALLAEPETAADMDRFRKLSRERAEL
FT                   EPVVEAFNAFLGVEADVATAQEMLSDPDMKAMAEDEIKTGRARIEEMEAALQLLLLPRD
FT                   PDDGRSLFLEIRAGTGGDESALFSGDLLRMYTRYAETRGWRVEIMSESESELGGYKEVI
FT                   ARIDGDGAYGRLKFESGAHRVQRVPATEAQGRIHTSACTVAVMPEADAMSDIVINPSDL
FT                   RIDTFRASGAGGQHINKTDSAVRITHVPTGLVVECQDDRSQHRNKDKAMQVLAARLKDK
FT                   EMRERQSKEAAERKSLIGSGDRSERIRTYNYPQGRVTDHRINLTLYKLQQIMEGDLDEL
FT                   TGALLAEHQAEQLAALGHDL"
FT   misc_feature    707..1048
FT                   /note="HMMPfam hit to PF00472, Peptidyl-tRNA hydrolase
FT                   domain"
FT   CDS_pept        1179..1991
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="BP0679"
FT                   /product="heme biosynthesis protein"
FT                   /EC_number="2.1.1.-"
FT                   /note="Similar to Escherichia coli HemK protein or B1212
FT                   SW:HEMK_ECOLI (P37186) (277 aa) fasta scores: E(): 1.2e-32,
FT                   42.578% id in 256 aa, and to Neisseria meningitidis HemK
FT                   protein or Nma0369 TR:Q9JWH6 (EMBL:AL162753) (273 aa) fasta
FT                   scores: E(): 7.5e-41, 48.846% id in 260 aa"
FT                   /db_xref="GOA:Q7W022"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W022"
FT                   /protein_id="CAE40990.1"
FT                   /translation="MTLLKDLLADPGLPRLEARMLAEHVLGRSRAWLLAHDTDPVEPAH
FT                   EAAWRQLAARRLAGEPMAYLLGGREFMGHWYALTPDVLIPRPDTELLVETALHWLQGRA
FT                   APRVLDLGTGSGAIAVSVALGCPQAEVTATDLSAAALAVAEGNAQRLGARVRCLAGDWY
FT                   EALPAQDRYDLIVSNPPYIAREDAHLAQGDLRFEPRGALTDENDGLAALARIAGGAPGR
FT                   LLPGGAIWMEHGWDQAEAARALLRQAGLREVHSRRDLAGIERISGGYL"
FT   misc_feature    1377..1412
FT                   /note="ScanRegExp hit to PS00213, Lipocalin signature."
FT   misc_feature    1701..1721
FT                   /note="ScanRegExp hit to PS00092, N-6 Adenine-specific DNA
FT                   methylases signature."
FT   CDS_pept        2028..2354
FT                   /transl_table=11
FT                   /locus_tag="BP0680"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Neisseria meningitidis hypothetical
FT                   protein Nma0984 or Nmb0773 TR:Q9JR73 (EMBL:AL162754) (103
FT                   aa) fasta scores: E(): 2.8e-24, 66.337% id in 101 aa, and
FT                   to Rhizobium meliloti conserved hypothetical protein
FT                   Smc00538 TR:CAC46360 (EMBL:AL591788) (111 aa) fasta scores:
FT                   E(): 9.6e-21, 57.009% id in 107 aa"
FT                   /db_xref="GOA:Q7W021"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W021"
FT                   /protein_id="CAE40991.1"
FT                   /translation="MSDVQEFIRETVTQHPVVLFMKGTTQFPQCGFSGRAIQILKGCGV
FT                   KKLVTVNVLEDDEVRQAIKTFSNWPTIPQLYVGGEFIGGSDIMSEMNESGELKQLLDDS
FT                   GATA"
FT   CDS_pept        2359..2919
FT                   /transl_table=11
FT                   /locus_tag="BP0681"
FT                   /product="probable flavoprotein"
FT                   /note="Similar to Streptomyces sp VdcB TR:Q9X696
FT                   (EMBL:AF134589) (200 aa) fasta scores: E(): 4.8e-33,
FT                   51.892% id in 185 aa, and to Escherichia coli phenylacrylic
FT                   acid decarboxylase-like protein Pad1 TR:Q9F8R0
FT                   (EMBL:AF242211) (197 aa) fasta scores: E(): 1.5e-31,
FT                   49.189% id in 185 aa"
FT                   /db_xref="GOA:Q7W020"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W020"
FT                   /protein_id="CAE40992.1"
FT                   /translation="MRRLVVGITGATGAIYAVRLLQALRGVSDVESHLIVSASGVLNIK
FT                   HELDVGRHDVQALADHVHSVRDVGATLASGAFQTAGMVIVPCSMRTLAAVAHGLSDNLI
FT                   TRAADVTLKERRRLVMMVRETPFNLAHLRNMTAVTEMGGIIFPPLPAFYHRPASIEEMV
FT                   DHTVARVLELFDIEVPGPHWAGM"
FT   misc_feature    2362..2727
FT                   /note="HMMPfam hit to PF02441, Flavoprotein"
FT   CDS_pept        3160..4152
FT                   /transl_table=11
FT                   /locus_tag="BP0682"
FT                   /product="putative exported protein"
FT                   /note="Similar to Variovorax paradoxus 2,4-diphenoxyacetic
FT                   acid gene cluster TR:Q9RHQ7 (EMBL:AB028643) (337 aa) fasta
FT                   scores: E(): 1.4e-38, 36.577% id in 298 aa, and to
FT                   Rhizobium meliloti conserved hypothetical protein Sma1927
FT                   TR:AAK65716 (EMBL:AE007292) (330 aa) fasta scores: E():
FT                   2.3e-42, 38.769% id in 325 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="PDB:2QPQ"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W019"
FT                   /protein_id="CAE40993.1"
FT                   /translation="MQRRSFLAKVAHIAAAVGVSACAATSSFAATGDFPNKPLDIIVTF
FT                   PPGGGTDMLARLIGNYLTESLGQTAVVENRPGASGNVGARLVADRAPDGYSLLMVNSSF
FT                   AVNPGVFRNLPFDPKKDFAAVINVAYVPSVFVVPAGSKYKTLGELMAAAKQTNTQVTYG
FT                   SCGNGTPQHLAGELLNVSAKTHMVHVPYKGCGPALNDVLGSQIGLAVVTASSAIPFIKA
FT                   GKLQALAVTSKERSALLPEVPTVAEQGVAGYELNQWHGLLVPGATPMAVRQKLYDGIAK
FT                   VMQRDDVQKKLADLGYSTASDGPEVFQKMVETDIDRFSALTKQIGLKVD"
FT   misc_feature    3160..3246
FT                   /note="Signal peptide predicted for BP0682 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.982 between residues 29 and 30"
FT   misc_feature    3175..3243
FT                   /note="1 probable transmembrane helix predicted for BP0682
FT                   by TMHMM2.0 at aa 13-35"
FT   misc_feature    3193..3225
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        4171..5166
FT                   /transl_table=11
FT                   /locus_tag="BP0683"
FT                   /product="4,5-dihydroxyphthalate decarboxylase"
FT                   /EC_number="4.1.1.55"
FT                   /note="Similar to Burkholderia cepacia
FT                   4,5-dihydroxyphthalate decarboxylase OphC TR:Q9ZFR0
FT                   (EMBL:AF095748) (330 aa) fasta scores: E(): 6.3e-68,
FT                   49.848% id in 329 aa, and to Comamonas testosteroni
FT                   4,5-dihydroxyphthalate decarboxylase PhtD SW:PHTD_COMTE
FT                   (Q59727) (330 aa) fasta scores: E(): 3.6e-65, 48.632% id in
FT                   329 aa"
FT                   /db_xref="GOA:Q7W018"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W018"
FT                   /protein_id="CAE40994.1"
FT                   /translation="MSSKLKISLSCGDYDRTRALFDGRAPIEGCEVTAVPLEPEEAFHR
FT                   AFRYHEYDVTEISMSSHMMTTARGDNEYIAIPAFLSRVFRHSGIYVRTDRDIDKPQDLR
FT                   GKTIGVPEYQITANVWIRGILEDAYGVKPQDIKWRRGGIEEPGRGERAPIELPDGIDLQ
FT                   QIPDDKTLSDMLEAGEIDGYIGARAPSCFLRGAPNVGRLFNDYLKTEQDYFRETRIFPI
FT                   MHMVGIRRSLVEQNPWLPVSVYKAFLKAKMLAVKELNEICHLAVTLPWMVHHYNAAREL
FT                   MGDDYWPYGLDANRHVIETFARYHYGQGLSRRLVKPEELFAASSLDLSKI"
FT   CDS_pept        join(5182..5958,5960..6052)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0684"
FT                   /product="molybdopterin dehydrogenase (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 259. The frameshift occurs within
FT                   a polymeric tract of (T)3. The sequence has been checked
FT                   and believed to be correct. Similar to Pseudomonas putida
FT                   quinoline 2-oxidoreductase, medium chain QorM TR:P72222
FT                   (EMBL:X98131) (288 aa) fasta scores: E(): 1.2e-31, 37.063%
FT                   id in 286 aa, and to Arthrobacter nicotinovorans ketone
FT                   dehydrogenase medium subunit KdhM TR:O87681 (EMBL:AJ306903)
FT                   (296 aa) fasta scores: E(): 2.5e-37, 39.175% id in 291 aa"
FT                   /db_xref="PSEUDO:CAE40995.1"
FT   misc_feature    5185..6012
FT                   /note="HMMPfam hit to PF00941, FAD binding domain in
FT                   molybdopterin dehydrogenase"
FT   variation       5958..5960
FT                   /note="(T)3 in pertussis; (T)2 in parapertussis and
FT                   bronchiseptica"
FT   CDS_pept        6049..6558
FT                   /transl_table=11
FT                   /locus_tag="BP0684A"
FT                   /product="probable 2Fe-2S ferredoxin"
FT                   /note="Similar to Pseudomonas thermocarboxydovorans carbon
FT                   monoxide oxygenase [cytochrome b-561], small chain Cut C
FT                   TR:Q52589 (EMBL:X77931) (163 aa) fasta scores: E():
FT                   1.1e-31, 57.051% id in 156 aa, and to Sulfolobus
FT                   solfataricus carbon monoxide dehydrogenase, small chain
FT                   amino-end fragment CutC-2 TR:Q97VI6 (EMBL:AE006859) (163
FT                   aa) fasta scores: E(): 5.3e-32, 54.658% id in 161 aa"
FT                   /db_xref="GOA:Q7W017"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W017"
FT                   /protein_id="CAE40996.1"
FT                   /translation="MSDITESTAQHVSLTVNGRACGGCAEPRMHLADFLRGELGLTGTH
FT                   IGCEHGVCGACTVLVDGYSTRSCLMLAVQAQDSRIDTIEGLAGEDDALHPIQQAFHELH
FT                   ALQCGYCTPGILMSVAELLAANPNPDEAQVRDVLSGHLCRCTGYQNIVAAVLRAAQLMR
FT                   AEAGHD"
FT   misc_feature    6082..6270
FT                   /note="HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster
FT                   binding domain"
FT   misc_feature    6190..6216
FT                   /note="ScanRegExp hit to PS00197, 2Fe-2S ferredoxins,
FT                   iron-sulfur binding region signature."
FT   misc_feature    6292..6519
FT                   /note="HMMPfam hit to PF01799, [2Fe-2S] binding domain"
FT   CDS_pept        6551..8932
FT                   /transl_table=11
FT                   /locus_tag="BP0685"
FT                   /product="probable dehydrogenase/oxidase"
FT                   /note="Similar to Pseudomonas putida quinoline
FT                   2-oxidoreductase, large chain QorL TR:P72224 (EMBL:X98131)
FT                   (788 aa) fasta scores: E(): 7.5e-52, 36.189% id in 782 aa,
FT                   and to Arthrobacter nicotinovorans ketone dehydrogenase
FT                   large subunit KdhL TR:CAC37487 (EMBL:AJ306904) (794 aa)
FT                   fasta scores: E(): 9.9e-82, 35.379% id in 766 aa"
FT                   /db_xref="GOA:Q7W016"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W016"
FT                   /protein_id="CAE40997.1"
FT                   /translation="MTDATSPGLGRSAPRIEDDALLRGQARFLDDIEVEGVLHACFVRS
FT                   PHAHARLVSIDLSAARAVPGVAAVYGARDLFGQLTSWRMPLGFPLAALPDDTTPFVLAE
FT                   REVAFVGEAIAVVVADSRHIAEDAAARVAIEYEVLGAVVDCRDALRPDAPLVRGELASN
FT                   ILQQYTLAYGDCETAFAQAHRVLEDDFWVHRGCAHPMEGRGVLARMDRATDTLTVWSST
FT                   QMAHELHYTLALMLGQPEDRLRVVTPDVGGGFGAKFMIYPEEMAIPAAARKLGRPVKWV
FT                   EDRREHFTTSIQERDQYWKVAMAIDDQGHVLGIRGNFVHDNGAYTPQGTNVPYNAASSM
FT                   TGPYVVPAFSLDVSVAYTNKVPVATVRGAGYPQAAFVMERMMDRVAAELGIDPGECRRR
FT                   NLIGPAKIPYTKPLKSRAGMPLTIDSGDFPALQACALQASDYDGFAVRRDAALARGRWR
FT                   GIAVANSVEPTGRGPFEVARVRVQPSGQVSIYTGALAMGQGIKTTLAQICAGHLGVPVA
FT                   AVEVQAGDTAYVGYGMGGFASRQAIMAGSAVDQAAAQVRRQALETAAAVLKAEAETLEL
FT                   ADGEVRAPDGQSVSLARLAMLRKGVPGYALVSPGDPGLDATAYFHCDAQTYAGASHVCE
FT                   VEVDPATGAIEIVRYVAAQDSGRIINPQLAEGQVHGGVVHGIGNALFEWMGYDAAGQPL
FT                   STTFAEYLLPTAPEVPPIEVVFQPSPTPLNPLGVKGVGECATIPVAVAVVGAVEHAVAH
FT                   CGVRVTEFPLTPVRLLELLTQAEARAAAPTDSGEFVDGVH"
FT   misc_feature    6617..8680
FT                   /note="HMMPfam hit to PF01315, Aldehyde oxidase and
FT                   xanthine dehydrogenase, a/b hammerhead domain"
FT   misc_feature    7967..7996
FT                   /note="ScanRegExp hit to PS00215, Mitochondrial energy
FT                   transfer proteins signature."
FT   CDS_pept        join(8973..9335,9339..9695)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0686"
FT                   /product="conserved hypothetical protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS contains an in-frame TAG stop
FT                   codon. The sequence has been checked and believed to be
FT                   correct. Similar to Arthrobacter nicotinovorans Orf235
FT                   TR:AAK64256 (EMBL:AF373840) (235 aa) fasta scores: E():
FT                   4.7e-09, 31.604% id in 212 aa, and to Mycobacterium
FT                   tuberculosis CDC1551 hypothetical 21.6 kDa protein mt0384.1
FT                   TR:AAK44606 (EMBL:AE006943) (200 aa) fasta scores: E():
FT                   1.7e-07, 34.194% id in 155 aa"
FT                   /db_xref="PSEUDO:CAE40998.1"
FT   variation       9336..9338
FT                   /note="In-frame TAG stop codon in pertussis; CAG in
FT                   parapertussis and bronchiseptica"
FT   CDS_pept        complement(9800..10750)
FT                   /transl_table=11
FT                   /locus_tag="BP0688"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA3"
FT                   /protein_id="CAE40999.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   repeat_region   9800..9831
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(9800..10852)
FT   misc_feature    complement(9836..10369)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(10427..10492)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   repeat_region   complement(10821..10852)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(10849..11799)
FT                   /transl_table=11
FT                   /locus_tag="BP0689"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Pseudomonas aeruginosa rare lipoprotein A
FT                   precursor RlpA or Pa4000 TR:Q9X6V6 (EMBL:AF147448) (342 aa)
FT                   fasta scores: E(): 8.6e-23, 39.869% id in 306 aa, and to
FT                   Vibrio cholerae rare lipoprotein A, putative Vc0948
FT                   TR:Q9KTF4 (EMBL:AE004177) (263 aa) fasta scores: E():
FT                   3.4e-23, 37.079% id in 267 aa"
FT                   /db_xref="GOA:Q7W015"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W015"
FT                   /protein_id="CAE41000.1"
FT                   /translation="MIRSRPLALLSTLLLALAIAGCSTPGKKRGGYYKDDGPDANPPSN
FT                   LDNVPDATPRLEPLASGPNRPYVVFGKRYVPDTSERPFRQQGLASWYGKKFHGNSTSNG
FT                   ESYDMYAMTAAHPTMPIPSYARVTSKINGRTVIVRVNDRGPFHSDRIMDLSYVAAHKLG
FT                   IIGPGSGPVTVERILPAEILAMNGGAAAPRPGPASATGPLPVAAPSAAAAVELHPATQL
FT                   ASNAPTPPRPAAGAGSGVYLQLGAFSQPANAESLVSRINGQLDPASGIPPAVVEQANNL
FT                   YRVRIGPYATREAALGAVQPVADRTGILPSLSATP"
FT   misc_feature    complement(11734..11766)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    complement(11737..11799)
FT                   /note="Signal peptide predicted for BP0689 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.564 between residues 21 and 22"
FT   CDS_pept        complement(11796..12668)
FT                   /transl_table=11
FT                   /locus_tag="BP0690"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Neisseria meningitidis hypothetical
FT                   protein Nmb0738 TR:Q9K080 (EMBL:AE002428) (284 aa) fasta
FT                   scores: E(): 6e-48, 46.643% id in 283 aa, and to Vibrio
FT                   cholerae hypothetical protein Vc2532 TR:Q9KP47
FT                   (EMBL:AE004322) (286 aa) fasta scores: E(): 1.9e-42,
FT                   43.554% id in 287 aa"
FT                   /db_xref="GOA:Q7W014"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W014"
FT                   /protein_id="CAE41001.1"
FT                   /translation="MLRVVLITGISGSGKSVALRLLEDAGFTCIDNLPVRFLAEFIANA
FT                   RDDAMERVAVAIDVRSPGELAELPDVITASRAMGTSLSVIFLDANTDTLVQRYSESRRR
FT                   HPLTDRLARGGKTPSLAECIALERELMAPLRDQEHVIDTSDLTPGQLRAWIRDLIQADR
FT                   PPLVLTFESFAYKRGVPSDADLMFDVRCLPNPYYDRTLRPLTGRDEPVATWLGGFDIVT
FT                   QMIDDIAAFIRRWLPQYTQDTRNYLTVAIGCTGGQHRSVYVVEQLARRFSDHDPLLVRH
FT                   RTQLPDDPA"
FT   misc_feature    complement(12201..12266)
FT                   /note="Predicted helix-turn-helix motif with score 1076
FT                   (+2.85 SD) at aa 135-156, sequence RDQEHVIDTSDLTPGQLRAWIR"
FT   misc_feature    complement(12621..12644)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        join(12840..13499,13499..13589)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0691"
FT                   /product="probable cytochrome C (pseudogene)"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   cytochrome C Pa2482 SWALL:Q9I100 (EMBL:AE004676)(217 aa)
FT                   fasta scores: E(): 2.9e-14, 33.01% id in 212 aa."
FT                   /db_xref="PSEUDO:CAE41002.1"
FT   misc_feature    12840..12947
FT                   /note="Signal peptide predicted for BP0691 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.939 between residues 36 and 37"
FT   misc_feature    12999..13016
FT                   /note="ScanRegExp hit to PS00190, Cytochrome c family
FT                   heme-binding site signature."
FT   misc_feature    13278..13514
FT                   /note="HMMPfam hit to PF00034, Cytochrome c"
FT   misc_feature    13305..13322
FT                   /note="ScanRegExp hit to PS00190, Cytochrome c family
FT                   heme-binding site signature."
FT   CDS_pept        13599..14885
FT                   /transl_table=11
FT                   /locus_tag="BP0692"
FT                   /product="cytochrome C"
FT                   /note="Similar to Pectobacterium cypripedii cytochrome C
FT                   precursor TR:O34215 (EMBL:U97665) (441 aa) fasta scores:
FT                   E(): 2.7e-35, 41.106% id in 416 aa, and to Acetobacter
FT                   pasteurianus cytochrome C subunit of alcohol dehydrogenase
FT                   TR:Q57536 (EMBL:D13893) (472 aa) fasta scores: E():
FT                   2.7e-34, 40.146% id in 411 aa"
FT                   /db_xref="GOA:Q7W013"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W013"
FT                   /protein_id="CAE41003.1"
FT                   /translation="MKIIKRVLVVAILALLAAVATLYWLGTRDHVPAGPQAAPATGSAD
FT                   ELVEQGRYLARAGNCMACHTARGGQAYAGGTPIPTPFGTLYGPNITPDAETGIGGWSAD
FT                   DFWQVLHNGKGPGGRLLYPAFPYTEYTRMTRADADALYAFLRTVEPVRQASRPHELASP
FT                   YDQRLLLAAWRALYFEPGGPQADPGQSLQWNRGRYLTEGLGHCAACHTPRNSLGATRAA
FT                   EALGGGMIDGLGWYAPPLTGQPGTGLGDWSAQDIAALLTTGIAPHSTVAGPMAEVVLGS
FT                   TQYLSGDDALAIGTYLKSLPAAASPPARRGAPSATVMELGGKLYGQHCAQCHQADGKGS
FT                   FPAWPALAGNPSVIAAEPANVIRMVLDGGFAPATAANPRPHGMPPFAQALPDNDIAMLV
FT                   SYVRNSWGNQAGAVTPLDVKRTRESGAGR"
FT   misc_feature    13599..13658
FT                   /note="Signal peptide predicted for BP0692 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.305 between residues 20 and 21"
FT   misc_feature    13617..13676
FT                   /note="1 probable transmembrane helix predicted for BP0692
FT                   by TMHMM2.0 at aa 7-26"
FT   misc_feature    13776..13793
FT                   /note="ScanRegExp hit to PS00190, Cytochrome c family
FT                   heme-binding site signature."
FT   misc_feature    14214..14231
FT                   /note="ScanRegExp hit to PS00190, Cytochrome c family
FT                   heme-binding site signature."
FT   misc_feature    14550..14816
FT                   /note="HMMPfam hit to PF00034, Cytochrome c"
FT   misc_feature    14583..14600
FT                   /note="ScanRegExp hit to PS00190, Cytochrome c family
FT                   heme-binding site signature."
FT   CDS_pept        complement(14939..15865)
FT                   /transl_table=11
FT                   /locus_tag="BP0693"
FT                   /product="Hpr serine kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /note="Similar to Bacillus subtilis Hpr(ser)
FT                   kinase/phosphatase HprK or PtsK SW:HPRK_BACSU (O34483) (309
FT                   aa) fasta scores: E(): 2.3e-34, 36.149% id in 296 aa, and
FT                   to Neisseria meningitidis putative kinase/phosphatase
FT                   nma0947 TR:Q9JV91 (EMBL:AL162754) (320 aa) fasta scores:
FT                   E(): 1.1e-48, 49.505% id in 303 aa"
FT                   /db_xref="GOA:Q7U365"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7U365"
FT                   /protein_id="CAE41004.1"
FT                   /translation="MLTVQELVDDNADKIPFSWIAGHDAADRAISDDGMAAADLVGHLN
FT                   LIHPSRIQVFGQEELAYYTRFDLRRRMHHMDELLIGGVPAILLADGLTPPQDLIDQCAQ
FT                   HQVPLLSTPVAAAQLIDLLRIYLGKKLAPTTTVHGVFLDVLGLGVLITGESGLGKSELA
FT                   LELISRGHGLVADDAVELSRTAPGVIEGHCPQLLQNLLEVRGLGLLDIRTIFGETSVRR
FT                   KMRLKLIVHLVRATAQDKFERLPLQDITQDMLGLPIRKVMLQVAAGRNLAVLVEAAVRN
FT                   TILKLRGIDTLGEFMERQAMAILQSSK"
FT   misc_feature    complement(14942..15862)
FT                   /note="HMMPfam hit to PF02603, Hpr Serine kinase"
FT   misc_feature    complement(15386..15409)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        complement(15884..16339)
FT                   /transl_table=11
FT                   /gene="rpoP"
FT                   /gene_synonym="ptsN"
FT                   /locus_tag="BP0694"
FT                   /product="nitrogen regulatory IIA protein"
FT                   /EC_number="2.7.1.69"
FT                   /note="Similar to Escherichia coli nitrogen regulatory IIA
FT                   protein PtsN or RpoP or B3204 SW:PTSN_ECOLI (P31222) (163
FT                   aa) fasta scores: E(): 6.2e-13, 40.000% id in 120 aa, and
FT                   to Alcaligenes eutrophus hypothetical 16.5 kDa protein
FT                   TR:Q9EX66 (EMBL:AJ131690) (151 aa) fasta scores: E():
FT                   1.6e-37, 65.986% id in 147 aa"
FT                   /db_xref="GOA:Q7W012"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W012"
FT                   /protein_id="CAE41005.1"
FT                   /translation="MNHLSRILPAGNVVLDMLATSKKRAFEQAGLLFENHHGLARSVVF
FT                   DSLFSRERLGSTALGQGVAVPHGRVKGLDQALAAFIRLAQPIPFDAPDGQPVSMLLCLL
FT                   VPEAATQQHLDILAELAQLMSNKPLREALASETDPAAVHRMLTTGQL"
FT   misc_feature    complement(16079..16210)
FT                   /note="HMMPfam hit to PF00359,
FT                   Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2"
FT   misc_feature    complement(16136..16186)
FT                   /note="ScanRegExp hit to PS00372, PTS EIIA domains
FT                   phosphorylation site signature 2. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   CDS_pept        complement(join(16616..16843,16846..16956))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="BP0696"
FT                   /product="probable sigma(54) modulation protein
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 37. The frameshift occurs within a
FT                   dimeric tract of (CA)2. The sequence has been checked and
FT                   believed to be correct. Similar to Alcaligenes eutrophus
FT                   probable sigma(54) modulation protein SW:RP5M_ALCEU
FT                   (P28613) (130 aa) fasta scores: E(): 4.3e-18, 50.820% id in
FT                   122 aa, and to Pseudomonas aeruginosa RpoN TR:Q51562
FT                   (EMBL:L26916) (103 aa) fasta scores: E(): 3.6e-14, 52.174%
FT                   id in 92 aa"
FT                   /db_xref="PSEUDO:CAE41006.1"
FT   misc_feature    complement(join(16670..16843,16846..16953))
FT                   /note="HMMPfam hit to PF02482, Sigma 54 modulation protein
FT                   / S30EA ribosomal protein"
FT   variation       complement(16842..16845)
FT                   /note="(CA)2 in pertussis; (CA)1 deleted in parapertussis
FT                   and bronchiseptica"
FT   CDS_pept        complement(17191..17982)
FT                   /transl_table=11
FT                   /locus_tag="BP0697"
FT                   /product="ABC transporter"
FT                   /note="Similar to Rhizobium leguminosarum ABC-type permease
FT                   homolog TR:Q52785 (EMBL:U23471) (258 aa) fasta scores: E():
FT                   3.3e-47, 60.938% id in 256 aa, and to Alcaligenes eutrophus
FT                   hypothetical 28.7 kDa protein TR:Q9EX70 (EMBL:AJ131690)
FT                   (263 aa) fasta scores: E(): 1.6e-57, 69.811% id in 265 aa"
FT                   /db_xref="GOA:Q7W011"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W011"
FT                   /protein_id="CAE41007.1"
FT                   /translation="MTDSHATLSTATAAGAAAGSLRATGLRKTYNGRTVVQDVSLSVVS
FT                   GEVVGLLGPNGAGKTTSFYMIVGLVPADSGRIEIDGSNITSMPIHKRARMGLSYLPQDA
FT                   SVFRRLTVEQNIRAVLELQLGPNGKPLPEARIRDNLEALLEELQIGHIRANTAISLSGG
FT                   ERRRVEIARALATSPRFILLDEPFAGVDPIAVIEIQRIVRFLKGRGIGVLITDHNVRET
FT                   LGICDRAYIISEGKVLTDGHPDEIVGDPAVRRVYLGEHFRM"
FT   misc_feature    complement(17278..17847)
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    complement(17461..17505)
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   misc_feature    complement(17803..17826)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    complement(17914..17982)
FT                   /note="Signal peptide predicted for BP0697 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.962) with cleavage site
FT                   probability 0.565 between residues 23 and 24"
FT   CDS_pept        complement(18014..18634)
FT                   /transl_table=11
FT                   /locus_tag="BP0698"
FT                   /product="putative exported protein"
FT                   /note="Similar to Escherichia coli protein YhbN precursor
FT                   YhbN or B3200 or Z4563 or Ecs4079 SW:YHBN_ECOLI (P38685)
FT                   (185 aa) fasta scores: E(): 0.19, 28.877% id in 187 aa, and
FT                   to Alcaligenes eutrophus hypothetical 16.9 kDa protein
FT                   TR:Q9EX71 (EMBL:AJ131690) (155 aa) fasta scores: E():
FT                   2.3e-09, 37.984% id in 129 aa"
FT                   /db_xref="GOA:Q7W010"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W010"
FT                   /protein_id="CAE41008.1"
FT                   /translation="MTHLRLSLAPLRLCSILLLAAAGAAQAQAQSGQAAPAEEPSTLIL
FT                   SDTLHYDDIKRQSIFTGNVILTRGLMTLTSDKLEVNEDAAGNQFGVATADKGKIVTIRQ
FT                   DRPETFELIEGKGLRAEYESSKSQFDLIGQAIVTRYICGKPFDTIRGDRVRYNEKTGIY
FT                   QAQGGPNSSAAGGRVRSLAEPRAKADAAIAECRAKKQAPKKPQ"
FT   misc_feature    complement(18554..18634)
FT                   /note="Signal peptide predicted for BP0698 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.604 between residues 27 and 28"
FT   CDS_pept        complement(18631..19260)
FT                   /transl_table=11
FT                   /locus_tag="BP0699"
FT                   /product="putative exported protein"
FT                   /note="Similar to Neisseria meningitidis putative
FT                   periplasmic hypothetical protein Nma2133 TR:Q9JSU4
FT                   (EMBL:AL162758) (193 aa) fasta scores: E(): 0.00062,
FT                   23.711% id in 194 aa, and to Pseudomonas aeruginosa
FT                   hypothetical protein Pa4459 TR:Q9HVV8 (EMBL:AE004860) (190
FT                   aa) fasta scores: E(): 0.04, 22.989% id in 174 aa"
FT                   /db_xref="GOA:Q7W009"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W009"
FT                   /protein_id="CAE41009.1"
FT                   /translation="MKERFPSLIALFLLLALVVGTWWAADYAQRAVQVDPPRRLTHEMD
FT                   SWARDFVMLRTDVQGHPINRLEGVYVEHFPDDDSYHVTTPRAIGQQAGNPITIGVSKTA
FT                   IMEQGGQRIVMNGDTHVHRQPDARNETLDVRSQQLILLPDEDVVFTDLPAQVNKGNSRM
FT                   NGTGMHYNNKTRQLRVSAAADVEIAGTEGRKRQSTETPANSNQNKP"
FT   misc_feature    complement(19177..19260)
FT                   /note="Signal peptide predicted for BP0699 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.991) with cleavage site
FT                   probability 0.508 between residues 28 and 29"
FT   misc_feature    complement(19189..19239)
FT                   /note="1 probable transmembrane helix predicted for BP0699
FT                   by TMHMM2.0 at aa 7-24"
FT   CDS_pept        complement(19273..19881)
FT                   /transl_table=11
FT                   /locus_tag="BP0700"
FT                   /product="probable hydrolase"
FT                   /note="Similar to Neisseria meningitidis hypothetical
FT                   protein Nma2134 TR:Q9JSU3 (EMBL:AL162758) (178 aa) fasta
FT                   scores: E(): 3.7e-25, 44.706% id in 170 aa, and to
FT                   Pseudomonas aeruginosa hypothetical protein Pa4458
FT                   TR:Q9HVV9 (EMBL:AE004860) (179 aa) fasta scores: E():
FT                   4.9e-25, 48.428% id in 159 aa"
FT                   /db_xref="GOA:Q7W008"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W008"
FT                   /protein_id="CAE41010.1"
FT                   /translation="MTKNSPVSVPHPAEALVLARIPASVRERAAAVRLMVFDVDGVLTD
FT                   GGLYYGEHGEMFKRFHALDGHGLRLLMEGGLKVALITGRSGPIADRRAAELGIAEVLQG
FT                   VRDKGGALSELAQRVGVQLNQTGYMGDDIIDLPAMQRAGFAASVANAPGYVAQAAHWVS
FT                   SQPGGQGAVRECCDLLLAAQGRLGTFLGTPALLGPGAIQ"
FT   misc_feature    complement(19426..19788)
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase"
FT   CDS_pept        complement(19878..20867)
FT                   /transl_table=11
FT                   /locus_tag="BP0701"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli GutQ protein GutQ or
FT                   SrlQ or B2708 SW:GUTQ_ECOLI (P17115) (321 aa) fasta scores:
FT                   E(): 2e-49, 48.438% id in 320 aa, and to Pseudomonas
FT                   aeruginosa hypothetical protein Pa4457 TR:Q9HVW0
FT                   (EMBL:AE004860) (326 aa) fasta scores: E(): 6.5e-60,
FT                   56.190% id in 315 aa"
FT                   /db_xref="GOA:Q7W007"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W007"
FT                   /protein_id="CAE41011.1"
FT                   /translation="MSAHPDPTPEAILASARRTLQTEAQAIADLAARLDDSFVQVVGML
FT                   LACRGRVVVSGIGKTGHIARKLAATLASTGTPAFFVHAAEAIHGDLGMVTRDDVLIAIS
FT                   YSGTGQELLTILPVVRRMGAGLIAITGNAESELARLADVHLDASVSQEACPLNLAPTAS
FT                   TTAALALGDALAVACLEARGFGREDFARSHPGGALGRRLLTHVRDVMRHGPALPIVAED
FT                   APLPRALEEISAKGMGMTAVVDAQRKPVGIFTDGDLRRLIERVGDIRSLTVADGMTRAP
FT                   RTIGPDALAAEAAQQMDDRRLNQMLVVDTAGVLIGALHTHDLMAAKVV"
FT   misc_feature    complement(19884..20045)
FT                   /note="HMMPfam hit to PF00571, CBS domain"
FT   misc_feature    complement(20079..20240)
FT                   /note="HMMPfam hit to PF00571, CBS domain"
FT   misc_feature    complement(20337..20741)
FT                   /note="HMMPfam hit to PF01380, SIS domain"
FT   CDS_pept        20973..22187
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /locus_tag="BP0702"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /EC_number="2.1.2.-"
FT                   /note="Similar to Escherichia coli
FT                   phosphoribosylglycinamide formyltransferase 2 PurT or B1849
FT                   SW:PURT_ECOLI (P33221) (391 aa) fasta scores: E(): 1.7e-87,
FT                   63.409% id in 399 aa, and to Pseudomonas aeruginosa
FT                   phosphoribosylglycinamide formyltransferase 2 PurT or
FT                   Pa3751 TR:Q9HXP3 (EMBL:AE004794) (393 aa) fasta scores:
FT                   E(): 9.7e-93, 67.424% id in 396 aa"
FT                   /db_xref="GOA:Q7W006"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W006"
FT                   /protein_id="CAE41012.1"
FT                   /translation="MSTFPAPVLGTPLSPTATRVMLLGAGELGKEVVIALQRLGVEVIA
FT                   VDRYADAPGHQVAHRAHVVSMTDPQALRQVIEQERPHVVVPEIEAIATDLLVALEDEGA
FT                   VHVTPTARAAHLTMNREGIRRLAAETLGLPTSPYRFVDTEQALREAIDGGIGYPCVIKP
FT                   VMSSSGKGQSIIRSADDIAAAWRYAQEGGRVGAGRVIVEGFIEFDYEITLLTVRARGAD
FT                   GQIVTQFCEPIGHRQVDGDYVESWQPHPMSPVALQRSREIALAVTGDLGGLGIFGVELF
FT                   VAGDQVWFSEVSPRPHDTGMVTLISQVQNEFELHARALLGLPVDTRLRQPGASSVIYGG
FT                   VDARGVAFEGVAQALAEPGTDIRLFGKPESYAKRRMGVGLAVADDVDQARAKAARVSQA
FT                   VRVRA"
FT   misc_feature    21108..21620
FT                   /note="HMMPfam hit to PF02222, ATP-grasp domain"
FT   CDS_pept        22324..24057
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0703"
FT                   /product="N-terminal region of TonB dependent receptor
FT                   protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. The C-terminal region of this CDS is
FT                   BP0257. Similar to Salmonella typhimurium ferrichrome iron
FT                   receptor FhuA TR:O86925 (EMBL:Y14025) (729 aa) fasta
FT                   scores: E(): 3.6e-19, 25.738% id in 610 aa, and to
FT                   Pseudomonas SpBG33R. ferrisiderophore receptor-like protein
FT                   TR:Q9RC04 (EMBL:AF153707) (691 aa) fasta scores: E():
FT                   1.2e-118, 56.469% id in 572 aa. Similar to BP1962 (30.179%
FT                   identity in 613 aa overlap)"
FT                   /db_xref="PSEUDO:CAE41013.1"
FT   misc_feature    22324..22407
FT                   /note="Signal peptide predicted for BP0703 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.938 between residues 28 and 29"
FT   repeat_region   24037..24068
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   24037..25089
FT   CDS_pept        24139..25089
FT                   /transl_table=11
FT                   /locus_tag="BP0704"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7W005"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W005"
FT                   /protein_id="CAE41014.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAHALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   misc_feature    24397..24462
FT                   /note="Predicted helix-turn-helix motif with score 2363
FT                   (+7.24 SD) at aa 87-108, sequence LTQARIAHALGVSASTVSRVLA"
FT   misc_feature    24520..25053
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(25058..25089)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        25089..26396
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0705"
FT                   /product="putative C-terminal region of dehydrogenase
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. This is the C-terminal region of BP3209.
FT                   Similar to Escherichia coli choline dehydrogenase BetA or
FT                   B0311 SW:BETA_ECOLI (P17444) (556 aa) fasta scores: E():
FT                   1.2e-51, 40.515% id in 427 aa, and to Pseudomonas
FT                   aeruginosa probable Gmc-type oxidoreductase Pa3710
FT                   TR:Q9HXT1 (EMBL:AE004790) (557 aa) fasta scores: E():
FT                   1.3e-107, 65.367% id in 436 aa. The N-terminal part of this
FT                   partial CDS is BP3209."
FT   misc_feature    25137..26360
FT                   /note="HMMPfam hit to PF00732, GMC oxidoreductase"
FT   CDS_pept        26523..27809
FT                   /transl_table=11
FT                   /locus_tag="BP0706"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Roseateles depolymerans Orf428 protein
FT                   TR:Q9F206 (EMBL:AB028938) (428 aa) fasta scores: E():
FT                   7.6e-89, 58.080% id in 427 aa, and to Xylella fastidiosa
FT                   hypothetical protein Xf0042 TR:Q9PHA2 (EMBL:AE003858) (420
FT                   aa) fasta scores: E(): 4.2e-44, 53.682% id in 421 aa"
FT                   /db_xref="GOA:Q7W004"
FT                   /db_xref="InterPro:IPR009978"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W004"
FT                   /protein_id="CAE41016.1"
FT                   /translation="MPHAIEIVATLLFSVAVLHTFSVPFFARLAHRNGPHAGVWHLLSE
FT                   VEAVFGVWAFVLIACMALMAGTDRAVQYMDTRNFTEPLFVFAIMVVASSRPILELVGSV
FT                   VRLLAAMVPIRRELATFFIVMSIVPLGGSFITEPAAMTLAAILLRDGYFRCSGRAGFKY
FT                   MTLGVLFVNVSIGGVLTSYAAPPVLMVAATFGWDTAYMATHFGWRAAVAVFLNAGVLTM
FT                   LCRQALLEGAVGTGAGVNASGDASEKRPPVPAPVTLMHLAFLVGIVLTAHHPAVFLGML
FT                   MMFIGFAHAYQRHQSRLMIREGLMVGFFLAGLVVLGGLQKWWLQDLLGGLEPTVLFWGA
FT                   TALTAITDNAALTYLGSLVEGTSEAWRYMLVAGAVTGGGLTVIANAPNPAGFAILGKYF
FT                   PDGSISSGRLFIAALVPTLVAAAMFMLPV"
FT   misc_feature    join(26532..26600,26643..26711,26769..26837,26895..26963,
FT                   27024..27092,27309..27377,27414..27482,27525..27593,
FT                   27630..27698,27741..27800)
FT                   /note="10 probable transmembrane helices predicted for
FT                   BP0706 by TMHMM2.0 at aa 21-43, 58-80, 100-122, 142-164,
FT                   185-207, 280-302, 315-337, 352-374, 387-409 and 424-443"
FT   CDS_pept        27975..28283
FT                   /transl_table=11
FT                   /locus_tag="BP0707"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical 10.8
FT                   kDa protein Sce22.04 TR:Q9KYV8 (EMBL:AL355832) (110 aa)
FT                   fasta scores: E(): 2.8e-07, 34.653% id in 101 aa, and to
FT                   Mycobacterium leprae hypothetical ser-rich C-terminus
FT                   protein Ml0180 TR:Q9CD66 (EMBL:AL583917) (99 aa) fasta
FT                   scores: E(): 9.8e-05, 32.673% id in 101 aa"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W003"
FT                   /protein_id="CAE41017.1"
FT                   /translation="MPIYAYKCSACGHAEDVLQKISDAPLADCPACGQSTYSKQVTAAG
FT                   FQLKGSGWYVTDFRNNNGAGKPAAGQSAAPAASGGDAGGASASAATPAPAAPAATST"
FT   CDS_pept        28284..28949
FT                   /transl_table=11
FT                   /locus_tag="BP0708"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Neisseria meningitidis putative integral
FT                   membrane protein Nma2020 TR:Q9JT22 (EMBL:AL162757) (245 aa)
FT                   fasta scores: E(): 1.3e-33, 47.143% id in 210 aa, and to
FT                   Rhizobium meliloti hypothetical transmembrane protein
FT                   Smc00229 TR:CAC46233 (EMBL:AL591788) (230 aa) fasta scores:
FT                   E(): 3.8e-26, 41.627% id in 209 aa"
FT                   /db_xref="GOA:Q7W002"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W002"
FT                   /protein_id="CAE41018.1"
FT                   /translation="MRHSVMRVFKKYFITGLLIWVPLAITVWVLGLLVATLEGFVPGFL
FT                   SSQSLFGVDIPGFRFVLVITVVLLTGVFAANLLGRSLLEHWERILGRIPLVRSIYNSVK
FT                   QVSDTVLAPNGRAFRQAVLIQYPRAGSWTIAFLTGTPSGEVASYLPGEHLSVYVPTTPN
FT                   PTSGFFLMMPRDQVIDLQMSVDAALKYIVSMGVVAPADRRPVSPPTTPGAPLAPGAEP"
FT   misc_feature    28299..28439
FT                   /note="Signal peptide predicted for BP0708 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.871) with cleavage site
FT                   probability 0.441 between residues 47 and 48"
FT   misc_feature    join(28317..28385,28452..28520)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BP0708 by TMHMM2.0 at aa 7-29 and 52-74"
FT   CDS_pept        28990..30780
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /gene_synonym="tls"
FT                   /locus_tag="BP0709"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="Similar to Escherichia coli aspartyl-tRNA synthetase
FT                   AspS or Tls or B1866 SW:SYD_ECOLI (P21889) (590 aa) fasta
FT                   scores: E(): 1.7e-138, 58.179% id in 593 aa, and to
FT                   Neisseria meningitidis aspartyl-tRNA synthetase Nmb0466
FT                   TR:Q9K0U5 (EMBL:AE002403) (602 aa) fasta scores: E():
FT                   2.1e-173, 70.252% id in 595 aa"
FT                   /db_xref="GOA:Q7W001"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W001"
FT                   /protein_id="CAE41019.1"
FT                   /translation="MRTCYTGQVCRDHLGQTVTLYGWVNRRRDHGGVIFIDLRDRTGLA
FT                   QIVFDPDNAEAFGTAERLRNEFCISITGLVRLRPEGTANAELASGEVEVLCQQVEILNA
FT                   SVTPPFQLDDDNLSETTRLTHRVLDLRRPQMQHNLMLRYRVSIEVRKYLDQLGFIDIET
FT                   PMLTKSTPEGARDYLVPSRVNAGYFFALPQSPQLFKQMLMVSGFDRYYQITKCFRDEDL
FT                   RADRQPEFTQIDCETSFLNEVEIREIFEGMIRHVFKVVQDVDLPTPFPIMSWTEAMQRY
FT                   GSDKPDLRVNLEFTDMTDVMRDVDFKVFASAATTAGSRVVALRVQGGGEMSRSEIDAYT
FT                   QFVGIYGAKGLAYIKVNDVAKGREGLQSPIVKNLHDAALAELVKRTGAQNGDIIFFGAD
FT                   RAKVVNDAIGALRVKIGHSEFGKKAGLFSGGWKPLWVVDFPMFEYDEEENRYTAAHHPF
FT                   TSPKDGHEDFLESDPGKAVAKAYDMVLNGWEIGGGSVRIHREEVQSKVFRALKIDAEEA
FT                   REKFGFLLDALQYGAPPHGGIAFGLDRIITMMAGAESIRDVIAFPKTQRAQCLLTGAPS
FT                   EVDEKQLRELHIRLRNVEVK"
FT   misc_feature    29041..29295
FT                   /note="HMMPfam hit to PF01336, OB-fold nucleic acid binding
FT                   domain"
FT   misc_feature    29341..30687
FT                   /note="HMMPfam hit to PF00152, tRNA synthetases class II
FT                   (D, K and N)"
FT   misc_feature    29638..29691
FT                   /note="ScanRegExp hit to PS00179, Aminoacyl-transfer RNA
FT                   synthetases class-II signature 1. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   misc_feature    30604..30633
FT                   /note="ScanRegExp hit to PS00339, Aminoacyl-transfer RNA
FT                   synthetases class-II signature 2."
FT   CDS_pept        30893..31753
FT                   /transl_table=11
FT                   /locus_tag="BP0710"
FT                   /product="putative endonuclease/exonuclease/phosphatase
FT                   family protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YbhP or B0790 or Z1009 or Ecs0868 SW:YBHP_ECOLI (P75772)
FT                   (253 aa) fasta scores: E(): 2.3e-20, 36.426% id in 291 aa,
FT                   and to Pseudomonas aeruginosa hypothetical protein Pa2156
FT                   TR:Q9I1V9 (EMBL:AE004642) (245 aa) fasta scores: E():
FT                   4.6e-20, 37.457% id in 291 aa. Also similar to BP1340,
FT                   37.801% identity (46.610% ungapped) in 291 aa overlap."
FT                   /db_xref="GOA:Q7W000"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W000"
FT                   /protein_id="CAE41020.1"
FT                   /translation="MSLIRVVSYNIHKGRSALGRRESLNDLRLGLYGLRPDLVFLQEVQ
FT                   GRNEVSSVLHAQHESLAAALRLQAAYGRNAIRTGTDHGNALLSRFDILDHENQDISDHR
FT                   LEQRGLLHARIDVGGTEVHCFVVHLGLFAGSRGRQIQALTDRIRQSVPDGAPLLIVGDF
FT                   NDWGDRLAPMFVQQLGLYEVFSHAPRSHGGDLPRLRDSVRRLGNVLRGVPNSVAVLERN
FT                   NQLGMGGAYCPLPPPRTFPAVFPWFRLDRIYQRGFAVRSARVLRGREWARLSDHSPLLA
FT                   ELELP"
FT   CDS_pept        31750..32955
FT                   /transl_table=11
FT                   /locus_tag="BP0711"
FT                   /product="putative phospholipase"
FT                   /note="Similar to Escherichia coli cardiolipin synthetase
FT                   Cls or Nov or B1249 SW:CLS_ECOLI (P31071) (486 aa) fasta
FT                   scores: E(): 2.8e-13, 28.378% id in 370 aa, and to
FT                   Escherichia coli hypothetical protein YbhO or B0789 or
FT                   Z1008 or Ecs0867 SW:YBHO_ECOLI (P75771) (413 aa) fasta
FT                   scores: E(): 9.9e-28, 38.265% id in 392 aa"
FT                   /db_xref="GOA:Q7VZZ9"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030872"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZZ9"
FT                   /protein_id="CAE41021.1"
FT                   /translation="MKAQIVRLHWTDGNAIRLLQNGGDFFPALCEAIDAARLSVHMETY
FT                   IFLLDRTGRQMLECLESAARRGVKVRVVLDGFGSAGTAETIRLRITQAGGQCRIFRPEP
FT                   RWLGHLAFSRSRLRRLHRKVAVVDAELAFVGGINIVDDYDDLDPGDDIPAPRFDFAVAV
FT                   QGPLVPHILYAQDLLWVRLNWARLRRHPGDWMRLFKPVHADASPAGKLRAALLLRDNLR
FT                   FRQTFEQAYLYGIQHARRDILIANAYFFPGHQFRKSLMQAAARGVRVRLLLQGKPEYRM
FT                   QYFATRALYDRLLRGGIEIYEYMPGYLHAKVAVIDNMATVGSSNLDPFSLLLAREANVV
FT                   VDDQPFAWDLQERLERAIALGGQFIRPLDYQRRGWLRRCVDVAAYTMLRIGVALTGRAG
FT                   RY"
FT   misc_feature    32095..32178
FT                   /note="HMMPfam hit to PF00614, Phospholipase D. Active site
FT                   motif"
FT   misc_feature    32659..32739
FT                   /note="HMMPfam hit to PF00614, Phospholipase D. Active site
FT                   motif"
FT   CDS_pept        complement(32952..33836)
FT                   /transl_table=11
FT                   /locus_tag="BP0712"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Vibrio cholerae hypothetical protein
FT                   Vca0090 TR:Q9KN75 (EMBL:AE004352) (297 aa) fasta scores:
FT                   E(): 9.3e-45, 47.887% id in 284 aa, and to Rhizobium loti
FT                   Mlr1585 protein TR:Q98K88 (EMBL:AP002997) (305 aa) fasta
FT                   scores: E(): 4.8e-22, 34.343% id in 297 aa"
FT                   /db_xref="GOA:Q7VZZ8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZZ8"
FT                   /protein_id="CAE41022.1"
FT                   /translation="MPRRDLLDLLALAAVWGGSFLFMRVAVPEFGPAALMELRVGLAAL
FT                   FLLPLALWRGKPALIARHWKAILVVGTLNSALPFLLYAYAAQSLGAGFLSVANAVTPVW
FT                   GAVIGWLWLGDRLPRMRALGLLISLSGIIVLVWDKLDFHDGGTGPAVLAAISAPVFYGM
FT                   AANWTKRYLGHVDALTNATGSMVAASLVLAPLAIIHWPEQAVSFEAWRATVLLAIVCTG
FT                   AAYIVFFRLIARVGPTAAVSVTFLVPVFGVLWGVWFLDEAVTPRILAGAGVILVGTALA
FT                   LGLVGARRVAAAD"
FT   misc_feature    complement(join(32982..33047,33063..33119,33141..33206,
FT                   33237..33302,33342..33395,33426..33476,33498..33563,
FT                   33579..33644,33681..33746,33759..33815))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BP0712 by TMHMM2.0 at aa 7-26, 30-52, 64-86, 91-113,
FT                   120-137, 147-165, 178-200, 210-232, 239-258 and 263-285"
FT   misc_feature    complement(32988..33362)
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6"
FT   misc_feature    complement(33426..33797)
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6"
FT   CDS_pept        complement(join(33852..34328,34346..35314))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0713"
FT                   /product="putative membrane protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 323. The frameshift occurs within
FT                   a dimeric tract of (TGGATTAt/cTCCCCGAGC)2. The sequence has
FT                   been checked and believed to be correct. Similar to
FT                   Burkholderia cepacia major facilitator superfamily
FT                   transporter homolog OrfD TR:Q9RPH2 (EMBL:AF158699) (531 aa)
FT                   fasta scores: E(): 1e-57, 41.492% id in 429 aa, and to
FT                   Rhizobium loti Mlr6842 protein Mlr6842 TR:Q987Z4
FT                   (EMBL:AP003010) (529 aa) fasta scores: E(): 7.2e-38,
FT                   32.353% id in 442 aa"
FT                   /db_xref="PSEUDO:CAE41023.1"
FT   misc_feature    complement(join(33897..33953,33984..34049,34086..34151,
FT                   34164..34229))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BP0713 by TMHMM2.0 at aa 24-46, 50-72, 84-106 and 116-135"
FT   variation       complement(34329..34362)
FT                   /note="(TGGATTA(c/t)TCCCCGAGC)2 in pertussis;
FT                   (TGGATTAcTCgCCGAGC)1 in parapertussis and bronchiseptica"
FT   misc_feature    complement(join(34376..34441,34505..34570,34601..34657,
FT                   34697..34762,34778..34843,34883..34948,34961..35017,
FT                   35057..35122,35153..35218))
FT                   /note="9 probable transmembrane helices predicted for
FT                   BP0714 by TMHMM2.0 at aa 32-54, 64-86, 99-118, 122-144,
FT                   157-179, 184-206, 219-238, 248-270 and 291-313"
FT   CDS_pept        complement(35353..35805)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0715"
FT                   /product="putative membrane protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. Similar to Pseudomonas carboxydovorans
FT                   CoxG protein TR:Q9KX24 (EMBL:X82447) (205 aa) fasta scores:
FT                   E(): 3.9e-07, 32.877% id in 146 aa, and to Rhizobium
FT                   meliloti conserved hypothetical protein Smc01132
FT                   TR:CAC41825 (EMBL:AL591783) (152 aa) fasta scores: E():
FT                   3e-08, 38.393% id in 112 aa"
FT   misc_feature    complement(35359..35415)
FT                   /note="1 probable transmembrane helix predicted for BP0715
FT                   by TMHMM2.0 at aa 118-137"
FT   CDS_pept        complement(35750..36748)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0716"
FT                   /product="transposase (Pseudogene)"
FT                   /note="Pseudogene. Transposase for IS481 element. The
FT                   transposase lacks a stop codon, hence it is extended by 15
FT                   aa at its C-terminus"
FT                   /db_xref="PSEUDO:CAE41025.1"
FT   repeat_region   35799..35829
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(35799..36850)
FT   misc_feature    complement(35834..36367)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(36819..36850)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(36908..37780)
FT                   /transl_table=11
FT                   /locus_tag="BP0718"
FT                   /product="carboxyvinyl-carboxyphosphonate phosphorylmutase"
FT                   /EC_number="2.7.8.23"
FT                   /note="Similar to Streptomyces hygroscopicus
FT                   carboxyvinyl-carboxyphosphonate phosphorylmutase BcpA
FT                   SW:CPPM_STRHY (P11435) (294 aa) fasta scores: E(): 2.5e-36,
FT                   39.789% id in 284 aa, and to Sulfolobus solfataricus
FT                   carboxyphosphonoenolpyruvate phosphonomutase PrpB TR:Q97VN2
FT                   (EMBL:AE006855) (285 aa) fasta scores: E(): 1e-39, 46.099%
FT                   id in 282 aa"
FT                   /db_xref="GOA:Q7VZZ7"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZZ7"
FT                   /protein_id="CAE41026.1"
FT                   /translation="MSNSTKRVLRERVAQRNGMLVAGAFNAMSARIVADQGFEAVYLTG
FT                   AGLTNMHYGAPDLGIIGLRDVADATSRIRDAVELPLIVDADTGFGNAVNVWHTVRVLER
FT                   AGADAIQLEDQVFPKRCGHFAGKSVAPLSEMVSKIKAAADARRDEDFLIIARTDARAVE
FT                   GFDAAIERARRFAEAGADILFVEAIVDQDEVGKLPQLLSQPLLVNIVVGGKTPPMPAAQ
FT                   LGRLGYSVVLYANATLQGAVLGMQRALGALRRDGKLDEDPALLAPFLERQRLVGKPLYD
FT                   ELEERYKDA"
FT   misc_feature    complement(37298..37546)
FT                   /note="HMMPfam hit to PF00463, Isocitrate lyase family"
FT   misc_feature    complement(37679..37780)
FT                   /note="Signal peptide predicted for BP0718 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.731) with cleavage site
FT                   probability 0.411 between residues 34 and 35"
FT   CDS_pept        38121..38339
FT                   /transl_table=11
FT                   /locus_tag="BP0720"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Thermoplasma volcanium Tvg1306680 protein
FT                   TR:Q978Z7 (EMBL:AP000996) (64 aa) fasta scores: E(): 7.1,
FT                   33.333% id in 48 aa, and to Agrobacterium tumefaciens
FT                   Agr_c_4413p TR:AAK88168 (EMBL:AE008157) (121 aa) fasta
FT                   scores: E(): 1.3e-13, 59.375% id in 64 aa"
FT                   /db_xref="InterPro:IPR009409"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZZ6"
FT                   /protein_id="CAE41027.1"
FT                   /translation="MSRKYIDCREFPSEMNCSVALSADSDAELLEAAVQHATTVHKHAD
FT                   TPELRAQLKTMFHEGTPPLAAQAGSRA"
FT   CDS_pept        complement(38379..39758)
FT                   /transl_table=11
FT                   /locus_tag="BP0721"
FT                   /product="probable aminotransferase"
FT                   /note="Similar to Bilophila wadsworthia taurine:pyruvate
FT                   aminotransferase TR:Q9APM5 (EMBL:AF269146) (456 aa) fasta
FT                   scores: E(): 9.3e-99, 54.000% id in 450 aa, and to Bacillus
FT                   subtilis probable aminotransferase YhxA SW:YHXA_BACSU
FT                   (P33189) (450 aa) fasta scores: E(): 7.4e-62, 37.418% id in
FT                   457 aa"
FT                   /db_xref="GOA:Q7VZZ5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZZ5"
FT                   /protein_id="CAE41028.1"
FT                   /translation="MNDLATINDLHSVVEDDRNAIWHHMLQHDALQATAPWVVVEGKGT
FT                   RIRDASGKEYLDATAGGFWTVNVGYGRERIANAMRDQMLKLNYFAQSAGNVPGALFARQ
FT                   LVSKMPGMSRVYFSNSGSEANEKVFKMVRQISARHHAGRKYKILFRERDYHGSSIATLA
FT                   AAGQPERAAQYGPFPDGFVQVPHCLEYRKQWDVANYGERAADAIEEVILREGPETVGLL
FT                   CLEPITAGGGIIVPPEGYWRRVQEICRRYDVLLHIDEVVCGLGRTGKWFGYQHFDIEPD
FT                   FVTLAKGTASGYAAIACTVTHERIFEQFKDEPDDPLSFFRDVSTFGGCAGSAAAALENL
FT                   RILEEEGLVEHAAQVGDYLQACLRQLADKHAVIGDVRGKGLLQGVELVSDRAAKTPVSE
FT                   ADAKRVVAQCKAQGVLIGVITRALPGLNTTLCLAPPLILTRDEVDELCGAIDRALATVF
FT                   G"
FT   misc_feature    complement(38481..39629)
FT                   /note="HMMPfam hit to PF00202, Aminotransferase class-III"
FT   CDS_pept        complement(39800..41197)
FT                   /transl_table=11
FT                   /locus_tag="BP0722"
FT                   /product="probable amidase"
FT                   /note="Similar to Bradyrhizobium japonicum indoleacetamide
FT                   hydrolase Bam SW:HYIN_BRAJA (P19922) (465 aa) fasta scores:
FT                   E(): 2.6e-45, 39.409% id in 406 aa, and to Streptomyces
FT                   spR1128 enantiomer selective amidase ZhuL TR:Q9F6D0
FT                   (EMBL:AF293442) (507 aa) fasta scores: E(): 3.5e-27,
FT                   33.407% id in 452 aa"
FT                   /db_xref="GOA:Q7VZZ4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZZ4"
FT                   /protein_id="CAE41029.1"
FT                   /translation="MTSELWRLSACEIVAGVKSGAFSASEAVRAALDRMEAVNGRINAV
FT                   VDSDPQAALAAAARVDARIAAGEDPGPLAGVPVTVKVTHDQAGFATTMGIRKLKDHRAA
FT                   ANSPIVDNFERAGAIPIGRTNMPAFGLRWFTNGRLHGDTYNPFDRSLTPGGSSGGASAA
FT                   VASGIGAIAHGTDIAGSIRYPAYACGVHGLRPTLGRIPNYNASFPERGLGGQLMSVSGP
FT                   LARTVADIELSFAALAHADPRDPWWVPAPLAGPARPRRVALCLRPDGLEIDAAVADALL
FT                   DAAARLRDAGWEVAELDDIPPMRDAAVAQVTLWLGDEYPALLAEAQAEGDPGALAMLRG
FT                   QPQSAGVTLQSYCSALKARASYLRQWMLFFEDYPLMMLPVSARLTFANDLDTRSAADYD
FT                   SVWEAQMPQLGLAFMGLPCMSVATGMCGSAPVGIQLAAGRYREDLLFLAAEDIAARGMP
FT                   PVPVDPV"
FT   misc_feature    complement(40292..41122)
FT                   /note="HMMPfam hit to PF01425, Amidase"
FT   misc_feature    complement(40643..40738)
FT                   /note="ScanRegExp hit to PS00571, Amidases signature.
FT                   Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        complement(41237..42889)
FT                   /transl_table=11
FT                   /locus_tag="BP0723"
FT                   /product="probable ABC transporter, ATP-binding protein"
FT                   /note="Similar to Rhizobium meliloti probable ABC
FT                   transporter, ATP-binding protein Sma1434 TR:AAK65441
FT                   (EMBL:AE007265) (550 aa) fasta scores: E(): 1e-76, 46.125%
FT                   id in 542 aa, and to Agrobacterium tumefaciens Agr_l_3504p
FT                   TR:AAK90329 (EMBL:AE008378) (575 aa) fasta scores: E():
FT                   7.1e-84, 48.780% id in 533 aa"
FT                   /db_xref="GOA:Q7VZZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZZ3"
FT                   /protein_id="CAE41030.1"
FT                   /translation="MIFRKRDLQHRPVVLRIAGLSLVDGQPGAGSAILRDIDVDIRQGE
FT                   TVCLVGESGSGKSMTSLAVMGLLPKGHLRVTGGRIELDGQNLLDLGPAALRDLRAKRIS
FT                   MIFQEPMTALNPVMKVGPQIEEVLDSHTALPRREKKQRVLDIMEQVHLPDVARIYESYP
FT                   HQLSGGQRQRIMIAMALVLEPRLLIADEPTTALDVTTQNQVLKLISELQHKHDTAVLFI
FT                   THDMGVVAEIADRVYVMRLGEIVESAPVEQLLREPRQDYTRKLLKSVPSLIPRPGRAAP
FT                   QACATLQVQGLAKRYAMGGFPGRRREVQAAHDVAFSIQPGRTLGIVGESGSGKSTVARC
FT                   VMRLIEPSEGAIRVGDADIARLGPRQLKPFRKHLQIVFQDPYRSLNPRRTIGASLIEGP
FT                   VNFGQDRQAALAQAAELLELVGLPADALARYPHQFSGGQRQRIAIARAIAMRPDVLVAD
FT                   EAVSALDVSVQAQVLELLDTLQRKLDIAILFITHDLRVAAQICDEVMVMRHGRVVEHDT
FT                   AENVLARPAHAYTRALIEAAPGRDWDFANFRER"
FT   misc_feature    complement(41360..41929)
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    complement(41546..41590)
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   misc_feature    complement(41885..41908)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    complement(42164..42760)
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    complement(42350..42394)
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   misc_feature    complement(42716..42739)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        complement(42893..43777)
FT                   /transl_table=11
FT                   /locus_tag="BP0724"
FT                   /product="probable ABC transporter, permease protein"
FT                   /note="Similar to Rhizobium sp probable peptide ABC
FT                   transporter permease protein Y4tQ SW:Y4TQ_RHISN (Q53192)
FT                   (291 aa) fasta scores: E(): 1.4e-52, 53.307% id in 257 aa,
FT                   and to Rhizobium loti ABC transporter, permease protein
FT                   mlr6290 TR:Q989T2 (EMBL:AP003008) (280 aa) fasta scores:
FT                   E(): 5.7e-46, 47.547% id in 265 aa. Also similar to several
FT                   B. pertussis CDSs such as BP3161 (57.348% identity in 279
FT                   aa overlap), BP1825 (57.977% identity in 257 aa overlap),
FT                   BP3459 (55.725% identity in 262 aa overlap), P2592 (40.304%
FT                   identity in 263 aa overlap)"
FT                   /db_xref="GOA:Q7VZZ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZZ2"
FT                   /protein_id="CAE41031.1"
FT                   /translation="MTTLPQPASALQAVFRVTQLPAWCRFGWPPIAAALVLAVLVLATA
FT                   AAYLYIPHDPIAINPLMRLKPASADHWLGTDALGRDVFSRVMAGGQVSLLVGVAAAVIS
FT                   IAAGLCIGLVSGFFRVLDGVVMRITDAVMSVPSILLAIALVALNGPSIWSVIIAITVPE
FT                   VPRVVRLVRSVVLSAREEPYVEAALALGTSMPGILWRHIMPNTLAPLMVQATYVCASAI
FT                   LTEAVLSFLGAGVSTEIPTWGNIMAEARMYFQIRPGLMLWPGLLLSLCILSINLLGDTA
FT                   RDMLDPRLKRRGE"
FT   misc_feature    complement(join(42944..43000,43061..43126,43301..43366,
FT                   43427..43492,43622..43687))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BP0724 by TMHMM2.0 at aa 30-52, 95-117, 137-159, 217-239
FT                   and 259-278"
FT   misc_feature    complement(43034..43255)
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   misc_feature    complement(43166..43252)
FT                   /note="ScanRegExp hit to PS00402, Binding-protein-dependent
FT                   transport systems inner membrane comp. sign."
FT   CDS_pept        complement(43777..44718)
FT                   /transl_table=11
FT                   /locus_tag="BP0725"
FT                   /product="probable ABC transporter, permease protein"
FT                   /note="Similar to Rhizobium sp probable peptide ABC
FT                   transporter permease protein Y4tP SW:Y4TP_RHISN (Q53191)
FT                   (313 aa) fasta scores: E(): 3.2e-65, 54.839% id in 310 aa,
FT                   and to Rhizobium loti ABC transporter, permease protein
FT                   Mlr6289 TR:Q989T3 (EMBL:AP003008) (314 aa) fasta scores:
FT                   E(): 5e-52, 47.284% id in 313 aa. Also similar to several
FT                   B. pertussis CDSs such as BP3160 (58.147% identity in 313
FT                   aa overlap), BP3458 (54.633% identity in 313 aa overlap),
FT                   BP1824 (53.922% identity in 306 aa overlap), BP2395
FT                   (44.268% identity in 314 aa overlap), and BP2691 (40.256%
FT                   identity in 313 aa overlap)"
FT                   /db_xref="GOA:Q7VZZ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZZ1"
FT                   /protein_id="CAE41032.1"
FT                   /translation="MFGYILRRVLATIPVVVIVAVFVFLLLRLTPGDAAAIIAGDSATP
FT                   AQIENIRKSLGLTEPLTVQFRTWMTQLASGDLGTSIISRQPVTKLIGQRVGPTLQIATL
FT                   TIILSVLIAVPLGVLAAWRHRSWLDYAVMAFSVIGFSIPAFVVGYILMKIFAVDLRWLP
FT                   VQGFTSVFQDPQQFLCTAVLPCMTLATVFVALIARMTRASMLDVLGEDYIRTARAKGVK
FT                   ERIVLFRHALGNAAVPIVTIIGTGFALLIVGVVVTESVYNIPGIGRLTVDAVLARDYPV
FT                   IQAMILLTSALYVFINLLIDLSYTIFDPRIRY"
FT   misc_feature    complement(join(43798..43863,43957..44022,44131..44187,
FT                   44248..44313,44353..44418,44638..44703))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP0725 by TMHMM2.0 at aa 5-27, 100-122, 135-157, 177-196,
FT                   232-254 and 285-307"
FT   misc_feature    complement(43894..44109)
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   CDS_pept        complement(44797..46416)
FT                   /transl_table=11
FT                   /locus_tag="BP0726"
FT                   /product="probable ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="Similar to Rhizobium sp probable peptide ABC
FT                   transporter periplasmic binding protein Y4tO precursor
FT                   SW:Y4TO_RHISN (P55669) (531 aa) fasta scores: E(): 5.6e-64,
FT                   37.786% id in 524 aa, and to Bradyrhizobium japonicum
FT                   putative ABC transporter TR:Q9RH65 (EMBL:AF065159) (516 aa)
FT                   fasta scores: E(): 1.1e-62, 37.670% id in 515 aa"
FT                   /db_xref="GOA:Q7VZZ0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZZ0"
FT                   /protein_id="CAE41033.1"
FT                   /translation="MFIARNAADPAVKIRAGARLAAVAAALCGLAATVPAAAQAPKTVT
FT                   AVMHSGLRVLDPIITTAHITRNHGYMIYDVLVSMDKDFNVRPQMADFSVSPDGLTYTFT
FT                   LRENLWFHDGAPVTAADVVASLKRWGERDTGGQHIFDQTESLAATDARTITWKLSKPFG
FT                   PMLETLGKQSTVPPFIMPKRVARTPSSEAITDYTGSGPFRFVLDEFSPGVKVAYAKFDK
FT                   YVPRNEPANWMAGGKVVKVDRANWVTMPDAQTAVSALSSGEIDYLEQTPTDLLPILESN
FT                   ADVVLEVRDQLGYQALGRMNFKQPPFNDKRIRQAALKAMSQEPILAAMVGNPKYYQVCG
FT                   AVLGCGTPLASEAGAGALTGKGDVEGARALLKEAGYDGSPVVILQPTDVPILAAPPLVA
FT                   AQQLRAAGFKVDLQPMDWQTLVTRRTNKGAPSQGGWSMFFSYWMVPEVTTPLINATLNA
FT                   RGDEGFFGWAQDPELEAMRGEYITAGSPQAQLDVAKRIQARVMDEVTYLPLGQFQTVQG
FT                   RRANLVDIIASPVPVFWQMDKK"
FT   misc_feature    complement(45472..45702)
FT                   /note="HMMPfam hit to PF00496, Bacterial extracellular
FT                   solute-binding proteins, family 5"
FT   misc_feature    complement(46033..46365)
FT                   /note="HMMPfam hit to PF00496, Bacterial extracellular
FT                   solute-binding proteins, family 5"
FT   misc_feature    complement(46300..46356)
FT                   /note="1 probable transmembrane helix predicted for BP0726
FT                   by TMHMM2.0 at aa 20-39"
FT   misc_feature    complement(46303..46416)
FT                   /note="Signal peptide predicted for BP0726 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.895 between residues 38 and 39"
FT   CDS_pept        46583..47398
FT                   /transl_table=11
FT                   /locus_tag="BP0727"
FT                   /product="probable transcriptional regulator"
FT                   /note="Similar to Rhodococcus opacus putative regulator of
FT                   catechol degradative operon CatR TR:O33539 (EMBL:X99622)
FT                   (256 aa) fasta scores: E(): 1.1e-17, 33.468% id in 248 aa,
FT                   and to Alcaligenes eutrophus hypothetical 30.8 kDa protein
FT                   TR:Q9L789 (EMBL:AF225972) (279 aa) fasta scores: E():
FT                   3.4e-22, 33.871% id in 248 aa"
FT                   /db_xref="GOA:Q7VZY9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZY9"
FT                   /protein_id="CAE41034.1"
FT                   /translation="MRRSIVNSELGVRSPTEEELEDPLFVQAAARTLQVLSAFHRAVRP
FT                   MSLDEIAEASGVGRSSTQRILNTLRVLGYVERSDGGRGYVPGIRILDHALDYLRLNTLI
FT                   SRASPVLLDLRRNALERVDLSVFDDLRLVYASRLQSKRETFFATLVGHSVPTFCTAGGR
FT                   AILSHLPGAEVDDIIARSDRAPFTDKTITALREIRKKVEQARVSGYAVTIEEVLVGEIG
FT                   IGVAVLGADGRPVGAIHIAGSLSEWTPEAFTARFAPLAVEAATAINRLS"
FT   misc_feature    46718..46783
FT                   /note="Predicted helix-turn-helix motif with score 1461
FT                   (+4.16 SD) at aa 46-67, sequence MSLDEIAEASGVGRSSTQRILN"
FT   misc_feature    46832..47392
FT                   /note="HMMPfam hit to PF01614, Bacterial transcriptional
FT                   regulator"
FT   CDS_pept        complement(47466..48035)
FT                   /transl_table=11
FT                   /locus_tag="BP0728"
FT                   /product="probable transcriptional regulator"
FT                   /note="Similar to Streptomyces roseosporus TetR homologue
FT                   WhiR TR:P72569 (EMBL:U58281) (179 aa) fasta scores: E():
FT                   0.00038, 28.814% id in 118 aa, and to Pseudomonas
FT                   aeruginosa probable transcriptional regulator Pa1283
FT                   TR:Q9I461 (EMBL:AE004558) (186 aa) fasta scores: E():
FT                   8.1e-17, 32.973% id in 185 aa. IS481 inserted immediately
FT                   upstream of the start codon. It is not clear whether this
FT                   insertion has any effect on the expression of this gene"
FT                   /db_xref="GOA:Q7VZY8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041479"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZY8"
FT                   /protein_id="CAE41035.1"
FT                   /translation="MVRPRTIDRERLLDIAESIISEAGAVTISFGGLAEAAGLSKASVQ
FT                   SVFGTREAMMEALLERWLRKEQRAYQKKIGPQSSLRERVRRHVKITGKESSEANSRLAA
FT                   VLTALVGSDATEGVMAKWYASRVGKFSAETQEERLLRIAFLAAEGAFFMRHVAGFPMSD
FT                   RLWRELFHDLLDFVAEPVGGAARSAA"
FT   misc_feature    complement(47889..47954)
FT                   /note="Predicted helix-turn-helix motif with score 1201
FT                   (+3.28 SD) at aa 28-49, sequence ISFGGLAEAAGLSKASVQSVFG"
FT   CDS_pept        complement(48036..48986)
FT                   /transl_table=11
FT                   /locus_tag="BP0729"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q79H25"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H25"
FT                   /protein_id="CAE41036.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT"
FT   repeat_region   48036..48067
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(48036..49088)
FT   misc_feature    complement(48072..48605)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(48663..48728)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   repeat_region   complement(49057..49088)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        49641..50738
FT                   /transl_table=11
FT                   /gene="nspC"
FT                   /locus_tag="BP0731"
FT                   /product="carboxynorspermidine decarboxylase"
FT                   /note="Similar to Vibrio alginolyticus carboxynorspermidine
FT                   decarboxylase NspC TR:Q56575 (EMBL:D31783) (377 aa) fasta
FT                   scores: E(): 1.4e-71, 52.291% id in 371 aa, and to
FT                   Rhizobium meliloti putative carboxynorspermidine
FT                   decarboxylase protein TR:CAC49950 (EMBL:AL603647) (365 aa)
FT                   fasta scores: E(): 6.7e-103, 69.041% id in 365 aa"
FT                   /db_xref="GOA:Q7VZY7"
FT                   /db_xref="InterPro:IPR005730"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZY7"
FT                   /protein_id="CAE41037.1"
FT                   /translation="MLKTPYYLIDKRALLQNLEVIRRIRERSGAKVLLALKCFATWSVF
FT                   DLMREYMDGTTSSSLFEVRLGREKFGGETHAYSVAYAEDDIDDVVACADKIIFNSLSQL
FT                   ERYAPRASAIPRGLRLNPGISVSGYDLANPARPFSRLGETDLDRIAQAMPMIDGFMVHN
FT                   NCENRDFTRFDALLTELEHRYGHLLGQINWISLGGGIHFTEPGYALDAFCDRLRRFSEQ
FT                   YGVQVYLEPGEAAITNTATLEVTVLDVMRNEKNLAIVDAATEAHMLDLLIYRMSARVQP
FT                   DQGPHRYVIYGNSCLAGDVFGEFSFESPLQPGSRISIQDAAGYTMVKKNWFNGVRMPAI
FT                   AIRELDGEIRLVREFGYQDYVDSLS"
FT   CDS_pept        50772..52037
FT                   /transl_table=11
FT                   /locus_tag="BP0732"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti conserved hypothetical
FT                   protein Smb21630 TR:CAC49949 (EMBL:AL603647) (413 aa) fasta
FT                   scores: E(): 2.6e-117, 67.317% id in 410 aa, and to
FT                   Agrobacterium tumefaciens Agr_l_1365p TR:AAK89265
FT                   (EMBL:AE008267) (412 aa) fasta scores: E(): 4.7e-117,
FT                   67.317% id in 410 aa"
FT                   /db_xref="GOA:Q7VZY6"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZY6"
FT                   /protein_id="CAE41038.1"
FT                   /translation="MKRNVLIIGAGGVAHVVAHKCAQHNATLGEIHIASRTLDKAQGIV
FT                   RSVHAMGNLQTNGVVKAHGLNALDIKATAALIRATNARIVIQAGTSFLNMAVLAACIET
FT                   GAAYIDTAIHEDPAKTCEAPPWYANYEWKQAQACADAGVTAILGAGFDPGVVNAYAKLA
FT                   VDELFDEVSSIDIIDTNAGSHGKYFATNFDPEINFREFTGSVWSWQEGRWCENRMFEEQ
FT                   RAWDLPVVGRQTTYLTGHDEIHSLSTHLNVPNIRFWMGFSDHYINVFTVLNSLGLLSEQ
FT                   PVRTAEGQQVVPLKVVKAVLPDPASLARTYKGKTCIGDLVRGVKDGRPHEVLIYNVCDH
FT                   EQAYREVGSQAISYTAGVPATAAALLIADGAWDNRKMNNIEQLAPRPWLQLLETMGLPS
FT                   RIRDAHGDRALLSPCGKLLKAA"
FT   misc_feature    50772..50831
FT                   /note="Signal peptide predicted for BP0732 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.648) with cleavage site
FT                   probability 0.520 between residues 20 and 21"
FT   misc_feature    51693..51716
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   repeat_region   52093..52124
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   52093..53145
FT   CDS_pept        52195..53145
FT                   /transl_table=11
FT                   /locus_tag="BP0733"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA3"
FT                   /protein_id="CAE41039.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   misc_feature    52453..52518
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    52576..53109
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(53114..53145)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        53187..53342
FT                   /transl_table=11
FT                   /locus_tag="BP0734"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZY5"
FT                   /protein_id="CAE41040.1"
FT                   /translation="MAISTLGPTAPGGLHWCRQRNAVAVSYGYRFNRTFLILMPCPGGQ
FT                   LAWPPP"
FT   misc_feature    53271..53303
FT                   /note="ScanRegExp hit to PS00284, Serpins signature."
FT   CDS_pept        53389..53979
FT                   /transl_table=11
FT                   /locus_tag="BP0735"
FT                   /product="putative exported protein"
FT                   /note="Similar to Xylella fastidiosa hypothetical protein
FT                   Xf1840 TR:Q9PCE1 (EMBL:AE004005) (237 aa) fasta scores:
FT                   E(): 4e-29, 47.486% id in 179 aa, and to Zymomonas mobilis
FT                   hypothetical 22.3 kDa protein zm10orf9 TR:Q9XBR4
FT                   (EMBL:AF157493) (204 aa) fasta scores: E(): 1.4e-18,
FT                   34.807% id in 181 aa"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZY4"
FT                   /protein_id="CAE41041.1"
FT                   /translation="MKKNYPAYFAATLLALAGLSAQAAPVDYRIDPEHTEVVVTWDHLG
FT                   FSKPTAHAGGVTGVVRYDAASPADSAVDLRIPVSKLTSHVPKLDGMLQGVQFFEAARYP
FT                   DIRFKSTSVTDRGDGRLQIDGILRIKGIDKPVVLQARRNGQGMHPMAQRPAIGFDATTT
FT                   LKRSDFGVDAFAPDVSDEVQLRITIEAVAEAAR"
FT   misc_feature    53389..53457
FT                   /note="Signal peptide predicted for BP0735 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 23 and 24"
FT   CDS_pept        complement(53995..56439)
FT                   /transl_table=11
FT                   /gene="bfrF"
FT                   /locus_tag="BP0736"
FT                   /product="putative ferric siderophore receptor"
FT                   /note="Similar to Escherichia coli ferrichrome-iron
FT                   receptor precursor FhuA or TonA or B0150 SW:FHUA_ECOLI
FT                   (P06971) (747 aa) fasta scores: E(): 7.8e-38, 40.000% id in
FT                   725 aa, and to Pseudomonas aeruginosa probable
FT                   hydroxamate-type ferrisiderophore receptor Pa0470 TR:Q9I648
FT                   (EMBL:AE004484) (802 aa) fasta scores: E(): 1.4e-103,
FT                   40.000% id in 815 aa"
FT                   /db_xref="GOA:Q7VZY3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZY3"
FT                   /protein_id="CAE41042.1"
FT                   /translation="MVITFNLFSVKHSMRARPSAATRALHSSSRPRRLIPALLGALACL
FT                   GTGVQAAPIDVDIPPQNLAQALHQLGRQANLQVLYSQDLVDGQRSPAVQGRMEPAEALE
FT                   RLLKGRNIRYSIQHNTVTLTPMPLTATLPAISVVGALPDSDTYVATGTTAGTKTDTPLI
FT                   EIPQSISVVTAAQIREQNPQTLGDAVRYTPGIVVQEGFNRTDDPFIIRGFDVRTNPGVM
FT                   FRDGLKIPLPHYSAMSEPYALERIEVVKGPASVLYGQASPGGIVNVVSKRPTDSPLREL
FT                   QLSGGSHSNRQLAGDFGGRIDDEGRLTYRLTGLARNADTMIDHVPDDRYYLAPALTWRI
FT                   SPDTSLTLLASYMKNKTINNAGYPLEGTVKYNPNGRIPRHRFTGEPDWSKWDQEVANVG
FT                   YQFAHRFNDTWQFKQNLGYAQSRNRVNHAYWWTWVPGSDFSTAERGAYRRDDDAHGVSI
FT                   DNQFEATWQSGRFRHNTLFGLDYTETSFTRKQYAGYNNLAPIDFFDPAYGSDVLLPAKP
FT                   DTYTNEKRSQLGLYLQDQIKFDDKLVVVLSGRYDNADGSTLNKLSGVNTRTGDNAFTWR
FT                   TGLLYLADNGLAPYTSYSTSFQPQAGTTSPARGTTPFDPTKGKQWEAGVKYQPNGSNSF
FT                   ITASVFELTRTNVPTTDPANPVYSVQEGEVRSRGLELSATANLASGWNLIAAYTYTDAE
FT                   ITKSNSNTLGNTPEAVPRNMASLWSDYTVPSGALAGLNIGAGVRYMGSTYNNTNAAKVG
FT                   DYTVFDAALRYDFGARSPSLKGWTADLTVRNLFDKDYVASCTYACFYGEGRTVLGRVTY
FT                   KW"
FT   misc_feature    complement(53998..54327)
FT                   /note="HMMPfam hit to PF00593, TonB dependent receptor
FT                   C-terminal region"
FT   misc_feature    complement(56287..56439)
FT                   /note="Signal peptide predicted for BP0736 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 51 and 52"
FT   misc_feature    complement(56308..56340)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(56559..57530)
FT                   /transl_table=11
FT                   /locus_tag="BP0737"
FT                   /product="putative inner membrane sensor for iron
FT                   transport"
FT                   /note="Similar to Bordetella bronchiseptica putative inner
FT                   membrane sensor BupR TR:Q9L429 (EMBL:AJ251793) (344 aa)
FT                   fasta scores: E(): 7.6e-19, 33.025% id in 324 aa, and to
FT                   Pseudomonas aeruginosa probable transmembrane sensor Pa2388
FT                   TR:Q9I192 (EMBL:AE004665) (331 aa) fasta scores: E():
FT                   3.9e-47, 44.377% id in 329 aa"
FT                   /db_xref="GOA:Q7VZY2"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZY2"
FT                   /protein_id="CAE41043.1"
FT                   /translation="MAVPPSKQDDLLTEQAVQWCVRIHDACCSEQDRAALQAWLEADPR
FT                   HAREYEAVRDIWTLAQDLPAHEAPAKACAPRRRPYPAARRALGACALGLACWAAGWWFA
FT                   VLPSSYHRYASDARVATVTLGDGTEVDMNIDTAMVYRNYRDARRVRLSDGEAYFRVFHD
FT                   ASHPFVVEAGAGTITVTGTAFNVWKSGDNVVVTLVEGRVDLRASATGKTVSLQPLTQAR
FT                   YAGRGEPVTRAVDGAQSAAWRHGKLVLDNTTLRDAIMQINRYLPAEARYTAVDPAIAGL
FT                   RLGGTYDVRNVGELARALPDILPVRTVRKADGSLALVPNPPR"
FT   misc_feature    complement(57216..57272)
FT                   /note="1 probable transmembrane helix predicted for BP0737
FT                   by TMHMM2.0 at aa 86-105"
FT   CDS_pept        join(57662..58117,58117..58149)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0738"
FT                   /product="ECF-family sigma factor Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 152. The sequence has been checked
FT                   and believed to be correct. Similar to Bordetella
FT                   bronchiseptica putative Ecf sigma factor BupI TR:Q9L430
FT                   (EMBL:AJ251793) (177 aa) fasta scores: E(): 6.1e-14,
FT                   37.419% id in 155 aa, and to Escherichia coli probable RNA
FT                   polymerase sigma factor FecI or B4293 SW:FECI_ECOLI
FT                   (P23484) (173 aa) fasta scores: E(): 1.2e-10, 34.507% id in
FT                   142 aa"
FT                   /db_xref="PSEUDO:CAE41044.1"
FT   misc_feature    57689..57853
FT                   /note="HMMPfam hit to PF00776, Sigma-70 factor (ECF
FT                   subfamily)"
FT   misc_feature    58025..58090
FT                   /note="Predicted helix-turn-helix motif with score 996
FT                   (+2.58 SD) at aa 134-155, sequence MSHDEIANSLGISVDMVHKHLT"
FT   variation       58118
FT                   /note="T in pertussis; (A)T in parapertussis and
FT                   bronchiseptica"
FT   CDS_pept        complement(58146..59096)
FT                   /transl_table=11
FT                   /locus_tag="BP0739"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA3"
FT                   /protein_id="CAE41045.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   repeat_region   58146..58177
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(58146..59198)
FT   misc_feature    complement(58182..58715)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(58773..58838)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   repeat_region   complement(59167..59198)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(59193..59231)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0739A"
FT                   /product="transposase (pseudogene)"
FT                   /note="transposase fragment for IS481-like element"
FT   repeat_region   complement(59193..59321)
FT                   /note="Fragment of a IS481-like element"
FT   repeat_region   59293..59321
FT                   /note="Inverted repeat for IS481-like element"
FT   CDS_pept        complement(59318..61513)
FT                   /transl_table=11
FT                   /locus_tag="BP0740"
FT                   /product="putative DNA methylase"
FT                   /note="no significant database matches"
FT                   /db_xref="GOA:Q7VZY1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR009537"
FT                   /db_xref="InterPro:IPR014455"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZY1"
FT                   /protein_id="CAE41047.1"
FT                   /translation="MPPPSRKPAAPRRVRRPAAAPVPRLAPVAGPGRLIDEGLSFYEAS
FT                   LAGKAERYGRGETPHTIHVWWARRPHSAMRALVYAALRAPADKRAAARLSELGATPVPQ
FT                   PGLLAEAAAELAGQYGGAPRVLDMFGGGGTIAFEAALLGCDAHSIDVNELAVFLQQANL
FT                   TYGATLDHGLLKQLAHRHGQAVLQRLARRTETLYPLRGRLASQAEKPIVYLWTYRHACP
FT                   QCGYAYTLSRRPWLSKKAGKALAMVATPGPDGDGVDMVSLPDGEPPPSRWAGRGATACP
FT                   RCSATATPGIADSADHCVAVVTSAGVGKQFALRDDALPAAGLLREQEETLLQRTGLALP
FT                   ATTLPAWSGIVNPALYGMRGHADLFNPRQRLVTLMLLEELLAEHRTLQAAHGADVARFV
FT                   SASLSGLIDQMVDWNCRLSMWIPQNEQVGRAFCGPGVAMLWDYAEVDPVGTGPGNLHAK
FT                   LERICAGIDALALLRRPVQVQRASAAALPYPDDSFDAIVTDPPYYDNIFYSVLADFFYA
FT                   WKKPLIDAIENRPTTPPHVPTANSGHDELVASRQRAGGSARAAHDEYCARLGQALREAA
FT                   RVLKPDGLLAFVYSHASVLGWAALVTAFRAAPFTINSVQPLSIERKARPRALASEAVNT
FT                   CTTFVARRAQAPRPVLARAALQAQFDAILRGGLHRSLLRAGWHEHDAGVALIAQGVALL
FT                   ANCAAVEDADTAALIVDLAGQVSALLPGFSIKQRASL"
FT   misc_feature    complement(60008..60028)
FT                   /note="ScanRegExp hit to PS00092, N-6 Adenine-specific DNA
FT                   methylases signature."
FT   CDS_pept        complement(61586..62014)
FT                   /transl_table=11
FT                   /locus_tag="BP0741"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Bacteriophage 434 repressor protein CI
FT                   SW:RPC1_BP434 (P16117) (94 aa) fasta scores: E(): 1.2,
FT                   35.088% id in 57 aa, and to Bacillus subtilis hypothetical
FT                   15.6 kDa protein TR:O52855 (EMBL:U09819) (139 aa) fasta
FT                   scores: E(): 0.38, 33.333% id in 69 aa. It's possible that
FT                   the upstream IS481 element has inserted within the
FT                   N-terminus of this CDS. Also similar to BP0744, 65.972%
FT                   identity (70.370% ungapped) in 144 aa overlap."
FT                   /db_xref="GOA:Q7VZY0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZY0"
FT                   /protein_id="CAE41048.1"
FT                   /translation="MKKFSDRLKHARRLRQLSQENLAHISGLSQSAVASYENGLRQSSR
FT                   SIRKLAIALQVNLDWFETGVGPMELEAYPSGPAAWRPGLMEPGGERAAAPWPFRAVAHA
FT                   RYQALSARDKLLLEQLVRTFIDACHADYGRAPPWPRER"
FT   misc_feature    complement(61832..61993)
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix"
FT   misc_feature    complement(61901..61966)
FT                   /note="Predicted helix-turn-helix motif with score 1793
FT                   (+5.29 SD) at aa 45-66, sequence LSQENLAHISGLSQSAVASYEN"
FT   repeat_region   62014..62045
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   62014..62416
FT   CDS_pept        join(62116..62415,62418..62510,62510..62686,62686..63063)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0742"
FT                   /product="transposase (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have three
FT                   frameshift mutations. Transposase for IS481 element"
FT                   /db_xref="PSEUDO:CAE41049.1"
FT   repeat_region   62417..62511
FT   repeat_region   62504..62685
FT   repeat_region   62681..63063
FT   misc_feature    62713..63027
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(63032..63063)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(63179..63622)
FT                   /transl_table=11
FT                   /locus_tag="BP0744"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Bacteriophage 434 repressor protein CI
FT                   SW:RPC1_BP434 (P16117) (94 aa) fasta scores: E(): 0.021,
FT                   37.097% id in 62 aa, and to Bacillus subtilis hypothetical
FT                   transcriptional regulator YqaE yqaE SW:YQAE_BACSU (P45902)
FT                   (116 aa) fasta scores: E(): 0.058, 27.083% id in 96 aa.
FT                   Also similar to BP0741, 65.972% identity (70.370% ungapped)
FT                   in 144 aa overlap."
FT                   /db_xref="GOA:Q7VZX9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZX9"
FT                   /protein_id="CAE41050.1"
FT                   /translation="MKTFSDRLKHARALRSLTQQDLARASGLSQSAVASYENGQRQSSR
FT                   SVRKLAAALQVNLDWLETGKGSMESLADYSASPAGGAYYLMEPGSGEAPPRALPPWPFT
FT                   TIARAQYEALAARDKRLLEQMLRSFVEACHAEYADGRGRARKH"
FT   misc_feature    complement(63440..63601)
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix"
FT   misc_feature    complement(63509..63574)
FT                   /note="Predicted helix-turn-helix motif with score 2149
FT                   (+6.51 SD) at aa 17-38, sequence LTQQDLARASGLSQSAVASYEN"
FT   CDS_pept        63730..64479
FT                   /transl_table=11
FT                   /locus_tag="BP0745"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Neisseria cinerea BasR TR:Q9F9Y4
FT                   (EMBL:AF139614) (222 aa) fasta scores: E(): 0.17, 28.729%
FT                   id in 181 aa, and to Bordetella pertussis transcriptional
FT                   regulatory protein, putative BasR TR:Q9S3M3 (EMBL:AJ132741)
FT                   (223 aa) fasta scores: E(): 0.0027, 28.319% id in 226 aa"
FT                   /db_xref="GOA:Q7VZX8"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZX8"
FT                   /protein_id="CAE41051.1"
FT                   /translation="MLAFSSVMIEARVQLEAGWRQAGWIVDWCEGQHALARLLAMHPPD
FT                   AVALCGVAGTLSGLVRTTRTSVPAAVVVALLSEGGLPERIAMMRAGVDLCWPIETQVEE
FT                   VAAMVDAFARRGTASAAAASAWYLSNAGRVLAGPGGVRLPLTVAEREFMARLLAAPGHR
FT                   LARQQLACGFRQRGVQDGAPVSSEVLPSWTANSSHAASYDAAAGLSRNVDVMVSRLRAK
FT                   AQRMGINLPLLSVRRWGYLFIADSDAG"
FT   CDS_pept        complement(64645..65721)
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="BP0746"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="Similar to Escherichia coli glutamate 5-kinase ProB
FT                   or B0242 or Z0303 or Ecs0269 SW:PROB_ECOLI (P07005) (367
FT                   aa) fasta scores: E(): 1.2e-47, 42.697% id in 356 aa, and
FT                   to Pseudomonas aeruginosa glutamate 5-kinase ProB or Pa4565
FT                   SW:PROB_PSEAE (Q9HVL9) (372 aa) fasta scores: E(): 6.1e-79,
FT                   61.064% id in 357 aa"
FT                   /db_xref="GOA:Q7VZX7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZX7"
FT                   /protein_id="CAE41052.1"
FT                   /translation="MGSSLVTNEGRGLDRAAVGHWAAQIAALHQQGKQVVLVSSGAIAE
FT                   GMARLGWRKRPSAMHELQAAAAVGQMGLCQAYEAAFAEFGLRTAQILLTHEDLADRHRY
FT                   LNARSTLFALLRLGVVPIVNENDTVVTDEIRFGDNDTLGALVTNLIEADALIILTDQRG
FT                   LYEADPRRDPAARFVAHAQAGDAALEAMAGGAGSGVGTGGMLTKILAAKRAAHSGAHTV
FT                   IASGRERNVLTRLAQGECIGTELRAVLPVWSARKQWLADHLRLRGRVVLDDGAVHALLH
FT                   EGKSLLPIGVAEVQGEFERGDVVACVDMHGRECARGLINYSSADTRRILRQPSSQIARI
FT                   LGSMTDPELMHRDNLVVT"
FT   misc_feature    complement(64699..64923)
FT                   /note="HMMPfam hit to PF01472, PUA domain"
FT   misc_feature    complement(64867..64890)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    complement(65080..65133)
FT                   /note="ScanRegExp hit to PS00902, Glutamate 5-kinase
FT                   signature."
FT   misc_feature    complement(65161..65739)
FT                   /note="HMMPfam hit to PF00696, Amino acid kinase family"
FT   CDS_pept        complement(65852..66985)
FT                   /transl_table=11
FT                   /locus_tag="BP0747"
FT                   /product="probable GTP-binding protein"
FT                   /note="Similar to Burkholderia pseudomallei GTP-binding
FT                   protein TR:Q9FD27 (EMBL:AF292383) (372 aa) fasta scores:
FT                   E(): 2.6e-86, 63.947% id in 380 aa, and to Neisseria
FT                   meningitidis GTP-binding protein Nmb2086 TR:Q9JXE5
FT                   (EMBL:AE002558) (384 aa) fasta scores: E(): 3.1e-77,
FT                   58.639% id in 382 aa"
FT                   /db_xref="GOA:Q7VZX6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZX6"
FT                   /protein_id="CAE41053.1"
FT                   /translation="MKFVDEATIEVIAGKGGNGVASFRREKFIPKGGPDGGDGGRGGSI
FT                   YAVADRNINTLIDFRYARLHRAKNGENGRGSDQYGAAAPDITLRVPVGTVVHDADTGEV
FT                   LFDLDRHDQKVTLAAGGAGGMGNIHFKSSTNRAPRQWTPGKEGEQRRLRMELKVLADVG
FT                   LLGLPNAGKSTLISRISNARPKIADYPFTTLHPNLGVVRTSPSRSFVVADIPGLIEGAS
FT                   EGAGLGHLFLRHLARTRVLLHLVDISSPDPEADPIEQAVVDANAIVEELRRYDPELAAK
FT                   PRWLVLNKLDMVPDAQDAQQRFCAEFGWTGPVFAISGLNGEGTQDLIWALQDYLDAEKR
FT                   KDQDAQDQADGTYVFEDPRFDASRGGAAPATPPGGDE"
FT   misc_feature    complement(65993..66940)
FT                   /note="HMMPfam hit to PF01018, GTP1/OBG family"
FT   misc_feature    complement(66308..66349)
FT                   /note="ScanRegExp hit to PS00905, GTP1/OBG family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   misc_feature    complement(66467..66490)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        complement(67135..67395)
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="BP0748"
FT                   /product="50S ribosomal protein L27"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein
FT                   L27 RpmA or B3185 SW:RL27_ECOLI (P02427) (84 aa) fasta
FT                   scores: E(): 2.8e-21, 71.084% id in 83 aa, and to Vibrio
FT                   cholerae ribosomal protein L27 Vc0436 TR:Q9KUS9
FT                   (EMBL:AE004131) (86 aa) fasta scores: E(): 5.1e-23, 73.256%
FT                   id in 86 aa"
FT                   /db_xref="GOA:Q7VZX5"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZX5"
FT                   /protein_id="CAE41054.1"
FT                   /translation="MAQKKGGGSTRNGRDSESKRLGVKVYGGQSILAGSIIVRQRGTRF
FT                   HPGVNVGVGKDHTLFALANGKVHFSVKGALNKPTVSVVAAE"
FT   misc_feature    complement(67147..67392)
FT                   /note="HMMPfam hit to PF01016, Ribosomal L27 protein"
FT   misc_feature    complement(67252..67296)
FT                   /note="ScanRegExp hit to PS00831, Ribosomal protein L27
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        complement(67429..67740)
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="BP0749"
FT                   /product="50S ribosomal protein L21"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein
FT                   L21 RplU or B3186 or Z4549 or Ecs4065 SW:RL21_ECOLI
FT                   (P02422) (103 aa) fasta scores: E(): 4.8e-18, 47.573% id in
FT                   103 aa, and to Burkholderia pseudomallei 50S ribosomal
FT                   protein L21 RplU TR:Q9FD29 (EMBL:AF292383) (103 aa) fasta
FT                   scores: E(): 1.4e-29, 80.583% id in 103 aa"
FT                   /db_xref="GOA:Q7VZX4"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZX4"
FT                   /protein_id="CAE41055.1"
FT                   /translation="MYAVIKTGGKQYRVATGEKLKVEQIPADIGQEITLDQVLSVGEGD
FT                   QLKVGTPLVSGAVVKATVLAHGRHDKIKIFKMRRRKHYQKHQGHRQNYTEIRIEAITA"
FT   misc_feature    complement(67453..67740)
FT                   /note="HMMPfam hit to PF00829, Ribosomal prokaryotic L21
FT                   protein"
FT   misc_feature    complement(67459..67527)
FT                   /note="ScanRegExp hit to PS01169, Ribosomal protein L21
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        68165..69313
FT                   /transl_table=11
FT                   /locus_tag="BP0750"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical 41.1
FT                   kDa protein Scf41.20C TR:Q9RJU9 (EMBL:AL117387) (390 aa)
FT                   fasta scores: E(): 2.9e-72, 54.856% id in 381 aa, and to
FT                   Agrobacterium tumefaciens Agr_c_4970p TR:AAK88456
FT                   (EMBL:AE008188) (386 aa) fasta scores: E(): 7e-73, 53.457%
FT                   id in 376 aa"
FT                   /db_xref="GOA:Q7VZX3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZX3"
FT                   /protein_id="CAE41056.1"
FT                   /translation="MAVPHDDLPEDLERALLVGRVWQPAPVDGPCVVAVRGGRLYDLTA
FT                   VTPTLADLLDRGDRVALARNAAGECLGPAADWLAGRAAGAMLAPCDLQPVKAAGATFAA
FT                   SLVERIGAEQAGGDAGRAAAVRERIAGLIGTDLSQLRPGSPEAARLKAVLWARGMWSPY
FT                   LEVGLGPDAEVFSKAPPMASVGYGSWIGLLPESEWNNPEPEIVLAVDARGQAVGATLGN
FT                   DVNLHDVEARSALLQNRAKDNNGSCAMGPFVRLFDASYGLGDVRRADVRLRIEGQEDGF
FT                   VLDATSHMREISRDPLELVRQTCGGHHQYPDGFMLFLGTMFSPTQDRAAAGRGFTHRPG
FT                   DLVRIASPRLGALVNRVGLATAIAPWTFGVRALYANLRRRGL"
FT   CDS_pept        69428..70393
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /gene_synonym="cel"
FT                   /locus_tag="BP0751"
FT                   /product="octaprenyl-diphosphate synthase"
FT                   /EC_number="2.5.1.-"
FT                   /note="Similar to Escherichia coli octaprenyl-diphosphate
FT                   synthase IspB or Cel or B3187 SW:ISPB_ECOLI (P19641) (323
FT                   aa) fasta scores: E(): 1.2e-63, 53.560% id in 323 aa, and
FT                   to Vibrio cholerae octaprenyl-diphosphate synthase Vc0434
FT                   TR:Q9KUT1 (EMBL:AE004131) (348 aa) fasta scores: E():
FT                   3.1e-63, 53.870% id in 323 aa"
FT                   /db_xref="GOA:Q7VZX2"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZX2"
FT                   /protein_id="CAE41057.1"
FT                   /translation="MNLPELIAPIADDMKAVDTVIRDRLNSDVVLIRTIGDYIIGAGGK
FT                   RMRPAMVLMVARALGYQGTHHQLLAAVVEFIHTATLLHDDVVDESDLRRGRDTANAVFG
FT                   NAASVLVGDYLYSRSFEMMVEADSMRIMQILSQATTVIAEGEVLQLLNVHDPDVSQERY
FT                   LQVVRYKTAKLFEAAAQVGAVLAGASPEQETAAAAYGRHVGTAFQLVDDVLDYSGDAHA
FT                   LGKNVGDDLREGKPTLPLIRVMETGTPEQRELIREAIKTGQADFAAVAQAIQATDALAH
FT                   ARQAAENEAELARQALSAFPVSLYQKSLLEFCAFAVNRDR"
FT   misc_feature    69518..70270
FT                   /note="HMMPfam hit to PF00348, Polyprenyl synthetase"
FT   misc_feature    69668..69712
FT                   /note="ScanRegExp hit to PS00723, Polyprenyl synthetases
FT                   signature 1. Confirmed by InterPro eMOTIF pattern match."
FT   misc_feature    70034..70072
FT                   /note="ScanRegExp hit to PS00444, Polyprenyl synthetases
FT                   signature 2. Confirmed by InterPro eMOTIF pattern match."
FT   tRNA            70440..70516
FT                   /note="tRNA Pro anticodon CGG, Cove score 84.17"
FT   CDS_pept        complement(70662..71528)
FT                   /transl_table=11
FT                   /locus_tag="BP0752"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="Similar to Escherichia coli transcriptional
FT                   activator protein LysR or B2839 SW:LYSR_ECOLI (P03030) (311
FT                   aa) fasta scores: E(): 4.6e-23, 34.507% id in 284 aa, and
FT                   to Agrobacterium tumefaciens regulatory protein NocR
FT                   SW:NOCR_AGRT5 (Q00678) (300 aa) fasta scores: E(): 5.3e-22,
FT                   33.333% id in 285 aa"
FT                   /db_xref="GOA:Q7VZX1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZX1"
FT                   /protein_id="CAE41058.1"
FT                   /translation="MLNFRQVETFRAVMLTRSMTQAAKDLHTTQPNVSRVIAQLEARIG
FT                   LRLFERVAGKLVPTREGEVFFRDVEMTFAGLRSLESSAATLRRRGTGHLRISAVPSPAL
FT                   VTVPEAMQLFAERFPDVTVSMHVADSITVCQWTAAGYSDIGVASDIFSSPGIGHHVASE
FT                   ALGVCIVPAGHRLAGMPRALAPADLAGERFLSLSPNDAMRKEIDKVFAAAICHMVGLGL
FT                   GVSIANPDVADGFRSLDIAIKPFAPDIRFSTYLVYPSSSPLSLLAQTFCECYEISAGRK
FT                   RARRQAG"
FT   misc_feature    complement(71091..71483)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    complement(71385..71477)
FT                   /note="ScanRegExp hit to PS00044, Bacterial regulatory
FT                   proteins, lysR family signature."
FT   misc_feature    complement(71415..71480)
FT                   /note="Predicted helix-turn-helix motif with score 1682
FT                   (+4.92 SD) at aa 4-25, sequence RSMTQAAKDLHTTQPNVSRVIA"
FT   CDS_pept        71659..73707
FT                   /transl_table=11
FT                   /gene="hyuA"
FT                   /locus_tag="BP0753"
FT                   /product="putative hydantoin utilization protein A"
FT                   /note="Similar to Pseudomonas sp hydantoin utilization
FT                   protein A HyuA SW:HYUA_PSESN (Q01262) (690 aa) fasta
FT                   scores: E(): 2.8e-78, 35.044% id in 682 aa, and to
FT                   Rhizobium loti hydantoin utilization protein A Mlr7024
FT                   TR:Q987J7 (EMBL:AP003010) (692 aa) fasta scores: E():
FT                   2.1e-118, 47.415% id in 677 aa"
FT                   /db_xref="GOA:Q7VZX0"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZX0"
FT                   /protein_id="CAE41059.1"
FT                   /translation="MSLRIGVDIGGSFADFAVLDESTRTIQTLKVFSRPDAPGSEVLAG
FT                   IEQLKARHGLDPAQVSYFTHGTTVGVNAVVQRRGLKLALITTRNFEDVLDIGRLKIPDM
FT                   YHLMSKRPAPLISRDRVFGVDERLGADGSVVAPVDEASVLAAAEALREAGCEGVVVSLL
FT                   HAYRNPAHERQVKAILQRALPGMFVSCSHEVWPIIREYERTLTATIGGYVQPRVSHYLE
FT                   SLQGALRESGVPVDLKVTKSNGGVMSAEHGKANCVQMILSGTASGVIGAAYIADLCHIP
FT                   NCMSLDIGGTTADIALIVDGKPQFATGEYIGDFQIHIPSVSVSSVGDGGGSIAWVDELG
FT                   VLKVGHQSAGSTPGPVCYGKGGTQPTITDAFAVMGVIGSQQLGYNAVQVDVEAARRSIE
FT                   PLAEKLGTDVLRTAEAIVNVSVSSMYAGVSRVISRFGIDPRVFSLMPFGGAGPMLACYL
FT                   AKALKVQKLLVPTTPGVLSALGGLIADVKNDFVRTTYCDLNAATVGSLAQAASELEAQA
FT                   RAWLVAEVGTDADAEIDISADMRYRGQSFEIDTPVERAWLEAGAIDSLSQAFHKEHERL
FT                   YGHGDASAGVQVVAMRLVITSRTPKPELNHIAQGAGVPPRESTLRIWLEGQYRDVPLYR
FT                   CEKLLAGQAFSGPAIVAQDDCTTCVLPGFDARVDTYGNLELTALALN"
FT   misc_feature    71668..73311
FT                   /note="HMMPfam hit to PF01968, Hydantoinase/oxoprolinase"
FT   CDS_pept        73725..75722
FT                   /transl_table=11
FT                   /gene="hyuB"
FT                   /locus_tag="BP0754"
FT                   /product="hydantoin utilization protein B"
FT                   /note="Similar to Pseudomonas sp hydantoin utilization
FT                   protein B HyuB SW:HYUB_PSESN (Q01263) (592 aa) fasta
FT                   scores: E(): 1.7e-52, 31.134% id in 591 aa, and to
FT                   Rhizobium loti hydantoin utilization protein B Mlr7025
FT                   TR:Q987J6 (EMBL:AP003010) (661 aa) fasta scores: E():
FT                   4.6e-142, 55.807% id in 663 aa. Also similar to BP0821
FT                   (58.133% identity in 664 aa overlap)"
FT                   /db_xref="GOA:Q7VZW9"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZW9"
FT                   /protein_id="CAE41060.1"
FT                   /translation="MNFDKTVLQIFANYCVAAAESMAHTLMRTAHSAFVKETEDFSCTI
FT                   MTPRGQTFASPKTLGATWYPGLDFSGAIDMIDGYEPGDICMTNDAYSGYVATHTPDIMM
FT                   WKPVYYQGEMVCFVGGHIHNTDMGGAVPASLSRTLTEVHQEGIRFPPTKIVRRGVLNEE
FT                   LMRLMELNVRSPDQNRGDLQAQTAMLMTGERRIVEIIERFGLQAFKEGMAAMLDYSEQQ
FT                   ARAIVRAMPDGEYFFAEYANEDSLNGKPLRVAITLRIRGDELEFDFTGSDPQLTSSLNM
FT                   PTGGKERHVLALVGLNYVLYSLNPEILLNAGMLRVARCILPEGSVVNPLAPAAVGMRSL
FT                   TCKVVQYATMGVFSQVVPDRLPASPAGGMSIVNVKTTDRDGKTIIAAIEPVGGGAGGDP
FT                   YSDGADASGAIVAFLRNTPVEINETEVPIRITRYGMVPDSGGPGRYRGGLGTCMEFQVY
FT                   TPNSAVTARNRDRSRFASWGVLGGKAGTVSRFLRNPGTAHEEDLGVHDFIHCQPGDVIR
FT                   LEGCGGGGYGSPWERDPARVLHDVRCGYVSVENARGQYGVVIEGGEVSRDATARLRAEL
FT                   AGRDPAVAHYDHGAGRDAFEAVWTLARYERMTHHLAGVAPIWRHFLKIKIFDALEQRLG
FT                   GNVADTRPEIVDEIFAQLLKACPQLQAASA"
FT   misc_feature    73731..75344
FT                   /note="HMMPfam hit to PF02538, Hydantoinase B/oxoprolinase"
FT   misc_feature    74223..74246
FT                   /note="ScanRegExp hit to PS00867, Carbamoyl-phosphate
FT                   synthase subdomain signature 2."
FT   CDS_pept        75757..77094
FT                   /transl_table=11
FT                   /locus_tag="BP0755"
FT                   /product="putative amino acid deaminase"
FT                   /note="Similar to Proteus vulgaris L-amino acid deaminase
FT                   Lad TR:Q9LCB2 (EMBL:AB030003) (471 aa) fasta scores: E():
FT                   9.2e-29, 31.628% id in 430 aa, and to Proteus mirabilis
FT                   amino acid deaminase Aad TR:Q51890 (EMBL:U35383) (473 aa)
FT                   fasta scores: E(): 7e-29, 28.638% id in 426 aa"
FT                   /db_xref="GOA:Q7VZW8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZW8"
FT                   /protein_id="CAE41061.1"
FT                   /translation="MQQLKQALLRIDTPHTPPAEVDVAIIGAGAAGVATAHELTRLGVR
FT                   VAVIEKGWVAAEQSSRNWGWCRTLGRDIRELELARLSVDLWRSVQADTGVDAGFRETGV
FT                   VFVTDDPSELRTWERWQQAAAARGVPARMLSAREANATHAWGKTPWIGGIRTERDGYAE
FT                   PARAIPLLARHAMDNGAQVIQQCAVNELLVEGGRVAGVQTECGLVRASQVVVAGGVWSS
FT                   LFCRKHKLPLPILQVHSSASRSRQFDTGGAAPARATHFSFRHREDGGLTLAKSGRGTMH
FT                   VVPDLLRYGMKFRSLYRARKANVRLSIGRQFFAQCWDEFRYFHLDRPPYARHRVLDPGP
FT                   DMALVRSAYEDAGAVFPGMGSDLIDQAWGGVIDNTPDGIPVISDVARMPGLYLCTGFSG
FT                   HGFSSSLGAGRCLAQWIARGRSDLSLDAFSYARLVDGRRLQPSILY"
FT   misc_feature    76177..76200
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        join(77091..77255,78305..79210)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0756"
FT                   /product="putative exported protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. Similar to Comamonas testosteroni OrfJ
FT                   protein TR:Q9RHM9 (EMBL:AB029044) (326 aa) fasta scores:
FT                   E(): 2.7e-31, 33.735% id in 332 aa, and to Rhizobium
FT                   meliloti conserved hypothetical protein Sma1927 TR:AAK65716
FT                   (EMBL:AE007292) (330 aa) fasta scores: E(): 1.1e-31,
FT                   35.629% id in 334 aa"
FT                   /db_xref="PSEUDO:CAE41062.1"
FT   repeat_region   77255..78306
FT   CDS_pept        77357..78304
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0756A"
FT                   /product="transposase (Pseudogene)"
FT                   /note="Pseudogene. Transposase for IS481 element. The
FT                   transposase lacks a stop codon, hence it is fused to the
FT                   C-terminal portion of the disrupted CDS."
FT   misc_feature    77615..77680
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    77738..78271
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(78276..78306)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        79265..80746
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BP0757"
FT                   /product="succinate-semialdehyde dehydrogenase [NADP+]"
FT                   /EC_number="1.2.1.16"
FT                   /note="Similar to Escherichia coli succinate-semialdehyde
FT                   dehydrogenase [NADP+] GabD or B2661 SW:GABD_ECOLI (P25526)
FT                   (482 aa) fasta scores: E(): 4.7e-99, 52.664% id in 488 aa,
FT                   and to Agrobacterium radiobacter AttK TR:Q9WWD5
FT                   (EMBL:U59485) (484 aa) fasta scores: E(): 4.7e-106, 57.819%
FT                   id in 486 aa"
FT                   /db_xref="GOA:Q7VZW7"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZW7"
FT                   /protein_id="CAE41064.1"
FT                   /translation="MSLSVGNAALLPGRNLIGSEWREAALGARFAVADPATGKVIAHVP
FT                   DSGARDAGAAVTAAHQAFADWRRTPAKVRAQIIKRWNALLHENAEDLARLISSEQGKPL
FT                   AEARGEVSYAASYVEWFAEEATRADGDLIPSPAQGRRMFALREPVGVVAAITPWNFPAA
FT                   MIARKIAPALAAGCTVVCKPAEDTPLTSLALTALAQQAGVPPGVLNIVTASRGRAAEVA
FT                   DAWLDDPRVRKITFTGSTPVGKHLARRSADTLKRVSLELGGNAPFIVFDDADLDAAVEG
FT                   LMVSKFRNGGQTCVCPNRIFVQAGVHDAFVRKLAARVEGLVVGPASDPASQIGPMINAR
FT                   AVEKIEHHVADALERGARLAVGGKRIHSARCAGDHYYAPTVLTGVDETMACFREETFGP
FT                   VAPITVFASEAEVVAAANATAFGLAAYFYSTDVRRIWRLADALETGIVGVNEGALAAEA
FT                   APFGGVKDSGYGREGSRHGLAEYMQIKYVCQGQLD"
FT   misc_feature    79322..80737
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
FT                   family"
FT   misc_feature    79838..79903
FT                   /note="Predicted helix-turn-helix motif with score 975
FT                   (+2.51 SD) at aa 192-213, sequence LALTALAQQAGVPPGVLNIVTA"
FT   misc_feature    80039..80062
FT                   /note="ScanRegExp hit to PS00687, Aldehyde dehydrogenases
FT                   glutamic acid active site."
FT   misc_feature    80123..80158
FT                   /note="ScanRegExp hit to PS00070, Aldehyde dehydrogenases
FT                   cysteine active site."
FT   CDS_pept        complement(80762..81319)
FT                   /transl_table=11
FT                   /gene="cyaC"
FT                   /gene_synonym="HlyC"
FT                   /locus_tag="BP0758"
FT                   /product="cyclolysin-activating lysine-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis cyclolysin-activating lysine-acyltransferase CyaC
FT                   SW:CYAC_BORPE (Q45359) (185 aa) fasta scores: E(): 2.1e-78,
FT                   99.459% id in 185 aa, and to Escherichia coli
FT                   hemolysin-activating lysine-acyltransferase HlyC
FT                   SW:HLYC_ECOLI (P06736) (170 aa) fasta scores: E(): 1.5e-24,
FT                   40.698% id in 172 aa"
FT                   /db_xref="GOA:P0A3I5"
FT                   /db_xref="InterPro:IPR003996"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A3I5"
FT                   /protein_id="CAE41065.1"
FT                   /translation="MLPSAQAPSLLNPTDDFAALGNIAWLWMNSPMHRDWPVHLLARNT
FT                   LAPIQLGQYILLRCNDVPVAYCSWALMDADTELSYVMAPSSLGGNAWNCGDRLWIIDWI
FT                   APFSRDDNRALRRALAERHPDSVGRSLRVRRGGDTARVKEYRGRALDAAAARAQLDRYH
FT                   AELIAGLRASNGGYAPRGRGTA"
FT   CDS_pept        81798..86918
FT                   /transl_table=11
FT                   /gene="cyaA"
FT                   /gene_synonym="cya"
FT                   /locus_tag="BP0760"
FT                   /product="bifunctional hemolysin-adenylate cyclase
FT                   precursor"
FT                   /EC_number="4.6.1.1"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis bifunctional hemolysin-adenylate cyclase
FT                   precursor Cya or CyaA SW:CYAA_BORPE (P15318) (1706 aa)
FT                   fasta scores: E(): 0, 99.941% id in 1706 aa, and to
FT                   Bordetella parapertussis bifunctional hemolysin-adenylate
FT                   cyclase precursor CyaA TR:Q9L469 (EMBL:AJ249835) (1706 aa)
FT                   fasta scores: E(): 0, 97.714% id in 1706 aa"
FT                   /db_xref="GOA:P0DKX7"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR003995"
FT                   /db_xref="InterPro:IPR005165"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018504"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR035099"
FT                   /db_xref="InterPro:IPR037017"
FT                   /db_xref="PDB:1YRT"
FT                   /db_xref="PDB:1YRU"
FT                   /db_xref="PDB:1ZOT"
FT                   /db_xref="PDB:2COL"
FT                   /db_xref="PDB:5CXL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DKX7"
FT                   /protein_id="CAE41066.1"
FT                   /translation="MQQSHQAGYANAADRESGIPAAVLDGIKAVAKEKNATLMFRLVNP
FT                   HSTSLIAEGVATKGLGVHAKSSDWGLQAGYIPVNPNLSKLFGRAPEVIARADNDVNSSL
FT                   AHGHTAVDLTLSKERLDYLRQAGLVTGMADGVVASNHAGYEQFEFRVKETSDGRYAVQY
FT                   RRKGGDDFEAVKVIGNAAGIPLTADIDMFAIMPHLSNFRDSARSSVTSGDSVTDYLART
FT                   RRAASEATGGLDRERIDLLWKIARAGARSAVGTEARRQFRYDGDMNIGVITDFELEVRN
FT                   ALNRRAHAVGAQDVVQHGTEQNNPFPEADEKIFVVSATGESQMLTRGQLKEYIGQQRGE
FT                   GYVFYENRAYGVAGKSLFDDGLGAAPGVPSGRSKFSPDVLETVPASPGLRRPSLGAVER
FT                   QDSGYDSLDGVGSRSFSLGEVSDMAAVEAAELEMTRQVLHAGARQDDAEPGVSGASAHW
FT                   GQRALQGAQAVAAAQRLVHAIALMTQFGRAGSTNTPQEAASLSAAVFGLGEASSAVAET
FT                   VSGFFRGSSRWAGGFGVAGGAMALGGGIAAAVGAGMSLTDDAPAGQKAAAGAEIALQLT
FT                   GGTVELASSIALALAAARGVTSGLQVAGASAGAAAGALAAALSPMEIYGLVQQSHYADQ
FT                   LDKLAQESSAYGYEGDALLAQLYRDKTAAEGAVAGVSAVLSTVGAAVSIAAAASVVGAP
FT                   VAVVTSLLTGALNGILRGVQQPIIEKLANDYARKIDELGGPQAYFEKNLQARHEQLANS
FT                   DGLRKMLADLQAGWNASSVIGVQTTEISKSALELAAITGNADNLKSVDVFVDRFVQGER
FT                   VAGQPVVLDVAAGGIDIASRKGERPALTFITPLAAPGEEQRRRTKTGKSEFTTFVEIVG
FT                   KQDRWRIRDGAADTTIDLAKVVSQLVDANGVLKHSIKLDVIGGDGDDVVLANASRIHYD
FT                   GGAGTNTVSYAALGRQDSITVSADGERFNVRKQLNNANVYREGVATQTTAYGKRTENVQ
FT                   YRHVELARVGQLVEVDTLEHVQHIIGGAGNDSITGNAHDNFLAGGSGDDRLDGGAGNDT
FT                   LVGGEGQNTVIGGAGDDVFLQDLGVWSNQLDGGAGVDTVKYNVHQPSEERLERMGDTGI
FT                   HADLQKGTVEKWPALNLFSVDHVKNIENLHGSRLNDRIAGDDQDNELWGHDGNDTIRGR
FT                   GGDDILRGGLGLDTLYGEDGNDIFLQDDETVSDDIDGGAGLDTVDYSAMIHPGRIVAPH
FT                   EYGFGIEADLSREWVRKASALGVDYYDNVRNVENVIGTSMKDVLIGDAQANTLMGQGGD
FT                   DTVRGGDGDDLLFGGDGNDMLYGDAGNDTLYGGLGDDTLEGGAGNDWFGQTQAREHDVL
FT                   RGGDGVDTVDYSQTGAHAGIAAGRIGLGILADLGAGRVDKLGEAGSSAYDTVSGIENVV
FT                   GTELADRITGDAQANVLRGAGGADVLAGGEGDDVLLGGDGDDQLSGDAGRDRLYGEAGD
FT                   DWFFQDAANAGNLLDGGDGRDTVDFSGPGRGLDAGAKGVFLSLGKGFASLMDEPETSNV
FT                   LRNIENAVGSARDDVLIGDAGANVLNGLAGNDVLSGGAGDDVLLGDEGSDLLSGDAGND
FT                   DLFGGQGDDTYLFGVGYGHDTIYESGGGHDTIRINAGADQLWFARQGNDLEIRILGTDD
FT                   ALTVHDWYRDADHRVEIIHAANQAVDQAGIEKLVEAMAQYPDPGAAAAAPPAARVPDTL
FT                   MQSLAVNWR"
FT   misc_feature    82842..82865
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    82887..84659
FT                   /note="HMMPfam hit to PF02382, RTX N-terminal domain"
FT   misc_feature    84840..85004
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding protein"
FT   misc_feature    85188..85373
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding protein"
FT   misc_feature    85278..85334
FT                   /note="ScanRegExp hit to PS00330, Hemolysin-type
FT                   calcium-binding region signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   misc_feature    85560..85793
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding protein"
FT   misc_feature    85704..85760
FT                   /note="ScanRegExp hit to PS00330, Hemolysin-type
FT                   calcium-binding region signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   misc_feature    85983..86195
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding protein"
FT   misc_feature    86073..86129
FT                   /note="ScanRegExp hit to PS00330, Hemolysin-type
FT                   calcium-binding region signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   misc_feature    86361..86573
FT                   /note="HMMPfam hit to PF00353, Hemolysin-type
FT                   calcium-binding protein"
FT   misc_feature    86505..86561
FT                   /note="ScanRegExp hit to PS00330, Hemolysin-type
FT                   calcium-binding region signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   CDS_pept        86996..89134
FT                   /transl_table=11
FT                   /gene="cyaB"
FT                   /locus_tag="BP0761"
FT                   /product="cyclolysin secretion ATP-binding protein"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis cyclolysin secretion ATP-binding protein CyaB
FT                   SW:CYAB_BORPE (P18770) (712 aa) fasta scores: E(): 0,
FT                   97.199% id in 714 aa, and to Escherichia coli hemolysin
FT                   secretion ATP-binding protein, chromosomal HlyB
FT                   SW:HLY2_ECOLI (P10089) (707 aa) fasta scores: E():
FT                   1.6e-133, 52.841% id in 704 aa"
FT                   /db_xref="GOA:P0DKX5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR010132"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039395"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DKX5"
FT                   /protein_id="CAE41067.1"
FT                   /translation="MTSPVAQCASVPDSGLLCLVMLARYHGLAADPEQLRHEFAEQAFC
FT                   SETIQLAARRVGLKVRRHRPAPARLPRAPLPAIALDRQGGYFVLARFEPGADQAVLIQR
FT                   PGQAPARLGQAEFEALWAGELLLCACAASPTQALARFDFSWFIPALVKHRHLIGEVLLI
FT                   SLVLQFIALLTPLFFQVVMDKVLVNNAMETLNVIAVGFLAAILFEALLTGIRTYLFAHT
FT                   SSKLDVELGARLYAHLLRLPLAYFQARRVGDSVARVRELEHIRAFLTGNAVTVLLDVVF
FT                   SVVFIAVMFFYSVKLTLVVLAALPCYFLLSLVLTPVLRRRLDVKFNRGAENQAFLVETV
FT                   SGIDTVKSLAVEPQWQRNWDRQLAGYVAAGLSVANVAMLANTGVTLISRLVALGVLWVG
FT                   ATEVVAQRMTVGELVAFNMLSGHVTQPVIRLAQLWNDFQQTGVSMQRLGDILNCRTEVA
FT                   GDKAQLPALRGSIELDRVSFRYRPDAADALRNVSLRIAPGEVVGVVGRSGSGKSTLTRL
FT                   IQRMFVADRGRVLIDGHDIGIVDSASLRRQLGVVLQESTLFNRSVRDNIALTRPGASMH
FT                   EVVAAARLAGAHEFICQLPEGYDTMLGENGVGLSGGQRQRIGIARALIHRPRVLILDEA
FT                   TSALDYESEHIIQRNMRDICDGRTVIIIAHRLSAVRCADRIVVMEGGEVAECGSHETLL
FT                   AAGGLYARLQALQAGEAG"
FT   misc_feature    87455..88276
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region."
FT   misc_feature    join(87473..87541,87584..87652,87800..87868,87881..87949,
FT                   88088..88156)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BP0761 by TMHMM2.0 at aa 160-182, 197-219, 269-291, 296-318
FT                   and 365-387"
FT   misc_feature    88487..89041
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    88508..88531
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    88820..88864
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        89131..90453
FT                   /transl_table=11
FT                   /gene="cyaD"
FT                   /locus_tag="BP0762"
FT                   /product="cyclolysin secretion protein"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis CyaD protein cyaD SW:CYAD_BORPE (P11091) (440 aa)
FT                   fasta scores: E(): 6.9e-151, 99.318% id in 440 aa"
FT                   /db_xref="GOA:P0DKX9"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DKX9"
FT                   /protein_id="CAE41068.1"
FT                   /translation="MRRALRELAARHGRVLAASWRQRHRRPAGWFDPVETEFLPSALSL
FT                   QERPISPTARWLARILMALAAGALVWSVVGKTEIVVHAAGKVVPVGQSKIIAASETGRV
FT                   ARVLVADNSRVAAGDVLLRLDAGVTEAEERKWRVQAAQARQDEARSRAMIRALDTGRAP
FT                   VLAELPADPGMMAAQSYLDSQYADYQAQLRSIEAAIATYRRELGLVTQIAHAHRGLRRD
FT                   GDVSQQAYLEKEQARMTLEGRLRQSEAQRAALQTQTRRQAFETLVLARKLAAQAEQEIA
FT                   RTSAQRSRLVLTAPVDGVVQQLVALTEGTAVAATQPLMMVVPSGAGIQVQAQLDSKDIG
FT                   FVRAGAPATVKVGAYDYTKYGTLEGKVLYVSPDTVVDDRQQHSYRVTIALAHPALEVDG
FT                   KPRLLKEGMAVQADIRTGSRRLIEYLLSPVARHAGESLGER"
FT   misc_feature    89404..90360
FT                   /note="HMMPfam hit to PF00529, HlyD family secretion
FT                   protein"
FT   misc_feature    90340..90408
FT                   /note="ScanRegExp hit to PS00543, HlyD family secretion
FT                   proteins signature. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   CDS_pept        90455..91879
FT                   /transl_table=11
FT                   /gene="cyaE"
FT                   /locus_tag="BP0763"
FT                   /product="cyclolysin secretion protein"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis protein CyaE precursor CyaE SW:CYAE_BORPE
FT                   (P11092) (474 aa) fasta scores: E(): 2.3e-165, 100.000% id
FT                   in 474 aa"
FT                   /db_xref="GOA:P0DKY0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR028351"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0DKY0"
FT                   /protein_id="CAE41069.1"
FT                   /translation="MAAVQVRRRGRALALALWAGFALSVGGGVRARDGLATPPAFEGQA
FT                   APAVSWPCPPPADRLDDLALLEAIDLALCHSPALRQGWARIKARSAEVGLARAPYYPSV
FT                   ALSAGRSAQRRSTGLGEDGVRNNVMAVTLAWRLFDSGARSAALRAAQAQLDEAAQAYGA
FT                   VLQDKLAEVVGAYYEAATARQALHTAVEDTEIARRSASIAARRARAGLDSHGDVLHAQA
FT                   ALERARLAQAQAEGAQARALAGLAQVLGVDPATPIVLAPGPLAPQRIEDRELAQWLRDA
FT                   RQRHPAIKAAQAGLAAATAQVDVARATDMPTVDLSLGHYRNSSENVSVFAGSSRSVSAS
FT                   LNLRIPLFDGFARRHRIQGARAEVQRQEALLDQARLATGAAVARAYADLRAARASHEAS
FT                   LRWLKAARAAYESDLRRYEAGVGGVAELLRAQSDWLSARQRHVLYAAQLRTRALALLAA
FT                   AGELGRSTIDGDPPKE"
FT   misc_feature    90455..90547
FT                   /note="Signal peptide predicted for BP0763 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.965) with cleavage site
FT                   probability 0.450 between residues 31 and 32"
FT   misc_feature    90488..90547
FT                   /note="1 probable transmembrane helix predicted for BP0763
FT                   by TMHMM2.0 at aa 12-31"
FT   misc_feature    90647..91237
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein"
FT   misc_feature    91274..91867
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein"
FT   CDS_pept        91970..92878
FT                   /transl_table=11
FT                   /gene="cyaX"
FT                   /locus_tag="BP0764"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis unknown Orf CyaX TR:Q45360 (EMBL:X14199) (285 aa)
FT                   fasta scores: E(): 1.6e-99, 93.411% id in 258 aa, and
FT                   similar to Escherichia coli transcriptional activator
FT                   protein IlvY or B3773 SW:ILVY_ECOLI (P05827) (297 aa) fasta
FT                   scores: E(): 1.3e-09, 26.733% id in 303 aa"
FT                   /db_xref="GOA:Q7VZW6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZW6"
FT                   /protein_id="CAE41070.1"
FT                   /translation="MMVMDLRWFQDFLTLAECGQFTTAAELRHVSQSAFSRRIQSLETW
FT                   VGTPLIDRGCFPTRLTAAGEQFRSAAAEIVRKVIDARGEAGATGHDSMVLRVAMPHCLA
FT                   TSRFPAWCARWQQVGGAASLRLHVGNVHDSVEWLAAGVVDLLVCFRHAVEDIQLDAQSY
FT                   MRAGVEADVLRLYRPAGMALDEAELACEAPQARYPYVSYAQGAYFRRLIELSCGPLLQR
FT                   AVLQRVCETDFVDGARDLVRAGVGLAWLPDSSARAAVEHGEIVAVADRRCAIPMEICMY
FT                   ARRHGPAQEAVERVFDQFGRG"
FT   misc_feature    91985..92410
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    92024..92089
FT                   /note="Predicted helix-turn-helix motif with score 1182
FT                   (+3.21 SD) at aa 19-40, sequence GQFTTAAELRHVSQSAFSRRIQ"
FT   misc_feature    92027..92119
FT                   /note="ScanRegExp hit to PS00044, Bacterial regulatory
FT                   proteins, lysR family signature."
FT   CDS_pept        92943..93857
FT                   /transl_table=11
FT                   /locus_tag="BP0765"
FT                   /product="probable extracellular solute-binding protein"
FT                   /note="Similar to Escherichia coli amino-acid ABC
FT                   transporter binding protein YbeJ precursor YbeJ or B0655
FT                   SW:YBEJ_ECOLI (P37902) (302 aa) fasta scores: E(): 2.3e-50,
FT                   47.038% id in 287 aa, and to Pseudomonas aeruginosa
FT                   probable binding protein component of ABC transporter
FT                   Pa1342 TR:Q9I402 (EMBL:AE004563) (302 aa) fasta scores:
FT                   E(): 2.5e-52, 47.797% id in 295 aa. Also similar to BP0057,
FT                   51.325% identity (52.013% ungapped) in 302 aa overlap."
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZW5"
FT                   /protein_id="CAE41071.1"
FT                   /translation="MKRLLNALTAALAIGAAAAGQAHAADLDGTLKKISDTGVITIGHR
FT                   ETSIPFSYYDANQKPVGYSIDICTRIVDAVKTRIKRDDIQVKYLPVTSATRIPLMGNGT
FT                   IDLECASTSNTLDCQKQVAFSVTTFVTGNRFISLKSANLKTIDDLKGKTVASTSGTANI
FT                   RQANEINEARSLGMKVVPVKEHAEGFLMVETGRAAAFIMDDILLYGLAANAKEPDRYQV
FT                   SGDSLSIEPYAIMLRRDDPQFKALVDDTIKSLYASGDFEALYKRWYQSPLPPKGINLNV
FT                   AMSEVLKRVVATPTDSGDPVAYK"
FT   misc_feature    92943..93014
FT                   /note="Signal peptide predicted for BP0765 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 24 and 25"
FT   misc_feature    92991..93023
FT                   /note="ScanRegExp hit to PS00626, Regulator of chromosome
FT                   condensation (RCC1) signature 2."
FT   misc_feature    93060..93752
FT                   /note="HMMPfam hit to PF00497, Bacterial extracellular
FT                   solute-binding proteins, family 3"
FT   CDS_pept        join(93965..94687,94687..94698)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="gltJ"
FT                   /locus_tag="BP0766"
FT                   /product="glutamate/aspartate transport system permease
FT                   protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 241. The frameshift occurs within
FT                   a polymeric tract of (G)5. The sequence has been checked
FT                   and believed to be correct. Similar to Escherichia coli
FT                   glutamate/aspartate transport system permease protein GltJ
FT                   or B0654 SW:GLTJ_ECOLI (P41074) (246 aa) fasta scores: E():
FT                   1.7e-37, 44.635% id in 233 aa, and to Pseudomonas
FT                   aeruginosa probable permease of ABC transporter Pa1341
FT                   TR:Q9I403 (EMBL:AE004563) (248 aa) fasta scores: E():
FT                   1.4e-39, 47.639% id in 233 aa. Also similar to BP0056,
FT                   57.759% identity (58.515% ungapped) in 232 aa overlap."
FT                   /db_xref="PSEUDO:CAE41072.1"
FT   misc_feature    94328..94549
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   misc_feature    94331..94417
FT                   /note="ScanRegExp hit to PS00402, Binding-protein-dependent
FT                   transport systems inner membrane comp. sign."
FT   variation       94684..94688
FT                   /note="(G)5 in pertussis; (G)6 in parapertussis"
FT   CDS_pept        94695..95378
FT                   /transl_table=11
FT                   /gene="gltK"
FT                   /locus_tag="BP0767"
FT                   /product="glutamate/aspartate transport system permease
FT                   protein"
FT                   /note="Similar to Escherichia coli glutamate/aspartate
FT                   transport system permease protein GltK or B0653 or Z0803 or
FT                   Ecs0692 SW:GLTK_ECOLI (P41075) (224 aa) fasta scores: E():
FT                   6.2e-33, 48.214% id in 224 aa, and to Pseudomonas
FT                   aeruginosa probable permease of ABC transporter Pa1340
FT                   TR:Q9I404 (EMBL:AE004563) (222 aa) fasta scores: E():
FT                   3e-32, 45.701% id in 221 aa. Also similar to BP0055,
FT                   56.696% identity (56.696% ungapped) in 224 aa overlap."
FT                   /db_xref="GOA:Q7VZW4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030205"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZW4"
FT                   /protein_id="CAE41073.1"
FT                   /translation="MSSFDYQAIIDALPYLFLTGLRFSLLLTLSSAAGGVVLGALLAIA
FT                   RLYGRRWVAWPAAIYVNLFRSLPLVLVIFLIYFILPYLLQWITQAERPIVLGATGSAFV
FT                   TFILFEAAYFSEIIRAGIGSVGPGQYAAGSALGLTHGQVLRKVILPQAVRNMLPVLLTQ
FT                   VIVIFQETALVYVLSLPDFLGAATKIAQRDNRLVEMYVLVAVVFFVLSFTASRGVRALR
FT                   ARLGA"
FT   misc_feature    join(94761..94829,94890..94958,94971..95039,95163..95231,
FT                   95289..95348)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BP0767 by TMHMM2.0 at aa 23-45, 66-88, 93-115, 157-179 and
FT                   199-218"
FT   misc_feature    95055..95288
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   CDS_pept        95395..96138
FT                   /transl_table=11
FT                   /gene="gltL"
FT                   /locus_tag="BP0768"
FT                   /product="glutamate/aspartate transport ATP-binding
FT                   protein"
FT                   /note="Similar to Escherichia coli glutamate/aspartate
FT                   transport ATP-binding protein GltL or B0652 or Z0802 or
FT                   Ecs0691 SW:GLTL_ECOLI (P41076) (241 aa) fasta scores: E():
FT                   5.2e-51, 65.000% id in 240 aa, and to Pseudomonas
FT                   aeruginosa probable ATP-binding component of ABC
FT                   transporter Pa1339 TR:Q9I405 (EMBL:AE004563) (244 aa) fasta
FT                   scores: E(): 5.5e-57, 69.262% id in 244 aa. Similar to
FT                   several B. pertussis CDSs: BP1181, P3828, BP1534, BP1855,
FT                   BP1575, BP1362, P0054, and BP1510."
FT                   /db_xref="GOA:Q7VZW3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZW3"
FT                   /protein_id="CAE41074.1"
FT                   /translation="MELLSMIEIERLGKCYGDLPVLKDCSLAVARGEVVVVCGPSGSGK
FT                   STLIKCVNRLEPFESGRIVVDGTDVGAPGTDLPALRARVGMVFQHFELFPHLSVLENVC
FT                   LGQMSVLGRSRAQARAKADALLERVGVAAHRDKHPGQLSGGQQQRVAIARALAMDPVVM
FT                   LFDEPTSALDPEMIGEVLDVMTGLARDGMTMMVVTHEMGFARRVADRIVFMEAGEIIDD
FT                   VASAEFFGSAASPRSREFLSRIISH"
FT   misc_feature    95488..96045
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    95509..95532
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    95818..95862
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        96168..97028
FT                   /transl_table=11
FT                   /locus_tag="BP0769"
FT                   /product="probable aminotransferase"
FT                   /note="Similar to Staphylococcus aureus D-alanine
FT                   aminotransferase TR:Q9KWZ6 (EMBL:Y14816) (282 aa) fasta
FT                   scores: E(): 4.4e-32, 39.130% id in 276 aa, and to Brucella
FT                   suis hypothetical 32.0 kDa protein TR:CAC67779
FT                   (EMBL:AJ305234) (289 aa) fasta scores: E(): 1.5e-47,
FT                   48.387% id in 279 aa"
FT                   /db_xref="GOA:Q7VZW2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZW2"
FT                   /protein_id="CAE41075.1"
FT                   /translation="MSSLFYINGSFVPAEQARVPAMDRGFLFGDGVYEVMAVIDGMLLE
FT                   FERHAARLARSLGEIGIANPLPRERLLAVCRELVSRAGLREGSVYVQVTRGADARRDFA
FT                   FPSGVEPTVMLFTSEKDLRVNPLAQSGVQVATVPDLRWQRRDIKSVSLLAQVLAKQAAQ
FT                   ARGAFEAVMVDAQGVVTEGSSSSVLLVNAAGEIVVRPLSQDILPGCTRAAVLELARERD
FT                   MAMVERPFTLDECRQAREVILTSALQFVLPVIAVDGEPVADGRPGPVCAALRELYLRHT
FT                   LATAL"
FT   misc_feature    96189..97001
FT                   /note="HMMPfam hit to PF01063, Aminotransferase class IV"
FT   CDS_pept        complement(97036..97602)
FT                   /transl_table=11
FT                   /locus_tag="BP0770"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Rhizobium meliloti conserved hypothetical
FT                   protein Smb20087 TR:CAC48487 (EMBL:AL603642) (201 aa) fasta
FT                   scores: E(): 0.00043, 27.807% id in 187 aa, and to
FT                   Rhizobium loti Mll2445 protein Mll2445 TR:Q98ID9
FT                   (EMBL:AP002999) (200 aa) fasta scores: E(): 9e-06, 28.495%
FT                   id in 186 aa"
FT                   /db_xref="GOA:Q7VZW1"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZW1"
FT                   /protein_id="CAE41076.1"
FT                   /translation="MSLIVAARFDTFPDVENAAQRLFSEGFTKQDVHVFYVNSAGEHSR
FT                   YAYGGDRRSDPDSGRADMGAILGAALFGLAFAIAGGFIVAGLNESTIAMLAAAGVGAYI
FT                   GSLFGALWVTGHLARKRGEAAPVDHPEVRPAGLLLALHTDPTRETLACQVLRAANGHDV
FT                   EHAEGVWRDNRWQDFDPLKPPQREP"
FT   misc_feature    complement(join(97264..97329,97342..97407))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BP0770 by TMHMM2.0 at aa 65-87 and 91-113"
FT   CDS_pept        complement(97691..98647)
FT                   /transl_table=11
FT                   /locus_tag="BP0771"
FT                   /product="putative exported protein"
FT                   /note="Similar to Comamonas testosteroni OrfJ protein
FT                   TR:Q9RHM9 (EMBL:AB029044) (326 aa) fasta scores: E():
FT                   3e-27, 34.727% id in 311 aa, and to Alcaligenes eutrophus
FT                   hypothetical 35.6 kDa protein in gbd 5'region precursor
FT                   SW:YGB7_ALCEU (Q44018) (327 aa) fasta scores: E(): 3.9e-30,
FT                   37.294% id in 303 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZW0"
FT                   /protein_id="CAE41077.1"
FT                   /translation="MKSINKYLAATLASLGLAAGAAATDFPKNEVRLVVNYGAGGNTDV
FT                   ASRALAKGMEKPLGKPVIVENKPGALGTIGPGYVARQAPDGYTVGVVTYSTQAIMPHLM
FT                   KLPYTMDDFDFVAGVGRYRYGITVRADSPYKTLQDLVEAAKKPNGMFFGAPSSPNNLAL
FT                   LELGRLTGGKFEQVSYKSGSETVTALLGGQVDVIVQNPSDVLPHIRDGKLRMIASASPM
FT                   RWPELPEVPTIQESGWPVQIDSWIGLATPRGAPADVLAKLQQAALAAVADPVTRDSFEK
FT                   LGVDPASLKGSEYAELLKQGHEEMGRMIRDANLPRIN"
FT   misc_feature    complement(98579..98647)
FT                   /note="Signal peptide predicted for BP0771 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.868 between residues 23 and 24"
FT   CDS_pept        complement(98692..99444)
FT                   /transl_table=11
FT                   /locus_tag="BP0772"
FT                   /product="putative acetoacetyl-CoA reductase"
FT                   /EC_number="1.1.1.36"
FT                   /note="Similar to Zoogloea ramigera acetoacetyl-CoA
FT                   reductase PhbB SW:PHBB_ZOORA (P23238) (241 aa) fasta
FT                   scores: E(): 2.3e-25, 38.710% id in 248 aa, and to
FT                   Azospirillum brasilense nodulation protein G NodG
FT                   SW:NODG_AZOBR (P17611) (246 aa) fasta scores: E(): 8.7e-26,
FT                   35.458% id in 251 aa"
FT                   /db_xref="GOA:Q7VZV9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZV9"
FT                   /protein_id="CAE41078.1"
FT                   /translation="MSEPRIAVVTGAGRGIGLASARALLAAGNHVVTIDRGAIDTQALF
FT                   GAQHDRVTAASADVQDLPALQALKARVEAELGPVSILVNNAGVSPKRPDGRSSGILEVS
FT                   EEEWAQVLGINLTCVMRLCQLFLPAMRDQGYGRIVNVASLAGRARSIVAGPSYMASKAG
FT                   VIGLTRAIASEMGPYGITANCVAPGRILTEMAQQAGPEVNQRYAEQIPVRRLGTPEEVG
FT                   TSIAFLCGPDAGFVNGAIIDINGGFYMP"
FT   misc_feature    complement(98716..98808)
FT                   /note="HMMPfam hit to PF00678,"
FT   misc_feature    complement(98866..99432)
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase"
FT   misc_feature    complement(99073..99138)
FT                   /note="Predicted helix-turn-helix motif with score 996
FT                   (+2.58 SD) at aa 103-124, sequence VSEEEWAQVLGINLTCVMRLCQ"
FT   CDS_pept        complement(99441..101186)
FT                   /transl_table=11
FT                   /locus_tag="BP0773"
FT                   /product="putative acetolactate synthase large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="Similar to Methanococcus aeolicus acetohydroxyacid
FT                   synthase large subunit IlvB TR:O08353 (EMBL:U35458) (599
FT                   aa) fasta scores: E(): 2.2e-48, 32.105% id in 570 aa, and
FT                   to Methanococcus maripaludis acetohydroxyacid synthase
FT                   large subunit IlvB TR:Q9Y8J0 (EMBL:AF118061) (587 aa) fasta
FT                   scores: E(): 3.6e-46, 32.737% id in 559 aa"
FT                   /db_xref="GOA:Q7VZV8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZV8"
FT                   /protein_id="CAE41079.1"
FT                   /translation="MSTLPKPLSAPGFTLDGTVAHAIVRALARHGVDTLFGQSLPSLLH
FT                   LAAEQAGMRQVAYRTENAGGYMADAYARVSGKPAIVTAQNGPAATLLVAPLAEAMKVSV
FT                   PVIALVQDVNRDQTDRNAFQELDHIALFQPVTKWVRRVTEASRIEDYVDQAFAAACSGR
FT                   PGPVALLLPADLLAAAAPAPALPRNNSLGHFPLDRSVAAPQAIARAASLLAQAQRPVVV
FT                   AGGGVHISDASAAMAALQETAHLPVATTVMGKGAVDERHPLSIGVVGSNMGPNGPTRFQ
FT                   RRLIAEADVVLLVGNRTNQNGTDSWQLYPKNAQYIHIDVDGLEVGRNYEALRLVGDARL
FT                   TLEALTAALAGQDLAARRQARAGVEQAIALGHEKHLEDSAAVRLSDASPIRPERIMHEL
FT                   QQQLDEQSIVVADASYSSIWITHFLTALRPGMRFLTPRGLAGLGWGFPMAMGAKLANPA
FT                   AEVYALVGDGGFGHVWSELETAARMGVKVTLIVINNGILGFQKHAENVKFGAHTSAVAF
FT                   APVNHTAIARACGCTGIRVEDPAQLADALAQARAASGSALIEVICDENAFPPITFFTPD
FT                   AGVQA"
FT   misc_feature    complement(99507..101108)
FT                   /note="HMMPfam hit to PF00205, Thiamine pyrophosphate
FT                   enzyme, central domain"
FT   misc_feature    complement(99780..99839)
FT                   /note="ScanRegExp hit to PS00187, Thiamine pyrophosphate
FT                   enzymes signature."
FT   CDS_pept        101271..102005
FT                   /transl_table=11
FT                   /locus_tag="BP0774"
FT                   /product="probable GntR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator Pa5525 TR:Q9HT48 (EMBL:AE004965)
FT                   (246 aa) fasta scores: E(): 8.4e-20, 37.069% id in 232 aa,
FT                   and to Rhizobium loti probable transcriptional regulator
FT                   Mlr1038 TR:Q98LF9 (EMBL:AP002996) (226 aa) fasta scores:
FT                   E(): 1e-19, 34.483% id in 203 aa"
FT                   /db_xref="GOA:Q7VZV7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZV7"
FT                   /protein_id="CAE41080.1"
FT                   /translation="MATLANRPLFAPIPPSMNMPLAPMARENIAAVIYRQLKQLLMMGE
FT                   LKPGEILTLRMLTERLGVSQTPVREALLQLVSERALAMSRGKSVSVPAPTREKLQELRD
FT                   IRLTLEVLATERATPRISDAEIKTLERLHREMVRYKNSEQREGVLKTNYEFHFTLYNAS
FT                   GMPDLVAIIEGLWAQTGPSLTYLYQKPFAHLYDAHPHLPLIEALRRHDVEAAVAAIRRD
FT                   VAGYGAALMERLPAEAGQPAGG"
FT   misc_feature    101367..101543
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family"
FT   misc_feature    101424..101489
FT                   /note="Predicted helix-turn-helix motif with score 1003
FT                   (+2.60 SD) at aa 34-55, sequence LTLRMLTERLGVSQTPVREALL"
FT   CDS_pept        102322..103344
FT                   /transl_table=11
FT                   /locus_tag="BP0775"
FT                   /product="hypothetical protein"
FT                   /note="Similar to the C-terminal region of Serratia
FT                   marcescens extracellular serine protease precursor
FT                   SW:PRTS_SERMA (P09489) (1045 aa) fasta scores: E():
FT                   1.2e-19, 30.435% id in 276 aa, and to Rhizobium loti serine
FT                   proteinase Mlr1935 TR:Q98JH8 (EMBL:AP002998) (1213 aa)
FT                   fasta scores: E(): 1.9e-29, 35.275% id in 309 aa. Also
FT                   similar to the C-terminal regions of BP1661 (43.344%
FT                   identity in 323 aa overlap) and BP1110 (42.722% identity in
FT                   316 aa overlap)"
FT                   /db_xref="GOA:Q7VZV6"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZV6"
FT                   /protein_id="CAE41081.1"
FT                   /translation="MSLHPVVCLDRSRRGPGDFPLLSMSAVAMRRGVSALLGVAGTLAL
FT                   AAPAWAQARQEAASAAHPTWMAAAGNWQVLEGGPGVARVKQRTTGVYAGSEHALGAGLR
FT                   LGGVLGLTRSTARFDDLYAKGHVNSYSLALYGARTVAAGAGDFNAVAGAAYTWHDMDTR
FT                   RHFHWAGTSQTLTADTHGSTFQAFGELGYRWRASARVQIEPFAALAWRDVRTRAFVESG
FT                   GWAAISAGPSRLTQTTTTLGVRGEAGYMLGPAPGKLRLTLGWRRAFGDVDPQATLVLDG
FT                   GNALAATGAPIARDAALAGLGAELALSRSAAIGLAYIGQYSGGNREHTGSLSLRWLFGA
FT                   "
FT   CDS_pept        complement(103360..104070)
FT                   /transl_table=11
FT                   /locus_tag="BP0776"
FT                   /product="probable GntR-family transcriptional regulator"
FT                   /note="Similar to Chelatobacter heintzii nta operon
FT                   transcriptional regulator NtaR or NmoR SW:NTRA_CHEHE
FT                   (P54988) (210 aa) fasta scores: E(): 5.8e-21, 40.476% id in
FT                   210 aa, and to EDTA-degrading bacterium BNC1 EmoR TR:Q9F9T1
FT                   (EMBL:AF176664) (207 aa) fasta scores: E(): 7.5e-20,
FT                   37.255% id in 204 aa"
FT                   /db_xref="GOA:Q7VZV5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZV5"
FT                   /protein_id="CAE41082.1"
FT                   /translation="MYKTTTEPAEKGRRAFSQVLEKLREMVISYEIKPGERLNEVALAE
FT                   RLGVSRTPVREALHFLARDGFLAEAGRGYVRRPLNLKEMIDLYETREVLEVACLQLAAG
FT                   RATPQRLDALEAFLAESRAKSPDLPVTELVSLDETFHHMLAEMSGNHELQRILHNVNER
FT                   IRFIRWINMERIGRDKTQAEHAAILAALRAGDIATAQQNLRSHISKRTEQIKECIAQGL
FT                   AHIYLDDDETSPGA"
FT   misc_feature    complement(103876..104016)
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family"
FT   misc_feature    complement(103888..103962)
FT                   /note="ScanRegExp hit to PS00043, Bacterial regulatory
FT                   proteins, gntR family signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   misc_feature    complement(103894..103959)
FT                   /note="Predicted helix-turn-helix motif with score 1086
FT                   (+2.89 SD) at aa 42-63, sequence LNEVALAERLGVSRTPVREALH"
FT   CDS_pept        complement(104227..105234)
FT                   /transl_table=11
FT                   /locus_tag="BP0777"
FT                   /product="probable Zinc-binding dehydrogenase"
FT                   /note="Similar to Rhodopseudomonas palustris putative
FT                   NADPH:quinone oxidoreductase BadC TR:O07459 (EMBL:U75363)
FT                   (339 aa) fasta scores: E(): 5.9e-22, 34.393% id in 346 aa,
FT                   and to Halobacterium sp alcohol dehydrogenase Adh4 or
FT                   Vng1821G TR:Q9HP38 (EMBL:AE005083) (347 aa) fasta scores:
FT                   E(): 5.3e-29, 43.875% id in 351 aa"
FT                   /db_xref="GOA:Q7U364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7U364"
FT                   /protein_id="CAE41083.1"
FT                   /translation="MKAVVIHGHGGPEVLQYDTAFPDPKAGEGDVILRVKATSINYHDV
FT                   FTRRGMPGIKLDFPVIMGLDVAGEIVEVGPGVQGWKAGDRVLVDPINRAEGGLMGETVH
FT                   GGLAELCKAREHQLIRIPDGVSYEQAAALPVAFGTAYRMMHTIGQVQAGEKVLVLGASG
FT                   GVGVGCVMLAKIAGAQVIACASSEAKMQRLRELGADHVINYADTDFAKAIYELYGKPHR
FT                   RKFDGGVDVAVNFTGGDTWVKSMRCLRRGGRLLTCGATAGYDPQTDLRFIWTFELNIRG
FT                   SNGWMREDLDALLGLVQSGKMQVPIDRVLSLQDAGEALRLIEDREVMGKVVVTP"
FT   misc_feature    complement(104230..105195)
FT                   /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenases"
FT   CDS_pept        complement(105275..106807)
FT                   /transl_table=11
FT                   /locus_tag="BP0778"
FT                   /product="putative acetyl-CoA synthetase"
FT                   /note="Similar to Amycolatopsis spHR167 feruloyl-CoA
FT                   synthetase Fcs TR:Q9EY88 (EMBL:AJ290449) (491 aa) fasta
FT                   scores: E(): 2.9e-35, 33.758% id in 471 aa, and to
FT                   Rhizobium loti probable acid-CoA ligase mlr1843 TR:Q98JP7
FT                   (EMBL:AP002998) (495 aa) fasta scores: E(): 1.3e-35,
FT                   31.911% id in 492 aa"
FT                   /db_xref="GOA:Q7VZV4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZV4"
FT                   /protein_id="CAE41084.1"
FT                   /translation="MRAAPANLGALFSPARDPAAIALIDLGGESGPREYTYAELDAQAD
FT                   GVARGLPAGARAAILSANRMEFLAAYLGIMRAGLIAVPVNYRLPPDSIDFILRDSGAAL
FT                   VFCDGPRRDAYTVALPSVEFGAGGAGGYARFLDPGPCEAARPADDQPALFLYTSGSTGR
FT                   PKGVKISHAGYLWTVRQRTASTDYGGHCFLVAAPLYHMNALNTIKLALAGQGRLVLMPQ
FT                   FSPAGYLDAIERYRCTWLTAIPTMIALLARETGALAGADLASVAMVRLGSEPLTQRIAD
FT                   SARAMFPRAAFGNGYGATETGALVFGPHPQGLAQPVLSVGYPHPAVQLRLADGADLDAA
FT                   TGVLQVRSPALMLGYHGLPEQTAAAMTHDGFYITGDVMRRDEHGFHYFIGRADDMFVCG
FT                   GENIYPGEVEKMLERHPAIAQACIVPLADPLKGMKPVALVVSRPDATLSEQEVKDYALA
FT                   HGPAYQHPRAVRFVDEMPISSTGKVNRKAALLAAELIAAASPLTQGGHALRR"
FT   misc_feature    complement(105539..106702)
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme"
FT   misc_feature    complement(106313..106348)
FT                   /note="ScanRegExp hit to PS00455, Putative AMP-binding
FT                   domain signature. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   CDS_pept        complement(106804..107922)
FT                   /transl_table=11
FT                   /locus_tag="BP0779"
FT                   /product="conserved hypothetical protein"
FT                   /note="Weakly similar to Vibrio cholerae hypothetical
FT                   protein Vca0936 TR:Q9KL13 (EMBL:AE004420) (312 aa) fasta
FT                   scores: E(): 0.077, 25.258% id in 194 aa. Similar to
FT                   BP2869, 43.785% identity (43.909% ungapped) in 354 aa
FT                   overlap."
FT                   /db_xref="InterPro:IPR021259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZV3"
FT                   /protein_id="CAE41085.1"
FT                   /translation="MRSKENAMEFHQCYALDYHRARDKFRAAAAAAGASLTQYLHEGRT
FT                   GPDGRPLHTDVARFGRADAPRRLLAISGTHGLEGFFGSAAQIGWMLGDGPASLDPDVAV
FT                   IMVHAINPWGFAHLSRTTENNVDLNRNFIDHGQPHPANPDYAILHPQLLREDWSSAAVA
FT                   AAQQAMEDFTARHGEDRLYDTLARGQYSHPDGLNYGGTAREWSNLTLERIVRDHLAGAR
FT                   KVALIDWHTGIGGYGEPFFLCFNEEGGPLHELAARWWGRDRIVGQRPHGKARPNYQGLL
FT                   FHGVQALLGDVPMCGAVIEFGTRGWHMRRLLRLDLWLKFKADPASERYAMLRADLLDSF
FT                   CPYDQVWREGTLRHAQEITRQAVAGLAAWTET"
FT   CDS_pept        complement(107919..108701)
FT                   /transl_table=11
FT                   /locus_tag="BP0780"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pasteurella multocida hypothetical
FT                   protein Pm1265 TR:Q9CLG9 (EMBL:AE006165) (254 aa) fasta
FT                   scores: E(): 1.9e-27, 35.628% id in 247 aa, and to
FT                   Agrobacterium tumefaciens Agr_l_128gMp TR:AAK88848
FT                   (EMBL:AE008228) (267 aa) fasta scores: E(): 4.4e-29,
FT                   36.052% id in 233 aa"
FT                   /db_xref="GOA:Q7VZV2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZV2"
FT                   /protein_id="CAE41086.1"
FT                   /translation="MSKSVKSFLYPLITGVVLVILWFASIRIFSVPNYLLPTPEAVLNT
FT                   LRIGYVEGQYWPHFLFTLQSTVYGYLIGCGMALVVGTVLAESETFEQFIYPYIIALQST
FT                   PKVAIAPLLLVWFGFGMASKVVMVALMSFFPMFINTVVGIRQANPAMLDLMKAFKASRS
FT                   HVFFHVKLPAASGHIFAGLQISVVLSLIGAVVSEFISSSQGLGYLIQSASVNMDVATMF
FT                   ACLFSLVVIGLTGTNLIRFLHRKLVFWEQSTTATVQPE"
FT   misc_feature    complement(join(107979..108044,108105..108170,
FT                   108270..108326,108357..108422,108459..108524,
FT                   108615..108680))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP0780 by TMHMM2.0 at aa 7-29, 59-81, 93-115, 125-144,
FT                   177-199 and 219-241"
FT   CDS_pept        complement(108713..109576)
FT                   /transl_table=11
FT                   /locus_tag="BP0781"
FT                   /product="probable ABC transporter, ATP-binding component"
FT                   /note="Similar to Arthrobacter keyseri transporter ATPase
FT                   PtrA TR:Q9AGL2 (EMBL:AF331043) (275 aa) fasta scores: E():
FT                   2.6e-35, 48.963% id in 241 aa, and to Pseudomonas
FT                   aeruginosa probable ATP-binding component of ABC
FT                   transporter Pa2294 TR:Q9I1I1 (EMBL:AE004655) (284 aa) fasta
FT                   scores: E(): 1.1e-36, 46.457% id in 254 aa"
FT                   /db_xref="GOA:Q7VZV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZV1"
FT                   /protein_id="CAE41087.1"
FT                   /translation="MTSLNLSMIEGGRPASRAAAATLDAVAGAGDGAALLTANNLSVVY
FT                   RTSKGPITAVDNLSLQLGAGEFVSVLGPSGCGKSTLIKVFSGLLKPSGGKALLNGTPID
FT                   EPRGDVGIVFQQPTLLPWKTVLDNVLVPIRALGMNVAEGRAKAMELLRLVGLEKFASNY
FT                   PSELSGGMQQRVGIARGLIHDPALLLMDEPFSALDTMTRDRMSIELQRIWMATRKSALF
FT                   ITHSIAEAVFLSDRIVVMSARPGRIIREVTVNLPRPRTLATLTDPEFTRLCGELRELFD
FT                   QLVQFD"
FT   misc_feature    complement(108848..109384)
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    complement(109034..109078)
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   misc_feature    complement(109340..109363)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        complement(109595..110692)
FT                   /transl_table=11
FT                   /locus_tag="BP0782"
FT                   /product="putative exported protein"
FT                   /note="Similar to Agrobacterium tumefaciens Agr_l_3061p
FT                   TR:AAK90103 (EMBL:AE008354) (316 aa) fasta scores: E():
FT                   3.6e-08, 27.181% id in 298 aa, and to Rhizobium loti
FT                   Mll8573 protein Mll8573 TR:Q982M7 (EMBL:AP003014) (342 aa)
FT                   fasta scores: E(): 7.9e-11, 26.796% id in 362 aa. Also
FT                   similar to BP2866, 46.197% identity (47.536% ungapped) in
FT                   355 aa overlap."
FT                   /db_xref="GOA:Q7VZV0"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZV0"
FT                   /protein_id="CAE41088.1"
FT                   /translation="MIGIEHLKRHARRGILAGAAAMALTAAGGAANAAEKVTFAYGINI
FT                   SLSNAPTLMAIGMGYFKEAGLDVQATFFQGAAVMLPQVTQKHITFGWITPDPLVISRQP
FT                   GRDALPVKMFYNGIYLSPFEVVVTKSSPARSLADLKGKKIGVGAMSWGNLAVTKAMMKK
FT                   LGLELQRDYEFVPVGVGATAFRALADDKVQALNLFDTFHVQMEQMGADLRRLPMDQSYR
FT                   ELFSSGWIAHQDTLRERPELVVAFARAAAKGVVACNANPQACVQNFWKLYPATKPADGT
FT                   EEKKLADAVQILKVRLATMLPEQGPQQMGYYTEQSWHDYVDVLHEGGQLSTKDVDVKPL
FT                   YTNQFVKDINDFDAAAVVSAAKQLK"
FT   misc_feature    complement(110594..110692)
FT                   /note="Signal peptide predicted for BP0782 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.992 between residues 33 and 34"
FT   CDS_pept        complement(110761..111687)
FT                   /transl_table=11
FT                   /locus_tag="BP0783"
FT                   /product="putative dioxygenase"
FT                   /note="Similar to Rhizobium loti Mlr0372 protein Mlr0372
FT                   TR:Q98MZ7 (EMBL:AP002994) (296 aa) fasta scores: E():
FT                   0.00021, 24.510% id in 306 aa, and to Agrobacterium
FT                   tumefaciens Agr_c_2627p TR:AAK87216 (EMBL:AE008068) (292
FT                   aa) fasta scores: E(): 0.022, 28.525% id in 305 aa"
FT                   /db_xref="GOA:Q7VZU9"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZU9"
FT                   /protein_id="CAE41089.1"
FT                   /translation="MTRTEPDQPMGAAPAGLDHVGLYAHDMDAAAAMYQRLGFTLTPLS
FT                   QHSGTHAVTREVVKAGIANRCAMLGHGYIELVAVVDPALDLRGIPEGLARYAGMHIVAF
FT                   DTPDPGQRIAALREAGFAAEPGVLQRYIDTADGPRLARFSQVRTPRQAMPEGLILTLRH
FT                   ETPELLWQARYMDHPNGARALAAAIVAVEDVDAAAARYARYLGVPAERRGGEAWFTLRS
FT                   GRLALVDQAALAARLPGSAAPTLPFPAALAVEVDNLSRTAAVLDDNQVAYRRAGGQLTV
FT                   AARDAGGAAVIFCANAEAAFAGAPEEP"
FT   misc_feature    complement(110800..111120)
FT                   /note="HMMPfam hit to PF00903, Glyoxalase/Bleomycin
FT                   resistance protein/Dioxygenase superfamily"
FT   misc_feature    complement(111253..111621)
FT                   /note="HMMPfam hit to PF00903, Glyoxalase/Bleomycin
FT                   resistance protein/Dioxygenase superfamily"
FT   CDS_pept        complement(111722..113416)
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="BP0784"
FT                   /product="putative acetolactate synthase large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="Similar to Escherichia coli acetolactate synthase
FT                   isozyme III large subunit IlvI or B0077 SW:ILVI_ECOLI
FT                   (P00893) (574 aa) fasta scores: E(): 1e-42, 30.515% id in
FT                   544 aa, and to Methanococcus aeolicus acetohydroxyacid
FT                   synthase large subunit IlvB TR:O08353 (EMBL:U35458) (599
FT                   aa) fasta scores: E(): 5.4e-59, 34.581% id in 561 aa"
FT                   /db_xref="GOA:Q7VZU8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZU8"
FT                   /protein_id="CAE41090.1"
FT                   /translation="MTQLNGAEAMVRMLQLNGVKHIFGLCGDTSLPFCDALQRLDHGME
FT                   HILTRDERSAAYMADAYARVTGKVGVCEGPSGGGATYLLPGLVEANESSVAVLGITSDV
FT                   SVGSRGKYPLTELDQEALYRPLTKWNTTIDRADQIPGAVRAAFRAMTTGRPGTAHLCLP
FT                   YDVQKHEVDPADVWAQPGHDRFPAMRFAPDPAAIEQAAARLVGARAPVILCGGGVVISG
FT                   ACAALEELAVTLNAPVCTTVSGQGSLADTHPLNAGVVGSNGGILATRAVLADADVVLLI
FT                   GCRAGSTSTEHWRFPSREVPILHIDSDPMVIAANYRTDVAMVGDALLALQALNREVHAR
FT                   IDARPTDAVDGKAVAAKAKGAKLAALQPLAASLDAPIRPERVVDALNRLLPAESVVVAD
FT                   PGTPCPYFSAYFEASKPGRHFITNRAHGALGFSMAAGMGAAIGRPSAKVVSVMGDGSFG
FT                   FTVGEMETIVRRKVPLLMIVLSNSVYGWIKASQKAGYQERYFSVDFNRTDHARVAEAYG
FT                   VKAWRVEDPRELDGVLKAAIEYGGPALVDIIVQPLQEAAAPVSQWMG"
FT   misc_feature    complement(111776..113377)
FT                   /note="HMMPfam hit to PF00205, Thiamine pyrophosphate
FT                   enzyme, central domain"
FT   misc_feature    complement(112049..112108)
FT                   /note="ScanRegExp hit to PS00187, Thiamine pyrophosphate
FT                   enzymes signature. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   CDS_pept        complement(113616..114551)
FT                   /transl_table=11
FT                   /locus_tag="BP0785"
FT                   /product="putative mechanosensitive channel protein"
FT                   /note="Similar to Rhizobium loti probable integral membrane
FT                   protein Mlr0973 TR:Q98LL9 (EMBL:AP002996) (410 aa) fasta
FT                   scores: E(): 1.5e-13, 28.019% id in 207 aa, and to
FT                   Rhizobium meliloti conserved hypothetical membrane protein
FT                   Smb20863 TR:CAC49557 (EMBL:AL603646) (343 aa) fasta scores:
FT                   E(): 6.1e-13, 26.054% id in 261 aa"
FT                   /db_xref="GOA:Q7VZU7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZU7"
FT                   /protein_id="CAE41091.1"
FT                   /translation="MIPGSRIAWLLWPTVLCSLSVVVYVFHAYLFQRYLPGSNPESFRR
FT                   FSAAAAFYAFAWLLARMAAAALTRKAKKKRKTPRLLRELVSATLFAIATVATIGVFLGQ
FT                   SAGGILASSGLIIAILGFAIRNVLADVLSGIAIGVEAPYRIGDWVGFDATIRGRVTEIG
FT                   WRTTRILTPNDTYMILPNSQISRQMLTNYSAPRKQYQGELEIVLSHDISISDGKQLLFD
FT                   AALSTSPAESLAPGQKPRVRATAYTAEGVTYKIKYWVPQFSDSTDCRDAILVAIDDAIR
FT                   SQGLALPVATPPRPQAIALRQPDTPDNPGA"
FT   misc_feature    complement(113688..114308)
FT                   /note="HMMPfam hit to PF00924, Mechanosensitive ion
FT                   channel"
FT   misc_feature    complement(join(114168..114233,114246..114311,
FT                   114348..114413,114459..114524))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BP0785 by TMHMM2.0 at aa 9-31, 46-68, 80-102 and 106-128"
FT   CDS_pept        complement(114657..115607)
FT                   /transl_table=11
FT                   /locus_tag="BP0786"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA3"
FT                   /protein_id="CAE41092.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   repeat_region   114657..114688
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(114657..115709)
FT   misc_feature    complement(114693..115226)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(115284..115349)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   repeat_region   complement(115678..115709)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(115689..116300)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0787"
FT                   /product="N-terminal region of a putative membrane protein
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. The C-terminal region of this CDS is
FT                   BP2450. Similar to Escherichia coli hypothetical protein
FT                   YhfK or B3358 SW:YHFK_ECOLI (P45537) (700 aa) fasta scores:
FT                   E(): 0.036, 24.365% id in 197 aa, and to Pyrococcus abyssi
FT                   hypothetical 47.1 kDa protein Pab0655 TR:Q9V021
FT                   (EMBL:AJ248286) (431 aa) fasta scores: E(): 1.5, 24.684% id
FT                   in 158 aa"
FT                   /db_xref="PSEUDO:CAE41093.1"
FT   misc_feature    complement(join(115800..115865,115911..115976,
FT                   115998..116063,116199..116264))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BP0787 by TMHMM2.0 at aa 21-43, 88-110, 117-139 and
FT                   154-176"
FT   CDS_pept        116771..118486
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="BP0789"
FT                   /product="acetolactate synthase large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="Similar to Escherichia coli acetolactate synthase
FT                   isozyme III large subunit IlvI or B0077 SW:ILVI_ECOLI
FT                   (P00893) (574 aa) fasta scores: E(): 4.5e-129, 56.098% id
FT                   in 574 aa, and to Neisseria meningitidis acetolactate
FT                   synthase III, large subunit Nmb1577 TR:Q9JYI0
FT                   (EMBL:AE002508) (575 aa) fasta scores: E(): 2.2e-152,
FT                   64.311% id in 566 aa"
FT                   /db_xref="GOA:Q7VZU6"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZU6"
FT                   /protein_id="CAE41094.1"
FT                   /translation="MELNGADIVVRCLAEEGVEHVFGYPGGAVLYIYDAIFKQDKFQHI
FT                   LVRHEQAAVHAADAYSRASQKVGVCLVTSGPGVTNAVTGIATAYMDSIPMVIISGQVPT
FT                   AAIGEDAFQECDTVGITRPCVKHNFLVRDVKDLAETMRRAFFIARTGRPGPVLVDIPKD
FT                   ITVAQCKYAPPKGEISMRSYAPVNKGHQGQIKKAVQMLLHAERPMIYTGGGVILSDAAE
FT                   ALRHLVDQTGAPCTNTLMGLGAMPATDHRFLGMPGMHGTYEANMAMQHCDVLLAIGARF
FT                   DDRVIGNPRHFAQNARKIIHIDIDPSSISKRVRVDVPIVGNVKDVLADLSAQYDLARAD
FT                   AKPAPIEKWWQQIEAWRGKECLKYAGSDEVIKPQFVVEKLWEVTGGDAFVTSDVGQHQM
FT                   WAAQYYKFNKPRRWINSGGLGTMGVGLPYAMGVQMANPGADIAVITGEASIQMNIQELS
FT                   TCHQYHLTPKIICLNNRFLGMVRQWQQIDYGSRYSESYMDSLPDFVKVAEAYGHVGLRI
FT                   ERPADVEPALREAFKKHKDRLVFLDFITDRTENVWPMVKAGRGLTEMLLGSEDL"
FT   misc_feature    116807..118399
FT                   /note="HMMPfam hit to PF00205, Thiamine pyrophosphate
FT                   enzyme, central domain"
FT   CDS_pept        118497..118988
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /gene_synonym="brnP"
FT                   /locus_tag="BP0790"
FT                   /product="acetolactate synthase small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="Similar to Escherichia coli acetolactate synthase
FT                   isozyme III small subunit IlvH or BrnP or B0078
FT                   SW:ILVH_ECOLI (P00894) (163 aa) fasta scores: E(): 3.7e-31,
FT                   55.828% id in 163 aa, and to Neisseria meningitidis
FT                   acetolactate synthase isozyme III small subunit IlvH or
FT                   Nma1765 or Nmb1576 TR:Q9JRF4 (EMBL:AL162757) (163 aa) fasta
FT                   scores: E(): 8.5e-38, 66.871% id in 163 aa"
FT                   /db_xref="GOA:Q7VZU5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZU5"
FT                   /protein_id="CAE41095.1"
FT                   /translation="MKHVISVLMENEPGALSRVVGLFSARGYNIETLTVAPTEDATLSR
FT                   LTVVTVGSDEVIEQITKHLNRLVDVVKVVDLTEGAHIERELMLIKVRAVGKEREEMKRM
FT                   ADIFRGRIIDVTDKSYTIELTGVQEKIQAFIEALDRSAILETVRTGVSGIGRGERILKI
FT                   "
FT   misc_feature    118497..118610
FT                   /note="ScanRegExp hit to PS00430, TonB-dependent receptor
FT                   proteins signature 1."
FT   misc_feature    118503..118724
FT                   /note="HMMPfam hit to PF01842, ACT domain"
FT   CDS_pept        119061..120077
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="BP0791"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="Similar to Zymomonas mobilis ketol-acid
FT                   reductoisomerase IlvC SW:ILVC_ZYMMO (Q9X5F8) (339 aa) fasta
FT                   scores: E(): 3e-80, 62.242% id in 339 aa, and to Neisseria
FT                   meningitidis ketol-acid reductoisomerase IlvC or Nmb1574
FT                   SW:ILVC_NEIMB (Q9JYI2) (337 aa) fasta scores: E(): 1.7e-93,
FT                   73.373% id in 338 aa"
FT                   /db_xref="GOA:Q7VZU4"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZU4"
FT                   /protein_id="CAE41096.1"
FT                   /translation="MKVFYDKDCDLSLVKGKTVAIIGYGSQGHAHALNLHDSGVKVVVG
FT                   LRKGGASWNKAANAGLEVAEVAEAVKRADIVMMLLPDENIAAVYRDEVHANIKAGAALA
FT                   FAHGFNVHYGQVVPREDIDVIMAAPKAPGHTVRSTYSQGGGVPHLIAVYQDKSGSARDV
FT                   ALSYASANGGGRAGIIETNFREETETDLFGEQAVLCGGTVELIKAGFDTLVEAGYAPEM
FT                   AYFECLHELKLIVDLIYEGGIANMNYSISNNAEFGEYETGPKVVTDATRQAMRECLTAI
FT                   QTGEYAKKFILENAAGAPTLTSRRRINAESQIEQVGGKLRAMMPWIAANKLVDKAKN"
FT   misc_feature    119067..120041
FT                   /note="HMMPfam hit to PF01450, Acetohydroxy acid
FT                   isomeroreductase, catalytic domain"
FT   CDS_pept        120245..121024
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="BP0792"
FT                   /product="putative CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase protein"
FT                   /EC_number="2.7.8.8"
FT                   /note="Similar to Agrobacterium sp31749 phosphatidylserine
FT                   synthase TR:AAL01116 (EMBL:AF410774) (274 aa) fasta scores:
FT                   E(): 2.3e-21, 40.930% id in 215 aa, and to Pseudomonas
FT                   aeruginosa phosphatidylserine synthase PssA or Pa4693
FT                   TR:Q9HVA3 (EMBL:AE004883) (271 aa) fasta scores: E():
FT                   2.5e-47, 61.778% id in 225 aa"
FT                   /db_xref="GOA:Q7VZU3"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZU3"
FT                   /protein_id="CAE41097.1"
FT                   /translation="MPNFSMRDPENRHRSIYLLPNAFTTAALFAGFYAVVQAMNDRFET
FT                   AAIAIFVAMVLDGMDGRVARLTNTQSAFGEQYDSLSDMTSFGVAPALVIYEWILQDLGR
FT                   WGWLAAFVYVAGAALRLARFNTNIAVVDKRFFQGLPSPAAAALVAGFVWLAIDNKLPIH
FT                   DSIMAWVAFVLTMYAGVAMVSNASFFSGKNFALGRSVPFWGILLVVAVFVFVSSDPPVV
FT                   LFGLFVLYGLSGWVVMAWRWNRARRLQQERRSGHHSP"
FT   misc_feature    join(120293..120361,120557..120610,120647..120715,
FT                   120743..120811,120824..120892,120905..120973)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP0792 by TMHMM2.0 at aa 17-39, 105-122, 135-157, 167-189,
FT                   194-216 and 221-243"
FT   misc_feature    120422..120490
FT                   /note="ScanRegExp hit to PS00379, CDP-alcohol
FT                   phosphatidyltransferases signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   CDS_pept        complement(121043..121570)
FT                   /transl_table=11
FT                   /locus_tag="BP0793"
FT                   /product="putative lipoprotein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZU2"
FT                   /protein_id="CAE41098.1"
FT                   /translation="MPPIRRPIGRALRLAGAGMLLAALAACANLNQVPPGTPLADVQAQ
FT                   FGAPNFACDLPNGGQRVIWTQQPYGQFAWGANVGPDGRVDRVVEVLTDEHFKVLGTGTW
FT                   TADQVRCEFGPPAEIKQVGLPSVRQVVWSYRYRESRVWNSLMYVYMGREGDRVTRFHPG
FT                   PDPMYDEDWRWH"
FT   misc_feature    complement(121490..121522)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        121864..122133
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /gene_synonym="secC"
FT                   /locus_tag="BP0794"
FT                   /product="30S ribosomal protein S15"
FT                   /note="Similar to Escherichia coli 30S ribosomal protein
FT                   S15 RpsO or SecC or B3165 SW:RS15_ECOLI (P02371) (88 aa)
FT                   fasta scores: E(): 7.3e-18, 69.136% id in 81 aa, and to
FT                   Photorhabdus luminescens 30S ribosomal protein S15 RpsO or
FT                   RprA SW:RS15_PHOLU (P41120) (88 aa) fasta scores: E():
FT                   4.3e-19, 67.045% id in 88 aa"
FT                   /db_xref="GOA:Q7VZU1"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZU1"
FT                   /protein_id="CAE41099.1"
FT                   /translation="MSVADIKKSEIVAQFQRAQGDTGSPEVQVALLTARINELTGHFKE
FT                   HMKDHHSRRGLLRMVSRRRKLLDYLKGRNPDSYRALIEKLGLRK"
FT   misc_feature    121930..122127
FT                   /note="HMMPfam hit to PF00312, Ribosomal protein S15"
FT   misc_feature    121978..122070
FT                   /note="ScanRegExp hit to PS00362, Ribosomal protein S15
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        122224..124383
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="BP0795"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="Similar to Escherichia coli polyribonucleotide
FT                   nucleotidyltransferase Pnp or B3164 SW:PNP_ECOLI (P05055)
FT                   (711 aa) fasta scores: E(): 2.2e-165, 62.691% id in 721 aa,
FT                   and to Neisseria meningitidis putative polyribonucleotide
FT                   nucleotidyltransferase Pnp or Nma0969 TR:Q9JV72
FT                   (EMBL:AL162754) (706 aa) fasta scores: E(): 1.9e-172,
FT                   65.260% id in 711 aa"
FT                   /db_xref="GOA:Q7VZU0"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZU0"
FT                   /protein_id="CAE41100.1"
FT                   /translation="MFNKVTKTFQYGQHSVVLETGEMARQASGAVLVSVEDTVVLATVV
FT                   AAKKAKAGQDFFPLTVDYIEKTYAAGRIPGGFFKREGKPSEKETLTSRLIDRPLRPLFP
FT                   EGFYNDVQVVIHTLSVNPDIDPDIPAMIGASAALAISGIPFNGPIGAARVGYVDGQYVL
FT                   NPTATQLKSSKMDLVVAGTENAVLMVESEAKQLSEEIMLGGVVFGHEQMQAAINAIHDL
FT                   VRDAGKPDWDWQPAPKNEALIAAVSAAAQEGLNAAYQIREKQARTTKLREVYAAVQAAM
FT                   AEQAAQAGQPAPDSVGVDNILFDLEARIVRSQILNGEPRIDGRDTRTVRPISIRLGVLP
FT                   RAHGSALFTRGETQALVVATLGTKQDEQIIDALMGEYRDRFMLHYNMPPFATGETGRIG
FT                   VPKRREIGHGRLAKRALLPLLPAPEDFQYTIRLVSEITESNGSSSMASVCGGSLAMMDA
FT                   GVPTNDHVAGVAMGLILDSGKFAVLTDILGDEDHLGDMDFKVAGTETGITALQMDIKIQ
FT                   GITKEIMQVALAQAREGRLHILGKMRDALEGSRTELSAFAPRMLTIKINPEKIRDVIGK
FT                   GGATIRALTEETGTQIDISDDGTIVIASVDETQAKEAQRRIVELTADVEVGQIYDGSVL
FT                   RLLDFGAIVQVLPGRDGLLHISEIANYRIANINDVLKVGQPVRVKVIEADDKGRLRLSI
FT                   KAIGGIEQQQSGTAEPAAQSEPQAE"
FT   misc_feature    122233..122856
FT                   /note="HMMPfam hit to PF01138, 3' exoribonuclease family"
FT   misc_feature    123181..123825
FT                   /note="HMMPfam hit to PF01138, 3' exoribonuclease family"
FT   misc_feature    123907..124035
FT                   /note="HMMPfam hit to PF00013, KH domain"
FT   misc_feature    124090..124308
FT                   /note="HMMPfam hit to PF00575, S1 RNA binding domain"
FT   CDS_pept        124504..125223
FT                   /transl_table=11
FT                   /locus_tag="BP0796"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa3069 TR:Q9HZD9 (EMBL:AE004731) (205 aa) fasta
FT                   scores: E(): 3.5e-40, 54.634% id in 205 aa, and to
FT                   Pseudomonas sp hypothetical 28.9 kDa protein Orf58
FT                   TR:AAK50290 (EMBL:U66917) (257 aa) fasta scores: E():
FT                   1.1e-35, 45.852% id in 229 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZT9"
FT                   /protein_id="CAE41101.1"
FT                   /translation="MTSRRLAALSGWAASVLLAGCIAPGGSGGPRGESMSADQFMQTDF
FT                   NRTVTLEIRDNLASLDTLLDKLYRRNPREWRKSGVADQAAAVARVKRLIEERRPPAGLA
FT                   GLRDIQVLAVSLDPAYGGDRVAAFVYGLADTLIAAHNDKTRIYLSDVLDGQRIYNAARN
FT                   VEAAAWLLASRRTAQGEPLLLANEMSAAATNLSFEREFGAIIGRLDLIANLLGENSRRI
FT                   GINYAQGLLFFNFLPVR"
FT   misc_feature    124534..124566
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(125220..126170)
FT                   /transl_table=11
FT                   /locus_tag="BP0797"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q79H25"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H25"
FT                   /protein_id="CAE41102.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT"
FT   repeat_region   125220..125251
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(125220..126272)
FT   misc_feature    complement(125256..125789)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(125847..125912)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   repeat_region   complement(126241..126272)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        126311..127528
FT                   /transl_table=11
FT                   /gene="tdcB"
FT                   /locus_tag="BP0798"
FT                   /product="threonine dehydratase catabolic"
FT                   /EC_number="4.3.1.19"
FT                   /note="Similar to Escherichia coli threonine dehydratase
FT                   catabolic TdcB or B3117 or Z4469 or Ecs3997 SW:THD2_ECOLI
FT                   (P05792) (329 aa) fasta scores: E(): 1.6e-41, 45.246% id in
FT                   305 aa, and to Caulobacter crescentus threonine dehydratase
FT                   Cc3635 TR:Q9A2D0 (EMBL:AE006022) (400 aa) fasta scores:
FT                   E(): 4.1e-72, 52.897% id in 397 aa"
FT                   /db_xref="GOA:Q7VZT8"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZT8"
FT                   /protein_id="CAE41103.1"
FT                   /translation="MIDLAAIQTARDILRGQVLNTPFTHSRTLSDILGAEIWLKFENLQ
FT                   FTASFKERGALNRMLNLTEAERAAGVIAVSAGNHAQGVAYHAQRMGVPAVIVMPRFTPT
FT                   VKVANTRRFGAEVVLAGDTFDDAKARGYELARERGLVMIHPYDDPAVIAGQGTVALEML
FT                   QARPDLDAIVVGIGGGGLIAGIATAAKAIKPDIEIIGVQTERFPSMYAAVKGVAMESGH
FT                   YTIAEGIAVKSPGTLTQEIVTRLVDHIELVNESDIEHAIVVLLEIEKTVVEGAGAAGLA
FT                   ALLRLQERRDERFRGKRLGLVLTGGNIDPLMLGELIERGMVRAGRLARIRVDLRDLPGA
FT                   LAQATKLIADAHANITEVHHQRAFTTLPVRNVEVDFVLQTRGHDHIQEVIAVLNAAGFA
FT                   ASNHDH"
FT   misc_feature    126350..127228
FT                   /note="HMMPfam hit to PF00291, Pyridoxal-phosphate
FT                   dependent enzyme"
FT   misc_feature    127292..127522
FT                   /note="HMMPfam hit to PF01842, ACT domain"
FT   CDS_pept        complement(127522..128133)
FT                   /transl_table=11
FT                   /locus_tag="BP0799"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Sphingomonas aromaticivorans hypothetical
FT                   21.4 kDa protein TR:O85864 (EMBL:AF079317) (196 aa) fasta
FT                   scores: E(): 0.0065, 28.571% id in 161 aa"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZT7"
FT                   /protein_id="CAE41104.1"
FT                   /translation="MPYLNLIPNPAPPFVVLDACVLMSGIARQLLLRVARTGVFQPVWT
FT                   ERIGEEWRRNAARLWDIPAAALAAQWEATNASFPRALEVDTQPYETGLRYSDPKDFHVI
FT                   AAGLARRARCGLPQAPATLVMTWNLKDFNRSELRRQGLDAFSPDHLLARWWQADPAALR
FT                   DALATVADDYVALGREPLPLAAILQRERLYRLRRLADADQ"
FT   tRNA            complement(128193..128277)
FT                   /note="tRNA Leu anticodon TAA, Cove score 79.53"
FT   CDS_pept        128767..129744
FT                   /transl_table=11
FT                   /locus_tag="BP0800"
FT                   /product="probable zinc-binding dehydrogenase"
FT                   /note="Similar to Rhizobium loti NADPH quinone
FT                   oxidoreductase Mll3767 TR:Q98FI0 (EMBL:AP003002) (326 aa)
FT                   fasta scores: E(): 3e-60, 57.669% id in 326 aa, and to
FT                   Rhizobium meliloti putative oxidoreductase protein Smc00034
FT                   TR:CAC45525 (EMBL:AL591785) (327 aa) fasta scores: E():
FT                   8.3e-58, 53.681% id in 326 aa"
FT                   /db_xref="GOA:Q7VZT6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZT6"
FT                   /protein_id="CAE41105.1"
FT                   /translation="MRAVEITRPGGPEVLVPTERSVPEPASGEVLIKVSAAGVNRPDVL
FT                   QRKGNYAPPPGASDLPGLEVAGEIVGGDAAAGGFAIGDKVCALVAGGGYAEYVVAPAPQ
FT                   CLPIPRGLTEIEAAGLPETYFTVWSNVFDRGRLAAGEALLVHGGASGIGTTAIQLARAM
FT                   GNKVYATVGSDERARAVEALGAALGINYKTQDYVKEVLDATGGAGVDVVLDMVAGEYIG
FT                   RNLKCLADDGRIVIIALLGGAHANVDCNQVLRRRLTITGSTLRPRPVEFKGEIARALRE
FT                   RVWPLLENGTLKPVVHATLPLEQAAAAHAMMEAGENIGKIILTV"
FT   misc_feature    128806..129741
FT                   /note="HMMPfam hit to PF00107, Zinc-binding dehydrogenases"
FT   CDS_pept        129888..130634
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /gene_synonym="tpi"
FT                   /locus_tag="BP0801"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="Similar to Escherichia coli triosephosphate
FT                   isomerase TpiA or Tpi or B3919 or Z5464 or Ecs4844
FT                   SW:TPIS_ECOLI (P04790) (255 aa) fasta scores: E(): 4.1e-37,
FT                   48.178% id in 247 aa, and to Pseudomonas aeruginosa
FT                   triosephosphate isomerase TpiA or Pa4748 SW:TPIS_PSEAE
FT                   (Q9HV51) (251 aa) fasta scores: E(): 3.4e-41, 53.846% id in
FT                   247 aa"
FT                   /db_xref="GOA:Q7VZT5"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZT5"
FT                   /protein_id="CAE41106.1"
FT                   /translation="MTTAENRARLVLGNWKMHGNLAENAALLAELRAADAAAHCEMGVC
FT                   VPFPYLAQTAAALQGSAIGWGAQDVSAHAKGAYTGEVAAPMLAEFGCRWVLVGHSERRT
FT                   LHAESDQLVADKARAALEAGLTPVVCVGESLQEREGGNTLGVIERQLEPVLALGRDALV
FT                   RMVLAYEPVWAIGTGRTASPEQAQEVHSAIRVALDGLQASQVRVLYGGSVKGANAASLF
FT                   AMPDIDGGLVGGASLVAEEFLRIAAA"
FT   misc_feature    129906..130631
FT                   /note="HMMPfam hit to PF00121, Triosephosphate isomerase"
FT   misc_feature    130389..130421
FT                   /note="ScanRegExp hit to PS00171, Triosephosphate isomerase
FT                   active site. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        130656..131102
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="BP0802"
FT                   /product="protein-export membrane protein"
FT                   /note="Similar to Escherichia coli protein-export membrane
FT                   protein SecG or B3175 or Z4537 or Ecs4054 SW:SECG_ECOLI
FT                   (P33582) (110 aa) fasta scores: E(): 3.4e-06, 35.965% id in
FT                   114 aa, and to Xylella fastidiosa protein-export membrane
FT                   protein Xf0304 TR:Q9PGJ6 (EMBL:AE003883) (132 aa) fasta
FT                   scores: E(): 1.3e-08, 39.098% id in 133 aa"
FT                   /db_xref="GOA:Q7VZT4"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZT4"
FT                   /protein_id="CAE41107.1"
FT                   /translation="MSLMLTVLLVVQVVSALAIIVLVLLQQGKGADMGSAFGSGSAGSL
FT                   FGATGAANFLSRTTKWAAVVFFVSTAGLAYVTHKGPSGPAIDSGVMQNFPQDRSVPQAP
FT                   GSAPAGSGSSVPQAPGSGVPAAPAQPDASVPQAPWRFCPWAFTC"
FT   misc_feature    130656..130796
FT                   /note="Signal peptide predicted for BP0802 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.887) with cleavage site
FT                   probability 0.417 between residues 47 and 48"
FT   misc_feature    join(130674..130727,130755..130823)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BP0802 by TMHMM2.0 at aa 7-24 and 34-56"
FT   tRNA            131153..131237
FT                   /note="tRNA Leu anticodon GAG, Cove score 63.68"
FT   CDS_pept        131890..134121
FT                   /transl_table=11
FT                   /gene="betT"
FT                   /locus_tag="BP0804"
FT                   /product="high-affinity choline transport protein"
FT                   /note="Similar to Escherichia coli high-affinity choline
FT                   transport protein BetT or B0314 or Z0401 or Ecs0360
FT                   SW:BETT_ECOLI (P17447) (677 aa) fasta scores: E():
FT                   2.5e-111, 44.296% id in 675 aa, and to Erwinia amylovora
FT                   high-affinity choline transport protein BetT TR:Q9F806
FT                   (EMBL:AF264948) (676 aa) fasta scores: E(): 1.5e-109,
FT                   43.004% id in 679 aa. Also similar to BP0831, 37.348%
FT                   identity (38.522% ungapped) in 656 aa overlap."
FT                   /db_xref="GOA:Q7VZT3"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZT3"
FT                   /protein_id="CAE41108.1"
FT                   /translation="MSITPPDDEGAEPGPSSQAPHAQAAALRRPIERSRFGGSQRRPER
FT                   QDGDDAPVSRSDLSKGPEEVLERRTASINWRVLLVSSAVIVAFSVWAILVPGDARMRMK
FT                   TAVDWIAANLGWYYVLTMTLVIGFVLWVAFSKEGDVRLGPDHSRPQYRLSTWVAMLFAA
FT                   GVGIDMLFFSVTGPVVQYLHSPSGEGGTAAAMQDAVVWTMFHYGVAGWSMYALLGMAMG
FT                   YFAYRWGMPLSIRAALYPLLGKRVRGPLGDGISIIALVGTVFGVATSMGIGVVLLNVGF
FT                   SLIFGLEQGLSLQIALVVGAVILTIGATTSGVDRGIRWISELNLWSAVAMMVYILLTGQ
FT                   TAFLLNALSENIGRFLVTFPARTLQTFAYEPGGPEWMGGWTLFFWAFWLAWGPFVGVFL
FT                   ARISRGWTLREFVIAAITAPVLCDFIIVSLFGNSALYHVLQGDTAFAALAVESSERGWY
FT                   ALLAMFPGAMFLIGLATLSGLLFYLTSANSGAMVMSNFSASIPDPSHDGPKWLRIFWAV
FT                   LTAVLTVAMLLAGGVTTMEYATLIFALPVTIIAYTVMASFYKVLRMERAEREGQVLRRP
FT                   SMAPMGGHLPERSWKQRLEQLHAFASLRQATQFLDHTVRPALGDVAAEFRNQGYEVASE
FT                   SLASERGIEEPLLRVSMDGFRAFQYHVAVVEAPVPMFSGRMSRETDVYYRLEVFTQTGS
FT                   GGYDLMGLTRQQVIDDVLERFEAHLAFLTFSTNTDTASVLTPPAPARNP"
FT   misc_feature    join(132106..132174,132217..132285,132346..132414,
FT                   132499..132567,132649..132717,132760..132828,
FT                   132862..132930,133015..133083,133120..133188,
FT                   133270..133338,133426..133494,133504..133572)
FT                   /note="12 probable transmembrane helices predicted for
FT                   BP0804 by TMHMM2.0 at aa 73-95, 110-132, 153-175, 204-226,
FT                   254-276, 291-313, 325-347, 376-398, 411-433, 461-483,
FT                   513-535 and 539-561"
FT   misc_feature    132118..133581
FT                   /note="HMMPfam hit to PF02028, BCCT family transporter"
FT   CDS_pept        complement(134144..134944)
FT                   /transl_table=11
FT                   /locus_tag="BP0805"
FT                   /product="probable transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator Pa3174 TR:Q9HZ60 (EMBL:AE004741)
FT                   (242 aa) fasta scores: E(): 1.4e-13, 31.048% id in 248 aa,
FT                   and to Rhizobium meliloti putative transcription regulator
FT                   protein Smc00263 TR:CAC46270 (EMBL:AL591788) (282 aa) fasta
FT                   scores: E(): 1.4e-14, 30.000% id in 250 aa"
FT                   /db_xref="GOA:Q7VZT2"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZT2"
FT                   /protein_id="CAE41109.1"
FT                   /translation="MENERGTVERIVRLIAFLASQDDDVGVKDIADELQLPHSTAHRLL
FT                   QQLVALNLMQRVQGARRYAFGPEMYRLGAMISNKVNVVQLASAPLHRIVAYTNESCALA
FT                   LYRDQDATLVFAKQVESANQLRYQLDLYRPVSVLWGASGHAVLAHLPPERVRTLLKKEP
FT                   LSPTGLAALPARELNRDLKQIREQGYSVSTRGEKIEGAAGISTPIFGTGGHVIGCFSLF
FT                   IPRIRYPEHRETELAQLLVREAGALSDVLAGRQAAPAGAPGAAR"
FT   misc_feature    complement(134195..134758)
FT                   /note="HMMPfam hit to PF01614, Bacterial transcriptional
FT                   regulator"
FT   misc_feature    complement(134807..134872)
FT                   /note="Predicted helix-turn-helix motif with score 1203
FT                   (+3.28 SD) at aa 70-91, sequence VGVKDIADELQLPHSTAHRLLQ"
FT   CDS_pept        135226..136458
FT                   /transl_table=11
FT                   /locus_tag="BP0806"
FT                   /product="methylaspartate ammonia-lyase"
FT                   /EC_number="4.3.1.2"
FT                   /note="Similar to Clostridium tetanomorphum methylaspartate
FT                   ammonia-lyase SW:MAAL_CLOTT (Q05514) (413 aa) fasta scores:
FT                   E(): 4.5e-51, 36.520% id in 408 aa, and to Citrobacter
FT                   amalonaticus 3-methylaspartate ammonia-lyase TR:O66145
FT                   (EMBL:AB005294) (413 aa) fasta scores: E(): 1e-53, 38.107%
FT                   id in 412 aa. Also similar to BP3177, 40.500% identity
FT                   (40.704% ungapped) in 400 aa overlap."
FT                   /db_xref="GOA:Q7VZT1"
FT                   /db_xref="InterPro:IPR006395"
FT                   /db_xref="InterPro:IPR022662"
FT                   /db_xref="InterPro:IPR022665"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZT1"
FT                   /protein_id="CAE41110.1"
FT                   /translation="MRVQRLLATDGIGGYYWRDQEAIGQGAPRDGFLYRGAPVTPGFTS
FT                   IIQVSSTVLLTGVADDGSELYGDCATVNHAFRSGRQQAPDAASLIAQAEGPLSRWLAQC
FT                   DLSSFRDAAAQLDTMRLDGQPLHMALRYGLSQLLLQAVAAHHRVTMAEILAREYGLTLA
FT                   DTPCDLLGSCGGNWYENVDKAIVRELPYFPQTAMVRTDQLDELPAYAEWISQRIRAVGR
FT                   PDFFPTLHYDLHGLLSQRVGDDLDAALVYLRKVEAASAPYPVLFEDPLDAGERGAQIAL
FT                   MGRLREALRRAGSGIRLIADEWCNTREDVREFVAQGCCDLIQIKMPDLGGVDNTVQACL
FT                   ICRDGGVGVYLGGSCNETDISARVAAHVALAVRPVEFLGKPGLGLDEGVMIVTNEMQRA
FT                   IRSYRTRLSAA"
FT   CDS_pept        136569..137558
FT                   /transl_table=11
FT                   /locus_tag="BP0807"
FT                   /product="putative exported protein"
FT                   /note="Similar to Comamonas testosteroni OrfJ protein
FT                   TR:Q9RHM9 (EMBL:AB029044) (326 aa) fasta scores: E():
FT                   1.3e-34, 35.737% id in 319 aa, and to Agrobacterium
FT                   tumefaciens Agr_l_312p TR:AAK88723 (EMBL:AE008213) (329 aa)
FT                   fasta scores: E(): 3.9e-38, 39.048% id in 315 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZT0"
FT                   /protein_id="CAE41111.1"
FT                   /translation="MTRWQQWIIAALGCGAACLGIATSALAAPAGYPKGPVTLVVPTGP
FT                   GGGTDLAARAFSERLSAILGQPVVVDNRAGAGGIIGTQDVAKSRPDGHTLLISSNQFGI
FT                   LPAVQDNLPFDPVKDFIPVTSIGLIPTLVLVNPSLPVRSVAELIDYARKQPGGVQYASA
FT                   GIGSPNHLFAAMFGSMADVPMMHVPFRGTSPALVAVAGGQTAVAFASQPASQSFVAAGK
FT                   LRAIAVTSARRLPSLPDLPPVSDTVPGYDADIWLGVWAVAGTPDTVVDAIHAAFEEALK
FT                   DPRVIDSLGKMGIVVATRSRQDFTAMVEREIGKWARVVAEAGDGFQKQ"
FT   misc_feature    136569..136649
FT                   /note="Signal peptide predicted for BP0807 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 27 and 28"
FT   misc_feature    136578..136610
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    136587..136655
FT                   /note="1 probable transmembrane helix predicted for BP0807
FT                   by TMHMM2.0 at aa 7-29"
FT   CDS_pept        137589..138977
FT                   /transl_table=11
FT                   /locus_tag="BP0808"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa0881 TR:Q9I564 (EMBL:AE004522) (450 aa) fasta
FT                   scores: E(): 8e-29, 33.842% id in 393 aa, and to
FT                   Agrobacterium tumefaciens Agr_l_2924p TR:AAK90029
FT                   (EMBL:AE008346) (448 aa) fasta scores: E(): 4.2e-31,
FT                   35.280% id in 428 aa"
FT                   /db_xref="GOA:Q7VZS9"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZS9"
FT                   /protein_id="CAE41112.1"
FT                   /translation="MQLASPSPAVGVTRPLADAIVATASSRLGAATLQTAQACLLDSLA
FT                   VTLAGAQEPLVAVLDRTLAGFGGAGQATLIGRGRRAPLPDAALVNGAAGHAFDFDDMHI
FT                   ESAMHPSVPVVAAALAVAEHEGADGAALLRALALGIEAQLRIGEAVRPHHYQRGWHATG
FT                   TLGHFGAAVAAGCLLGLDAQQTTMALGIAGTQASGPKETFGTMSKPLHAGQAARNGVMA
FT                   ALLARQGYTSTEDILDGHYGFGRVCGDGAHWDGLLDGWGERWSMHDILYKPHASSFCTQ
FT                   ALIECALALRATPGFAWTAVARIHGEVSAMSMANARIVEPRDGMQAKFSLSHAIAQGLV
FT                   HGQATIADFSDARAREPALRALRARTTIAQGAGLAWPEAIVTVTLADGSQLRRHADLRA
FT                   STATSQDKWRVTLGKFMSVAGAVPGFASCDAVRDAVLRLPEAPGAVAALMALLRPQAAT
FT                   PSGA"
FT   CDS_pept        join(139025..139294,139294..140517)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="BP0809"
FT                   /product="putative argininosuccinate lyase (Pseudogene)"
FT                   /EC_number="4.3.2.1"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 90. The sequence has been checked
FT                   and believed to be correct. Similar to Escherichia coli
FT                   argininosuccinate lyase ArgH or B3960 SW:ARLY_ECOLI
FT                   (P11447) (457 aa) fasta scores: E(): 1.4e-30, 31.127% id in
FT                   408 aa, and to Rhizobium meliloti probable
FT                   argininosuccinate lyase AsaL protein TR:CAC47226
FT                   (EMBL:AL591791) (467 aa) fasta scores: E(): 3.3e-38,
FT                   33.183% id in 443 aa"
FT                   /db_xref="PSEUDO:CAE41113.1"
FT   misc_feature    join(139121..139294,139294..139965)
FT                   /note="HMMPfam hit to PF00206, Lyase"
FT   misc_feature    139196..139225
FT                   /note="ScanRegExp hit to PS00215, Mitochondrial energy
FT                   transfer proteins signature."
FT   variation       139295
FT                   /note="(C)1 in pertussis; (C)2 in parapertussis"
FT   CDS_pept        140576..141559
FT                   /transl_table=11
FT                   /locus_tag="BP0810"
FT                   /product="putative exported protein"
FT                   /note="Similar to Variovorax paradoxus 2,4-diphenoxyacetic
FT                   acid gene cluster TR:Q9RHQ7 (EMBL:AB028643) (337 aa) fasta
FT                   scores: E(): 9e-44, 42.415% id in 323 aa, and to
FT                   Burkholderia cepacia hypothetical 35.5 kDa protein
FT                   TR:AAK81675 (EMBL:AF029344) (337 aa) fasta scores: E():
FT                   9e-44, 42.415% id in 323 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZS8"
FT                   /protein_id="CAE41114.1"
FT                   /translation="MADLFSVLRIAYTLALGAALAAPAAVAAPFPDRPVRLVVPYPPGG
FT                   GADIFARTLSEPLAAQLGQPVIVENRPGANGIIGTDAVARAAPDGYTILLGNSGPNAIN
FT                   QAIYPDLPYDAVDSFEEVSLIGYTTHVLVVHPGVQARSVTELIALARRSPGQLNFASTG
FT                   QGGTPHLAGELFKLMTGTDMVHVPYKGASPSNADVIAGQVQLTFNTLPPLMTSIRAGKV
FT                   RALAVTGKQRSQLLPEVPTIDEAGVAGYDVQTWYGIHAPAGTPAAVVDRLNQALVAVLS
FT                   NAQVRAALVGQGYEVATSTPGEFSRMVRDDVAKWRKVVKEAKVKVD"
FT   misc_feature    140576..140656
FT                   /note="Signal peptide predicted for BP0810 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.996 between residues 27 and 28"
FT   misc_feature    140588..140656
FT                   /note="1 probable transmembrane helix predicted for BP0810
FT                   by TMHMM2.0 at aa 5-27"
FT   repeat_region   141571..142801
FT                   /note="Insertion sequence"
FT   CDS_pept        141756..142772
FT                   /transl_table=11
FT                   /locus_tag="BP0812"
FT                   /product="transposase for IS1663"
FT                   /note="Similar to Neisseria meningitidis putative
FT                   invertase/transposase nma1800 TR:Q9JTF3 (EMBL:AL162757)
FT                   (318 aa) fasta scores: E(): 2e-17, 28.48% id in 316 aa and
FT                   Acinetobacter spSE19. pilin inverting protein chnY
FT                   TR:Q9F7E1 (EMBL:AF282240) (324 aa) fasta scores: E():
FT                   8.2e-50, 47.516% id in 322 aa"
FT                   /db_xref="GOA:Q7TTN4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTN4"
FT                   /protein_id="CAE41115.1"
FT                   /translation="MADSSLLSAGGQVHVFIGIDVSKAKLDCTLLTAEADKCKTKVVVN
FT                   TAAGVQALLAWCAKHGAQPAQLHAILEPTGLYHEQAATALPQVRVSLVNPAQARDFAKA
FT                   LALRSKNDALDSYVLARYGQTLSPALWHPAPLHARQLRALLTRREALSKDLLRELNRKE
FT                   KSQFSPSAPLVDGSIDKAIAFLREQIKQIERAIDQHIDNHPDLKQDCELLNSIPAIGPQ
FT                   AGNAILAVMHNRHIDSAQSLAAYLGVVPVQRQSGSSLNSCARLSKAGPSQVRATLYMAA
FT                   LVGTRHNPHIRALYQRLLKAGKSKKAALGAAMRKLVHLCFGVLKNRIPYQPNYAMNG"
FT   misc_feature    142008..142295
FT                   /note="HMMPfam hit to PF01548, Transposase"
FT   misc_feature    142308..142640
FT                   /note="HMMPfam hit to PF02371, Transposase
FT                   IS116/IS110/IS902 family"
FT   CDS_pept        complement(142969..143793)
FT                   /transl_table=11
FT                   /locus_tag="BP0813"
FT                   /product="probable short-chain dehydrogenase"
FT                   /note="Similar to Rhizobium loti probable short-chain
FT                   dehydrogenase/reductase Mlr0808 TR:Q98LZ5 (EMBL:AP002995)
FT                   (259 aa) fasta scores: E(): 1.2e-30, 45.985% id in 274 aa,
FT                   and to Rhizobium meliloti putative oxidoreductase protein
FT                   Smc01157 TR:CAC41799 (EMBL:AL591783) (259 aa) fasta scores:
FT                   E(): 2.3e-21, 41.791% id in 268 aa"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZS7"
FT                   /protein_id="CAE41116.1"
FT                   /translation="MDLGIAGRWALVCGASKGLGYGCASALLQNGVNVVINARNDGVLQ
FT                   DAASALRKDAENQARQSGGQAGKVIAVACDITTEPGRQAALEAPGGPGPDFDIVVTNAG
FT                   GPPPGQYQDWDRDDWIKAIDANMLTPIALIKATVDGMQARGFGRIVNITSTAVKAPIST
FT                   LGLSNGARSGLTGFIAGLARSEIAARGVTINNILPGRFDTDRLKSTMRVAAQACGQSIE
FT                   ALREEQQLGIPAGRFGRPDEFGALCAFLCSVHAGYITGQNMLIDGGAYPGTY"
FT   misc_feature    complement(142999..143091)
FT                   /note="HMMPfam hit to PF00678,"
FT   misc_feature    complement(143182..143772)
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase"
FT   CDS_pept        complement(143871..144761)
FT                   /transl_table=11
FT                   /locus_tag="BP0814"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="Similar to Escherichia coli probable transcriptional
FT                   regulator LrhA or GenR or B2289 SW:LRHA_ECOLI (P36771) (312
FT                   aa) fasta scores: E(): 3.9e-37, 36.396% id in 283 aa, and
FT                   to Erwinia chrysanthemi pectinase gene transcriptional
FT                   regulator PecT SW:PECT_ERWCH (P52662) (316 aa) fasta
FT                   scores: E(): 3.5e-36, 36.704% id in 267 aa"
FT                   /db_xref="GOA:Q7VZS6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZS6"
FT                   /protein_id="CAE41117.1"
FT                   /translation="MRHLDMQQLRTLVTIAQTGSFSATAEKLFKTQPAITHQMHQLEAT
FT                   LGTALFEKQGRSRVLTEDGQKMLKYASQVLALNDEVFRVFQERLQGTLRIGSPHDAVET
FT                   LLPSILRQASQALPQLNIDVCIDSAPRLFELLQRGEIDMAISARFHQEFEGLILKRSPV
FT                   VWLCAADYVHRPDKALPLILADGSSIYREMALAALEQHHIRWTVTRIVPDLVGIKAAIR
FT                   AGLGVTPRSIDLLAPDMRMLDEADGLPPLPEMTYHLWIRPHADDSPARQAYEMLRQAWE
FT                   LVDAVPAARAGPAAG"
FT   misc_feature    complement(144327..144746)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    complement(144642..144707)
FT                   /note="Predicted helix-turn-helix motif with score 1103
FT                   (+2.94 SD) at aa 19-40, sequence GSFSATAEKLFKTQPAITHQMH"
FT   CDS_pept        144965..146116
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="BP0815"
FT                   /product="cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /note="Similar to Escherichia coli cystathionine beta-lyase
FT                   MetC or B3008 SW:METC_ECOLI (P06721) (395 aa) fasta scores:
FT                   E(): 1.1e-56, 41.795% id in 390 aa, and to Rhizobium
FT                   meliloti probable cystathionine beta-lyase protein
FT                   TR:CAC46058 (EMBL:AL591787) (395 aa) fasta scores: E():
FT                   2.6e-63, 46.073% id in 382 aa. Also similar to BP0112,
FT                   42.784% identity in 388 aa overlap."
FT                   /db_xref="GOA:Q7VZS5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZS5"
FT                   /protein_id="CAE41118.1"
FT                   /translation="MKFDTLLTHGGRDPKAHKGMVNTPVYRTSTVVFESMAEYKATRGA
FT                   KFDHVRYGRLGTHTVKELENLVAAIEGGHRAVLTPSGVSAIATTLNTLARPGSHILVPD
FT                   NVYYPCREFCEKVLAPRGVRVEYYAGSEVERLVRPDTSVVYCESPGSLTMEMQDFARIA
FT                   AAAHAVGAKVVADNTWATPVFLQPFEHGIDVSIHAATKYLVGHSDVMMGTVTAHDPELW
FT                   LAIRTEAAAQGLSISPDDAYLATRGIRTLGVRMAAHYRNALDVAQWLAGHPRVAQVLYP
FT                   ALPQHPDHALWRRQMRGASGLLTLELEPCSLEQRDAFIDRLTLFAIGASWGGYESLVLP
FT                   ADTAGKRSLAGRDYAGPLVRLHIGLEDVEDLKRDLDQALRRED"
FT   misc_feature    144974..146104
FT                   /note="HMMPfam hit to PF01053, Cys/Met metabolism
FT                   PLP-dependent enzyme"
FT   misc_feature    145541..145585
FT                   /note="ScanRegExp hit to PS00868, Cys/Met metabolism
FT                   enzymes pyridoxal-phosphate attachment site. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   CDS_pept        146120..147151
FT                   /transl_table=11
FT                   /locus_tag="BP0816"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium loti Mlr7142 protein TR:Q987A0
FT                   (EMBL:AP003011) (349 aa) fasta scores: E(): 2.1e-12,
FT                   26.901% id in 342 aa, and to Rhizobium meliloti
FT                   hypothetical protein Smb20435 TR:CAC48821 (EMBL:AL603643)
FT                   (331 aa) fasta scores: E(): 2.3e-12, 26.586% id in 331 aa"
FT                   /db_xref="GOA:Q7VZS4"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZS4"
FT                   /protein_id="CAE41119.1"
FT                   /translation="MSKIQDLLSGMQPGTVAHDYLPVGTMSSGMAIAIPVTVIKGAAPG
FT                   PCLWVNGQVHGNELNGVIAAVELGRRVDPAALSGSLVITPTANPLGLDNRTKTAPQDLQ
FT                   DLDQTFPGNPQGMVTNHMAHALFQEVRAVASCLVNMHTMGSIHDSKPYCVYKVFPGSAV
FT                   TEAQLLRMTSFFEPSVSCRMDVGGAGELPGNIAGGLDYQCLAIDVPAFMVELGQGSWYT
FT                   PENVEQALTGLLRLASHLGLIDESGVSAGAPAPASVRRVTRRRWVMARHGGLFLAAGRA
FT                   GQIVPAGAPLGRIVDLHGAEVEAVSLDTDCIVIGMRRDPVVHTGDRVAFVATQWDQADI
FT                   GAG"
FT   CDS_pept        147280..148251
FT                   /transl_table=11
FT                   /locus_tag="BP0817"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti conserved hypothetical
FT                   protein Sma1927 TR:AAK65716 (EMBL:AE007292) (330 aa) fasta
FT                   scores: E(): 5.6e-32, 35.474% id in 327 aa, and to
FT                   Agrobacterium tumefaciens Agr_l_312p TR::AAK88723
FT                   (EMBL:AE008213) (329 aa) fasta scores: E(): 6e-30, 33.739%
FT                   id in 329 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZS3"
FT                   /protein_id="CAE41120.1"
FT                   /translation="MQHTLAKYLAAAVAVLPWTAGAQDKAAKPWQPDGPVTLILGYGAG
FT                   GGHYALAQVLQARMAEELGQPLIVMPKPGAGGLIATDFVANARPDGRTITWSGPGVLTI
FT                   WPQLRQISYDPKKLTPVNLLVQMGYMLVTKPGESRWNSVQDVIDGSKSGDVTYSSVGVG
FT                   TSNSMTGHLLNAMTGSRLREIGYKGGGPALMSTMAGETDIGFGDTATHKLIAAGRLRAI
FT                   ATTTRQREPRFPDVPTVAETVPGYEVTNWLGVIAPPGTPQPIVDRYQQIFAKLMAEPEI
FT                   AKRVKELGMTPDVGTPQAFSELIDSETQLWKRLIRDQNIKVE"
FT   misc_feature    147280..147345
FT                   /note="Signal peptide predicted for BP0817 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.972) with cleavage site
FT                   probability 0.938 between residues 22 and 23"
FT   CDS_pept        148276..150360
FT                   /transl_table=11
FT                   /locus_tag="BP0818"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   thiosulfate sulfurtransferase Pa2603 TR:Q9I0N4
FT                   (EMBL:AE004689) (527 aa) fasta scores: E(): 1.4e-45,
FT                   40.310% id in 516 aa, and to Agrobacterium tumefaciens
FT                   Agr_pti_bx104p TR:AAK91049 (EMBL:AE007935) (395 aa) fasta
FT                   scores: E(): 9.6e-31, 41.987% id in 312 aa"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZS2"
FT                   /protein_id="CAE41121.1"
FT                   /translation="MTTMQQRYDAVKDAMAQIGRLAAQLDGEALREAIGPVLVALGERD
FT                   ELFPRDEFPIRAGKPGGLYQLWRGESGDLALYASAGKTGKKQPPHDHTTWAVIAGVYGE
FT                   EHNVFFERTDDGSRAGFGTLRQIDALTVVQGNAARLSGEVFHTIEVVSEEDSLHLHLYG
FT                   RALDTLSGRINFATEEGGAYTRFMAVPETYAPWIAPRDLYEMLTDGGELAILDVRENGV
FT                   YTQGHLFHAASMPLSVFELRVDDGLPSPHVRIVVIDDADGLAEQAVRLLHQRGYHNVAV
FT                   LQGGQPGWNAAGLPVYTGVFVPSKAFGEVAEHVYGTPSISAVELDALRRSEEVLVLDSR
FT                   TEQEFNLMSVPGAYSCPGAELVARALDHAGPIVVNCAGRTRSIIGAQSLRNAGKTDVRA
FT                   LENGTMGQHLAGLPLERGKSASYLDRPVAAGAAQAAQAWALGMSIATLDAGELHDMLSN
FT                   PYRTTYLFDARDPSCSSRATLPRAVAAPGGQLVQQTDYYAPVRNARIVVFDTDGVQAPM
FT                   TAGWLHQMGWEVYLHRPEATALVAPPRVEYDDERGVPVEAVAADAVIIDVGDSRTYRAG
FT                   HLAGAAWAPRSRLPALLAQRKPAGPLLFTCADGRVSRLAAADAAAQGYQAAYLKGGTAA
FT                   LGADRLRGDAPQFLTEAIDVWYRPYDRETGIEEAMHQYLSWETGLLDKVRSDPTVAFRI
FT                   "
FT   misc_feature    148867..149151
FT                   /note="HMMPfam hit to PF00581, Rhodanese-like domain"
FT   CDS_pept        complement(150427..151419)
FT                   /transl_table=11
FT                   /locus_tag="BP0819"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti conserved hypothetical
FT                   protein Sma1927 TR:AAK65716 (EMBL:AE007292) (330 aa) fasta
FT                   scores: E(): 4.4e-35, 37.037% id in 324 aa, and to
FT                   Pseudomonas putida hypothetical 34.5 kDa protein in
FT                   clcB-clcD intergenic region precursor SW:YCLC_PSEPU
FT                   (Q47100) (329 aa) fasta scores: E(): 3.7e-32, 34.375% id in
FT                   320 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZS1"
FT                   /protein_id="CAE41122.1"
FT                   /translation="MNNQRRNALRVLTGLCGAAALPRLALAQAGAYPAGPVTVVVPYGS
FT                   GGSTDVIARLLVNDVSERLGGKFIVENKPGAAGNIGTRQVGISRPDGTTLLYSTATPFC
FT                   INPYVYRTLPFDPDKDFAAVSRTAKLPLVLVVNAGLGIKTPQAFIDYLRKNQQQCSYSS
FT                   YGIGTSSHIASAIFTKKIGAPGVLHVPYKDMTAMSDLAAGRNTFHIDAWSVVDPLVRAG
FT                   KLTALAVSSAEPLPWAPKLPTIASVIGSDYEVVTWHAVFAPRKTPAEIVQKLNHEFRQT
FT                   IAKPSVQKTYVDQGFLTYPPATPAEIDAFVQQDKQRWKSFVEAAGITPS"
FT   misc_feature    complement(151339..151419)
FT                   /note="Signal peptide predicted for BP0819 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.879 between residues 27 and 28"
FT   CDS_pept        complement(151528..152862)
FT                   /transl_table=11
FT                   /locus_tag="BP0820"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Agrobacterium tumefaciens Agr_l_1811p
FT                   TR:AAK89479 (EMBL:AE008289) (440 aa) fasta scores: E():
FT                   1.4e-42, 32.143% id in 448 aa, and to Rhizobium meliloti
FT                   putative oxidoreductase Sma1850 TR:AAK65676 (EMBL:AE007288)
FT                   (425 aa) fasta scores: E(): 2.5e-39, 33.724% id in 427 aa"
FT                   /db_xref="GOA:Q7VZS0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZS0"
FT                   /protein_id="CAE41123.1"
FT                   /translation="MAASRDIFAPDFRRRPYWWEGYEPPECGEDTLPASADVAIVGGGY
FT                   TGVCCALALREAGIEAVVLEAGRPGEGASTRSGGQVSGGVNVQKKALAAVGESAGQRAE
FT                   RLAARLRDAAASMAYVESLIERYAIECGWRRTGRLTTMWVPAHYQSWQARLDQLNACTG
FT                   SQARMIPREELAAEIGSSVYHGAALIEHAGHLQPAQLYGGMLRAARDAGARVLGRTPVE
FT                   RIERRAGGYDVHTARGTVRAGQVVIATIGYTGANLGGLKRRIVPVCTHMIATEALPPDL
FT                   AASLLPTNRAVSESRRVVNHYRLSPDGRRLLFGGRARFVPTDEATTARLLYRAMLKRFP
FT                   QLAGTRITHSWGGNVAMTLDSMPHIGGADGLHYALGCNGSGVAMMSYLGHCVGRKIATQ
FT                   SGEPINAFDMGEIPGHPFYFGNPWFLFAIGSWYQARDAYDHWRAR"
FT   CDS_pept        complement(152888..154900)
FT                   /transl_table=11
FT                   /gene="hyuB"
FT                   /locus_tag="BP0821"
FT                   /product="hydantoin utilization protein B"
FT                   /note="Similar to Pseudomonas sp hydantoin utilization
FT                   protein B HyuB SW:HYUB_PSESN (Q01263) (592 aa) fasta
FT                   scores: E(): 4.3e-44, 29.223% id in 592 aa, and to
FT                   Rhizobium loti hydantoin utilization protein B Mlr7025
FT                   TR:Q987J6 (EMBL:AP003010) (661 aa) fasta scores: E():
FT                   5.8e-133, 52.108% id in 664 aa"
FT                   /db_xref="GOA:Q7VZR9"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZR9"
FT                   /protein_id="CAE41124.1"
FT                   /translation="MTVDNFRLQVLANHCTAAAEAMGYTLMRTAYSTFVKETEDFSAQL
FT                   MTPAGKTFASPKTFGATWYTGLDYGRVIAMFDDYREGDIYLTNDPYSGFVATHTPDMHV
FT                   WKPVFRDGRLVCFVGSHIHNTDMGGAVPASLSRTLTEVHQEGLRIPPMLLARDGVIDEK
FT                   VLRIMEVNVRMPEQNRGDLNAQIAALNVGERKVHEIIDRFGVDEFMQGAEAILDYAEQQ
FT                   TRALIREIPDGEYRFAEYADEDTVGGYPCRIQITLRVRGDELELDFTGSDPQVASSLNV
FT                   PTGGDGHHSVITVGLIYVMHTLAPRNVLNAGSVRPCRAVLPEGTVVNPQAPAAVGMRSL
FT                   MAAVIQACTFGVFSRAMPDRLPACPAGGSTLLNVKTATREGRQVLSSIGPCGGGAGGGP
FT                   EHDGVEGCGANNAFLKNTPVEINEAEVPIEIIRYGLVPDTGGAGRQRGGNAATMEFRLL
FT                   APNGVVTARNRNRSELAAWGVMGGKAGANSRFIRNPDSDAPEELRNSDLVNCAPGDVIR
FT                   LQGPAGGGYGHPYERPIEQVVEDVRCGFVSRQRAREAYGVAVRADLSVDEAATRELRRA
FT                   DRGGQAHFDHGPGRSRFEAVWTPARYDAMTRIMAALPISWRHFVKHQMFAALAGSAPPQ
FT                   DGGAQDIERLYAQLSQRYADLPSPQAIAAASGAAA"
FT   misc_feature    complement(153281..154894)
FT                   /note="HMMPfam hit to PF02538, Hydantoinase B/oxoprolinase"
FT   misc_feature    complement(154379..154402)
FT                   /note="ScanRegExp hit to PS00867, Carbamoyl-phosphate
FT                   synthase subdomain signature 2."
FT   CDS_pept        complement(154897..156969)
FT                   /transl_table=11
FT                   /gene="hyuA"
FT                   /locus_tag="BP0822"
FT                   /product="hydantoin utilization protein A"
FT                   /note="Similar to Pseudomonas sp hydantoin utilization
FT                   protein A hyuA SW:HYUA_PSESN (Q01262) (690 aa) fasta
FT                   scores: E(): 1.3e-75, 34.776% id in 693 aa, and to
FT                   Rhizobium loti hydantoin utilization protein A Mlr7024
FT                   TR:Q987J7 (EMBL:AP003010) (692 aa) fasta scores: E():
FT                   8.9e-130, 53.254% id in 676 aa"
FT                   /db_xref="GOA:Q7VZR8"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZR8"
FT                   /protein_id="CAE41125.1"
FT                   /translation="MRDIDGGTMGYRVGVDIGGSFTDFAVFDEDNGEIKSLKVFSRPDQ
FT                   PGEEVIAGVRMLGERYGIQPEQITYFTHGTTVGINTVIQRKGLKLALFTTENFSDVLEL
FT                   ARLKTPDMYHLLSRRPAPLVKRSMVFGIAERMGPDGTVRAPLDEASVERAVRQALDAGA
FT                   EGIVVSLLHAYRNPAHELRVREIAEALAPGLPVSCSSETWPIIREYERTITAVIGGYVQ
FT                   PRVAHYLTSLQQALKNAGVQPEPRLTKSNGGVMTAEQGKRDCVQMILSGTAAGVIGASH
FT                   VAATAGLPRCLSLDIGGTSADIAVIVDGKPQYGVGELIGDFQIYIPSVSVSSVGEGGGS
FT                   IAWVDPLGVLKVGPESAGSHPGPACYRRGGTRATITDAFVCCGLVGHSELGYQAVTVDA
FT                   DASRQAVGELADRLGRGIEETAEAIIQIAVSGMYSEVSGLVSRYGIDPREYAVLAFGGA
FT                   GPMLGCFLARELKVREIVVPPSPGTLSALGGLIADLKSDFLKTVYTDLSADRLAFVCDE
FT                   FATLAGRARQWLAQEQGHAEEAELVYSAEMRYRGQSYEIDTVLDPIHIEAGDVQAVGQA
FT                   FHDMHRRLYGHADEQAPVQIVSLRVVIAGNNDKPAFPRHALRPGAPRAERKVRVWLDGA
FT                   WHEVPLYARTALAAGQQFTGPAIVTQDDCTTVIPPDYACRVDEYANLRITEGAAS"
FT   misc_feature    complement(155290..156936)
FT                   /note="HMMPfam hit to PF01968, Hydantoinase/oxoprolinase"
FT   CDS_pept        157049..157696
FT                   /transl_table=11
FT                   /locus_tag="BP0823"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Pseudomonas putida pca regulon regulatory
FT                   protein PcaR SW:PCAR_PSEPU (Q52154) (291 aa) fasta scores:
FT                   E(): 6e-07, 31.655% id in 139 aa, and to Rhodococcus opacus
FT                   PcaR TR:O67983 (EMBL:AF003947) (265 aa) fasta scores: E():
FT                   3.5e-08, 28.108% id in 185 aa"
FT                   /db_xref="GOA:Q7VZR7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZR7"
FT                   /protein_id="CAE41126.1"
FT                   /translation="MNDNRSVQRCLALLRSFRSGPGQSLTALSKAVDLPHSTVLRFLTT
FT                   LESEGYVRKEGTLWSLTPQLLEIGFAALANTGVNDVIQSALQELADQCAGTANIGERSK
FT                   NDVIIIARASSEAERRKILVVNLRVGNALPPASALCSALDLPEDQWAIARYPERKVTTV
FT                   GVALFSSQARGLSLGLSVNDDDYDMPRIEAEVLPRLRAQRDHIRRLMSLGEM"
FT   misc_feature    157115..157180
FT                   /note="Predicted helix-turn-helix motif with score 1102
FT                   (+2.94 SD) at aa 23-44, sequence QSLTALSKAVDLPHSTVLRFLT"
FT   CDS_pept        157879..158331
FT                   /transl_table=11
FT                   /locus_tag="BP0824"
FT                   /product="azurin"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   bronchiseptica azurin SW:AZUR_BORBR (P00278) (129 aa) fasta
FT                   scores: E(): 4.2e-49, 100.000% id in 129 aa,and similar to
FT                   Alcaligenes xylosoxydans xylosoxydans azurin-I precursor
FT                   Az1 TR:O87169 (EMBL:AB013077) (150 aa) fasta scores: E():
FT                   4e-42, 74.667% id in 150 aa"
FT                   /db_xref="GOA:P0A320"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR014068"
FT                   /db_xref="InterPro:IPR028871"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A320"
FT                   /protein_id="CAE41127.1"
FT                   /translation="MFKQVLGGMALMAAFSAPVLAAECSVDIAGTDQMQFDKKAIEVSK
FT                   SCKQFTVNLKHTGKLPRNVMGHNWVLTKTADMQAVEKDGIAAGLDNQYLKAGDTRVLAH
FT                   TKVLGGGESDSVTFDVAKLAAGDDYTFFCSFPGHGALMKGTLKLVD"
FT   misc_feature    157879..157941
FT                   /note="Signal peptide predicted for BP0824 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 21 and 22"
FT   misc_feature    157942..158325
FT                   /note="HMMPfam hit to PF00127, Copper binding proteins,
FT                   plastocyanin/azurin family"
FT   misc_feature    158254..158304
FT                   /note="ScanRegExp hit to PS00196, Type-1 copper (blue)
FT                   proteins signature. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   CDS_pept        complement(158375..159046)
FT                   /transl_table=11
FT                   /locus_tag="BP0825"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Vibrio cholerae hypothetical protein
FT                   Vc2666 TR:Q9KNR5 (EMBL:AE004332) (205 aa) fasta scores:
FT                   E(): 2.1e-30, 43.781% id in 201 aa, and to Bacillus
FT                   halodurans Bh3429 protein Bh3429 TR:Q9K7D5 (EMBL:AP001518)
FT                   (215 aa) fasta scores: E(): 3.8e-14, 31.818% id in 198 aa"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZR6"
FT                   /protein_id="CAE41128.1"
FT                   /translation="MSDQSASVSTHWVPHQPAERILMTLKTRGPQGIAAIAEVLDVTAE
FT                   AVRQQMARLQVEGLVDAETRSAGRGRPTQIWRLTQAGHARFPDMHAEMTVQMLGAVRQV
FT                   FGESGIDKLIGAREASMRASYAEAMQGADGLRERLERLVAVRSREGYMAELVATDDGYL
FT                   LVENHCPICAAAQACMAFCRSELDLFREIIGPQARVERAEHILAGARRCAYTVRPLRQA
FT                   A"
FT   misc_feature    complement(158891..158956)
FT                   /note="Predicted helix-turn-helix motif with score 1118
FT                   (+2.99 SD) at aa 31-52, sequence QGIAAIAEVLDVTAEAVRQQMA"
FT   CDS_pept        complement(159061..160554)
FT                   /transl_table=11
FT                   /locus_tag="BP0826"
FT                   /product="outer membrane component of multidrug efflux
FT                   system"
FT                   /note="Similar to Pseudomonas aeruginosa mexE, mexF & oprN
FT                   genes OprN TR:P95423 (EMBL:X99514) (472 aa) fasta scores:
FT                   E(): 5e-47, 39.703% id in 471 aa, and to Xanthomonas
FT                   maltophilia (Pseudomonas maltophilia) (Stenotrophomonas
FT                   SmeC TR:Q9RBY7 (EMBL:AF173226) (471 aa) fasta scores: E():
FT                   1.1e-31, 33.612% id in 479 aa"
FT                   /db_xref="GOA:Q7VZR5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZR5"
FT                   /protein_id="CAE41129.1"
FT                   /translation="MTHPVPTTFARTAGALLAALALAGCAVGPQYQAPTPAPVKLASPE
FT                   QALFSADRLQREWWRQLQDARLDALIGLALARNLDIGLALARNLDIRQAQARLREARAA
FT                   LDEKELDRWPTVTAAGGYTRSLSQINPGPDQRNLAQSYRAGFDATWEIDLFGRLQRRAE
FT                   AAAARDQAAAADLAQTRLVVVAELARNYFEMRGAEQRLAVARANLATQQETLRVTAALV
FT                   ETGRGYAGDLASARAELAGTRALLAPLETQRRLAQYHIAVLAAMRPAELGELRQEQPLA
FT                   PLAAQLPIGDVAMLLQRRPDVRAAERLLAATNADVGAITAELYPRIDLGGFLGFIALRG
FT                   GDLGQASSKAFALAPTISWPALHLGSVQAQLRAGQARHDAARARYEQVALQAIEEVEGA
FT                   LTRYGQNQQRLRDLLDSATQSQRAADLAQTRYREGAAPYLTVLDAQRTLLRAQDAVAQS
FT                   ESESYTSLVALYKALGGGWNTDAAAPARSARTAALPASP"
FT   misc_feature    complement(159100..159693)
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein"
FT   misc_feature    complement(159727..160326)
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein"
FT   misc_feature    complement(160459..160554)
FT                   /note="Signal peptide predicted for BP0826 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.755 between residues 32 and 33"
FT   CDS_pept        complement(160551..163664)
FT                   /transl_table=11
FT                   /locus_tag="BP0827"
FT                   /product="integral membrane component of multidrug efflux
FT                   system"
FT                   /note="Similar to Pseudomonas aeruginosa probable Rnd
FT                   efflux transporter Pa4207 TR:Q9HWH4 (EMBL:AE004837) (1029
FT                   aa) fasta scores: E(): 0, 69.697% id in 1023 aa, and to
FT                   Vibrio cholerae multidrug resistance protein, putative
FT                   Vc0164 TR:Q9KVI2 (EMBL:AE004106) (1036 aa) fasta scores:
FT                   E(): 3.4e-183, 48.309% id in 1035 aa"
FT                   /db_xref="GOA:Q7VZR4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZR4"
FT                   /protein_id="CAE41130.1"
FT                   /translation="MTFTDLFVRRPVLALVVSTLILLLGLRATGELPVRQYPLTENTTI
FT                   TITTQYPGASPELMQGFVTQPIAQAVATVENIDYLSSSSTQGRSLITVRMKLNADSNKA
FT                   LTEIMAKVNQVKYRLPQEIYDPVLAKSSGEATSVAYVGFSSKTMPIPALTDYLQRVVLP
FT                   QLSSIDGVASVDLYGGQTLAMRVWLDPARMAARGISAGEIAQALRDNNVQAAPGQTKGL
FT                   YVVSNIQVNTDLNSLTDFRDMVVRQVDGAIVRLGDVGTVELGAASYDSSARMDGEKAVY
FT                   FGLNATPVGNPLTIVERINALLPGIKQNLPPGVEVQVPFELARFINASIDEVRNTQLEA
FT                   VLIVVAVIFLCLGSLRAVLVPVVTIPLSMLGAAAIMLSLGFSINLLTLLAMVLAIGLVV
FT                   DDAIVVVENVHRHIEEGKSPVHAALVGAREVAGPVIAMTLTLAAVYAPIGLMGGLTGSL
FT                   FKEFAFTLAAAVGVSGVIALTLSPVMSSFLLNSRVSEGWMARKAEHFFQRLGDAYGRVL
FT                   DVSLRHRWVTGLIAVVVLANLPVLYGSAQRELAPAEDQAMILTAVKSPQHANIDYVEKF
FT                   GQKWDTVMQEIPEQNGRWLINGSDGVANSIGGVNLVTWQARKRSADEIQGDLQNRVNAI
FT                   EGSNTFAFQLPSLPGSTGGLPVQMVLMSAADYRVVYDAMETLKHAARASGLFMVVDSDL
FT                   DYNNPVVRVDIDRAKANSLGVTMKAIGDTLAVLVGENYVNRFGMDGRSYDVIPQSPRGM
FT                   RLTPQSLGQFYVKSASGAQVPLATLVKISMGVEPNRLTQFDQLNSATFQAIPMPGVTMG
FT                   DAMQFLTEQARLLPPGFSHDWQSDARQYSQEGSALVVTFLFAIIVIYLVLAAQYESLRD
FT                   PLIILVSVPMSICGALIPLALGMATINIYTQIGLVTLIGLISKHGILMVEFANEMQAHA
FT                   GLDRRAAMERAARIRLRPILMTTAAMVVGLVPLLFASGAGAHSRFSLGLVIVVGMLVGT
FT                   LFTLFVLPTMYTLLARDHRAAGQSARARELARLDAQAGAASPAHETAS"
FT   misc_feature    complement(160653..163658)
FT                   /note="HMMPfam hit to PF00873, AcrB/AcrD/AcrF family"
FT   misc_feature    complement(join(160656..160721,160767..160832,
FT                   160980..161045,161076..161132,162198..162263,
FT                   162309..162374,162474..162539,162585..162650))
FT                   /note="8 probable transmembrane helices predicted for
FT                   BP0827 by TMHMM2.0 at aa 338-360, 375-397, 430-452,
FT                   467-489, 844-863, 873-895, 944-966 and 981-1003"
FT   misc_feature    complement(163575..163664)
FT                   /note="Signal peptide predicted for BP0827 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.857) with cleavage site
FT                   probability 0.695 between residues 30 and 31"
FT   CDS_pept        complement(163677..164783)
FT                   /transl_table=11
FT                   /locus_tag="BP0828"
FT                   /product="probable HlyD-family secretion protein"
FT                   /note="Similar to Pseudomonas aeruginosa probable Rnd
FT                   efflux membrane fusion protein precursor Pa4206 TR:Q9HWH5
FT                   (EMBL:AE004837) (370 aa) fasta scores: E(): 4.6e-48,
FT                   48.011% id in 352 aa, and to Vibrio cholerae hypothetical
FT                   protein Vc0165 TR:Q9KVI1 (EMBL:AE004106) (368 aa) fasta
FT                   scores: E(): 1.7e-30, 36.593% id in 317 aa"
FT                   /db_xref="GOA:Q7VZR3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZR3"
FT                   /protein_id="CAE41131.1"
FT                   /translation="MKSKKGTLAAGIVAAVAIAGGAWLYLRDAGSAPAWTMAPVKVAAA
FT                   PAALGPLPVTLAGIGTLQASRQVVIPAEVDGRIARIAFESGQAVRAGQVLAQLNDAPEQ
FT                   GDLARLQAQLRNARSVLERTRRLVPQQAATAEQLDQARAAYDQAAGEVRRVQALVEQKQ
FT                   VKAPFDGVLGVRRVDLGQFVRAGEPVVSLTDARTMYADITLPEQALRDIRTGQAVSVGV
FT                   DAYPGRAFDGVVSTIEPQVSAQARTLLVCATLPNPDGVLAPGMYVNARVALPERPGVIT
FT                   VPETAVSYSAYGDSVYVVDDTVRPATVRQVFLKTAERVDSRIVVTEGLQAGQRVVTSGQ
FT                   LRLHNGAAVEVFGQDTLAAGGGTALASH"
FT   misc_feature    complement(163773..164588)
FT                   /note="HMMPfam hit to PF00529, HlyD family secretion
FT                   protein"
FT   misc_feature    complement(164706..164762)
FT                   /note="1 probable transmembrane helix predicted for BP0828
FT                   by TMHMM2.0 at aa 7-26"
FT   misc_feature    complement(164727..164783)
FT                   /note="Signal peptide predicted for BP0828 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.438 between residues 19 and 20"
FT   CDS_pept        complement(164907..165575)
FT                   /transl_table=11
FT                   /locus_tag="BP0829"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Streptomyces lipmanii StgU TR:O88133
FT                   (EMBL:AJ006517) (210 aa) fasta scores: E(): 7.2e-21,
FT                   41.743% id in 218 aa, and to Streptomyces coelicolor
FT                   hypothetical 23.3 kDa protein Sc2h4.05 TR:O86588
FT                   (EMBL:AL031514) (216 aa) fasta scores: E(): 1.1e-19,
FT                   39.524% id in 210 aa"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR029229"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZR2"
FT                   /protein_id="CAE41132.1"
FT                   /translation="MAGKRSYEDGCAGAHALDLVGERWALLVVRELLLGPKRFTDLRKG
FT                   LPGISPNVLTQRLTELEAVAVLRRRKLDPPAGAWVYELTDWGRELEPVILQLGKWGARS
FT                   PALPREAGLSVDSLVLSFRAMFDPRAAARLTATYELVLNGQHFWARVENGQIALLRGRP
FT                   PARPDATIEASPNALAALVYDDGDLDAAVAAEQLRYSGPRAGIARFLGLFTLPEPAAQD
FT                   "
FT   misc_feature    complement(165252..165521)
FT                   /note="HMMPfam hit to PF01638, Protein of unknown function
FT                   DUF24"
FT   repeat_region   165694..165725
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   165694..166746
FT   CDS_pept        165796..166746
FT                   /transl_table=11
FT                   /locus_tag="BP0830"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q79H25"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H25"
FT                   /protein_id="CAE41133.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT"
FT   misc_feature    166054..166119
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    166177..166710
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(166715..166746)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        166829..168787
FT                   /transl_table=11
FT                   /gene="betT"
FT                   /locus_tag="BP0831"
FT                   /product="high-affinity choline transport protein"
FT                   /note="Similar to Escherichia coli high-affinity choline
FT                   transport protein BetT or B0314 or Z0401 or Ecs0360
FT                   SW:BETT_ECOLI (P17447) (677 aa) fasta scores: E(): 2.1e-92,
FT                   42.249% id in 658 aa, and to Pseudomonas aeruginosa
FT                   probable choline transporter Pa5291 TR:Q9HTR3
FT                   (EMBL:AE004941) (661 aa) fasta scores: E(): 2.5e-188,
FT                   74.732% id in 653 aa. Also similar to BP0804, 37.348%
FT                   identity (38.522% ungapped) in 656 aa overlap."
FT                   /db_xref="GOA:Q7VZR1"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZR1"
FT                   /protein_id="CAE41134.1"
FT                   /translation="MQNELKPTINKPVFLTSALFILLLVVFTIAAPATAQDFFNVIQAW
FT                   ILGNASWFYILTVAIILLAVIFVAVSRYGNIKLGPDHSEPDYRDITWFAMLFSTGMGIG
FT                   LMFFGVAEPVMHFIDPPVGEGGTALAAREAMKITFFHWGLHAWAIYASVALVLAFFCFR
FT                   HGLPLTLRSALYPLIGERIYGPIGHAVDIFAIIGTVFGVATSLGLGVAQINSGLNHLFG
FT                   VPVGIPTQIILIVISCGLATISVASGLDRGIRILSETNLLLAVVLLLFVLVLGPTVFLL
FT                   QTFVQNTGAYLSDIVNKTFNLYAYEPTDWIGGWTLFYWGWWIAWSPFVGLFIARISRGR
FT                   TIRQFVGGVLLVPAGFTLFWMTVFGDAAIHAILVEGMGSLAETVKADSSLALFAFLEHL
FT                   PWGSVTSVVAIVMVVVFFVTSADSGALVVDQLASGGAESTPVWQRIFWSTLMGVVAIAL
FT                   LLADGLQALQTATIASALPFSIILLLALWGLFKALRLDATKRSLLHRTITRTQPVRGQN
FT                   WEHRLRNIVMMPRRAHVLRFISDVVRPAMDDVAEALRKEAYEAQVVDGEEGEVRLEVSH
FT                   GVYLDFSYAVYPRSEVRPSLTPQEANDEEERRYFRAEVHLREGGQDYDIMGWTRDEVIG
FT                   DILDQYERHRHYLHVVH"
FT   misc_feature    166829..166933
FT                   /note="Signal peptide predicted for BP0831 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.985 between residues 35 and 36"
FT   misc_feature    join(166865..166933,166976..167035,167096..167164,
FT                   167264..167332,167393..167461,167504..167572,
FT                   167609..167677,167756..167824,167861..167920,
FT                   168023..168091,168161..168229,168239..168298)
FT                   /note="12 probable transmembrane helices predicted for
FT                   BP0831 by TMHMM2.0 at aa 13-35, 50-69, 90-112, 146-168,
FT                   189-211, 226-248, 261-283, 310-332, 345-364, 399-421,
FT                   445-467 and 471-490"
FT   misc_feature    166865..168316
FT                   /note="HMMPfam hit to PF02028, BCCT family transporter"
FT   misc_feature    167765..167794
FT                   /note="ScanRegExp hit to PS01303, BCCT family of
FT                   transporters signature. Confirmed by InterPro eMOTIF
FT                   pattern match."
FT   CDS_pept        168815..169516
FT                   /transl_table=11
FT                   /locus_tag="BP0832"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="Similar to Yersinia pestis hypothetical
FT                   transcriptional regulator TR:Q9ZC44 (EMBL:AL031866) (320
FT                   aa) fasta scores: E(): 3.9e-39, 54.091% id in 220 aa, and
FT                   to Rhizobium meliloti putative LysR-type regulator Sma0498
FT                   TR:AAK64920 (EMBL:AE007219) (299 aa) fasta scores: E():
FT                   2.7e-13, 31.364% id in 220 aa"
FT                   /db_xref="GOA:Q7VZR0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZR0"
FT                   /protein_id="CAE41135.1"
FT                   /translation="MTLKQLEAFYWAATCASFAVAADRLHLSLSSLSKRIAELESALGL
FT                   DLFDRSGHRAVLTAAGERLLPQARDLLASADRIRASLRAEPELGVRCRFGVGELSALTW
FT                   LPRLIGRVRGRYPGLALEPYVDVGQVLKRKVAEGELDFAVVAGASSHSAIASAPVGQAH
FT                   FAWVAAPSVAGAAQSLTPQLLAGTALVSLPDGAGTTRLLDPWLAGGAPAGPRLAGCPER
FT                   ALRGTPRLRYL"
FT   misc_feature    168815..168877
FT                   /note="Signal peptide predicted for BP0832 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.941) with cleavage site
FT                   probability 0.836 between residues 21 and 22"
FT   misc_feature    168821..169246
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    168860..168925
FT                   /note="Predicted helix-turn-helix motif with score 1212
FT                   (+3.31 SD) at aa 16-37, sequence ASFAVAADRLHLSLSSLSKRIA"
FT   misc_feature    168863..168955
FT                   /note="ScanRegExp hit to PS00044, Bacterial regulatory
FT                   proteins, lysR family signature."
FT   CDS_pept        join(169521..169649,169648..170478)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0833"
FT                   /product="conserved hypothetical protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 43. The frameshift occurs within a
FT                   polymeric tract of (CG)3. The sequence has been checked and
FT                   believed to be correct. Similar to Rhizobium loti Mll8080
FT                   protein Mll8080 TR:Q984B1 (EMBL:AP003013) (285 aa) fasta
FT                   scores: E(): 6.4e-18, 31.950% id in 241 aa, and to
FT                   Agrobacterium tumefaciens Agr_c_1840p TR:AAK86810
FT                   (EMBL:AE008031) (325 aa) fasta scores: E(): 1.8e-12,
FT                   26.299% id in 308 aa"
FT                   /db_xref="PSEUDO:CAE41136.1"
FT   variation       169648..169653
FT                   /note="(CG)3 in pertussis; (CG)4 in parapertussis and
FT                   bronchiseptica"
FT   CDS_pept        170475..171290
FT                   /transl_table=11
FT                   /locus_tag="BP0834"
FT                   /product="probable DNA repair exonuclease"
FT                   /note="Similar to Rhizobium loti 3',5'-cyclic-nucleotide
FT                   phosphodiesterase CpdA homolog Mll9676 TR:Q98NZ2
FT                   (EMBL:AP003017) (269 aa) fasta scores: E(): 2.2e-26,
FT                   35.659% id in 258 aa, and to Caulobacter crescentus
FT                   hypothetical protein Cc3556 TR:Q9A2K5 (EMBL:AE006014) (262
FT                   aa) fasta scores: E(): 5.4e-20, 35.484% id in 248 aa"
FT                   /db_xref="GOA:Q7VZQ9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZQ9"
FT                   /protein_id="CAE41137.1"
FT                   /translation="MMRVLHISDTHFGTEREPVVHALHALADTLRPDLVVLGGDITQRA
FT                   RRGQFAAARRFIQALQRPVLAVPGNHDIPLFNLAARLFDPYGNYRRALGAVLEPVYEDD
FT                   RLLAIGVNSTRAARRKNGEVSRTQAQRVAQRLRDARPGQLRVVALHHPVHAMVESDQRN
FT                   LLIGREFAVPAWVDAGVDLILGGHIHLPYVAPLHGKAGEAGRRAWTVQAGTAVSRRVRG
FT                   RVPNSVNLIDYAAQADSPACTVQRWDFQTDSGAFVLFGQQVLALNRARG"
FT   misc_feature    170478..171167
FT                   /note="HMMPfam hit to PF02549, DNA repair exonuclease"
FT   CDS_pept        171307..172110
FT                   /transl_table=11
FT                   /locus_tag="BP0835"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Bacillus megaterium hypothetical 24.9 kDa
FT                   protein in cytochrome p450meg gene 3'region TR:Q06074
FT                   (EMBL:Z21972) (216 aa) fasta scores: E(): 9.7e-13, 31.658%
FT                   id in 199 aa, and to Caulobacter crescentus Pap2
FT                   superfamily protein Cc3019 TR:Q9A424 (EMBL:AE005965) (259
FT                   aa) fasta scores: E(): 1.3e-10, 36.134% id in 238 aa"
FT                   /db_xref="GOA:Q7VZQ8"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZQ8"
FT                   /protein_id="CAE41138.1"
FT                   /translation="MPLFVNLLADVSSIDPMESYAVWIAAHPIIIFVAAPVLAAAGALL
FT                   LWQLVAGLPAGRRRTMVFAVLALVAVGVFGALAASVEHQGGMVAFDQALARALGLSMPA
FT                   ALLWVLSWFTHLGDRTLLTLVAVGMTLTLLWRRRWVLAGACVAATGGAGALNWLLKRAF
FT                   QRVRPDHLHGYTLADGWSFPSGHASASMAVYGIACYLMLRTLPARWRSSALAGVAALIV
FT                   AIGVSRVLLQVHFLSDVVAGFAITAAWLALCVAVTEWALRVNARA"
FT   misc_feature    join(171379..171447,171484..171543,171586..171654,
FT                   171715..171783,171841..171909,171943..172011,
FT                   172021..172089)
FT                   /note="7 probable transmembrane helices predicted for
FT                   BP0835 by TMHMM2.0 at aa 25-47, 60-79, 94-116, 137-159,
FT                   179-201, 213-235 and 239-261"
FT   misc_feature    171634..172092
FT                   /note="HMMPfam hit to PF01569, PAP2 superfamily"
FT   CDS_pept        complement(172094..172528)
FT                   /transl_table=11
FT                   /locus_tag="BP0836"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti putative
FT                   oxidoreductase protein Smc01572 TR:CAC46902 (EMBL:AL591790)
FT                   (155 aa) fasta scores: E(): 0.00047, 32.593% id in 135 aa,
FT                   and to Rhizobium loti probable oxidoreductase Mlr0254
FT                   TR:Q98N82 (EMBL:AP002994) (305 aa) fasta scores: E():
FT                   0.016, 30.075% id in 133 aa"
FT                   /db_xref="GOA:Q7VZQ7"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZQ7"
FT                   /protein_id="CAE41139.1"
FT                   /translation="MTREITIIGLGATGSQAAHALLHAAPDVSLTLYDRQPLRCEPFRG
FT                   QATLAASAAEALRESAVIVLALTDEREIDRTLERFSDGKVGVDLQGKRVLDLCPSPPDW
FT                   VRALGAAVSEAGADYRHADPREVAGERAGPQALLRLMLAR"
FT   misc_feature    complement(172469..172528)
FT                   /note="Signal peptide predicted for BP0836 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.916) with cleavage site
FT                   probability 0.715 between residues 20 and 21"
FT   CDS_pept        complement(172525..172959)
FT                   /transl_table=11
FT                   /locus_tag="BP0837"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa4093 TR:Q9HWT5 (EMBL:AE004825) (138 aa) fasta
FT                   scores: E(): 1.2e-09, 40.164% id in 122 aa, and to
FT                   Rhizobium meliloti hypothetical transmembrane protein
FT                   Smc01805 TR:CAC45823 (EMBL:AL591786) (143 aa) fasta scores:
FT                   E(): 3e-08, 34.815% id in 135 aa"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZQ6"
FT                   /protein_id="CAE41140.1"
FT                   /translation="MNIPAAEPRARMTLAEFHRLLADQHPFAQVLGIDVVDIGHGTARA
FT                   VLPARDTHQRLGGIVAGPMLMGLADLTMYAAVVGATGQAGAVTANLTIHFLRKTSGAAV
FT                   IADARVLKTGRLAMAEAILRCDGADEPVAHVVSAWAVPAP"
FT   CDS_pept        complement(172961..173539)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0838"
FT                   /product="probable TetR-family transcriptional regulator
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. The insertion occurred near the
FT                   N-terminus. Similar to Aquifex aeolicus transcriptional
FT                   regulator Acrr2 or Aq_2179 TR:O67927 (EMBL:AE000776) (192
FT                   aa) fasta scores: E(): 3.3e-05, 32.479% id in 117 aa, and
FT                   to Caulobacter crescentus transcriptional regulator, TetR
FT                   family Cc3123 TR:Q9A3S9 (EMBL:AE005976) (202 aa) fasta
FT                   scores: E(): 0.00016, 31.206% id in 141 aa"
FT   misc_feature    complement(173372..173512)
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family"
FT   misc_feature    complement(173399..173464)
FT                   /note="Predicted helix-turn-helix motif with score 1613
FT                   (+4.68 SD) at aa 18-39, sequence TTIRAIAKEADCTTGAIYPWFD"
FT   CDS_pept        complement(173533..174483)
FT                   /transl_table=11
FT                   /locus_tag="BP0839"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA3"
FT                   /protein_id="CAE41142.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   repeat_region   173533..173564
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(173533..173953)
FT   misc_feature    complement(173569..174102)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(173952..174585)
FT   misc_feature    complement(174160..174225)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   CDS_pept        174796..175953
FT                   /transl_table=11
FT                   /locus_tag="BP0840"
FT                   /product="outer membrane porin protein precursor"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis outer membrane porin protein precursor
FT                   SW:OMP_BORPE (Q04064) (385 aa) fasta scores: E(): 4e-149,
FT                   100.000% id in 385 aa. Also similar to BP2851 (53.728%%
FT                   identity in 389 aa overlap), and BP0267 (58.844% identity
FT                   in 294 aa overlap), and its C-terminus is similar to BP0138
FT                   (66.667% identity in 90 aa overlap)."
FT                   /db_xref="GOA:Q04064"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q04064"
FT                   /protein_id="CAE41143.1"
FT                   /translation="MKKTLLAAALLAGFAGAAQAETSVTLYGIIDTGIGYNDVDFKVKG
FT                   ANADDSDFKYNHSRFGMINGVQNGSRWGLRGTEDLGDGLQAVFQLESGFNSGNGNSAQD
FT                   GRLFGRQATIGLQSESWGRLDFGRQTNIASKYFGSIDPFGAGFGQANIGMGMSAMNTVR
FT                   YDNMVMYQTPSYSGFQFGIGYSFSANDKDADAVNRVGFATADNVRAITTGLRYVNGPLN
FT                   VALSYDQLNASNNQAQGEVDATPRSYGLGGSYDFEVVKLALAYARTTDGWFGGQGYPVA
FT                   VTLPSGDKFGGFGVNTFADGFKANSYMVGLSAPIGGASNVFGSWQMVDPKLTGGDEKMN
FT                   VFSLGYTYDLSKRTNLYAYGSYAKNFAFLEDAKSTAVGVGIRHRF"
FT   misc_feature    174796..174855
FT                   /note="Signal peptide predicted for BP0840 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.997 between residues 20 and 21"
FT   misc_feature    174985..175179
FT                   /note="HMMPfam hit to PF00267, Gram-negative porin"
FT   misc_feature    175294..175341
FT                   /note="ScanRegExp hit to PS00225, Crystallins beta and
FT                   gamma 'Greek key' motif signature."
FT   misc_feature    175795..175950
FT                   /note="HMMPfam hit to PF00267, Gram-negative porin"
FT   CDS_pept        176142..176501
FT                   /transl_table=11
FT                   /gene="nuoA"
FT                   /locus_tag="BP0841"
FT                   /product="probable NADH-ubiquinone oxidoreductase chain 3"
FT                   /note="Similar to Paracoccus denitrificans NADH-ubiquinone
FT                   oxidoreductase chain 7 Nqo7 SW:NQO7_PARDE (P29919) (121 aa)
FT                   fasta scores: E(): 5e-28, 60.345% id in 116 aa, and to
FT                   Rhodobacter capsulatus NADH dehydrogenase I chain A NuoA
FT                   SW:NUOA_RHOCA (O84969) (126 aa) fasta scores: E(): 1.1e-28,
FT                   60.345% id in 116 aa"
FT                   /db_xref="GOA:Q7VZQ5"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZQ5"
FT                   /protein_id="CAE41144.1"
FT                   /translation="MNLHPYFPVLLFILVATLIGFALLTAGSLLGPRRPYAEKLSPYEC
FT                   GFEAFEDARMKFDVRYYLVAILFILFDLEIAFLFPWAIAQGTVGLVGFWTVMVFLAVLT
FT                   VGFIYEWKKGALDWE"
FT   misc_feature    176142..176216
FT                   /note="Signal peptide predicted for BP0841 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.970) with cleavage site
FT                   probability 0.396 between residues 25 and 26"
FT   misc_feature    join(176169..176237,176322..176390,176400..176468)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BP0841 by TMHMM2.0 at aa 10-32, 61-83 and 87-109"
FT   misc_feature    176253..176495
FT                   /note="HMMPfam hit to PF00507,
FT                   NADH-ubiquinone/plastoquinone oxidoreductase, chain 3"
FT   CDS_pept        176538..177014
FT                   /transl_table=11
FT                   /gene="nuoB"
FT                   /locus_tag="BP0842"
FT                   /product="NADH-ubiquinone oxidoreductase, 20 kDa subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Arabidopsis thaliana NADH-ubiquinone
FT                   oxidoreductase 20 kDa subunit, mitochondrial precursor
FT                   T22p22_160 SW:NUKM_ARATH (Q42577) (218 aa) fasta scores:
FT                   E(): 4e-51, 85.714% id in 140 aa, and to Neisseria
FT                   meningitidis NADH dehydrogenase I, B subunit Nmb0242
FT                   TR:Q9K1C2 (EMBL:AE002381) (160 aa) fasta scores: E():
FT                   1e-53, 81.646% id in 158 aa"
FT                   /db_xref="GOA:Q7VZQ4"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZQ4"
FT                   /protein_id="CAE41145.1"
FT                   /translation="MAIDGILKQGFITTSADKFLNWAKTGSMWPMTFGLACCAVEMMHA
FT                   GAARYDLDQFGIIFRPSPRQSDLMIVAGTLCNKMGPALRKVYDQMPEPRWVVSMGSCAN
FT                   GGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGLLQMQNKIRLTNTIAR"
FT   misc_feature    176655..176978
FT                   /note="HMMPfam hit to PF01058, NADH ubiquinone
FT                   oxidoreductase, 20 Kd subunit"
FT   misc_feature    176889..176939
FT                   /note="ScanRegExp hit to PS01150, Respiratory-chain NADH
FT                   dehydrogenase 20 Kd subunit signature. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   CDS_pept        177089..177712
FT                   /transl_table=11
FT                   /gene="nuoC"
FT                   /locus_tag="BP0843"
FT                   /product="respiratory-chain NADH dehydrogenase, 30 kDa
FT                   subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Neurospora crassa NADH-ubiquinone
FT                   oxidoreductase 30.4 kDa subunit, mitochondrial precursor
FT                   Nuo-31 SW:NUGM_NEUCR (P23710) (283 aa) fasta scores: E():
FT                   5.9e-22, 41.250% id in 160 aa, and to Neisseria
FT                   meningitidis NADH dehydrogenase I chain C NuoC or Nmb0243
FT                   SW:NUOC_NEIMB (Q9K1C1) (197 aa) fasta scores: E(): 4.8e-43,
FT                   55.172% id in 203 aa"
FT                   /db_xref="GOA:Q7VZQ3"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZQ3"
FT                   /protein_id="CAE41146.1"
FT                   /translation="MMMTRLETLKNNLQAAFGQDLALTESLGELTLEVAAEQWFSACTK
FT                   LRTDPALRFESCIDLCGVDYLTWGNGTQPEEKTGPVTRGRYAVVVHLLSIEHNWRLRVR
FT                   TWAPDDEFPMVSSLLECWPGVNWFEREAFDLYGIVFEGHPDLRRILTDYGFIGHPFRKD
FT                   FPLSGTVEMRYDPEQKRVIYQPVTIDPREITPRVVREDSYGMGR"
FT   misc_feature    177395..177604
FT                   /note="HMMPfam hit to PF00329, Respiratory-chain NADH
FT                   dehydrogenase, 30 Kd subunit"
FT   misc_feature    177473..177538
FT                   /note="ScanRegExp hit to PS00542, Respiratory chain NADH
FT                   dehydrogenase 30 Kd subunit signature."
FT   CDS_pept        177715..178971
FT                   /transl_table=11
FT                   /gene="nuoD"
FT                   /locus_tag="BP0844"
FT                   /product="respiratory-chain NADH dehydrogenase, 49 kDa
FT                   subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Paracoccus denitrificans NADH-ubiquinone
FT                   oxidoreductase chain 4 Nqo4 SW:NQO4_PARDE (P29916) (412 aa)
FT                   fasta scores: E(): 1.6e-56, 59.277% id in 415 aa, and to
FT                   Neisseria meningitidis NADH dehydrogenase I chain D NuoD or
FT                   Nma0016 TR:Q9JX81 (EMBL:AL162752) (418 aa) fasta scores:
FT                   E(): 1.1e-134, 74.760% id in 416 aa"
FT                   /db_xref="GOA:Q7VZQ2"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZQ2"
FT                   /protein_id="CAE41147.1"
FT                   /translation="MAEIKNYTLNFGPQHPAAHGVLRLVLELDGEVIQRADPHIGLLHR
FT                   ATEKLAEHKTFIQALPYMDRLDYVSMMCNEHAYVMAIEKLLGIEAPLRAQYIRVMFDEI
FT                   TRVLNHLMSLGSHALDVGAMAVFLYAFREREDLMDCYEAVSGARMHAAYYRPGGVYRDL
FT                   PDTMPQYGDSSKYRGEKEVRAMNDARSGSLLDFIEDFTNRFPSCVDEYETLLTDNRIWK
FT                   QRLVGIGVVDPDRAKALGFTGPMLRGSGVAWDLRKTQPYEVYDLMDFDVPVGVNGDCYD
FT                   RYLVRVAEMRESNRIIRQCVEWLRNNPGPVMIENHKIAPPSRTAMKSNMEELIHHFKLF
FT                   SEGFHVPPGEAYAAVEHPKGEFGIYLVADGANKPYRLKIRAPGFAHLQSLDEMARGHMI
FT                   ADAVTIIGTQDIVFGEIDR"
FT   misc_feature    177841..177876
FT                   /note="ScanRegExp hit to PS00535, Respiratory chain NADH
FT                   dehydrogenase 49 Kd subunit signature."
FT   misc_feature    178072..178206
FT                   /note="HMMPfam hit to PF00346, Respiratory-chain NADH
FT                   dehydrogenase, 49 Kd subunit"
FT   misc_feature    178291..178968
FT                   /note="HMMPfam hit to PF00346, Respiratory-chain NADH
FT                   dehydrogenase, 49 Kd subunit"
FT   CDS_pept        179017..179511
FT                   /transl_table=11
FT                   /gene="nuoE"
FT                   /locus_tag="BP0845"
FT                   /product="respiratory-chain NADH dehydrogenase I, 24 kDa
FT                   subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Rattus norvegicus NADH-ubiquinone
FT                   oxidoreductase 24 kDa subunit precursor NdufV2 SW:NUHM_RAT
FT                   (P19234) (241 aa) fasta scores: E(): 3.8e-22, 39.490% id in
FT                   157 aa, and to Neisseria meningitidis NADH dehydrogenase I,
FT                   E subunit Nmb0245 TR:Q9K1B9 (EMBL:AE002381) (157 aa) fasta
FT                   scores: E(): 8.2e-37, 62.000% id in 150 aa"
FT                   /db_xref="GOA:Q7VZQ1"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZQ1"
FT                   /protein_id="CAE41148.1"
FT                   /translation="MLLSEQAYKKIDRELAKFPADQRQSAIMASLAIAQEEKGWLPAEI
FT                   LEDVANYIGVPPIAVQEVATFYNMFDVKPVGTHKIAVCTNLPCALRDGEKAADYLKRKL
FT                   GVDFRETTADGRFTLIEGECMGACGDSPVLIVNNKHMCVRMTEEKLDALVDGLKSQGES
FT                   A"
FT   misc_feature    179017..179490
FT                   /note="HMMPfam hit to PF01257, Respiratory-chain NADH
FT                   dehydrogenase 24 Kd subunit"
FT   CDS_pept        179508..180875
FT                   /transl_table=11
FT                   /gene="nuoF"
FT                   /locus_tag="BP0846"
FT                   /product="respiratory-chain NADH dehydrogenase, 51 kDa
FT                   subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Rhizobium meliloti NADH dehydrogenase I
FT                   chain F 2 NuoF2 SW:NUF2_RHIME (P56913) (421 aa) fasta
FT                   scores: E(): 3.8e-86, 52.518% id in 417 aa, and to
FT                   Neisseria meningitidis NADH dehydrogenase I chain F NuoF or
FT                   Nma0014 TR:Q9JX83 (EMBL:AL162752) (433 aa) fasta scores:
FT                   E(): 2.7e-133, 77.240% id in 413 aa"
FT                   /db_xref="GOA:Q7VZQ0"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZQ0"
FT                   /protein_id="CAE41149.1"
FT                   /translation="MNAPDLYKRLAQGLDPNPLNDLSISMCLHGRHIAPQIMADVDGEN
FT                   WRLQEYVKRGGYEALRKILTTGMTPEDVIAEVKASGLRGRGGAGFPTGLKWSFMPRAFP
FT                   GQKYLVCNSDEGEPGTFKDRDILRFNPHIVIEGMAIAAYAMGISVGYNYIHGEIFEVYE
FT                   RFEEALEEARAAGFLGDKLLGSDFSFQLHAFHGYGAYICGEETALLESLEGKKGQPRFK
FT                   PPFPASFGLYGKPTTINNTETFAAVPWIIRNGGQAYLEVGKPNNGGTKLFSISGDVERP
FT                   GNYEIPMGTPFSKLLELAGGMRGGRKLKAVIPGGSSAPVLPADIMMDCTMDYDAIAKAG
FT                   SMLGSGAVIVMDETRCMVKSLLRLSYFYFEESCGQCTPCREGTGWLYRMVHRIENGQGR
FT                   PEDLDMLDSVAGNIMGRTICALGDAAAMPVRSFIKHFRDEFAHHIEHKSCVVPQYL"
FT   misc_feature    179622..180479
FT                   /note="HMMPfam hit to PF01512, Respiratory-chain NADH
FT                   dehydrogenase 51 Kd subunit"
FT   misc_feature    180618..180653
FT                   /note="ScanRegExp hit to PS00645, Respiratory-chain NADH
FT                   dehydrogenase 51 Kd subunit signature 2. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   CDS_pept        180891..183218
FT                   /transl_table=11
FT                   /gene="nuoG"
FT                   /locus_tag="BP0847"
FT                   /product="NADH-ubiquinone oxidoreductase, 75 kDa subunit"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Solanum tuberosum NADH-ubiquinone
FT                   oxidoreductase 75 kDa subunit, mitochondrial precursor
FT                   SW:NUAM_SOLTU (Q43644) (738 aa) fasta scores: E(): 2.2e-59,
FT                   36.006% id in 711 aa, and to Neisseria meningitidis NADH
FT                   dehydrogenase I chain G NuoG or Nma0010 TR:Q9JX87
FT                   (EMBL:AL162752) (753 aa) fasta scores: E(): 1.1e-89,
FT                   48.383% id in 773 aa"
FT                   /db_xref="GOA:Q7VZP9"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZP9"
FT                   /protein_id="CAE41150.1"
FT                   /translation="MVELTVDGNQVEVPEGSMVMHAAQKLGLYVPHFCYHKKLSIAANC
FT                   RMCLVEVEKAPKALPACATPVTNGMVVHTCSEKAKAAQKSVMEFLLINHPLDCPICDQG
FT                   GECQLQDLAVGYGGSSSRYKEEKRVVFHKDLGPLVSAEEMARCIHCTRCVRFGQEIAGV
FT                   MELGMLNRGEHAEITSFVGRSIESELSGNMIDLCPVGALTSKPFRYSARTWELARRRSV
FT                   SPHDSMGANLVVQVKGDCALRVVPFENEALNECWISDRDRFSYEGLNSDDRLAAPMIKG
FT                   ADGKWQEASWADALQAVAQGLSRVRESFGAGQIGALASEYATTEEFSLLGRLVRALGSE
FT                   NIDFRLRQTDAGFDAALSGAPWLGMPVAELDNLDRVLVIGSFLRKDHPLMAQRLRQAAK
FT                   RGTQVLLLDAAADDPLMPVAGRLTVAPSGLASALAEVAVALAQAKGQAVPAEFAAVAAG
FT                   EGAKQIAASLASGSNAAVLLGNMAVNAPQAATLAANAQAVAQLAGAKLGFLTAGGNTVG
FT                   GYLAGAVPGKGGKNAAAMLADPLKAYIVLHAEPSLDADNAPQALAALRGAQFAVALTPY
FT                   RSAAQGWADVMLPVAPFTETSGTFVNAQGQPQSFKGTVAPFGQTRPAWKVLRVLGNVLH
FT                   LAGFDEETSETVRDAALAGGVEARLSNAISAPLGLGQPLDALERVADVPIYRTDAIVRR
FT                   SEPLQAAPASRAPKARMNGRTLASLGVSAGDKVRVSGAAGAIELEAALDEAVADRAVRV
FT                   AAAFEQTAALGGAFGQISVERV"
FT   misc_feature    180894..181094
FT                   /note="HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster
FT                   binding domain"
FT   misc_feature    181182..181220
FT                   /note="ScanRegExp hit to PS00642, Respiratory-chain NADH
FT                   dehydrogenase 75 Kd subunit signature 2. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   misc_feature    181326..181358
FT                   /note="ScanRegExp hit to PS00643, Respiratory-chain NADH
FT                   dehydrogenase 75 Kd subunit signature 3. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   misc_feature    181545..181589
FT                   /note="ScanRegExp hit to PS00066,
FT                   Hydroxymethylglutaryl-coenzyme A reductases signature 1."
FT   CDS_pept        183218..184291
FT                   /transl_table=11
FT                   /gene="nuoH"
FT                   /locus_tag="BP0848"
FT                   /product="NADH-ubiquinone oxidoreductase, chain H"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Paracoccus denitrificans NADH-ubiquinone
FT                   oxidoreductase chain 8 Nqo8 SW:NQO8_PARDE (P29920) (345 aa)
FT                   fasta scores: E(): 5.6e-45, 44.109% id in 331 aa, and to
FT                   Neisseria meningitidis NADH dehydrogenase I chain H NuoH or
FT                   Nma0009 TR:Q9JX88 (EMBL:AL162752) (358 aa) fasta scores:
FT                   E(): 7.6e-78, 58.011% id in 362 aa"
FT                   /db_xref="GOA:Q7VZP8"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZP8"
FT                   /protein_id="CAE41151.1"
FT                   /translation="MEWLNVLESHGQALLGPVAWMVVWSLVKIVVIAVPIILCVAYLTY
FT                   WERKMIGAMHVRLGPTRVGFKGLLQPFADVFKLLTKEVVVPSAANKVLFVVAPVVTLMP
FT                   ALAAWAVVPFGPEVVLANVNAGLLYIMAITSIGVYGVIVAGWASNSKYAFLGALRASAQ
FT                   MVSYELAIGFVLVSVLLVSGSLNMSEIVLGQGRGWFAERGLTFLSWNWLPLLPLFIIYV
FT                   ISAVAETNRHPFDVVEGESEIVAGHMVEYSGMAFALFFLGEYANMILLSCMAAIMFLGG
FT                   WMSPIDIAPLNWIPGWIWLGIKTFCVVSMFVWFRASFPRYRYDQIMRLGWKIFIPLTGV
FT                   WLVVLAIWMQTPWNIWR"
FT   misc_feature    join(183275..183343,183491..183550,183593..183661,
FT                   183722..183790,183833..183892,183986..184054,
FT                   184097..184165,184202..184270)
FT                   /note="8 probable transmembrane helices predicted for
FT                   BP0848 by TMHMM2.0 at aa 20-42, 92-111, 126-148, 169-191,
FT                   206-225, 257-279, 294-316 and 329-351"
FT   misc_feature    183281..184270
FT                   /note="HMMPfam hit to PF00146, NADH dehydrogenase"
FT   misc_feature    183914..183955
FT                   /note="ScanRegExp hit to PS00668, Respiratory-chain NADH
FT                   dehydrogenase subunit 1 signature 2. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   CDS_pept        184313..184801
FT                   /transl_table=11
FT                   /gene="nuoI"
FT                   /locus_tag="BP0849"
FT                   /product="NADH-ubiquinone oxidoreductase, chain I"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Paracoccus denitrificans NADH-ubiquinone
FT                   oxidoreductase chain 9 Nqo9 SW:NQO9_PARDE (P29921) (163 aa)
FT                   fasta scores: E(): 2.3e-38, 65.132% id in 152 aa, and to
FT                   Neisseria meningitidis NADH dehydrogenase I chain I NuoI or
FT                   Nma0008 or nmb0251 TR:Q9JQM2 (EMBL:AL162752) (159 aa) fasta
FT                   scores: E(): 7.1e-48, 72.956% id in 159 aa"
FT                   /db_xref="GOA:Q7VZP7"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZP7"
FT                   /protein_id="CAE41152.1"
FT                   /translation="MEAIKDFFGSLLLTELFKGLRLTGKYFFKRKVTLRYPMEKTPTSA
FT                   RFRGLHALRRYPNGEERCIACKLCEAVCPALAITIESEQRDDGTRRTTRYDIDLTKCIF
FT                   CGFCEESCPVDSIVETHIHEYHGEKRGDLYFTKDMLLAVGDRYEAEIARRRAEDAPYR"
FT   misc_feature    184478..184549
FT                   /note="HMMPfam hit to PF00037, 4Fe-4S binding domain"
FT   misc_feature    184499..184534
FT                   /note="ScanRegExp hit to PS00198, 4Fe-4S ferredoxins,
FT                   iron-sulfur binding region signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   misc_feature    184595..184666
FT                   /note="HMMPfam hit to PF00037, 4Fe-4S binding domain"
FT   misc_feature    184616..184651
FT                   /note="ScanRegExp hit to PS00198, 4Fe-4S ferredoxins,
FT                   iron-sulfur binding region signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   misc_feature    184625..184690
FT                   /note="ScanRegExp hit to PS00028, Zinc finger, C2H2 type,
FT                   domain signature."
FT   CDS_pept        184819..185466
FT                   /transl_table=11
FT                   /gene="nuoJ"
FT                   /locus_tag="BP0850"
FT                   /product="NADH-ubiquinone oxidoreductase, chain J"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Paracoccus denitrificans NADH-ubiquinone
FT                   oxidoreductase chain 10 Nqo10 SW:NQOA_PARDE (P29922) (200
FT                   aa) fasta scores: E(): 4.2e-21, 46.927% id in 179 aa, and
FT                   to Neisseria meningitidis NADH dehydrogenase I, J subunit
FT                   Nmb0253 TR:Q9K1B2 (EMBL:AE002382) (223 aa) fasta scores:
FT                   E(): 5.4e-28, 46.009% id in 213 aa"
FT                   /db_xref="GOA:Q7VZP6"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZP6"
FT                   /protein_id="CAE41153.1"
FT                   /translation="MTFTTVLFYILAFVLVIAAFRVITARSPVTAVLHLILAFANAAMI
FT                   WMLLGAEFLALLLVLVYVGAVMVLFLFVVMMLDIRIDSLRDGLKTYLPLGLVIGVVLVL
FT                   EMAFVLGSTWYGAGPQAPVAGDYNNARALGEVMYTQYVYAIEVGAALLLVGMVAAIALT
FT                   LRRRRDAKYNDPVAAVRVRAKDRFRMVKMTAQSDRAQARVASPSADAQGEQQ"
FT   misc_feature    184819..184890
FT                   /note="Signal peptide predicted for BP0850 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.881) with cleavage site
FT                   probability 0.278 between residues 24 and 25"
FT   misc_feature    184828..185310
FT                   /note="HMMPfam hit to PF00499,
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 6"
FT   misc_feature    join(184831..184890,184909..184968,184981..185049,
FT                   185086..185154,185242..185310)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BP0850 by TMHMM2.0 at aa 5-24, 31-50, 55-77, 90-112 and
FT                   142-164"
FT   CDS_pept        185463..185771
FT                   /transl_table=11
FT                   /gene="nuoK"
FT                   /locus_tag="BP0851"
FT                   /product="NADH-ubiquinone oxidoreductase, chain K"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Paracoccus denitrificans NADH-ubiquinone
FT                   oxidoreductase chain 11 Nqo11 SW:NQOB_PARDE (P29923) (101
FT                   aa) fasta scores: E(): 5.4e-23, 69.388% id in 98 aa, and to
FT                   Neisseria meningitidis NADH dehydrogenase I chain K NuoK or
FT                   Nma0005 or Nmb0254 TR:Q9JQU9 (EMBL:AL162752) (101 aa) fasta
FT                   scores: E(): 1e-23, 69.000% id in 100 aa"
FT                   /db_xref="GOA:Q7VZP5"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZP5"
FT                   /protein_id="CAE41154.1"
FT                   /translation="MTLTLAHYLILGAILFAIGIFGIFLNRRNLIILLMSIELVLLAVN
FT                   MNFVAFSSWFGDIAGQVFVFFILTVAAAEAAIGLAILVLLFRNLNTINVDELDRLKG"
FT   misc_feature    185469..185768
FT                   /note="HMMPfam hit to PF00420,
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 4L"
FT   misc_feature    join(185472..185537,185550..185618,185646..185714)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BP0851 by TMHMM2.0 at aa 4-25, 30-52 and 62-84"
FT   CDS_pept        185789..187801
FT                   /transl_table=11
FT                   /gene="nuoL"
FT                   /locus_tag="BP0852"
FT                   /product="NADH-ubiquinone oxidoreductase, chain L"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Synechococcus sp NADH-plastoquinone
FT                   oxidoreductase chain 5 NdhF SW:NU5C_SYNP2 (P31971) (664 aa)
FT                   fasta scores: E(): 3.2e-81, 42.285% id in 674 aa, and to
FT                   Neisseria meningitidis NADH dehydrogenase I chain L NuoL or
FT                   Nma0002 SW:NUOL_NEIMA (Q9JX92) (674 aa) fasta scores: E():
FT                   9.9e-147, 61.367% id in 673 aa"
FT                   /db_xref="GOA:Q7VZP4"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZP4"
FT                   /protein_id="CAE41155.1"
FT                   /translation="MSSSPNLYLLIALAPLVGAILAGQFGTGFLGRPIGRRGSHVITIL
FT                   GVLISTIGSFVVLGDVLDGHTYDGTVYTWSLIGQTKLEIGFLIDPLSAMMMVVVTSVSL
FT                   MVHIYTIGYMADDPGYQRFFAYISLFTFSMLMLVMSNNMVQLFFGWEAVGLVSYLLIGF
FT                   WYTRPTAIFANMKAFLINRVGDFGFVLGIGLLFAYAGTMHYADVFAQADKLAGETLPGT
FT                   DWMLLTVACICLFIGAMGKSAQVPLHAWLPDSMEGPTPISALIHAATMVTAGIFMVARF
FT                   SPLFELSDTALSFVIVIGAIGALFLGILGIIQNDIKRVVAYSTLSQLGYMTVALGASAY
FT                   SVAIFHLMTHAFFKALLFLGAGSVIIGMHHDQDIRNMGGLRKYMPITWITFLLGTLALV
FT                   GTPFFSGFYSKEHIIEAAGAANVWGASFAYYSTLIGVFVTSLYSFRVYFLVFHGKERFD
FT                   AHGHGHHGDAHHDDHGHHGGTPHESPWVVTLPLVLLAIPSVLIGAWVVEPMLFGKFFDG
FT                   VIKVLPQHPAMAELGHEWHGWVAFGLHSVQTVPFWLVVAGAVIAWYCYLINPRVPAAIQ
FT                   STFSGVYKLLENKYYVDWINEQIIARGARCLGYGLWQTGDRGIIDGVLVNGSARVVGWV
FT                   AAISRHLQSGFIYHYAFAMIIGIMALVTFFVLIPQ"
FT   misc_feature    185789..185854
FT                   /note="Signal peptide predicted for BP0852 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.969) with cleavage site
FT                   probability 0.919 between residues 22 and 23"
FT   misc_feature    join(185816..185884,185903..185971,186065..186133,
FT                   186152..186205,186215..186283,186344..186412,
FT                   186455..186508,186569..186628,186656..186724,
FT                   186743..186811,186821..186889,186950..187009,
FT                   187067..187135,187238..187306,187430..187489,
FT                   187724..187792)
FT                   /note="16 probable transmembrane helices predicted for
FT                   BP0852 by TMHMM2.0 at aa 10-32, 39-61, 93-115, 122-139,
FT                   143-165, 186-208, 223-240, 261-280, 290-312, 319-341,
FT                   345-367, 388-407, 427-449, 484-506, 548-567 and 646-668"
FT   misc_feature    185996..186175
FT                   /note="HMMPfam hit to PF00662, NADH-Ubiquinone
FT                   oxidoreductase (complex I), chain 5 N-terminus"
FT   misc_feature    186206..187096
FT                   /note="HMMPfam hit to PF00361,
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains"
FT   CDS_pept        187801..189300
FT                   /transl_table=11
FT                   /gene="nuoM"
FT                   /locus_tag="BP0853"
FT                   /product="NADH-ubiquinone oxidoreductase, chain M"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Marchantia polymorpha NADH-ubiquinone
FT                   oxidoreductase chain 4 Nd4 or Nad4 SW:NU4M_MARPO (P26848)
FT                   (495 aa) fasta scores: E(): 1.3e-83, 47.510% id in 482 aa,
FT                   and to Neisseria meningitidis NADH dehydrogenase chain M
FT                   NuoM or Nma2229 TR:Q9JSL7 (EMBL:AL162758) (498 aa) fasta
FT                   scores: E(): 8.3e-115, 64.414% id in 503 aa"
FT                   /db_xref="GOA:Q7VZP3"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZP3"
FT                   /protein_id="CAE41156.1"
FT                   /translation="MASDMASNNFPWLTLAIFVPIVFGLLVLALGRDDRPGLTRGLSLI
FT                   GALAGFLVTIPLYTGFEAGTAQMQFVEKASWIEAFNVNYHLGIDGISLWFVLLTAFITI
FT                   IVVGAGWQVITSRVAQYMAAFLILSGLMVGVFAALDGMLFYVFFEATLIPMYIIIGVWG
FT                   GPNRVYAAFKFFLYTLLGSLLTLVAFVYLWNVSGGSFDIQTWHQTKLGYTPQVLIFVAL
FT                   LAAFAVKVPMWPVHTWLPDAHVEAPTGGSVVLAAIMLKLGAYGFLRFSLPIAPDASHGL
FT                   AGLMIALSLIAVIYIGLVAIVQDDMKKLVAYSSVAHMGFVTLGFFIFNTAGLEGAIVQM
FT                   ISHGFVSGAMFLCIGVLYDRMHSRRIADYGGVVNVMPRFVTFFVLFSMANSGLPATSGF
FT                   VGEFLVIMGAVEYNFWIGLLTATALILGASYSLWMLKRVAFGDIGNDRVREMTDLSGRE
FT                   FLILGVMAIAVLFMGIYPKPFTDVMHVSVEALLQHVAVSKL"
FT   misc_feature    join(187825..187893,187912..187980,188074..188142,
FT                   188161..188214,188224..188292,188311..188379,
FT                   188437..188505,188542..188610,188638..188706,
FT                   188725..188793,188806..188874,188935..189003,
FT                   189031..189099,189160..189228)
FT                   /note="14 probable transmembrane helices predicted for
FT                   BP0853 by TMHMM2.0 at aa 10-32, 39-61, 93-115, 122-139,
FT                   143-165, 172-194, 214-236, 249-271, 281-303, 310-332,
FT                   337-359, 380-402, 412-434 and 455-477"
FT   misc_feature    188212..189084
FT                   /note="HMMPfam hit to PF00361,
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains"
FT   CDS_pept        189311..190795
FT                   /transl_table=11
FT                   /gene="nuoN"
FT                   /locus_tag="BP0854"
FT                   /product="NADH-ubiquinone oxidoreductase, chain N"
FT                   /EC_number="1.6.5.3"
FT                   /note="Similar to Paracoccus denitrificans NADH-ubiquinone
FT                   oxidoreductase chain 14 Nqo14 SW:NQOE_PARDE (P29926) (499
FT                   aa) fasta scores: E(): 1.7e-60, 41.004% id in 478 aa, and
FT                   to Neisseria meningitidis NADH dehydrogenase chain N NuoN
FT                   or Nma2228 TR:Q9JSL8 (EMBL:AL162758) (481 aa) fasta scores:
FT                   E(): 8.4e-55, 49.290% id in 493 aa"
FT                   /db_xref="GOA:Q7VZP2"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZP2"
FT                   /protein_id="CAE41157.1"
FT                   /translation="MMQSHLDFALATPEILLLVLGLAILLIDAVSSHPERKTTFVLTLA
FT                   TLAALTVVSLLQWRDGVEGQTFNGLYVTDSLAHLLKVASYIAVAATLVYGRIYAQQRDM
FT                   MQRGGELYVLTLFALLGQMVMISAGNLISIYLGLELMSLALYALIALRREDKVATEAAM
FT                   KYFVLGALASGFLLYGMSMVYGATGHLDLAKIAEVIASGQAKQLPLVFGVVFLVSGLAF
FT                   KLGAVPFHMWLPDVYQGSPTAVTLILGAAPKLAAFAITLRLLVDGLHGLAADWQPMLMI
FT                   LAVLSLAIGNLTAIVQTNFKRMLAYSTISHTGFVLLGLMAGVVDGKPDAAASAYGAALF
FT                   YMLTYVLTTLGTFGIILLLARQGFECEQIDDLKGLNRRNPWHAAIVLLLMFSLAGIPPL
FT                   VGFYAKLAVLQALVEAGHVALAVVAVMFSLIGAFYYLRVVKVVYFDDPVDQPAALAVTA
FT                   GQRSILSLNGALILVLGILPGGLMALCVQVIQASLG"
FT   misc_feature    join(189338..189406,189425..189478,189536..189604,
FT                   189641..189694,189704..189766,189803..189871,
FT                   189929..189997,190034..190102,190145..190198,
FT                   190217..190279,190322..190390,190451..190519,
FT                   190547..190615,190715..190783)
FT                   /note="14 probable transmembrane helices predicted for
FT                   BP0854 by TMHMM2.0 at aa 10-32, 39-56, 76-98, 111-128,
FT                   132-152, 165-187, 207-229, 242-264, 279-296, 303-323,
FT                   338-360, 381-403, 413-435 and 469-491"
FT   misc_feature    189692..190606
FT                   /note="HMMPfam hit to PF00361,
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains"
FT   CDS_pept        190812..191141
FT                   /transl_table=11
FT                   /locus_tag="BP0855"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Neisseria meningitidis hypothetical inner
FT                   membrane protein Nma2227 TR:Q9JSL9 (EMBL:AL162758) (116 aa)
FT                   fasta scores: E(): 4.5e-10, 36.634% id in 101 aa"
FT                   /db_xref="GOA:Q7VZP1"
FT                   /db_xref="InterPro:IPR016768"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZP1"
FT                   /protein_id="CAE41158.1"
FT                   /translation="MNQTAAVWLLIALALVSANLPFLSERVFALLPYKRAGVHAPKPFW
FT                   LRLCEVLVWYAVVGLLGFAFEAQLGNRFAQAWEFYAITFSLFLVLGYPGFVYRYLYKKR
FT                   RPARA"
FT   misc_feature    190812..190865
FT                   /note="Signal peptide predicted for BP0855 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.969) with cleavage site
FT                   probability 0.300 between residues 18 and 19"
FT   misc_feature    join(190821..190880,190941..191003,191046..191114)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BP0855 by TMHMM2.0 at aa 4-23, 44-64 and 79-101"
FT   CDS_pept        191442..193673
FT                   /transl_table=11
FT                   /gene="bfrD"
FT                   /locus_tag="BP0856"
FT                   /product="probable TonB-dependent receptor for iron
FT                   transport"
FT                   /note="Similar to Pseudomonas aeruginosa hydroxamate-type
FT                   ferrisiderophore receptor PiuA or Fiu or Pa4514 TR:O68590
FT                   (EMBL:AF051690) (753 aa) fasta scores: E(): 1.1e-95,
FT                   37.317% id in 753 aa, and to Caulobacter crescentus
FT                   TonB-dependent receptor Cc0028 TR:Q9AC38 (EMBL:AE005677)
FT                   (851 aa) fasta scores: E(): 1.7e-47, 38.562% id in 765 aa"
FT                   /db_xref="GOA:P81549"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030148"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/Swiss-Prot:P81549"
FT                   /protein_id="CAE41159.1"
FT                   /translation="MKFYSSHPMPESLAAAIAVPLLGLLPAAQAASTAVQLPSVTVEGE
FT                   YSSYQPESAQSPKFTAPLADTPRTVQVIPERLIQDQGASDLEAVLRNAPGISMTAGEGG
FT                   RPASDLPFIRGQNSASSLFVDGLRDPSTQSRDTFNLEQVDVVKGPDSVFSGRGGAGGSI
FT                   NLVTKTPRNQDFTEVQAGIGTAETYRGTIDGNWVLGENTALRLNLLGTRDTVPGRDKAV
FT                   EFSRVGIAPSLRLGLSGPTRVTLGLYHYRHRRVPDYSIPYDPRTGTPITETIGVSRRNF
FT                   YGLVRRDSGDTEDYAATVKWEHDLANGFKVENLARYSRATVEQITTMPELKTADLAKGL
FT                   VYRNLRASYQVNDSFANRTDLRGTFDTGQWRHTFDLGGEFATSRRSRDRYKQEIPDAAS
FT                   PCSPVTDGNNPALCASLRDPDPHVDFPGTVRRNHNPARYHTDILSLYGFDTIAFDEQWQ
FT                   LNLGLRWDHYKTSGRNLPVRGAKPPVYERAARTDNLFNYQLGLVYKPRPDGSVYASYGT
FT                   ASTPSAVSDYAPADSISGTSQQLKPERSEAIEIGTKWQVLDRRLLVTGAMFRETRKNTS
FT                   IEVAEGLRAPAGKSRVTGMELGVAGSLTPRWDVYGGYALLDSKLVRASHKSGAQGQPLP
FT                   SAPRHAFSIWSTYKLLPELTVGAGAFYRSKVYGNADAGYNKDGTPKARWVPAYWRFDAM
FT                   AAYQLNKHLTAQLNVYNLLDKTYYAKTYRSHYAALGPGRSAMLTFKLSY"
FT   misc_feature    191442..191531
FT                   /note="Signal peptide predicted for BP0856 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.962 between residues 30 and 31"
FT   misc_feature    193335..193670
FT                   /note="HMMPfam hit to PF00593, TonB dependent receptor
FT                   C-terminal region"
FT   CDS_pept        193897..196155
FT                   /transl_table=11
FT                   /gene="bfrE"
FT                   /locus_tag="BP0857"
FT                   /product="probable TonB-dependent receptor for iron
FT                   transport"
FT                   /note="Similar to Pseudomonas aeruginosa hydroxamate-type
FT                   ferrisiderophore receptor PiuA or Fiu or Pa4514 TR:O68590
FT                   (EMBL:AF051690) (753 aa) fasta scores: E(): 3.4e-106,
FT                   43.742% id in 775 aa, and to Escherichia coli probable
FT                   TonB-dependent receptor YbiL precursor YbiL or B0805
FT                   SW:YBIL_ECOLI (P75780) (760 aa) fasta scores: E(): 7.2e-50,
FT                   35.058% id in 773 aa"
FT                   /db_xref="GOA:Q7VZP0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030148"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZP0"
FT                   /protein_id="CAE41160.1"
FT                   /translation="MKSLDSYSASTLANSLAAAIAVPALCLMPGAQAQTSAGVTQLAPV
FT                   QVEGEASPYQATTVQSSKMTAPLLDTPRTVQVVPQQVIQDQAATNLQDVLRNSPGITMG
FT                   AGEGGRAGGDLPIIRGQNAAGSIFVDGVRDPSTQIRDTFNLEQVEIIKGPDSVYSGRGG
FT                   AGGSINLVSKTPKARDFAEGSVQIGTDSNYRATADGNWLLGDNAAFRLNLMGNKGDVPG
FT                   RDHAVDFSRWGVAPTLQLGVGTPTRITLGYYHYQDDSMPDYAIPYDPKSGQPVTETQGV
FT                   SRKNFYGLTGRDFMKSRDDVATLAIDHDFSSKLRLRNVTRYGRSVTDYAATNPDDSKGN
FT                   VPNGLVYRALKAGYYTNKTFTNQTDLSGEFETGSLQHSFDVGFEYSNIKQDKDSYTQTI
FT                   AKGAMPCKVGANDASNPALCTSLWDPDPHDYYPGHLSRNDNPARYSTDTIALYGFDTIK
FT                   FNEQWQASVGLRWDNYRVSGSNIARGRNDPASTPAFYSTSREDNLFNYQLGLAYKPVPN
FT                   GTIYASYGTSSTPSAVAGSNVSDAVTVSNESLAPEKSRTVEVGTKWQLFDDRLTLSGAL
FT                   FQDIRKNTSVAVSATETEQIGKAKVRGIELGFSGSITPKWNVYGGYTFMDSELVEGAYN
FT                   SGAVGQDLPNTPRNAFSLWTTYKLVPQLTVGGGAYYVDKVYGNADNGRNADGTPKARWV
FT                   PSYWRFDAMAAYEFNDHLTAQLNVMNIFDKTYYTKAYAAHYAALGTGRAAVLSFNIKY"
FT   misc_feature    193897..193995
FT                   /note="Signal peptide predicted for BP0857 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.997 between residues 33 and 34"
FT   misc_feature    195817..196152
FT                   /note="HMMPfam hit to PF00593, TonB dependent receptor
FT                   C-terminal region"
FT   CDS_pept        196268..196786
FT                   /transl_table=11
FT                   /locus_tag="BP0858"
FT                   /product="probable GnaT-family acetyltransferase"
FT                   /note="Similar to Caulobacter crescentus acetyltransferase,
FT                   GnaT family Cc1083 TR:Q9A9B1 (EMBL:AE005785) (173 aa) fasta
FT                   scores: E(): 3.2e-14, 32.530% id in 166 aa, and to
FT                   Rhizobium loti Mll3172 protein Mll3172 TR:Q98GU4
FT                   (EMBL:AP003001) (179 aa) fasta scores: E(): 1.5e-13,
FT                   32.544% id in 169 aa"
FT                   /db_xref="GOA:Q7VZN9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="PDB:3JUW"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZN9"
FT                   /protein_id="CAE41161.1"
FT                   /translation="MTNMRQVLKTDRLVLEPQSMARFDQWFAMERQRDEAGHRDLTEDQ
FT                   AWLRLCARQGMWDAYACGFYYLLDPVSGEMRGEAGFQFRRRGFGPGFDNHPEAAWAVAS
FT                   AHQGRGLAAEAMQALLAHHDRSSGRQRVVALIARSNLPSLRLAERLGFRGYSDVAFDGA
FT                   AHLLLERAG"
FT   misc_feature    196466..196726
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family"
FT   CDS_pept        complement(196796..197572)
FT                   /transl_table=11
FT                   /locus_tag="BP0859"
FT                   /product="short-chain dehydrogenase"
FT                   /note="Similar to Escherichia coli 7-alpha-hydroxysteroid
FT                   dehydrogenase HdhA or HsdH or B1619 or X2624 or Ecs2327
FT                   SW:HDHA_ECOLI (P25529) (255 aa) fasta scores: E(): 4.6e-23,
FT                   36.800% id in 250 aa, and to Rhodopseudomonas palustris
FT                   putative 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase
FT                   BadH TR:O07457 (EMBL:U75363) (255 aa) fasta scores: E():
FT                   3.9e-27, 41.569% id in 255 aa"
FT                   /db_xref="GOA:Q7VZN8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZN8"
FT                   /protein_id="CAE41162.1"
FT                   /translation="MTPREQPRFRGKRALVTGAGAGIGRAIALALAKDGAHVCVLDADH
FT                   AAADETAAMVRQLGAEAATIVHDMGCASVVASIASMQDGFGAFDLLVNNAGISPKQPDG
FT                   RKRMIWETPPEEWQRVIQVNLCGYFFALRAVLPGMVERRAGAVVNIASLAGLRYSSIAG
FT                   ASYATAKNAVVGLTRQAAGEVAEFGIRINCVAPGRIETAMASVAGGEFNETIRASTPLR
FT                   RLGQPADIADAVLFLLSEQAGFITGETLPVTGGRGL"
FT   misc_feature    complement(196808..196825)
FT                   /note="ScanRegExp hit to PS00343, Gram-positive cocci
FT                   surface proteins 'anchoring' hexapeptide."
FT   misc_feature    complement(196817..196909)
FT                   /note="HMMPfam hit to PF00678,"
FT   misc_feature    complement(196967..197539)
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase"
FT   misc_feature    complement(197030..197116)
FT                   /note="ScanRegExp hit to PS00061, Short-chain
FT                   dehydrogenases/reductases family signature."
FT   misc_feature    complement(197477..197572)
FT                   /note="Signal peptide predicted for BP0859 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.924) with cleavage site
FT                   probability 0.689 between residues 32 and 33"
FT   CDS_pept        complement(197569..199257)
FT                   /transl_table=11
FT                   /locus_tag="BP0860"
FT                   /product="putative acetolactate synthase large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="Similar to Escherichia coli acetolactate synthase
FT                   isozyme III large subunit IlvI or b0077 SW:ILVI_ECOLI
FT                   (P00893) (574 aa) fasta scores: E(): 2e-18, 28.571% id in
FT                   532 aa, and to Rhizobium meliloti probable AtrC
FT                   acetolactate syntase AtrC TR:AAK65177 (EMBL:AE007243) (570
FT                   aa) fasta scores: E(): 4.3e-100, 50.722% id in 554 aa"
FT                   /db_xref="GOA:Q7VZN7"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZN7"
FT                   /protein_id="CAE41163.1"
FT                   /translation="MLKAAGVAQIFGQSCPTALFLAADAIGIRQIGYRTENAGAAMADG
FT                   AARVGRQLTVITAQNGPAAALLVAGFSEATKASVPILAIVQEVPRANADKNAFQELDHV
FT                   QLFASCAKWVRRIDVAERAAEYTERAIRIATSGRPGPVVLLVSQDVLTTACPQARPVAQ
FT                   DSDEPLGRFPLDRTVPVAGRLAQLAQRLLDAKRPLVVAGGGVHLSGACDALARLQSLAG
FT                   LPVATTNMGKGAIDETHPLSLGVIGNAMGTRSPAKHFMDYVRSADFVLFVGTRTNENGT
FT                   ASWSLFPEQAQYAQIDIDSEEVGRNYGAMRFAGDAAATLQALGDALQGRGQAVAARRMA
FT                   ELAPAFEACRQAHRAELAPYAQSDASPMRPERIMAELRASHGDIIWVADASYSSIWLAQ
FT                   FIPCTEAGTRFVTPRGIAGLGWGVPMAIGAKIARPGARVICLTGDGGFAHCWAELETAR
FT                   RHEVPLTIVVLNNGVLGFQINAEESRFGTHTDVCHFGAIDHVAIAKACGCDGASVSDAA
FT                   SLRQAMAAAERSPVPFVIDVKTEPSAFPPISAFESQLRPLGGETP"
FT   misc_feature    complement(197647..199179)
FT                   /note="HMMPfam hit to PF00205, Thiamine pyrophosphate
FT                   enzyme, central domain"
FT   misc_feature    complement(197920..197979)
FT                   /note="ScanRegExp hit to PS00187, Thiamine pyrophosphate
FT                   enzymes signature. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   misc_feature    complement(199213..199245)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(199419..200399)
FT                   /transl_table=11
FT                   /locus_tag="BP0861"
FT                   /product="putative exported protein"
FT                   /note="Similar to Comamonas testosteroni OrfJ protein
FT                   TR:Q9RHM9 (EMBL:AB029044) (326 aa) fasta scores: E():
FT                   8.7e-43, 38.889% id in 324 aa, and to Agrobacterium
FT                   tumefaciens Agr_l_312p TR:AAK88723 (EMBL:AE008213) (329 aa)
FT                   fasta scores: E(): 4.2e-49, 46.226% id in 318 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZN6"
FT                   /protein_id="CAE41164.1"
FT                   /translation="MLLHRVLISLATGVLTLGVLGAAHADAYPTKPIRLVVPYPPGGIT
FT                   DIAARGLARAMSEELKQSVIVENRAGAGGIIGSDYVARAPADDYTLLIGTSATHGTNPS
FT                   TYANLPYSATGSFEPIAAVASSPLLVVVNPSSPVRDVQGLIAHLKANPGKESYASTGTG
FT                   GSLHLTLELFKLMTGTDIQHVPYKVSAPALTDLIGGHVQLMFDNMPSSLPQVKAGSLRA
FT                   LAVTGPQRSALVPELPTVAEAVPGFASASWVALYAPKNTPAAIVQTLNAAANKGLKSQD
FT                   VLAQFSAAGLEPTGGTSAALDSFMRAEIAKWAEVVKKINLPPSKL"
FT   misc_feature    complement(200325..200399)
FT                   /note="Signal peptide predicted for BP0861 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.971 between residues 25 and 26"
FT   CDS_pept        200537..201454
FT                   /transl_table=11
FT                   /locus_tag="BP0862"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="Similar to Salmonella typhimurium OsmT protein OsmT
FT                   TR:CAC44465 (EMBL:AJ313506) (308 aa) fasta scores: E():
FT                   1.3e-25, 34.354% id in 294 aa, and to Rhizobium meliloti
FT                   putative transcriptional regulator protein smb20123
FT                   TR:CAC48523 (EMBL:AL603642) (298 aa) fasta scores: E():
FT                   8.2e-30, 35.932% id in 295 aa"
FT                   /db_xref="GOA:Q7VZN5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZN5"
FT                   /protein_id="CAE41165.1"
FT                   /translation="MNVTFRQLTAFIEVASSRSFSQAAQALHVTQPALTAMIQKLETQL
FT                   GVVLFTRTRRGAELTTTGRELLPELQRILANLEVVIEDVRGAASPRGGTVTLACIPSLS
FT                   NTWIPSLIARVEQAYPRIKVILKDAMTENRSIHEMLRTGDIDYGVGSPSVEQDGLEFDL
FT                   LAHDELVAVVPQDHPLARRTLVRWSELAESPLIGMSYQSHVRMLVDEAFAANGISKRPK
FT                   REVSLITTAIGMVRAGLGVSVLPTTAIEVCNVAGLKVLRLHAPRVRRPLGFLHLPTRSL
FT                   SPAARLLLRFVKDAGPIPLGKQPE"
FT   misc_feature    200549..200983
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    200588..200653
FT                   /note="Predicted helix-turn-helix motif with score 1639
FT                   (+4.77 SD) at aa 18-39, sequence RSFSQAAQALHVTQPALTAMIQ"
FT   misc_feature    200591..200683
FT                   /note="ScanRegExp hit to PS00044, Bacterial regulatory
FT                   proteins, lysR family signature."
FT   CDS_pept        complement(201583..202443)
FT                   /transl_table=11
FT                   /gene="serB"
FT                   /locus_tag="BP0863"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /note="Similar to Escherichia coli, and phosphoserine
FT                   phosphatase SerB or B4388 or Z5989 or Ecs5346 SW:SERB_ECOLI
FT                   (P06862) (322 aa) fasta scores: E(): 2.1e-28, 46.444% id in
FT                   239 aa, and to Neisseria meningitidis putative
FT                   phosphoserine phosphatase SerB or nma1179 TR:Q9JUR1
FT                   (EMBL:AL162755) (277 aa) fasta scores: E(): 1.6e-31,
FT                   49.327% id in 223 aa"
FT                   /db_xref="GOA:Q7VZN4"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR025138"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZN4"
FT                   /protein_id="CAE41166.1"
FT                   /translation="MTIHHLVIQSPALAAEHAEQLAALAQAQGVTRISTTAARLLDVQQ
FT                   DGDTRAQVRHWAETHGVDAAFVPAGLALADCRILAMDMDSTLINIECIDEIATVAGVGA
FT                   QVAQITEAAMRGEIKDFSESLRRRVALLAGAPAAALERVYAEKLRLNPGAERLLASVRA
FT                   AGIQTLLVSGGFTFFTERLRERLGLDHAHANTLEVDADGKLTGRVLGDILDGDAKAAHL
FT                   AALAQCLSARPEQIIAIGDGANDLKMLARAGFAVAYHAKPIVREQTPYALNVCGLDGVL
FT                   NWFEK"
FT   misc_feature    complement(201658..202218)
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase"
FT   CDS_pept        complement(202479..205910)
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="BP0864"
FT                   /product="transcription-repair coupling factor"
FT                   /note="Similar to Escherichia coli transcription-repair
FT                   coupling factor Mfd or B1114 SW:MFD_ECOLI (P30958) (1148
FT                   aa) fasta scores: E(): 6e-212, 51.619% id in 1143 aa, and
FT                   to Pseudomonas aeruginosa transcription-repair coupling
FT                   protein Mfd or Pa3002 TR:Q9HZK3 (EMBL:AE004725) (1148 aa)
FT                   fasta scores: E(): 0, 54.440% id in 1126 aa"
FT                   /db_xref="GOA:Q7VZN3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZN3"
FT                   /protein_id="CAE41167.1"
FT                   /translation="MPIPATATTLSALKPGARFTQPRPPGSGDGWLLADLARQAGKPLV
FT                   VLTADPLEAQRLADEIPQFAPELRVRQLPDWETLPYDAFSPHQDLISQRLRTLHALMNQ
FT                   GVDILTVPVTTALYRLAPPAFLAAYTFSFKQKDRLDEAALRAQLTLANYSHVTQVTAPG
FT                   EFCLRGGLIDLFPMGSVVPYRLDLFDDEIESIRSFDVDTQRSLYPVGEVQLLPGREFPM
FT                   DEEARNRFRARFREVFEGDPSRALPYKDIGNGIAFAGIEYYLPLFFEQTATLFDYLAAD
FT                   TITVTVGDIDDAMQRFAHDTRSRYDFLKVDRERPVLPPDTLFLDHEALFARLKDFPRLA
FT                   LMAERPHPDFAAAPDVAVARRADDPVARLRALLAQTGDRVLLCADSAGRRETLAQMLGE
FT                   HGLAPEAQADSIQAFLDDGARFGLAVAPLSAGFCVPGGALLFLTENDLYPGHAGVTRRG
FT                   KRTQERTSNVEAMVRDLAELRAGDPVVHAQHGIGRYHGLVNMDMGEGEMEFLHLEYASG
FT                   STLYVPVSQLHVIARYSGADPDAAPLHQLGSGQWDKARRKAARQVRDTAAELLALYAQR
FT                   AAREGYAFKLPMSDYEAFAEGFGFEETPDQAAAIQAVIMDMTSGRPMDRLVCGDVGFGK
FT                   TEVALRAAFLAVANGKQVALLCPTTLLAEQHAQTFSDRFADWPVRVVELSRFRSAKEVA
FT                   AAVEGINDGRVDIVIGTHKILSKDVRFKRLGLVIIDEEHRFGVRQKETLKALRAEVDVL
FT                   TLTATPIPRTLGMSLEGIRDFSVIATAPQKRLAIKTFVRREDGSTIREALLRELKRGGQ
FT                   VYFLHNEVETIHNRRARLEELVPEARIAVAHGQMPERELEQVMKGFYQQRHNVLLCTTI
FT                   IETGIDIPTANTIVIHRADRFGLAQLHQLRGRVGRSHHQAYAYLLTPGEDAITNNAKKR
FT                   LEAIQAMEELGSGFYLAMHDLEIRGTGEILGDSQSGNIQEVGFSMYNEMLNEAVRALKA
FT                   GEEPDLDAPFNLACEVNLHAPALLPSDYCPDVHGRLAIYKRLSHADGEDDLIRIQEELI
FT                   DRFGKLPEAAQTLLATHRLRLAAQPLGIVKIDASETQALLQFGAKTTVDPLRIIELVQR
FT                   QRHIKLSGQDKLRVEIKAPQIAARADAVRAVLRALK"
FT   misc_feature    complement(203187..203441)
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain"
FT   misc_feature    complement(203547..204137)
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase"
FT   misc_feature    complement(204003..204026)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        205964..206647
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="BP0865"
FT                   /product="4-diphosphocytidyl-2c-methyl-D-erythritol
FT                   synthase"
FT                   /EC_number="2.7.7.-"
FT                   /note="Similar to Escherichia coli
FT                   4-diphosphocytidyl-2c-methyl-D-erythritol synthase IspD or
FT                   B2747 SW:ISPD_ECOLI (Q46893) (235 aa) fasta scores: E():
FT                   5.3e-27, 46.667% id in 225 aa, and to Pseudomonas
FT                   aeruginosa 4-diphosphocytidyl-2c-methyl-D-erythritol
FT                   synthase IspD or Pa3633 SW:ISPD_PSEAE (P57707) (234 aa)
FT                   fasta scores: E(): 6.1e-27, 44.843% id in 223 aa"
FT                   /db_xref="GOA:Q7VZN2"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZN2"
FT                   /protein_id="CAE41168.1"
FT                   /translation="MSESLIAIVPAAGIGARASLPGEAAVPKQYRPLAGQPMLRHAVRA
FT                   LLADPRIVQVRVAVSAGDGWVEQALAGLPRTVWRPCGGPNRADTVAAALADSGAAADDW
FT                   ILVHDAARPGLPAAALARLIDACLDDAVGGLLALPVADTVKAGRQRVSRTVDRDGLWLA
FT                   QTPQMFRAGLLRDALARARAAGLAVTDEASAVEAAGHAPRLVAGALRNFKVTWPDDFEL
FT                   MEKWL"
FT   misc_feature    205964..206035
FT                   /note="Signal peptide predicted for BP0865 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.612) with cleavage site
FT                   probability 0.529 between residues 24 and 25"
FT   misc_feature    205976..206638
FT                   /note="HMMPfam hit to PF01128, Uncharacterized protein
FT                   family UPF0007"
FT   misc_feature    206276..206299
FT                   /note="ScanRegExp hit to PS01295,
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase
FT                   signature."
FT   CDS_pept        206644..207132
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /gene_synonym="mecS"
FT                   /locus_tag="BP0866"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /note="Similar to Escherichia coli 2C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase IspF or MecS or B2746 or
FT                   Z4054 or Ecs3600 SW:ISPF_ECOLI (P36663) (159 aa) fasta
FT                   scores: E(): 1.5e-28, 58.333% id in 156 aa, and to
FT                   Neisseria meningitidis 2C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase IspF or Nmb1512 SW:ISPF_NEIMB
FT                   (Q9JYM5) (160 aa) fasta scores: E(): 1.1e-35, 67.742% id in
FT                   155 aa"
FT                   /db_xref="GOA:Q7VZN1"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZN1"
FT                   /protein_id="CAE41169.1"
FT                   /translation="MNIPFRVGQGFDVHALVEGRPLIIGGVTIAHTHGLLGHSDADVLL
FT                   HAVTDALLGGAGLGDIGRHFPDTDPAYRGADSRVLLRAAFDKVRAAGWAPVNVDATIHA
FT                   QAPKIGPHAAAMVANIAADLALDAGAVNIKAKTNEGLGYLGRKEGIAANVVVLLARAG"
FT   misc_feature    206656..207126
FT                   /note="HMMPfam hit to PF02542, YgbB family"
FT   misc_feature    206758..206805
FT                   /note="ScanRegExp hit to PS01350, 2C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase signature."
FT   repeat_region   207129..207160
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   207129..208181
FT   CDS_pept        207231..208181
FT                   /transl_table=11
FT                   /locus_tag="BP0867"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7VZN0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZN0"
FT                   /protein_id="CAE41170.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVSEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   misc_feature    207489..207554
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    207612..208145
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(208150..208181)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(208178..209197)
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /gene_synonym="fdp"
FT                   /locus_tag="BP0868"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="Similar to Escherichia coli
FT                   fructose-1,6-bisphosphatase Fbp or Fdp or B4232
FT                   SW:F16P_ECOLI (P09200) (332 aa) fasta scores: E(): 3.1e-49,
FT                   47.273% id in 330 aa, and to Pseudomonas aeruginosa
FT                   fructose-1,6-bisphosphatase Fbp or Pa5110 TR:Q9HU73
FT                   (EMBL:AE004923) (336 aa) fasta scores: E(): 2.6e-97,
FT                   73.591% id in 337 aa"
FT                   /db_xref="GOA:Q7VZM9"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZM9"
FT                   /protein_id="CAE41171.1"
FT                   /translation="MKRKTLTQYLVEQQRSAQALGPEVRLLIEVVARACKAISHAVSKG
FT                   ALGGVLGSLESENVQGEVQKKLDVLSNEILLEANEWGGHLAAMASEEMETIHLIPNRYP
FT                   KGEYLLLFDPLDGSSNIDVNVSIGTIFSVLRAPHRVAGADVCEQDFLQPGSQQVAAGYA
FT                   VYGPQTMLVLTIGNGVVGFTLDREMGSWVLTHESMRIPEDTKEFAINMSNMRHWAPPVK
FT                   RYIDECLAGKTGPLGKDYNMRWIASMVADVHRILTRGGIFMYPWDAREPGKAGKLRLMY
FT                   EANPMGLIVEQAGGAAIDGTGRILDIQPDKLHQRVSVILGSKNEVERVGRYHAEAHAS"
FT   misc_feature    complement(208220..209017)
FT                   /note="HMMPfam hit to PF00316, Fructose-1-6-bisphosphatase"
FT   CDS_pept        complement(209207..211915)
FT                   /transl_table=11
FT                   /gene="pepN"
FT                   /locus_tag="BP0869"
FT                   /product="aminopeptidase N"
FT                   /EC_number="3.4.11.2"
FT                   /note="Similar to Escherichia coli aminopeptidase N PepN or
FT                   B0932 SW:AMPN_ECOLI (P04825) (869 aa) fasta scores: E():
FT                   1.6e-65, 47.052% id in 899 aa, and to Caulobacter
FT                   crescentus aminopeptidase N PepN or Cc2481 SW:AMPN_CAUCR
FT                   (P37893) (863 aa) fasta scores: E(): 1.3e-70, 48.946% id in
FT                   901 aa"
FT                   /db_xref="GOA:Q7VZM8"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012779"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024601"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="InterPro:IPR035414"
FT                   /db_xref="InterPro:IPR037144"
FT                   /db_xref="InterPro:IPR038438"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZM8"
FT                   /protein_id="CAE41172.1"
FT                   /translation="MRTDTPVTVYRKDYQPYPYTIADVALEFDLDPASTTVRCLMQVAR
FT                   KADARDDAPLVLDGEALELVSIRVDGRDWARDGYVLDDATLTLRGLPPSAAVEIVSRCR
FT                   PAANSTLMGLYVSGGNFFTQCEAEGFRRIAWFADRPDVMSRYRVTLRAAPDYPVLLSNG
FT                   NLLATATLPDGRLQAEWEDPFPKPSYLFALVAGRLTHREERVRTQSGRDVLLQVYSDPG
FT                   SENRTEWALESLRHALRWDESRFGLELDLDRFMVVAVRDFNMGAMENKGLNIFNAAYVL
FT                   ADPATATDANYEGIESVIGHEYFHNWTGNRVTCRDWFQLSLKEGLTVFRDQEFSADMMA
FT                   RGLDEQAAASARAVKRIDDVVTLRAAQFPEDAGPMAHPIRPDSYQEIGNFYTATVYEKG
FT                   AEVIRMQHTLLGEPGFRAGMDEYFRRHDGQAVTCDDFVAAMESVYAARNPGRDLSVFRR
FT                   WYSQAGTPRVSVKLDHDAQSGRCTVTLTQRCAPVGVEKRAGRDFAKQAFHIPFAIGLLD
FT                   AQGRALPLHLNGQPARDTVLLELTEARASWTFEQVPDMPVPSLLRGFSAPVIVEYDWSD
FT                   ADLALLSAHDTDPFARWEAGQELATREILALTASHQAGQPLAVRPAFIAAWRALLTDPT
FT                   LDAAYRARALALPSEKTLAERMEQIDPPALAVARDFLRAEVGRQLAAPWRAAFDANQTP
FT                   GAYSPAAGPAGRRALKNQALSHLMAAESADAQALAQAQYDQADNMTDSMAALSALVNFG
FT                   APDSAAAALAAFYERWRDDPLVVDKWFTLQATARSTDIDAVRALMAHPAFTLRNPNRAR
FT                   ALVFQFCLNNARGMHRADGRGYDFWAEQVLALDALNPEIAARLARGLDNWARFAEPLRG
FT                   AMQAALAHVRAHAGLSRNVQEIVSKALDLAA"
FT   misc_feature    complement(210719..210850)
FT                   /note="HMMPfam hit to PF01433, Peptidase family M1"
FT   misc_feature    complement(210914..211573)
FT                   /note="HMMPfam hit to PF01433, Peptidase family M1"
FT   misc_feature    complement(210995..211024)
FT                   /note="ScanRegExp hit to PS00142, Neutral zinc
FT                   metallopeptidases, zinc-binding region signature."
FT   misc_feature    complement(211139..211180)
FT                   /note="ScanRegExp hit to PS01039, Bacterial extracellular
FT                   solute-binding proteins, family 3 signature."
FT   CDS_pept        212063..212719
FT                   /transl_table=11
FT                   /locus_tag="BP0870"
FT                   /product="putative exported protein"
FT                   /note="Similar to Zymomonas mobilis hypothetical 23.9 kDa
FT                   protein TR:Q9EZA0 (EMBL:AF300471) (220 aa) fasta scores:
FT                   E(): 0.00027, 33.333% id in 207 aa"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZM7"
FT                   /protein_id="CAE41173.1"
FT                   /translation="MFSIHAYSRLARLAGLAGLAGLAALLAGAALVAGCAAPSVSARVT
FT                   SFQQWPDGVAGQTYQFAPESGQLNNLEYQSYQDMVRAGIGATGLVEAREGRKARFTVSF
FT                   RYGSAQTQVMVRRAYDPYFYGGYGGYYGPRWWGGGVGYWGPEWVDVPTVAYRNSLSLEI
FT                   RDTARGGAEVYRSTAYITSGRDDLLGAMPYLVQAIFDNFPGNNGSEREIEYPLAR"
FT   misc_feature    212063..212188
FT                   /note="Signal peptide predicted for BP0870 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.582 between residues 42 and 43"
FT   repeat_region   212716..212747
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   212716..213768
FT   CDS_pept        212818..213768
FT                   /transl_table=11
FT                   /locus_tag="BP0871"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA4"
FT                   /protein_id="CAE41174.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIPPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   misc_feature    213076..213141
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    213199..213732
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(213737..213768)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(213765..215597)
FT                   /transl_table=11
FT                   /locus_tag="BP0872"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Similar to Rhizobium loti ATP-binding protein of ABC
FT                   transporter Mll0815 TR:Q98LY9 (EMBL:AP002995) (601 aa)
FT                   fasta scores: E(): 3.1e-156, 74.624% id in 599 aa, and to
FT                   Agrobacterium tumefaciens Agr_l_309p TR:AAK88722
FT                   (EMBL:AE008213) (600 aa) fasta scores: E(): 4.1e-147,
FT                   68.781% id in 599 aa"
FT                   /db_xref="GOA:Q7VZM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZM6"
FT                   /protein_id="CAE41175.1"
FT                   /translation="MARNKLDLRGSAFKAVLGFTFRHWARQPWRIGLIAMLALLSALAD
FT                   ILTPLYVGRLIDAVAGGAPADTVARNAALGAFWLLIALGVGATLLRQAIFMNIIALTLK
FT                   MMHDIVGLAFHQVQRLSSDWHANTFAGSTVRKITRGMWALDLLNDTLLIALLPSLAMLA
FT                   GATALLGWHWPLMGLVVGLGSLLYVAVTMALSLDYVAPAARLGNAWDTRMGGALADAVS
FT                   CNAVVKAFGAEWREEARLARVTDKWRHRTRRGWVRGTINGGVQGAMLVAMQAAILGVAL
FT                   LLWQRGQASVGDVTFAFTTFFMLQGYLRDVGMNIRNLQRSINDMEELVSLQRQPLDVED
FT                   LPGAGPIDIGAGEIRFENVTFRYGPHEQPLYRDFSVRIAPGERVGLVGHSGSGKTTFIK
FT                   LIQRLYDVDGGRITIDGQDIAAVRQASLRSQIAIVQQDPVLFHRSLAENIAYGRPGATQ
FT                   AEIERAARLASAHDFIMALPKGYDTLVGERGVKLSGGERQRVAIARAFLADAPILILDE
FT                   ATSSLDSESEVLIQRAMERLMEGRTTLVVAHRLSTVRALDRLLVMDRGRVIEEGSHEAL
FT                   IRLHGGVYRRLFERQALELTRGLSQWELGGAAAS"
FT   misc_feature    complement(213903..214457)
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    complement(214080..214124)
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   misc_feature    complement(214413..214436)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    complement(214674..215507)
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region."
FT   misc_feature    complement(join(214746..214811,214998..215063,
FT                   215079..215144,215313..215378,215439..215504))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BP0872 by TMHMM2.0 at aa 37-59, 79-101, 157-179, 184-206
FT                   and 268-290"
FT   CDS_pept        215996..216655
FT                   /transl_table=11
FT                   /gene="tpm"
FT                   /locus_tag="BP0873"
FT                   /product="thiopurine S-methyltransferase"
FT                   /EC_number="2.1.1.67"
FT                   /note="Similar to Pseudomonas syringae thiopurine
FT                   S-methyltransferase Tpm SW:TPMT_PSESJ (O86262) (218 aa)
FT                   fasta scores: E(): 1.1e-35, 44.495% id in 218 aa, and to
FT                   Pseudomonas aeruginosa thiopurine methyltransferase Tpm or
FT                   Pa2832 TR:Q9I011 (EMBL:AE004710) (218 aa) fasta scores:
FT                   E(): 1.5e-37, 49.309% id in 217 aa"
FT                   /db_xref="GOA:Q7VZM5"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR022474"
FT                   /db_xref="InterPro:IPR025835"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZM5"
FT                   /protein_id="CAE41176.1"
FT                   /translation="MDADFWLDRWREGRTHFHQTRVTPLLQKYWPTLDVPAGGQVLVPL
FT                   AGKSLDMVWLAGQGLRVLGVELSQLAVEQFFDENDLRPEIHQSAQGRHYVAGNLELICG
FT                   DVFALEDATLAACAGVYDRAALVALPEPMRKRYAREVYGRLGRGCRGILITLDYPQDQM
FT                   EGPPFSVDDAEVQALYAGHTEARLIDRRDILDKEPKFNQRGVARLDTLVYRLERLG"
FT   CDS_pept        216743..216895
FT                   /transl_table=11
FT                   /gene="vir-18"
FT                   /locus_tag="BP0874"
FT                   /product="vir-repressed protein"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis vir-repressed protein Vir-18 TR:Q04274
FT                   (EMBL:M37228) (23 aa) fasta scores: E(): 0.0007, 100.000%
FT                   id in 23 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZM4"
FT                   /protein_id="CAE41177.1"
FT                   /translation="MGMKSILGLLLAAALLGGCAVYTPHGAAVVDPPDRGGGFCPPGQA
FT                   KKGNC"
FT   misc_feature    216761..216829
FT                   /note="1 probable transmembrane helix predicted for BP0874
FT                   by TMHMM2.0 at aa 30-52"
FT   misc_feature    216767..216799
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        217004..217171
FT                   /transl_table=11
FT                   /locus_tag="BP0875"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZM3"
FT                   /protein_id="CAE41178.1"
FT                   /translation="MKFCMATLMLAASLALAGCAGGQGSQPGPPHPGAVNPYSSGGFHD
FT                   AGPDYPDTGR"
FT   misc_feature    217004..217069
FT                   /note="Signal peptide predicted for BP0875 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.610 between residues 22 and 23"
FT   misc_feature    217028..217060
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(217183..217863)
FT                   /transl_table=11
FT                   /locus_tag="BP0876"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Escherichia coli hypothetical lipoprotein
FT                   YdcL precursor YdcL or B1431 or Z2287 or Ecs2036
FT                   SW:YDCL_ECOLI (P76101) (222 aa) fasta scores: E(): 4.1e-13,
FT                   30.942% id in 223 aa, and to Rhizobium meliloti putative
FT                   polysaccharide export system periplasmic transmembrane
FT                   protein Smc01794 TR:CAC45812 (EMBL:AL591786) (191 aa) fasta
FT                   scores: E(): 2.1, 28.161% id in 174 aa"
FT                   /db_xref="InterPro:IPR021747"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZM2"
FT                   /protein_id="CAE41179.1"
FT                   /translation="MKSSLYRIAALSAAALLLAGCANQRAPKESGFLGDYSQLREEQVP
FT                   GGARLIYRDAALKPRQYTAMWLSPVEYYPSPQPSAQVSMETLTELQNYLDQSLRRKIGR
FT                   EIRLVNGPGPGVAKARIAITAVGSESEALAAYQYIPVALAVTGARAVLEGGRPQQATIA
FT                   IESKVTDSQTGQLLWASVRGGTGERVRAIAQGQASVPASALKPLIDEWTDNVAREIRNY
FT                   VRSK"
FT   misc_feature    complement(217792..217863)
FT                   /note="Signal peptide predicted for BP0876 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.596 between residues 24 and 25"
FT   misc_feature    complement(217801..217833)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        218145..218861
FT                   /transl_table=11
FT                   /locus_tag="BP0877"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa3353 TR:Q9HYP3 (EMBL:AE004757) (263 aa) fasta
FT                   scores: E(): 0.00072, 27.426% id in 237 aa"
FT                   /db_xref="GOA:Q7VZM1"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR023787"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZM1"
FT                   /protein_id="CAE41180.1"
FT                   /translation="MPDAHDPYLVSGRFEIANLLQTLQARQCLLLMRIPGRPFNSVTSV
FT                   LHVDAQAGQVVLDAAQDDTLNQRLADVGDVAFDTSLDNISISFAAARVARCEFEARPAL
FT                   LVDLPETLTRVQRRDTFRIAVPVAQPATWVREAGGAEPLALCDISPGGLALADPLQTLD
FT                   PAPGKIYRGVLALPELGAFAAAIRVVHHLDEVLAKGKTSRRIGCAFVELDKGTGIRIQA
FT                   YVNALQRDQIARQRGL"
FT   CDS_pept        complement(218876..220177)
FT                   /transl_table=11
FT                   /locus_tag="BP0878"
FT                   /product="putative phospholipase"
FT                   /note="Similar to Campylobacter coli phospholipase A PldA
FT                   TR:O32349 (EMBL:Y11031) (297 aa) fasta scores: E():
FT                   1.3e-09, 27.170% id in 265 aa, and to Campylobacter jejuni
FT                   phospholipase A PldA or Cj1351 TR:Q9PMU8 (EMBL:AL139078)
FT                   (329 aa) fasta scores: E(): 2.8e-09, 26.459% id in 257 aa"
FT                   /db_xref="GOA:Q7VZM0"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZM0"
FT                   /protein_id="CAE41181.1"
FT                   /translation="MQVPDPRSPFIRPALAGALALALAGMSLPALAGISYRLDRPAAAP
FT                   GETVRLEAVFFNDGSASAAWNAPQQLVLQWRGADDQTIRSLAQRPAGEAALNIPVNNFA
FT                   RMSWDAVVPVHARGLQAVSIEGESTMLALDATGREQDTLASTPADVPVTDARTGQPLPP
FT                   AAVTAAGVSPDSGPAPAQVAVSQTFQPASAFDVFRSAISEYQPMYFDIGTREQTTARFQ
FT                   ISAKYRLFSPKGDRPATFGENFYLGYTQTSLWDLEGDSKPFIDTTFNPSAFWLSDNIWS
FT                   SASQNWRVGLNTGVEHQSNGKSGNDSRSLNDAYVQPALNYRFDSGSTLTFAPKVKTYFG
FT                   VARENLDYADYAGYVDWNLRWAQDGGAVVSAMYRQGASSRRTTQLDFAWPLKRTWLDMN
FT                   GYLHLQYFNGYGETLLGYNQRHDSQFRIGLSLVP"
FT   misc_feature    complement(220082..220177)
FT                   /note="Signal peptide predicted for BP0878 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 32 and 33"
FT   CDS_pept        complement(join(220312..221151,221155..221334,
FT                   221337..221804))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0879"
FT                   /product="probable aldehyde dehydrogenase (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 156 (the frameshift occurs within
FT                   a polymeric tract of (G)4), and an in-frame TAG stop codon
FT                   following codon 216. The sequence has been checked and
FT                   believed to be correct. Similar to Streptomyces
FT                   clavuligerus semialdehyde dehydrogenase Pcd TR:O85725
FT                   (EMBL:AF073895) (512 aa) fasta scores: E(): 1.9e-112,
FT                   62.955% id in 494 aa, and to Pseudomonas aeruginosa
FT                   probable aldehyde dehydrogenase Pa1027 TR:Q9I4U7
FT                   (EMBL:AE004535) (529 aa) fasta scores: E(): 1.6e-130,
FT                   72.819% id in 493 aa"
FT                   /db_xref="PSEUDO:CAE41182.1"
FT   misc_feature    complement(join(220357..221151,221155..221334,
FT                   221337..221759))
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
FT                   family"
FT   misc_feature    complement(221023..221046)
FT                   /note="ScanRegExp hit to PS00687, Aldehyde dehydrogenases
FT                   glutamic acid active site."
FT   variation       complement(221152..221154)
FT                   /note="TAG stop codon in pertussis; GAG in parapertussis
FT                   and bronchiseptica"
FT   variation       complement(221334..221337)
FT                   /note="(G)4 in pertussis; (G)2 in parapertussis and
FT                   bronchiseptica"
FT   tRNA            221986..222062
FT                   /note="tRNA Arg anticodon TCT, Cove score 90.16"
FT   CDS_pept        join(222346..224601,224610..225218)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0880"
FT                   /product="putative exported protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 752. The frameshift occurs within
FT                   a polymeric tract of (GCGCCGGC)3. The sequence has been
FT                   checked and believed to be correct. Similar to Vibrio
FT                   cholerae chemotactic transducer-related protein Vca0895
FT                   TR:Q9KL53 (EMBL:AE004417) (981 aa) fasta scores: E():
FT                   6.7e-71, 32.070% id in 976 aa"
FT                   /db_xref="PSEUDO:CAE41183.1"
FT   misc_feature    222346..222432
FT                   /note="Signal peptide predicted for BP0880 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.978) with cleavage site
FT                   probability 0.297 between residues 29 and 30"
FT   variation       224585..224608
FT                   /note="(GCGCCGGC)3 in pertussis;(GCGCCGGC)2 in
FT                   parapertussis and bronchiseptica"
FT   CDS_pept        225442..226794
FT                   /transl_table=11
FT                   /locus_tag="BP0882"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Methanothermobacter thermautotrophicus
FT                   conserved protein Mth965 TR:O27046 (EMBL:AE000870) (452 aa)
FT                   fasta scores: E(): 2.8e-21, 27.912% id in 455 aa, and to
FT                   Agrobacterium tumefaciens Agr_l_2924p TR:AAK90029
FT                   (EMBL:AE008346) (448 aa) fasta scores: E(): 2e-24, 29.899%
FT                   id in 398 aa"
FT                   /db_xref="GOA:Q7VZL9"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZL9"
FT                   /protein_id="CAE41184.1"
FT                   /translation="MNITQEIAKRVVQTSIRDLPADAVGYSETLAMSALGAMAAGHRSA
FT                   GGREIVDYVKSAGGAAQATVLGHGLKTSMEMAGLANGTFAHATEYEDDSFPEAVSSYTL
FT                   FPAIFAVAEHAQASGARVVEAFAAGYEAQARIGLACRQARRNGFMVLSLAGSIGCAASA
FT                   AKLLGLDERQTTMALSLAASQGAGIGYQTGSMAHIVEMGFAARNGIAAALMAAQGMTGQ
FT                   PDVLEAPRGLMNMITGDQVEAPAAIIEHWGRPYRLMEIGIKSYPCCYHLQRIIETTVDL
FT                   RHAEGLAAADIEEISVEVNAFFPTVVQHMEPHDEIEAQFSLPHVLAIAMLEDQVVPAGF
FT                   SQARIDDAAFQAFRRKVRQVVREDWGWTPTGWTPRITYRLADGRVIVREPEQARGQPPA
FT                   LLTFDQCVPKYLGCVQGIYPEQQVERSIALLRGLAGLDSVAELMRCLATPA"
FT   CDS_pept        226823..227344
FT                   /transl_table=11
FT                   /locus_tag="BP0883"
FT                   /product="biotin carboxyl carrier protein"
FT                   /note="Similar to Glycine max acetyl-CoA carboxylase AccB-1
FT                   TR:AAF80463 (EMBL:AF162283) (262 aa) fasta scores: E():
FT                   1.8e-07, 33.939% id in 165 aa, and to Synechococcus sp
FT                   biotin carboxyl carrier protein accB TR:Q54761
FT                   (EMBL:U59235) (158 aa) fasta scores: E(): 5.9e-12, 41.358%
FT                   id in 162 aa. Also similar to BP2997, 41.333% identity
FT                   (44.928% ungapped) in 150 aa overlap."
FT                   /db_xref="GOA:Q7VZL8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZL8"
FT                   /protein_id="CAE41185.1"
FT                   /translation="MLVVKTKFSDLTHEDIDRILEIVNRVDDIDLQIQVDGLGLRVRKG
FT                   NVGAPVAPPAVSAPAAAEAPAPAPSPAPAAQPAAAPAAAPAAPAAARQDLLSITAPMIG
FT                   RFYAKPSPNDPAFVALGSQVGPDDSVCILEVMKLFNTVKAGVAGEIVEILVQEGDMVEE
FT                   GDVLFRVKPQ"
FT   misc_feature    227108..227332
FT                   /note="HMMPfam hit to PF00364, Biotin-requiring enzyme"
FT   CDS_pept        227341..228795
FT                   /transl_table=11
FT                   /locus_tag="BP0884"
FT                   /product="probable carboxylase"
FT                   /note="Similar to Methanococcus jannaschii pyruvate
FT                   carboxylase subunit B PycB or Mj1231 SW:PYCB_METJA (Q58628)
FT                   (567 aa) fasta scores: E(): 5.8e-52, 35.685% id in 482 aa,
FT                   and to Pyrococcus horikoshii 571aa long hypothetical
FT                   oxaloacetate decarboxylase alpha chain ph0834 TR:O58564
FT                   (EMBL:AP000003) (571 aa) fasta scores: E(): 3.8e-49,
FT                   38.073% id in 436 aa"
FT                   /db_xref="GOA:Q7VZL7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZL7"
FT                   /protein_id="CAE41186.1"
FT                   /translation="MSRRIGIIDTTLRDAQQCLWATRMTAGMMDPIAQALDEAGFDMID
FT                   FMAPVQFDVCVRYLREDPFEKARHFRKRFRNTPMRSYCRSKSLVGFSMVPDDMVELWID
FT                   CLAANGFSAVGTLDSLLDVDNMKVSVRRAKKIGIKSIGALVFCESPLHTDALYAGTAAE
FT                   LVRCGVDGIMLKDSGALLTIERIRTLIPALRAAVGDIPIEVHSHSNTGLVQRVYLDAAD
FT                   LGIDQLHTSIAPLAGGVAQPSIQNMTRNLAQRGYRTDVDMARVEEISAYLHRLAARYDF
FT                   PLGKPMEYDEFHYRHQMPGGMTENWRFQLRQAGLENRFEEILEEIGRVREDLAWPIMVT
FT                   PFSQIIGVQAMLNVVNGERYRAVPDEVKMYALGHFGRLLGPVEPNALDRIVANGSPDVG
FT                   LTPQPKDPALPGLRKANPGMTDEELLLRYMFPADDVEATLGCKPLKLTVPAGGPIVRLI
FT                   EEILPRAGIRHFELRSQSEHISFTRP"
FT   misc_feature    227371..228192
FT                   /note="HMMPfam hit to PF00682, HMGL-like"
FT   misc_feature    227878..227907
FT                   /note="ScanRegExp hit to PS00339, Aminoacyl-transfer RNA
FT                   synthetases class-II signature 2."
FT   misc_feature    228220..228744
FT                   /note="HMMPfam hit to PF02436, Conserved carboxylase
FT                   domain"
FT   CDS_pept        228812..229078
FT                   /transl_table=11
FT                   /locus_tag="BP0885"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium loti Mlr4612 protein Mlr4612
FT                   TR:Q98DP4 (EMBL:AP003004) (122 aa) fasta scores: E(): 3,
FT                   29.487% id in 78 aa"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZL6"
FT                   /protein_id="CAE41187.1"
FT                   /translation="MPRRIRMTQPAASSHAVIVMYDAPAELDAWMHGDHYREVLATPGV
FT                   TGVRRYEVLDGPQACRKYLAVIETDDLDATLAWRDSEAGARSQ"
FT   CDS_pept        229250..230059
FT                   /transl_table=11
FT                   /locus_tag="BP0886"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Mycobacterium tuberculosis CDC1551
FT                   conserved hypothetical protein Mt2360 TR:AAK46645
FT                   (EMBL:AE007078) (307 aa) fasta scores: E(): 2e-09, 25.498%
FT                   id in 251 aa, and to Agrobacterium tumefaciens Agr_c_2623p
FT                   TR:AAK87214 (EMBL:AE008068) (291 aa) fasta scores: E():
FT                   6e-07, 24.413% id in 213 aa"
FT                   /db_xref="GOA:Q7VZL5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZL5"
FT                   /protein_id="CAE41188.1"
FT                   /translation="MFRTAMHYPRHNLTFKGARSAWLEDVGLLFEEMDSAGIRYGVAMG
FT                   RASSGAGNLGGVANQDIVDLLATYPDRFLGFLGVDLDNIAGSLAEIRELAGAPGVKEIS
FT                   IEPGSARVPRWSDDKTLDPVYELALELKLPVSISLSGLLSALAGHDITWSSPVSIQRVA
FT                   QRYRDLKIVVSHAAWPYADEMVVVALACPNIYVSPDLYASTRGMICADSYVKGANMFLE
FT                   DRTLFGTAYPVKDIQDSLRDFLQLGWREDIIHKVLWTNAARLLGVDK"
FT   CDS_pept        230085..231140
FT                   /transl_table=11
FT                   /locus_tag="BP0887"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Arabidopsis thaliana induced upon
FT                   wounding stress TR:Q39171 (EMBL:X99793) (386 aa) fasta
FT                   scores: E(): 9.1e-20, 30.458% id in 371 aa, and to
FT                   Arabidopsis thaliana hypothetical 44.2 kDa protein T22a6.50
FT                   or At4g24220 TR:Q9STX2 (EMBL:AL078637) (388 aa) fasta
FT                   scores: E(): 6.2e-26, 31.892% id in 370 aa"
FT                   /db_xref="GOA:Q7VZL4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZL4"
FT                   /protein_id="CAE41189.1"
FT                   /translation="MKRTALIAGPYGIVGNALVQHLARDAAWDVVTISRRQEAALPGVR
FT                   HIAADLLDAAQAEAALAAFPGITHVFYCAYAPRPTLGEEAAPNLAMLANLVSAVDRHAR
FT                   GLERVVLVHGTKWYGNHLGPFRTPAREDDARHCPPNFYYDQQDWIAARQRESGRWSWTA
FT                   FRPHGIFGYALGSPMNHLMALSLYASVMKAVATPLKFPGTPAAFAALNQCTDARLLARA
FT                   MAWSVDVAACENEAFNFHNGEPERWANLWPAVAEAFGMQAGGVQQIRLAAMMPANEAAW
FT                   QAICQRQGLRHFPLEAYVNWSFADWVYSNGFDQVCSLYKLRRAGWTEILLFDDMLKSML
FT                   SDLRQRKLLPA"
FT   CDS_pept        231153..231944
FT                   /transl_table=11
FT                   /locus_tag="BP0888"
FT                   /product="GntR-family transcriptional regulator"
FT                   /note="Similar to Bacillus subtilis hypothetical
FT                   transcriptional regulator YurK SW:YURK_BACSU (O32152) (242
FT                   aa) fasta scores: E(): 2.1e-15, 30.472% id in 233 aa, and
FT                   to Deinococcus radiodurans transcriptional regulator, GntR
FT                   family dra0211 TR:Q9RYU6 (EMBL:AE001863) (279 aa) fasta
FT                   scores: E(): 3.7e-12, 29.046% id in 241 aa"
FT                   /db_xref="GOA:Q7VZL3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZL3"
FT                   /protein_id="CAE41190.1"
FT                   /translation="MAQMKDNNVSNRATLVLYENRSIPLYRMIKEELIRFVQKKGIKSG
FT                   MALPGDNELASQFGVSVGTVRRAIAELVSERIVIRQQGRGTFLAPYDTSRMLNSFWHIE
FT                   RRDGVVDVPLVSTHGFSQASATEEVAQKLALQPGDPVFVIKNSMTMQGTPVLLDTIYVP
FT                   VRTFEGLTREKLSARDATIYDFYREQYGINIVKTIDRVSATVADKDTAKRLGCKLGASM
FT                   LRILRVAYSFGDTPIEYRCSLLDSENHEYVDVTGGDTSRYG"
FT   misc_feature    231237..231416
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family"
FT   misc_feature    231297..231362
FT                   /note="Predicted helix-turn-helix motif with score 1399
FT                   (+3.95 SD) at aa 49-70, sequence PGDNELASQFGVSVGTVRRAIA"
FT   CDS_pept        231977..233347
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /gene_synonym="fabG"
FT                   /locus_tag="BP0889"
FT                   /product="biotin carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /note="Similar to Escherichia coli biotin carboxylase AccC
FT                   or FabG or B3256 SW:ACCC_ECOLI (P24182) (449 aa) fasta
FT                   scores: E(): 9.6e-86, 54.018% id in 448 aa, and to Anabaena
FT                   sp biotin carboxylase AccC SW:ACCC_ANASP (Q06862) (447 aa)
FT                   fasta scores: E(): 5.9e-93, 56.629% id in 445 aa"
FT                   /db_xref="GOA:Q7VZL2"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZL2"
FT                   /protein_id="CAE41191.1"
FT                   /translation="MKLKKVLIANRGEIALRIIRACREMDIRTVQVYSSADEDSLPVRL
FT                   ADEAAPIGGPEPSASYLNIAALIAAAREHGCDAIHPGYGFLSENEDFAQACIDAGIVFI
FT                   GPDPGAIRMMGDKAQARKIAKEAGVPIVPGSPEPVSDVEEAIRVAREVGYPLLVKAAAG
FT                   GGGRGMRVIQGEAQLREGLERASMEAKSAFGDGSVYIERYISPVRHVEIQVFGDGEDVI
FT                   HLGERECSIQRRHQKLLEESPSPVLSDETRQRMGEAACALARAVKYRGAGTLEFVMDGK
FT                   SGEFFFIEMNTRIQVEHPVTETVTGVDLVRLQLAVAAGGRLGLRQQDIVMKGHAIECRI
FT                   NAEDPQKAFMPSPGTVNDIRLPSGPGVRMDSHVYRGYKLPPYYDSLLGKLIVWDESREK
FT                   AIARMLRALGELEIVGVKTTKEFHERLMRDEDFIAGNVSTQFVKEKLYADHPMCHLL"
FT   misc_feature    231989..233092
FT                   /note="HMMPfam hit to PF00289, Carbamoyl-phosphate synthase
FT                   L chain, N-terminal domain"
FT   misc_feature    232436..232480
FT                   /note="ScanRegExp hit to PS00866, Carbamoyl-phosphate
FT                   synthase subdomain signature 1. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   misc_feature    232835..232858
FT                   /note="ScanRegExp hit to PS00867, Carbamoyl-phosphate
FT                   synthase subdomain signature 2."
FT   misc_feature    233333..233344
FT                   /note="ScanRegExp hit to PS00294, Prenyl group binding site
FT                   (CAAX box)."
FT   CDS_pept        233363..234442
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0890"
FT                   /product="putative acyl-CoA carboxylase (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. Similar to Saccharopolyspora erythraea
FT                   propionyl-CoA carboxylase beta chain PccB SW:PCCB_SACER
FT                   (P53003) (546 aa) fasta scores: E(): 4.3e-33, 34.146% id in
FT                   369 aa, and to Pyrococcus horikoshii 522aa long
FT                   hypothetical methylmalonyl-CoA decarboxylase alpha chain
FT                   Ph1287 TR:O59018 (EMBL:AP000005) (522 aa) fasta scores:
FT                   E(): 4e-42, 38.108% id in 370 aa"
FT                   /db_xref="PSEUDO:CAE41192.1"
FT   misc_feature    233402..234430
FT                   /note="HMMPfam hit to PF01039, Carboxyl transferase domain"
FT   repeat_region   234422..234453
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   234422..235055
FT   CDS_pept        234524..235474
FT                   /transl_table=11
FT                   /locus_tag="BP0891"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7VZL1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZL1"
FT                   /protein_id="CAE41193.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIPPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKRRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   misc_feature    234782..234847
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    234905..235438
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   235053..235474
FT   repeat_region   complement(235443..235474)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        235527..235748
FT                   /transl_table=11
FT                   /locus_tag="BP0892"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZL0"
FT                   /protein_id="CAE41194.1"
FT                   /translation="MGDVMQRGELAYWLNVVVENGEPGAPQIPVPEQFVTALTTLRCIE
FT                   RNAQGQLVVTEKGRLALHMEEPGALHRQ"
FT   CDS_pept        235908..236120
FT                   /transl_table=11
FT                   /locus_tag="BP0893"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZK9"
FT                   /protein_id="CAE41195.1"
FT                   /translation="MQHRDQEVLIDVSTAAMDTGGYGVLLTVTAEGGTEVDAAFSYLGT
FT                   CASLDEARDRAEAFAQDWLRENIYR"
FT   CDS_pept        236219..237358
FT                   /transl_table=11
FT                   /gene="pmi"
FT                   /locus_tag="BP0894"
FT                   /product="putative mannose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /note="Similar to Rhizobium meliloti mannose-6-phosphate
FT                   isomerase Pmi or R02982 or Smc03111 SW:MANA_RHIME (P29954)
FT                   (387 aa) fasta scores: E(): 4.5, 27.763% id in 389 aa, and
FT                   to Caulobacter crescentus mannose-6-phosphate isomerase
FT                   Cc3617 TR:Q9A2E8 (EMBL:AE006020) (386 aa) fasta scores:
FT                   E(): 1.3e-13, 32.031% id in 384 aa"
FT                   /db_xref="GOA:Q7VZK8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZK8"
FT                   /protein_id="CAE41196.1"
FT                   /translation="MHARRTPMSAASFHTDLPALVAQLRQHFNTVIVPLWLERGFDAGL
FT                   GLPCEALDAHGAPLPAQRYRAMACARQLYVFSRTDGAAAAAHAERLFSSLLRYFQNAAH
FT                   GGWRHSVDAQGQPLDDTQDLYTHAFVVFACAAYFARTRDARARKTLLATVDVIEQRFRT
FT                   RQGLYVAALSADWAQVVRGPAQNPVMHLTEAYLAAAGVVEPAWFAQTLGRLTQDVASTF
FT                   LYAPRLCIAEEPLDQPPRFEPGHQFEWYSLLHGAPDLFGDLELGSALQRGCAWVRQHGV
FT                   DAHSHGVAAVLDESGAVRDATQRIWAQTEYARYLALSGQWPELATQLRAFQARFLHQDG
FT                   WHECLDAQGNVSRADMPSTTPYHLATCYAALEDALAGQG"
FT   CDS_pept        237455..237670
FT                   /transl_table=11
FT                   /locus_tag="BP0895"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Halobacterium sp 50S ribosomal protein
FT                   l44E Rpl44e or Vng0551G TR:Q9HRT6 (EMBL:AE005006) (61 aa)
FT                   fasta scores: E(): 8.8, 39.024% id in 41 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZK7"
FT                   /protein_id="CAE41197.1"
FT                   /translation="MSVMCPACQAINAGSSGVEPHPRLGHQGFTNPSQKGREANREDHF
FT                   RCIECGAKWLRETDRWGVDLGFRLAP"
FT   CDS_pept        237864..238115
FT                   /transl_table=11
FT                   /locus_tag="BP0896"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZK6"
FT                   /protein_id="CAE41198.1"
FT                   /translation="MVQKVLNGFAVVAFATQPEHGMPPRAFIQTAPMDGAGQAEPQVFE
FT                   IFLARRFRSAVEAMSAARNALDRVVSVDQDGVPAPLPD"
FT   repeat_region   238125..238156
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   238125..238202
FT   repeat_region   238198..239178
FT   CDS_pept        238228..239178
FT                   /transl_table=11
FT                   /locus_tag="BP0897"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7VZK5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZK5"
FT                   /protein_id="CAE41199.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWTYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   misc_feature    238486..238551
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    238609..239142
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(239147..239178)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(239175..239558)
FT                   /transl_table=11
FT                   /locus_tag="BP0898"
FT                   /product="putative ferredoxin"
FT                   /note="Similar to Pseudomonas spCA10 ferredoxin component
FT                   of carbazole 1,9a-dioxygenase CaraC TR:O32475 (EMBL:D89064)
FT                   (107 aa) fasta scores: E(): 0.16, 28.736% id in 87 aa, and
FT                   to Pseudomonas aeruginosa hypothetical protein Pa4711
FT                   TR:Q9HV87 (EMBL:AE004885) (115 aa) fasta scores: E():
FT                   3.9e-10, 35.965% id in 114 aa"
FT                   /db_xref="GOA:Q7VZK4"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZK4"
FT                   /protein_id="CAE41200.1"
FT                   /translation="MTDSTPAVRVCAAADLVDGGLGVKVPVTDGAGQASAFFVRYRGQV
FT                   YGYLNRCAHVGVELDWENSFFTRAGDLIMCARHGATYEPDTGLCIGGPCRNGRLTALQV
FT                   DERPDAGGMAVYWLPSGKIQPRG"
FT   misc_feature    complement(239277..239471)
FT                   /note="HMMPfam hit to PF00355, Rieske [2Fe-2S] domain"
FT   CDS_pept        complement(239613..241430)
FT                   /transl_table=11
FT                   /locus_tag="BP0899"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="Similar to Rhizobium loti ABC transporter,
FT                   ATP-binding protein Mlr7818 TR:Q984W3 (EMBL:AP003012) (627
FT                   aa) fasta scores: E(): 1.9e-115, 56.324% id in 593 aa, and
FT                   to Rhizobium meliloti probable ABC transporter ATP-binding
FT                   transmembrane protein Smc00550 TR:CAC45699 (EMBL:AL591786)
FT                   (627 aa) fasta scores: E(): 5.7e-117, 57.022% id in 591 aa"
FT                   /db_xref="GOA:Q7VZK3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZK3"
FT                   /protein_id="CAE41201.1"
FT                   /translation="MMPSPSPTPAGRNSLDTLRTLAPFLWPADRPGLKARVVIAILCLL
FT                   AAKAAVVYVPILYKSAVDQLGGGAPGAVTVPLGLILAYGAARVLSLLFSELRDAVFARV
FT                   GQHAIRAVGLQIFLHLHALALRFHLARQTGGLTRAIERGTKGIQTLLTFLLFNVLPTLF
FT                   EIGLVCAVLWKMFDGWLALATGATVTLYLAYTLVVTEWRTRFRRQMNETDSEANTKAVE
FT                   SLLNYETVKYFGNEEHEAQRYDASLRRYERAAVRSQVSLSILNIGQAVIISAGLTLVMW
FT                   MAARGIAQGRYTLGDFVLVNTYLLQLYDPLSFFGFIYREIKQALIDMERMFELLGEGRE
FT                   IADPPGALALRLEGGAVEFREVYFGYDPRRPILKGVSFRIPAGKTVAVVGTSGAGKSTL
FT                   ARLLFRFYDADRGAILVDGQDVRGVTQASLRAAIGVVPQDTVLFNDTIHYNIAYGRPGA
FT                   SDGEVQAAARLAHIHDLIMAMPDGYRTMVGERGLKLSGGEKQRVAIARTLLKNPSIFLF
FT                   DEATSALDTHTEREIQANLREVSQGRSTLIIAHRLSTIADADEIIVLGDGRVVERGRHQ
FT                   ALLAQGGIYAGMWARQQEAARPAAVALDD"
FT   misc_feature    complement(239730..240284)
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    complement(239907..239951)
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   misc_feature    complement(240240..240263)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    complement(240498..241322)
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region."
FT   misc_feature    complement(join(240588..240653,240837..240902,
FT                   240915..240980,241044..241109,241170..241235,
FT                   241257..241322))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP0899 by TMHMM2.0 at aa 36-58, 65-87, 107-129, 150-172,
FT                   176-198 and 259-281"
FT   CDS_pept        241577..242404
FT                   /transl_table=11
FT                   /locus_tag="BP0900"
FT                   /product="probable oxidoreductase"
FT                   /note="Similar to Corynebacterium SP 2,5-diketo-D-gluconic
FT                   acid reductase TR:P06632 (EMBL:M12799) (278 aa) fasta
FT                   scores: E(): 5.9e-54, 53.008% id in 266 aa, and to
FT                   Streptomyces coelicolor putative oxidoreductase Sc4b5.01C
FT                   TR:Q9ZBW7 (EMBL:AL034443) (277 aa) fasta scores: E():
FT                   1.7e-61, 58.303% id in 271 aa"
FT                   /db_xref="GOA:Q7VZK2"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZK2"
FT                   /protein_id="CAE41202.1"
FT                   /translation="MAQVPVLKLNDGNAMPQLGLGVWQVPNDQAAASVKAALAAGYRSI
FT                   DTAAIYGNEAGVGEGLRAAGVARKDLFVTTKLWNDRHGYDEAQRAMDESLRKLGLAYVD
FT                   LFLIHWPVAGSDKFVDAWRAMVAMKEDGRARSIGVSNFTIANLRRLVDETGVVPAVNQV
FT                   ELHPGFAQRELRAFHAEQGIATESWSPLGQGAVMHDATLAGIAARHGKSAAQVTLRWHL
FT                   QNGLIVIPKSVTPARIQANIDVFDFELSADEMADIDALPEGPRLGPDPATFTG"
FT   misc_feature    241601..242371
FT                   /note="HMMPfam hit to PF00248, Aldo/keto reductase family"
FT   misc_feature    241697..241750
FT                   /note="ScanRegExp hit to PS00798, Aldo/keto reductase
FT                   family signature 1. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   misc_feature    241949..242002
FT                   /note="ScanRegExp hit to PS00062, Aldo/keto reductase
FT                   family signature 2."
FT   misc_feature    242261..242308
FT                   /note="ScanRegExp hit to PS00063, Aldo/keto reductase
FT                   family putative active site signature."
FT   CDS_pept        242450..243430
FT                   /transl_table=11
FT                   /locus_tag="BP0901"
FT                   /product="putative oxidoreductase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   aldo/keto reductase Scf81.28C TR:Q9RJC4 (EMBL:AL133171)
FT                   (307 aa) fasta scores: E(): 6.4e-83, 66.667% id in 309 aa,
FT                   and to Escherichia coli hypothetical oxidoreductase YajO or
FT                   b0419 SW:YAJO_ECOLI (P77735) (324 aa) fasta scores: E():
FT                   9.9e-80, 61.846% id in 325 aa"
FT                   /db_xref="GOA:Q7VZK1"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZK1"
FT                   /protein_id="CAE41203.1"
FT                   /translation="MEYVRLGSTGLKVSRLCLGCMTYGEPARGNHAWTLDETQSRPFFR
FT                   QALDAGINFFDTANSYSDGTSEEFLGRALREYVPRDEVVVATKVFFPLRKEPNSGGLSR
FT                   KAIMREIDASLRRLGTDYVDLYQIHRWDYDTPIEETLQALHDVVKAGKARYIGASSMHA
FT                   WQFAKALYLADRHGWTRFSTMQNHYNLLYREEEREMLKLCCAEGVGVLPWSPLARGRLT
FT                   RDWAEGSARADTDDVLKRLYSATEQADRGVIDAVGEVAAQRGVSRAQVAMAWLLRQPAV
FT                   TAPIVGASKPRHLEDAVAALALRLTDEEAARLEAAYAPHPVAGFA"
FT   misc_feature    242612..242920
FT                   /note="HMMPfam hit to PF00248, Aldo/keto reductase family"
FT   CDS_pept        complement(243427..243639)
FT                   /transl_table=11
FT                   /locus_tag="BP0902"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Caulobacter crescentus hypothetical
FT                   protein Cc2926 TR:Q9A4B1 (EMBL:AE005957) (70 aa) fasta
FT                   scores: E(): 0.0073, 44.231% id in 52 aa"
FT                   /db_xref="GOA:Q7VZK0"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZK0"
FT                   /protein_id="CAE41204.1"
FT                   /translation="MTPRQHFYFVWGMPIVLGALSVFGLLAALLGTGVWHWASWLALAW
FT                   LLVVIARFWIVPRERRPAPGPRRGG"
FT   misc_feature    complement(join(243472..243537,243553..243618))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BP0902 by TMHMM2.0 at aa 7-29 and 34-56"
FT   misc_feature    complement(243559..243639)
FT                   /note="Signal peptide predicted for BP0902 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.899) with cleavage site
FT                   probability 0.648 between residues 27 and 28"
FT   CDS_pept        complement(243636..244817)
FT                   /transl_table=11
FT                   /locus_tag="BP0903"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa1909 TR:Q9I2J5 (EMBL:AE004617) (383 aa) fasta
FT                   scores: E(): 1.4e-72, 52.910% id in 378 aa, and to
FT                   Caulobacter crescentus hypothetical protein Cc2927
FT                   TR:Q9A4B0 (EMBL:AE005957) (394 aa) fasta scores: E():
FT                   2.4e-53, 50.681% id in 367 aa"
FT                   /db_xref="GOA:Q7VZJ9"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZJ9"
FT                   /protein_id="CAE41205.1"
FT                   /translation="MSTASTIKTWYLVHKWTSLVCTLFLLIICITGLPLVFHHEIEHLL
FT                   DEGKPVAQVAEGTPDASLDTIVARAHALYPDEYIDYVFLDDEEPQVYVGFTPKLGQAVE
FT                   AGHAVRVDARTGDILHDGPKYSADRFSFMGIMLALHVDLYAGLAGELFLGLMGLLFVIA
FT                   IVSGVVLYGPFMKKLDFGTVRASRSNRLKWLDLHNLLGIVTLVWAFVVGLTGVINELST
FT                   PLFRLWQQTELQAMTAPYQGKPVPRPAELSAPQRAADTALAAVPDRALTGISYPGNAFG
FT                   SPQHYIVWLKGNTPLTSKLNTPVLVDGKTGELAAVARMPWYLTVLELSRPLHFGDYGGM
FT                   PLKIIWALLDLITIVVLGSGLYLWLARRKATDARVAELVRRHQQAAEPQRTPA"
FT   misc_feature    complement(join(243720..243785,244164..244229,
FT                   244293..244358,244704..244769))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BP0903 by TMHMM2.0 at aa 16-38, 153-175, 196-218 and
FT                   344-366"
FT   CDS_pept        244981..245715
FT                   /transl_table=11
FT                   /gene="pphA"
FT                   /gene_synonym="prpA"
FT                   /locus_tag="BP0904"
FT                   /product="serine/threonine protein phosphatase 1"
FT                   /EC_number="3.1.3.16"
FT                   /note="Similar to Escherichia coli serine/threonine protein
FT                   phosphatase 1 PphA or PrpA or B1838 SW:PRP1_ECOLI (P55798)
FT                   (218 aa) fasta scores: E(): 1.9e-18, 34.821% id in 224 aa,
FT                   and to Bacteriophage lambda serine/threonine protein
FT                   phosphatase SW:PP_LAMBD (P03772) (221 aa) fasta scores:
FT                   E(): 1.2e-18, 33.803% id in 213 aa"
FT                   /db_xref="GOA:Q7VZJ8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZJ8"
FT                   /protein_id="CAE41206.1"
FT                   /translation="MAPNLQYPAFLRLPRNPAGRDFAVGDIHGHFSRLEQALDECGFDP
FT                   RRDRLFSVGDLIDRGPDSEAAVQWLAHPWFYAVQGNHEDYAIRHVRTGLVDQDNWRSYG
FT                   GGWFLDAAPERQRAWAGAFAALPVVIEVATQAGPVGLLHADCPVRDWSRLEYFLQARPK
FT                   RARSVCQWSRERLASGDARGVDGIRAVVAGHTPVSEPVVLGNVYHIDTQGWRPHGYFTL
FT                   FDLCTLSAWPRPAQAGAPAARG"
FT   CDS_pept        complement(245717..248329)
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /gene_synonym="ponA"
FT                   /locus_tag="BP0905"
FT                   /product="penicillin-binding protein 1A"
FT                   /EC_number="2.4.2.-"
FT                   /note="Similar to Escherichia coli penicillin-binding
FT                   protein 1A MrcA or PonA or B3396 SW:PBPA_ECOLI (P02918)
FT                   (850 aa) fasta scores: E(): 2.1e-61, 37.243% id in 827 aa,
FT                   and to Pseudomonas aeruginosa penicillin-binding protein 1A
FT                   MrcA or PonA or Pa5045 SW:PBPA_PSEAE (Q07806) (822 aa)
FT                   fasta scores: E(): 3.7e-62, 38.882% id in 805 aa"
FT                   /db_xref="GOA:Q7VZJ7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZJ7"
FT                   /protein_id="CAE41207.1"
FT                   /translation="MNTSSQSTKPPPPGGPRLFRKSLLIKAGVAVAGLGAAGALALGLA
FT                   LALAWPSLPELHAMTDYRPRVPLRVYTADGVLIGEFGEEHRNVLRADEIPQVMKQAVLA
FT                   AEDDRFYQHGGVDWMGVARAVLTNMVKLSKSQGGSTITMQVARNFYLSSEKTYSRKFYE
FT                   LLLTYKIEAELTKDQILELYMNQIYLGHRSYGFAAASRTYFGKPLSEVTPAEAAMLAGI
FT                   PKAPSRANPLASLPRATARQQYVLGRMQTLGYLTPEQVQEARAQTIVLRGSEGGPAHGF
FT                   AIHGEYPAELVRQLMYSIYQDGAYTHGIDVYTTIDSKAQQAAYRAVRAGVLDYTRRAPY
FT                   PGPQAQIDLPDGIEQDAQAFDEILDSVQDQAPDSDDLLAGVVLSTSPTSVTVARTATDI
FT                   VTVDDKKALAIVARALAPNAKDALRIRRGSVVYLHKNGDTWEIINMPALQAALVSMSPA
FT                   DGAISAMIGGFDFHRGSFNRVTQAWRQPGSTIKPFVYAAALERGMTPATQVNDQPFMLT
FT                   AEQTGSRAWEPKNDGNRYEPMLTLREGLYRSKNMVSIRILQAIGPEYARDYLTRFGFEQ
FT                   ARWPAMLPLALGAGGATPLQVANAYSVFANGGYRVTPYLIDRVTDRSGKVLMQTTPVKA
FT                   GDETARAIDPRTAWVIDDIMHDTTTKGTAARVYRTLKRNDIAGKTGTTNDAVDVWFSGY
FT                   TAQQTTTVWMGFDQPRSLGTNEFGSGLALSTWLDYEQPTLKGTPQAPRAPRPQGLIVDN
FT                   GEYYFSEFPPGQAVAALDLSSGDELTDFLNNMRPSDGAPARVQQPGQPPAGSSSGGQPP
FT                   IPPIPVPRADLPDGQATPASLPLGAPPAAASAPPAAPAHGGASAQPVTLPGRVGATPL"
FT   misc_feature    complement(246146..247072)
FT                   /note="HMMPfam hit to PF00905, Penicillin binding protein
FT                   transpeptidase domain"
FT   misc_feature    complement(247622..248128)
FT                   /note="HMMPfam hit to PF00912, Transglycosylase"
FT   misc_feature    complement(248183..248248)
FT                   /note="1 probable transmembrane helix predicted for BP0905
FT                   by TMHMM2.0 at aa 51-73"
FT   CDS_pept        complement(248465..250378)
FT                   /transl_table=11
FT                   /locus_tag="BP0906"
FT                   /product="putative peptidase"
FT                   /note="Similar to Rickettsia conorii
FT                   acylamino-acid-releasing enzyme Rc0603 TR:AAL03141
FT                   (EMBL:AE008621) (676 aa) fasta scores: E(): 2.3e-62,
FT                   34.783% id in 621 aa, and to Caulobacter crescentus prolyl
FT                   oligopeptidase family protein Cc3723 TR:Q9A243
FT                   (EMBL:AE006030) (667 aa) fasta scores: E(): 3.4e-42,
FT                   30.653% id in 659 aa"
FT                   /db_xref="GOA:Q7VZJ6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZJ6"
FT                   /protein_id="CAE41208.1"
FT                   /translation="MLTLIKRTVLAAGLIGTTLGAAAQPPRAYPLKDFFRNPERGYFRL
FT                   ADDGKTLGFMQPVSIDGQPPRMNIYVQALADGVPAGEPRKLTSETARDISNFFWKGDDT
FT                   VLYQKDFGGDENFHVLAVNARTGQVADLTPYEGVRASIEDDLPDDPDHVLISHNRRDPQ
FT                   VFDVYRVNVRTGAAELVAQNPGNVVGWQTDHAGKVRAAITSDGLNTTLLYRDDEAAPFR
FT                   PLITTDYRVSVSPAFFTFDDRKLYALSNRGRDKLALVVIDPATPDVEQPVFEPDEVDLD
FT                   AAGYSRKRKVLTVASYQTDKPRHRFFDAETEALYARLARALPGYDFALQGWNRDEDTFI
FT                   VAAYNDRTPGSRYLYDARRDSLHKLADINPAIPEADMAPVRPVSYQSRDGLTIHGYLTL
FT                   PAGRAPRNLACIVNPHGGPWARDGWGYNPEVQFLANRGFCVLQMNFRGSTGYGRKFWEA
FT                   GFGQWGLKMQDDITDGVQWLIDQGIADPRRIGIYGGSYGGYATLAGVAFTPDLYAAAVD
FT                   YVGVSNLFTFMNTIPPYWKPLLAKMQDMVGDPVRDKARLEATSPALHVDRIKTPLFIAQ
FT                   GAKDPRVNKAESDQVVQALRQRGVEVEYMVKDNEGHGFHNDENKFEFYAAMEKFFTEHL
FT                   KP"
FT   misc_feature    complement(248879..249076)
FT                   /note="HMMPfam hit to PF00326, Prolyl oligopeptidase
FT                   family"
FT   misc_feature    complement(250310..250378)
FT                   /note="Signal peptide predicted for BP0906 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.925 between residues 23 and 24"
FT   CDS_pept        join(250538..250942,250942..250968,250971..250991)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0907"
FT                   /product="putative lipoprotein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have two frameshift
FT                   mutations, following codons 156 and 144. The frameshift
FT                   occurs within dimeric tracts of (G)2 and (TC)2,
FT                   respectively. The sequence has been checked and believed to
FT                   be correct. No significant database matches"
FT                   /db_xref="PSEUDO:CAE41209.1"
FT   misc_feature    250559..250591
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   variation       250942..250943
FT                   /note="(G)2 in pertussis; (G)3 in parapertussis and
FT                   bronchiseptica"
FT   variation       250967..250970
FT                   /note="(TC)2 in pertussis; (TC)1 in parapertussis and
FT                   bronchiseptica"
FT   CDS_pept        complement(250994..251404)
FT                   /transl_table=11
FT                   /locus_tag="BP0908"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Halobacterium halobium hypothetical 15.6
FT                   kDa protein in phr 5'region SW:YPHR_HALHA (P20378) (151 aa)
FT                   fasta scores: E(): 2e-08, 29.688% id in 128 aa, and to
FT                   Halobacterium sp Vng1336C TR:Q9HQ45 (EMBL:AE005055) (151
FT                   aa) fasta scores: E(): 2e-08, 29.688% id in 128 aa"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZJ5"
FT                   /protein_id="CAE41210.1"
FT                   /translation="MSTPHTDFFGLTIPFMQLLGVVPEHSGNGTARTRLPARADLVNSR
FT                   GDIHGGTLMSVLDFTLGAAIRGDTPEVGVATIDMNTSFMSPGRGDLVIETRCLRRGASI
FT                   AFCKGEIRDSAGELVAKATATFKIIQRRPGGD"
FT   misc_feature    complement(251018..251380)
FT                   /note="HMMPfam hit to PF02584, Uncharacterized protein
FT                   PaaI, COG2050"
FT   CDS_pept        251502..252587
FT                   /transl_table=11
FT                   /gene="dinP"
FT                   /locus_tag="BP0909"
FT                   /product="DNA-damage-inducible protein p"
FT                   /note="Similar to Escherichia coli DNA-damage-inducible
FT                   protein P DinP or B0231 SW:DINP_ECOLI (Q47155) (351 aa)
FT                   fasta scores: E(): 1.1e-46, 45.845% id in 349 aa, and to
FT                   Neisseria meningitidis ImpB/MucB/SamB family protein
FT                   Nma1661 or DinP TR:Q9JRG1 (EMBL:AL162756) (352 aa) fasta
FT                   scores: E(): 1.3e-69, 56.358% id in 346 aa"
FT                   /db_xref="GOA:Q7VZJ4"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZJ4"
FT                   /protein_id="CAE41211.1"
FT                   /translation="MSQLQRKIVHIDMDAFYASVEQRDNPALRGLPVVVAWTGPRSVVC
FT                   AASYEARRYGVHSAMAAARAQRLCPDAVYVPPDFNRYREVSRQVRAIFARHTDLIEPLS
FT                   LDEAYLDVTCNKLGLASATEVAQIIRRQIREETGLTASAGVAPNKFLAKIASDWNKPDG
FT                   LFVIKPSRVLDFLQPLPVRKVPGVGKVMQARLEQLGIQTVGDLSRHSVAELEQRFGRYG
FT                   VRLYELARGIDERAVQADQPAQQVSAETTFDTDLALEALGEALERLAAKVWEQGAKKGR
FT                   IGRTTVLKLKTDRFRILTRSLTLMQPPGSAAELAAIARQLCTRVDLPAHTRYRLVGVGM
FT                   SNFPDAQAEAPRQAELFGDAF"
FT   misc_feature    251532..252536
FT                   /note="HMMPfam hit to PF00817, impB/mucB/samB family"
FT   repeat_region   252584..252615
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   252584..253636
FT   CDS_pept        252686..253636
FT                   /transl_table=11
FT                   /locus_tag="BP0910"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTC0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTC0"
FT                   /protein_id="CAE41212.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHN"
FT   misc_feature    252944..253009
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    253067..253600
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(253605..253636)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(253634..253711)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0910A"
FT                   /product="N-terminal region of a putative decarboxylase
FT                   (pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481. No significant database matches"
FT   CDS_pept        complement(253724..254275)
FT                   /transl_table=11
FT                   /locus_tag="BP0911"
FT                   /product="putative decarboxylase"
FT                   /note="Similar to Streptomyces wedmorensis
FT                   phosphonopyruvate decarboxylase Fom2 TR:Q56190
FT                   (EMBL:AB016934) (384 aa) fasta scores: E(): 0.00013,
FT                   32.278% id in 158 aa, and to Methanothermobacter
FT                   thermautotrophicus phosphonopyruvate decarboxylase related
FT                   protein Mth1206 TR:O27274 (EMBL:AE000888) (165 aa) fasta
FT                   scores: E(): 9.5e-10, 36.957% id in 138 aa"
FT                   /db_xref="GOA:Q7VZJ3"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZJ3"
FT                   /protein_id="CAE41214.1"
FT                   /translation="MGAIAAHETGDTAATATWDETVWRILKKEDIRLVTYVPDKVLKPL
FT                   IDRVEADDHFQVVCPAREEEALGIVCGAQMAGMRSILLTQTSGFATLANVLASLPVPYE
FT                   IPVVMVISERGALGDRQLVQVRVWQTMRPILDSLGIPHHTLTRADAVEFVAEEAIRQAF
FT                   ATRSPAALILSPKLTKKSSD"
FT   CDS_pept        join(254449..255096,255095..255448)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0912"
FT                   /product="LysR-family transcriptional regulator
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 216. The frameshift occurs within
FT                   a dimeric tract of (GC)2. The sequence has been checked and
FT                   believed to be correct. Similar to Escherichia coli cyn
FT                   operon transcriptional activator CynR or B0338
FT                   SW:CYNR_ECOLI (P27111) (311 aa) fasta scores: E(): 4.5e-15,
FT                   28.013% id in 307 aa, and to Rhizobium meliloti putative
FT                   transcriptional regulator protein Smb20123 TR:CAC48523
FT                   (EMBL:AL603642) (298 aa) fasta scores: E(): 1.9e-17,
FT                   28.276% id in 290 aa"
FT                   /db_xref="PSEUDO:CAE41215.1"
FT   misc_feature    254467..254895
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    254509..254601
FT                   /note="ScanRegExp hit to PS00044, Bacterial regulatory
FT                   proteins, lysR family signature."
FT   variation       255094..255097
FT                   /note="(GC)2 in pertussis; (GC)3 in parapertussis and
FT                   bronchiseptica"
FT   CDS_pept        255553..256527
FT                   /transl_table=11
FT                   /locus_tag="BP0913"
FT                   /product="putative exported protein"
FT                   /note="Similar to Escherichia coli putative aliphatic
FT                   sulfonates binding protein precursor SsuA or B0936
FT                   SW:SSUA_ECOLI (P75853) (319 aa) fasta scores: E(): 1.7e-09,
FT                   24.903% id in 257 aa, and to Agrobacterium tumefaciens
FT                   Agr_l_1399p TR:AAK89280 (EMBL:AE008268) (338 aa) fasta
FT                   scores: E(): 2.9e-13, 28.197% id in 305 aa"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZJ2"
FT                   /protein_id="CAE41216.1"
FT                   /translation="MKSRICRRLAGALLGVVAACASQAQDTIRLGLQAVPTDELYQARD
FT                   WAQPYGLKTEISTYSSAGDSLKAFLAGRVDVVSGGAARLVTMAAKQPEVFYIVAANQYG
FT                   GDRYGIIVGPEAPYKSIADLKGKKIGVVSGSGAHGTLMLYLEKNQLSPKDFRFVNMKVE
FT                   DIAAAVNRGVVDAGLAWEPHVALAEVNGAVKRIQSMKGVNESPNFILVNREYAGKHPEA
FT                   VAKYIASMIDMSQLTANDPKKAGEMIAAQLGKSGVSIPPKAMELAVSRIVVDPRIEDRL
FT                   LEELPAIAEPMIAAGRINAMPEFGKLVQKSYYERAAALAKARQ"
FT   misc_feature    255553..255624
FT                   /note="Signal peptide predicted for BP0913 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.995 between residues 24 and 25"
FT   misc_feature    255580..255612
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        256547..257419
FT                   /transl_table=11
FT                   /locus_tag="BP0914"
FT                   /product="probable inner membrane component of
FT                   binding-protein-dependent transport system"
FT                   /note="Similar to Escherichia coli taurine transport system
FT                   permease protein TauC or SsiC or B0367 SW:TAUC_ECOLI
FT                   (Q47539) (275 aa) fasta scores: E(): 1e-26, 35.887% id in
FT                   248 aa, and to Pseudomonas aeruginosa probable permease of
FT                   ABC taurine transporter Pa3936 TR:Q9HX80 (EMBL:AE004811)
FT                   (272 aa) fasta scores: E(): 4.9e-27, 33.585% id in 265 aa"
FT                   /db_xref="GOA:Q7VZJ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZJ1"
FT                   /protein_id="CAE41217.1"
FT                   /translation="MKPLAATTAHTVMIRPAARRTPGACAAYAEFGRFMLPIVTLLVFW
FT                   EFAVRAGWIASNIFPSPSMIFARASEQLFSTGPEQGMLFKHIGASLYRAISAFLLSVLI
FT                   GIPLGFCLGLMPSVHKWTSPILSVMLPLPAVAWTPILLVAFGQGDRTIITVCFLGAFFP
FT                   VLYSTIQGVKAVSKQSIWVVRSMGGKRRHVLLNVLLPSCLPALISGLKLGMAHSWRTLV
FT                   AAEMLAAISTGLGYMIFAARSYMDVSTMFVGIALLALIGMAIEYGIFGMLEQRTIRKWH
FT                   GASRIGGSK"
FT   misc_feature    join(256820..256888,256916..256984,257003..257062,
FT                   257120..257188,257207..257266,257294..257362)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP0914 by TMHMM2.0 at aa 92-114, 124-146, 153-172, 192-214,
FT                   221-240 and 250-272"
FT   misc_feature    257057..257275
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   CDS_pept        257416..258243
FT                   /transl_table=11
FT                   /locus_tag="BP0915"
FT                   /product="probable inner membrane component of
FT                   binding-protein-dependent transport system"
FT                   /note="Similar to Escherichia coli taurine transport system
FT                   permease protein TauC or SsiC or B0367 SW:TAUC_ECOLI
FT                   (Q47539) (275 aa) fasta scores: E(): 2.1e-25, 32.530% id in
FT                   249 aa, and to Rhizobium loti taurine transport system
FT                   permease protein Mlr4519 TR:Q98DW5 (EMBL:AP003004) (286 aa)
FT                   fasta scores: E(): 4.4e-24, 32.830% id in 265 aa"
FT                   /db_xref="GOA:Q7VZJ0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZJ0"
FT                   /protein_id="CAE41218.1"
FT                   /translation="MSSAMASSMPGGDGARVFDRLLVPLVSLGVPLLIWEFLARSGLVS
FT                   DFLFPPPSSIFSTLWSDSGADVHGGQLYRHVYYSMMRLLAGLALAAAVGTLIGILIGLT
FT                   RWGRFVFKPLLSLFMPVPTLAWTPILLLLIGVDNKTTILIVFIAASFEVILNVVAGIEN
FT                   MNVKVFWVARSMGASRLQIFFKVIVPGILPYLITGVRLGSGYAWRALIAAEMLAASSYG
FT                   LGFMIYEASEFMDMTTIYGGLIMIALLGYLIENVLMGAFEERTVGKWGVQVER"
FT   misc_feature    join(257476..257532,257653..257721,257755..257823,
FT                   257833..257901,257959..258018,258028..258096,
FT                   258130..258198)
FT                   /note="7 probable transmembrane helices predicted for
FT                   BP0915 by TMHMM2.0 at aa 21-39, 80-102, 114-136, 140-162,
FT                   182-201, 205-227 and 239-261"
FT   misc_feature    257893..258111
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   CDS_pept        join(258267..258668,258672..259046)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0916"
FT                   /product="putative ATP-binding protein of a transporter
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS contains an in-frame TGA stop
FT                   codon. The sequence has been checked and believed to be
FT                   correct. Similar to Pseudomonas putida sulfate ester
FT                   transporter protein AtsC TR:Q9WWU7 (EMBL:AF126201) (287 aa)
FT                   fasta scores: E(): 7.3e-31, 48.544% id in 206 aa, and to
FT                   Methanococcus jannaschii hypothetical ABC transporter
FT                   ATP-binding protein Mj0412 mj0412 SW:Y412_METJA (Q57855)
FT                   (267 aa) fasta scores: E(): 4.9e-39, 49.573% id in 234 aa"
FT                   /db_xref="PSEUDO:CAE41219.1"
FT   misc_feature    258378..258401
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   variation       258669..258671
FT                   /note="TGA in-frame stop codon in pertussis; GGA in
FT                   parapertussis and bronchiseptica"
FT   CDS_pept        259146..260567
FT                   /transl_table=11
FT                   /locus_tag="BP0918"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Methanothermobacter thermautotrophicus
FT                   conserved protein Mth965 TR:O27046 (EMBL:AE000870) (452 aa)
FT                   fasta scores: E(): 3.4e-34, 32.143% id in 420 aa, and to
FT                   Pseudomonas aeruginosa hypothetical protein Pa0881
FT                   TR:Q9I564 (EMBL:AE004522) (450 aa) fasta scores: E():
FT                   2.2e-30, 29.556% id in 450 aa"
FT                   /db_xref="GOA:Q7VZI9"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZI9"
FT                   /protein_id="CAE41220.1"
FT                   /translation="MREMSMNEETAAKLQGLTRRFAKLVHDLKFEDLPEEVLHKAKLII
FT                   RDGLGNQIAASAISEPARRVVEIVREWGGKPEATVIGYGFKVPAPLAAMCNAMLGHGVE
FT                   LDDAHGSGLIKGGSVMIPSIMALAEANGKSGRDVITAIVAGYEVAVRIAKAINLGHRQR
FT                   GFHTTGTVSLFGAAAGGAKLLGCDEEGIAAAIGLAAMQSAGIQSYLDDPCMAKPFSPGK
FT                   SAFNGTMAAVMASRGFAGPRKALECKEGFFNAYCEDIRVDDLLDGLGERFVIMEVGFKP
FT                   HAACRYAHGPIDLAQQFFEEGVRLEDVEKIDVRMCELSIRQASKPKAPNLNAAMGSTEF
FT                   GVALALAGGRNGLREYWDGFNDQRVHEAAADRTRLIMEPAYGVTGRQAAMAVTLKDGRV
FT                   LQRDQAEPKGEPSNPLTDQELTDKFTGLVDMVETSSQVSGEFSQRLMRLEDEKAIADLI
FT                   GPLKAAGQTPALRAA"
FT   CDS_pept        260672..262126
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BP0919"
FT                   /product="putative succinate-semialdehyde dehydrogenase
FT                   [NADP+]"
FT                   /EC_number="1.2.1.16"
FT                   /note="Similar to Escherichia coli succinate-semialdehyde
FT                   dehydrogenase [NADP+] GabD or B2661 SW:GABD_ECOLI (P25526)
FT                   (482 aa) fasta scores: E(): 1.3e-46, 35.532% id in 470 aa,
FT                   and to Bacillus halodurans NADP-dependent
FT                   glyceraldehyde-3-phosphate dehydrogenase Bh1738 TR:Q9KC36
FT                   (EMBL:AP001513) (482 aa) fasta scores: E(): 7.4e-67,
FT                   40.812% id in 468 aa"
FT                   /db_xref="GOA:Q7VZI8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZI8"
FT                   /protein_id="CAE41221.1"
FT                   /translation="MNVTDGIAQRSMAEYTGILINGVWQAGEGSFPVLDKYTLVPAAEV
FT                   FRASRRQVAQAVAQCKAAADRGAPAARERAAVLRRAAGLLDTYRQDFEAVMMVEGGFTV
FT                   HDISAEFTRAKVTLELSADEALRLTGSMVPFQASPGAEHKLGFTVRVPVGVVAAITPFN
FT                   APLNTVLHKVAPAFAAGNAVVLKPSAFTPLTSALLARVLLEAGMPPEFLAVVQGEGDDV
FT                   GTWLLEEQDVAFYTFTGSTRVGRIIQRAAGLRRTQMELGSIASTIVCADADLEAAVPRI
FT                   ANAAFRKAGQVCTSIQRLYVEDALKNELIERLSRYLDDMPAGDPRAVATRVGPMISEAA
FT                   ATRAQAWIAEAVEAGARLVRGGERQGAVVQPAVLADVPESCSAWSTEVFSPMVSVGGFA
FT                   RFDDVLASANDTPYGLAAGIFTNDHARIMSAVRSLRFGTVHINETSSARCDVMPFGGVK
FT                   DSGFGKEGPGYAAREMTEERLIVFNQ"
FT   misc_feature    260738..262123
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
FT                   family"
FT   CDS_pept        complement(262176..263579)
FT                   /transl_table=11
FT                   /locus_tag="BP0920"
FT                   /product="putative exported protein"
FT                   /note="Similar to Salmonella typhi hypothetical protein
FT                   R0146 TR:Q9L5J6 (EMBL:AF250878) (467 aa) fasta scores: E():
FT                   4.6e-137, 73.176% id in 466 aa"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR012831"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZI7"
FT                   /protein_id="CAE41222.1"
FT                   /translation="MIDVLVIGGGNAALCAALSAREAGASVLLLEAAPREWRGGNSQHT
FT                   RNLRCMHDAPQDVLVESYPEEEYWQDLLKVTGGITNEHLARLVIRRSSNCRPWMRSHGV
FT                   RFQNSLSGTLHLARTNAFFMGGGKALVNAYYRSAAALGIQVRYDTPVAAIERDGERFVA
FT                   AVLEDGARIEAGSCVLAAGGFESNLDWLDQAWGTNENGERPALQFLIRGTRYNRGVLLR
FT                   HMLDSGADAIGDPTQAHMVAIDARSPLYDGGICTRIDCVPLGIVVNRAGQRFYDEGEDF
FT                   WPKRYAIWGRLVAQQPGQIAWSIIDRKSIGRFMPPVFPGTQADSIEALARKLGLPVEQT
FT                   SRTIAEYNATCISGTFDHTVLDDCRTQGLTPAKTHWASPIVEPPFQGFPLKPGITFTYL
FT                   GLKTDDTAAVRFNDRPSPNLFVAGEMMAGNILGKGYTGDIGMAIGTAFGRIAGAGAAQH
FT                   ALAGRRQAA"
FT   misc_feature    complement(262545..262610)
FT                   /note="Predicted helix-turn-helix motif with score 1357
FT                   (+3.81 SD) at aa 324-345, sequence DSIEALARKLGLPVEQTSRTIA"
FT   misc_feature    complement(263514..263579)
FT                   /note="Signal peptide predicted for BP0920 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.600) with cleavage site
FT                   probability 0.232 between residues 22 and 23"
FT   CDS_pept        complement(263600..264784)
FT                   /transl_table=11
FT                   /gene="citB"
FT                   /locus_tag="BP0921"
FT                   /product="citrate utilization protein B"
FT                   /note="Similar to Escherichia coli citrate utilization
FT                   protein B CitB SW:CIT2_ECOLI (P05853) (379 aa) fasta
FT                   scores: E(): 2.6e-91, 60.743% id in 377 aa, and to
FT                   Salmonella typhi putative citrate utilisation protein CitB
FT                   TR:Q9L5J7 (EMBL:AF250878) (379 aa) fasta scores: E():
FT                   2.3e-90, 60.212% id in 377 aa"
FT                   /db_xref="GOA:Q7VZI6"
FT                   /db_xref="InterPro:IPR012830"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZI6"
FT                   /protein_id="CAE41223.1"
FT                   /translation="MSTPYTESQVMARATIPIAVEDTGIEHDEAQARRILTICNACRYC
FT                   EGFCAVFPAMTRRLDFVKEDVHYLANLCHNCGACLHACQYAAPHEFDVNIPRTLAKVRL
FT                   KTYSEYAWPRALGQLYDRNGLTLSLATAVGLSLFLALLFWLNGALWHAPLQGNFYAIFP
FT                   HNLLVAMFGLVFLYAALALGIGATRFWRGTRQDAAPPSSASGAAAEASFDVLTLRYLGG
FT                   GHGEGCNEESARFTLWRRRFHHLTFYGFMLCFAATGVATVYHYALGWQAPYPVLSLPVL
FT                   LGTAGGIGLLIGPAGLYLLNRKRHADHGDPAQHAMDRGFMALLFFVSLTGLLLLALRDT
FT                   SWMAVLLAVHLGFVMAFFLTMPYGKFAHGIYRSAALLKNAVEKRTPGTLNVGAD"
FT   misc_feature    complement(join(263693..263758,263774..263824,
FT                   263888..263953,263984..264049,264230..264286,
FT                   264347..264412))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP0921 by TMHMM2.0 at aa 124-146, 166-185, 245-267,
FT                   277-299, 320-337 and 342-364"
FT   misc_feature    complement(264518..264589)
FT                   /note="HMMPfam hit to PF00037, 4Fe-4S binding domain"
FT   CDS_pept        complement(264827..266002)
FT                   /transl_table=11
FT                   /locus_tag="BP0922"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Bacillus subtilis hypothetical 39.5 kDa
FT                   protein in sigZ-csn intergenic region YraM SW:YRAM_BACSU
FT                   (O07931) (367 aa) fasta scores: E(): 3.4e-41, 38.462% id in
FT                   364 aa, and to Vibrio cholerae hypothetical protein Vc1339
FT                   TR:Q9KSB9 (EMBL:AE004213) (400 aa) fasta scores: E():
FT                   5.1e-39, 34.896% id in 384 aa. Also similar to BP2370,
FT                   35.459% identity (36.968% ungapped) in 392 aa overlap."
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZI5"
FT                   /protein_id="CAE41224.1"
FT                   /translation="MTADPEQLSLPCLYMRGGSSKGGFFLAADLPADPLERDATLLAAY
FT                   GSPDARQIDGIGGADPLTSKAAIVARSGRPDADVEYTFCQVDLTRAQVSTGGNCGNMLA
FT                   AVGPYAVLRGLIPAREGQNRVRIYTTNTKQVVEASFAVRAGVPCVEGPTVVPGVPGSGA
FT                   TVAIDFGDCAGSVSGTLLPTGRAADAIEIDGRPVRVSLVDAATPFVYVVAEDIGGDATA
FT                   TPQDIQNDSALMDRLEQARGWAAVTLGLVDDARKARETSPNVPRVMMISAPRDYVAGDT
FT                   PIKAADINLCVRQLAMQKPHKALAVTGAVCTAIACRIPGSVVQEQLRGDTGSEIRLGHP
FT                   SGALSVDSQVDQTPAGPRVRKAALNRTARLIMAGQLFIAREKIRQLMQRMR"
FT   CDS_pept        266173..266988
FT                   /transl_table=11
FT                   /locus_tag="BP0923"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Methanococcus jannaschii hypothetical
FT                   protein Mj0255 SW:Y255_METJA (Q57703) (251 aa) fasta
FT                   scores: E(): 2.6e-16, 32.500% id in 240 aa, and to
FT                   Methanothermobacter thermautotrophicus conserved protein
FT                   Mth1674 TR:O27710 (EMBL:AE000925) (258 aa) fasta scores:
FT                   E(): 3.5e-16, 30.116% id in 259 aa"
FT                   /db_xref="GOA:Q7VZI4"
FT                   /db_xref="InterPro:IPR003830"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036112"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZI4"
FT                   /protein_id="CAE41225.1"
FT                   /translation="MDKPRTAPVASLSPLSFDHDHRSKKPRAVGLTSVIDFGPDGFGWA
FT                   GPASLRDYLRCVADYIDYAKIYALNALILPEEIVRETVRIYRDADIKPYAGGILFEYAY
FT                   LKNELDGYIRHLKKLGMPRIEVSENYLDFGDDERMRHIETMQKHGFEVIYEFGRKNPTE
FT                   PFSLAQLERVIRSNVAMGVHHTIIEQSEIDCVSASNPAILKDIAARDWFRNIFIEADPY
FT                   AFPKGHATLLEKFGDGVNLANITADQVLRLQGFRYGVGRAVNYSILSRI"
FT   misc_feature    266218..266955
FT                   /note="HMMPfam hit to PF02679, Uncharacterized ACR,
FT                   COG1809"
FT   CDS_pept        267030..267926
FT                   /transl_table=11
FT                   /locus_tag="BP0924"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Klebsiella oxytoca CymJ TR:Q48400
FT                   (EMBL:X86014) (268 aa) fasta scores: E(): 5.8e-10, 24.895%
FT                   id in 237 aa, and to Bacillus subtilis YrhO TR:O05405
FT                   (EMBL:U93874) (275 aa) fasta scores: E(): 4.8e-13, 25.704%
FT                   id in 284 aa"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR021586"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZI3"
FT                   /protein_id="CAE41226.1"
FT                   /translation="MNNTRSAYEKIIKDLQGVGFSDYEAKTYIALLLTPNATAYEISKE
FT                   AGIPKANCYSVLEALRKNGAVQAVSENPVKYVAVDPNRYFNQMVELTQLRCEDLKESLK
FT                   NIGHLPQEDLVWSLNDAAAVGLHIEKMIGSARDTIRIKAADTTLEPHLPSLKKAARRGV
FT                   KVLIILFGEDVRPFELGKNCKVYLHEGNGIRVGISHKLITVTRDYKEALVAEVGRDAYG
FT                   SYTENKPIVTLADSLLRHEIYFAEIFSCFGDEIQEKFGPALVKLRESYLPADQADALKV
FT                   FLETADPARLAGKATAA"
FT   misc_feature    267057..267761
FT                   /note="HMMPfam hit to PF01978, Helix-turn-helix family
FT                   DUF118"
FT   CDS_pept        complement(267981..268841)
FT                   /transl_table=11
FT                   /locus_tag="BP0925"
FT                   /product="putative fumarylacetoacetate-family hydrolase"
FT                   /note="Similar to Homo sapiens unknown TR:AAH09403
FT                   (EMBL:BC009403) (314 aa) fasta scores: E(): 1.5e-30,
FT                   41.702% id in 235 aa, and to naphthalenesulfonate-degrading
FT                   bacterium BN6 homolog to 2-hydroxyhepta-2 TR:Q50913
FT                   (EMBL:U38978) (144 aa) fasta scores: E(): 2.1e-31, 58.451%
FT                   id in 142 aa"
FT                   /db_xref="GOA:Q7VZI2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZI2"
FT                   /protein_id="CAE41227.1"
FT                   /translation="MQFVNLDHAGRAMAAVAHPHGYVLLPGPENGDSPELGERIRREED
FT                   LPALGAQALAAGTPLVAGSAAVLAPLLTRPGKIICLGLNYYDHAREGGRDKPTYPWFFL
FT                   RAPSSLVAHGQAAWLPRVSGHFYYEAELAVVIGKRARHVMPEQALDMVLGYACFNDMSV
FT                   RDYQKKTPQWTVGKNFDRTGGFGPALVLAGDLPPGGRGLGITCRVNGRTVQEANTDDMI
FT                   FDVAEAIGIVTECMTLEPGDVLVMGTPAGVGMARTPPLWLKPQDTVEVEIERVGRLCNP
FT                   VLAEP"
FT   misc_feature    complement(268071..268571)
FT                   /note="HMMPfam hit to PF01557, Fumarylacetoacetate (FAA)
FT                   hydrolase family"
FT   CDS_pept        complement(268919..269992)
FT                   /transl_table=11
FT                   /locus_tag="BP0926"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa1213 TR:Q9I4C5 (EMBL:AE004551) (319 aa) fasta
FT                   scores: E(): 2.2e-14, 30.556% id in 288 aa"
FT                   /db_xref="GOA:Q7VZI1"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZI1"
FT                   /protein_id="CAE41228.1"
FT                   /translation="MNEACTPTEASLDSYRNAQAWYGPQLDKHPEYWVHHLTGPELEQL
FT                   DRAVRRADAGGKDITELSQDDFELGELGQRLQHVKHEVLHGRGLYLIRGVPVEQYTMRQ
FT                   SAIAFWALGTNLGLPVSQNGKGHVLGHVANLGLDYADAAVRGYQTSNRLPYHTDSSDIV
FT                   GLLCVRPAKAGGLSSVVSSTTVWNELAARHPEHARTLLDSFHRTRWGEIPEGQKPYSSS
FT                   PVFAPYQGRMYANYVRSAIRKAQALPSVPRLSAQQNEALDCLDALTCDPALYLDMDFKP
FT                   GDVQLLSNFTIFHSRTAYEDWPETERRRHLLRLWLACEGGPPIPEPLLRRNGLASNGRP
FT                   NGIEVPGVKPNAPLVPQ"
FT   CDS_pept        complement(270118..271092)
FT                   /transl_table=11
FT                   /locus_tag="BP0927"
FT                   /product="putative exported protein"
FT                   /note="Similar to Comamonas testosteroni Orf4 protein
FT                   TR:Q9S155 (EMBL:AB024335) (325 aa) fasta scores: E():
FT                   2.6e-40, 36.977% id in 311 aa, and to Rhizobium meliloti
FT                   conserved hypothetical protein Sma1927 TR:AAK65716
FT                   (EMBL:AE007292) (330 aa) fasta scores: E(): 9.2e-39,
FT                   35.647% id in 317 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZI0"
FT                   /protein_id="CAE41229.1"
FT                   /translation="MLQRLFAVLLAASTHAAACAQTPTPAYPERTVRFLVPYTPGGNAD
FT                   MLVRLLSLKLTEYWDKPVVVENKPGASGTIAVNTVAKAEPDGHTLVLGAAGNLVVANKL
FT                   IKGLPYDPVEDLKAVSVVATPPFVLITAEQSRYQDVASLVADAGQRPEQITFGSAGIGS
FT                   ANHLSGELLALMKRVKFTHVAYKGMGPALNDVVAGRIDFAFAPIPLVLPQIQAGKLRAL
FT                   AVSGTTRTQVLPDVPTVSEAGVTGFESGAWFTVMVPKNTPDRIVDKINHDLKSAMQDAD
FT                   FIRKLAEEGAVPIGNTPAEASASLQSEMAKWGDLIDRLNLQPI"
FT   misc_feature    complement(271033..271092)
FT                   /note="Signal peptide predicted for BP0927 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.642 between residues 20 and 21"
FT   CDS_pept        271231..272220
FT                   /transl_table=11
FT                   /locus_tag="BP0928"
FT                   /product="LysR-type transcriptional regulator"
FT                   /note="Similar to alpha proteobacterium Y3F LysR-type
FT                   transcriptional regulator PcaQ TR:Q9L5A8 (EMBL:AF253466)
FT                   (308 aa) fasta scores: E(): 5.8e-19, 30.293% id in 307 aa,
FT                   and to Pseudomonas aeruginosa probable transcriptional
FT                   regulator Pa2206 TR:Q9I1R1 (EMBL:AE004647) (315 aa) fasta
FT                   scores: E(): 5.6e-22, 31.707% id in 287 aa"
FT                   /db_xref="GOA:Q7VZH9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZH9"
FT                   /protein_id="CAE41230.1"
FT                   /translation="MQKSAARGLGHIRIKHLRLLELVVQYGSLRKAAEGLHLSEPAASQ
FT                   MLREVESTFGVTLFERGRRGMRPNPFADVLVGRVWVILRELHEMQADVAELEHRQGVSS
FT                   DLGALPRCLHTLVPTTLVRLFGAGFRSRVRIAEGTSRQLLDALDQGAIDIAVTRLLESH
FT                   AGLAGARNFDSAVLYEEAIAIVCSTDHPLSAVDTVTLDMLTQYDWVLPPSTSITGKLIE
FT                   EEFVSAGLRPPVPKVEWLTSASRLTLVQKSNFLGICPASVAAELQQGGRLHVLPVNPRV
FT                   PLPPISVVWRRTKGDIAEIMDMKNALIECAAAMPGAMETGAAVRAGEF"
FT   misc_feature    271270..271698
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    271309..271374
FT                   /note="Predicted helix-turn-helix motif with score 1555
FT                   (+4.48 SD) at aa 27-48, sequence GSLRKAAEGLHLSEPAASQMLR"
FT   misc_feature    271312..271404
FT                   /note="ScanRegExp hit to PS00044, Bacterial regulatory
FT                   proteins, lysR family signature."
FT   CDS_pept        complement(272245..272820)
FT                   /transl_table=11
FT                   /locus_tag="BP0929"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Helicobacter pylori J99 putative Jhp0345
FT                   TR:Q9ZM77 (EMBL:AE001470) (189 aa) fasta scores: E(): 0.02,
FT                   22.527% id in 182 aa, and to Streptomyces coelicolor
FT                   putative membrane protein Sc5e9.11 TR:Q9EWM6
FT                   (EMBL:AL446003) (233 aa) fasta scores: E(): 0.15, 28.333%
FT                   id in 180 aa"
FT                   /db_xref="GOA:Q7VZH8"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZH8"
FT                   /protein_id="CAE41231.1"
FT                   /translation="MKLKPAPNSIFAILLRSSWWISAAIALVLIASALASTRPTFTAVL
FT                   FFAALPFLVIAAMAAWKQRNVPSAARVERATNAARAMSWETFSKVLQEGLRQDGCEVTV
FT                   LQGGPADYVLRRKNRLAVVGAKRWKASRVGVQALQELNAVRETHGAHDAIYVTIGEISA
FT                   PALAYAKANQIQFMAEAELTRLLPQLST"
FT   misc_feature    complement(join(272638..272703,272716..272781))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BP0929 by TMHMM2.0 at aa 13-35 and 39-61"
FT   misc_feature    complement(272716..272820)
FT                   /note="Signal peptide predicted for BP0929 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.463 between residues 35 and 36"
FT   CDS_pept        complement(272914..274572)
FT                   /transl_table=11
FT                   /locus_tag="BP0930"
FT                   /product="putative CoA ligase"
FT                   /note="Similar to Pseudomonas diterpeniphila coenzyme A
FT                   ligase TdtL TR:AAK95584 (EMBL:AF274704) (543 aa) fasta
FT                   scores: E(): 7.2e-54, 33.333% id in 546 aa, and to
FT                   Escherichia coli probable crotonobetaine/carnitine-CoA
FT                   ligase CaiC or B0037 SW:CAIC_ECOLI (P31552) (522 aa) fasta
FT                   scores: E(): 1.7e-38, 29.039% id in 489 aa"
FT                   /db_xref="GOA:Q7VZH7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZH7"
FT                   /protein_id="CAE41232.1"
FT                   /translation="MQAANIWPAIDAEAEIGDIRQWTTGAVLARRAERCPDRVFLRFAP
FT                   DGRSYTFADLHRRTNGIAQAMIGYGIAQGEHVAMLSPNCPECLLGNLALGKVGAVSVPI
FT                   NTNAKASLLEYYLTHADCVTAIVADACMEAFAAVAPRLAQLRRVLVIGDAANARRMLAG
FT                   LPLAVEPFPADAASDEAVDNDVRFTDLAYLMFTSGTTGPSKAIMIPHGAAWHWGKHSVH
FT                   YRYFLPEDVDYVCMPLFHANALLLSCTTAIVAGTSVVLDERFSASRFWERVRAFGVTRF
FT                   NAIGAIGNFLWSQPASPVDLEHKVRICSLAPPPPFVHDFERRFGLRVIAGYALSDYGFG
FT                   ASLSPDAPPEKSLSLGRTCEGVAIRVVDEDDLTLPAGQVGEIVMRIEQPGAAPLGYYKM
FT                   PEATLAAWRNLWFHTGDRGYFDADGYLYLTDRKKDMIRRRGENISSYEVESVIALHPAV
FT                   LQVAVYPLQSEHSEDEVAVTIMLKDGQALDPDELVAFCQQQMAAHMVPRFVEFVDAMPL
FT                   TPTNKIEKYKIKERAQADRSRLWDRERTPGARPGP"
FT   misc_feature    complement(273184..274422)
FT                   /note="HMMPfam hit to PF00501, AMP-binding enzyme"
FT   misc_feature    complement(273961..273996)
FT                   /note="ScanRegExp hit to PS00455, Putative AMP-binding
FT                   domain signature."
FT   CDS_pept        complement(274584..275567)
FT                   /transl_table=11
FT                   /locus_tag="BP0931"
FT                   /product="putative exported protein"
FT                   /note="Similar to Burkholderia cepacia hypothetical 35.5
FT                   kDa protein TR:AAK81675 (EMBL:AF029344) (337 aa) fasta
FT                   scores: E(): 5.3e-24, 33.779% id in 299 aa, and to
FT                   Comamonas testosteroni Orf4 protein TR:Q9S155
FT                   (EMBL:AB024335) (325 aa) fasta scores: E(): 3e-25, 33.750%
FT                   id in 320 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZH6"
FT                   /protein_id="CAE41233.1"
FT                   /translation="MHSGNRITRRSFMLAAGALGLALAGAAQAAAFPQRPVAMIVPFPA
FT                   GTAVDVVARFLATRFTQQWNQSVYVENRVGADGLIGTVAAKMAPADGHTILYTGPPFLF
FT                   VPDLNPQADYDPLKDFRPVARVTAPVYMLAATKSAPYSTFREMVETAKRTGSQLDVGTV
FT                   GAHGTATAAGMARAAGVDINIINYKTTAQLISDSIAGHVPMVLSALGSLNTLTHNGSLK
FT                   ALAVSGPQRSIIAPEVPTAMEAGAKDFSVVSWNSAFVRTGTPDAAVDAIAQAIHKATLS
FT                   PDFIEFCRAQGLEPAFEDGQAWLKTLPAERSYLNGLLRQSGLLAAK"
FT   misc_feature    complement(275481..275567)
FT                   /note="Signal peptide predicted for BP0931 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.991 between residues 30 and 31"
FT   CDS_pept        complement(275572..275994)
FT                   /transl_table=11
FT                   /locus_tag="BP0932"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Methanothermobacter thermautotrophicus
FT                   conserved protein Mth1398 TR:O27449 (EMBL:AE000902) (133
FT                   aa) fasta scores: E(): 1.1e-07, 35.398% id in 113 aa, and
FT                   to Archaeoglobus fulgidus conserved hypothetical protein
FT                   Af2417 TR:O30254 (EMBL:AE001108) (122 aa) fasta scores:
FT                   E(): 2.2e-07, 37.349% id in 83 aa"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZH5"
FT                   /protein_id="CAE41234.1"
FT                   /translation="MQNSEQACGWQADPYALAYPESAPFWQAAETGTLLLPQCVRCECF
FT                   HWHPRAFCPFCKAPDPRWTASSGQGEIFSFSVARTATPYVVAYVRLAEGPLMLTNIVDC
FT                   DPDSVRIGQRVSARFRPTQQGRLLPVFAPTHDHEKD"
FT   misc_feature    complement(275605..275937)
FT                   /note="HMMPfam hit to PF01796, Domain of unknown function
FT                   DUF35"
FT   CDS_pept        complement(join(275998..276183,276188..277186))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0933"
FT                   /product="conserved hypothetical protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 333. The sequence has been checked
FT                   and believed to be correct. Similar to Rhodococcus spNCIMB
FT                   9784 non-specific lipid carrier-like protein CampC
FT                   TR:AAK50624 (EMBL:AF323755) (408 aa) fasta scores: E():
FT                   1.2e-30, 32.741% id in 394 aa, and to Pseudomonas
FT                   aeruginosa hypothetical protein Pa1016 TR:Q9I4V7
FT                   (EMBL:AE004534) (383 aa) fasta scores: E(): 1.4e-42,
FT                   41.463% id in 369 aa"
FT                   /db_xref="PSEUDO:CAE41235.1"
FT   variation       complement(276184..276187)
FT                   /note="TCTG in pertussis; (-) deleted in parapertussis and
FT                   bronchiseptica"
FT   CDS_pept        complement(277241..277600)
FT                   /transl_table=11
FT                   /locus_tag="BP0934"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches. Similar to BP0328,
FT                   48.598% identity (48.598% ungapped) in 107 aa overlap."
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZH4"
FT                   /protein_id="CAE41236.1"
FT                   /translation="MQEYRLVVFTNPTQGMEDQFDEWYVNQHLPDVLAVPGFKAGQRFE
FT                   LEQEQLKAGPHPWRFMTVFDIETDDLRHTFDTLISRVNTPLMPMSPSIAEHRIAYAYKA
FT                   VTPKVQATPHGQQPK"
FT   CDS_pept        complement(277635..278609)
FT                   /transl_table=11
FT                   /locus_tag="BP0935"
FT                   /product="putative exported protein"
FT                   /note="Similar to Comamonas testosteroni OrfJ protein
FT                   TR:Q9RHM9 (EMBL:AB029044) (326 aa) fasta scores: E():
FT                   1e-39, 39.264% id in 326 aa, and to Agrobacterium
FT                   tumefaciens Agr_l_312p TR:AAK88723 (EMBL:AE008213) (329 aa)
FT                   fasta scores: E(): 9.5e-39, 38.509% id in 322 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZH3"
FT                   /protein_id="CAE41237.1"
FT                   /translation="MNRRHALKVLGAAALPALGWPMSAMAGEFPQKPIRFISPSPPGGV
FT                   TDFLPRLLGQEMSKILGQPVVIENRTGGNQTIATNYVAKAAPDGYTILLATSGALAVNP
FT                   HLIADIPYQPLTDFEPISMLGGVASVVMATHASDARTLAQLLEAGRGKGRKPAFGHTGI
FT                   GTSPHLVLEALKQEAGIDIVDVPYKGTQQLFTDAKGGQFEFLCNNIGPSLPLIRNGDLR
FT                   ALAVTSRKRSPALPDVPAIAETLPGFEVLGWMAAYVPAGTPADVIDRLAAALHASLATD
FT                   EVRKALANFAIDAMPTSPQEAKDFLAAEYRRWGEVVRRSGIRI"
FT   misc_feature    complement(278532..278609)
FT                   /note="Signal peptide predicted for BP0935 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 26 and 27"
FT   CDS_pept        278755..279645
FT                   /transl_table=11
FT                   /locus_tag="BP0936"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="Similar to Caulobacter crescentus isoleucine
FT                   biosynthesis transcriptional activator IlvR or Cc3045
FT                   SW:ILVR_CAUCR (P52670) (296 aa) fasta scores: E(): 1.2e-22,
FT                   37.091% id in 275 aa, and to Pseudomonas aeruginosa
FT                   probable transcriptional regulator Pa1826 TR:Q9I2R9
FT                   (EMBL:AE004609) (301 aa) fasta scores: E(): 5.1e-28,
FT                   39.373% id in 287 aa"
FT                   /db_xref="GOA:Q7VZH2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZH2"
FT                   /protein_id="CAE41238.1"
FT                   /translation="MNLKSLRHFCVVATELNLRRAAEQLHIAQPALSVSIAQLESRLGA
FT                   RLFVRGRRGVTLTEAGALLLPEAMQILRHAERLPFLARDAASGDVGTLRLAFVGSAPYR
FT                   LLPQALPQLQRAHPGVHVELYEATTDRIVEGLHNRTFDLGIVRYPLDAFPGLELELVDE
FT                   DGFCVALPHDHALVAAGEISLRDLADEPLLLPPREHSPPLRALMLEGFQAQGIMPRIAN
FT                   HMATQTATVLALVEMGAGIALVPQSIVGRVGYRVAFRPLAPGSRFRTGLALLSSPDHHT
FT                   TLADHFRRAIRQSIG"
FT   misc_feature    278761..279189
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    278800..278865
FT                   /note="Predicted helix-turn-helix motif with score 1393
FT                   (+3.93 SD) at aa 23-44, sequence LNLRRAAEQLHIAQPALSVSIA"
FT   misc_feature    278803..278895
FT                   /note="ScanRegExp hit to PS00044, Bacterial regulatory
FT                   proteins, lysR family signature."
FT   CDS_pept        complement(279922..280314)
FT                   /transl_table=11
FT                   /locus_tag="BP0937"
FT                   /product="phage-related protein"
FT                   /note="Similar to Bacteriophage HP1 hypothetical 14.9 kDa
FT                   protein in rep-hol intergenic region SW:YO14_BPHP1 (P51716)
FT                   (133 aa) fasta scores: E(): 5.6e-11, 37.795% id in 127 aa,
FT                   and to Haemophilus influenzae phage HP2 Orf14 TR:AAK37796
FT                   (EMBL:AY027935) (133 aa) fasta scores: E(): 5.6e-11,
FT                   37.795% id in 127 aa"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZH1"
FT                   /protein_id="CAE41239.1"
FT                   /translation="MKYPIAIEPGSDTRAWGVVVPDLPGCFSAADEGIDQAIENAKEAI
FT                   ELWIETAIDSGAPIPPATSIANHQANPEFANWIWAIADVDPAVLDETVERVNITIPRRI
FT                   LKRLDDRARAAGESRSSYIAHLAMTA"
FT   repeat_region   280342..280373
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   280342..281394
FT   CDS_pept        280444..281394
FT                   /transl_table=11
FT                   /locus_tag="BP0938"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTC0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTC0"
FT                   /protein_id="CAE41240.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHN"
FT   misc_feature    280702..280767
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    280825..281358
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(281363..281394)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(281424..281606)
FT                   /transl_table=11
FT                   /locus_tag="BP0939"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium loti Msr2149 protein Msr2149
FT                   TR:Q98J18 (EMBL:AP002999) (62 aa) fasta scores: E():
FT                   2.3e-09, 51.667% id in 60 aa, and to Rhizobium meliloti
FT                   hypothetical protein Smc04441 TR:CAC46618 (EMBL:AL591789)
FT                   (62 aa) fasta scores: E(): 8.8e-09, 50.000% id in 60 aa"
FT                   /db_xref="GOA:Q7VZH0"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZH0"
FT                   /protein_id="CAE41241.1"
FT                   /translation="MDSKELIKQLERSGWTLRGVKGSHHVFTHPDRPGHISVPHPKKDL
FT                   GIGLLNSILKAAGLK"
FT   misc_RNA        complement(281950..282335)
FT                   /gene="ssrA"
FT                   /product="tmRNA"
FT   CDS_pept        complement(282379..283560)
FT                   /transl_table=11
FT                   /locus_tag="BP0940"
FT                   /product="putative sugar efflux transpoter"
FT                   /note="Similar to Erwinia chrysanthemi sugar efflux
FT                   transpoter SotB TR:Q9S3J9 (EMBL:AJ249181) (395 aa) fasta
FT                   scores: E(): 1.7e-30, 31.967% id in 366 aa, and to
FT                   Pseudomonas aeruginosa probable Mfs transporter pa2933
FT                   TR:Q9HZR4 (EMBL:AE004719) (392 aa) fasta scores: E():
FT                   1e-82, 64.541% id in 392 aa"
FT                   /db_xref="GOA:Q7VZG9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZG9"
FT                   /protein_id="CAE41242.1"
FT                   /translation="MLLPIILLSAAGFTILTTEFLIVGLLPPLARDLQVTVSQAGLLVS
FT                   LFAFTVAAAGPVLTALLANLERKRLFVWVLVLFGLANALAAVSPNIWVMAFARFVPALA
FT                   LPVFWSLASATAVELVGPAYAGRAISIIGFGIVAATVLGIPIGVLVSDAFGWRAAFAVL
FT                   TAVAWAKALLLAYFPKPRTGRQNQRLSTQLRILRDPRLLGHVMLSLLVFTGMFTAYTYL
FT                   ADMLEHLAGFDGKVVGWTMMAFGGAGILGNWLGGRLVDRSPLGATILFSLIMTAGLLFV
FT                   AQVMQAPYWLALALALWGVAQAALLTVCHVRVIKAAPQAPAFAASLNISGANIGIGLGA
FT                   AVGGHFIDSRGLASLGTVAAVIVLAAVGLAIALVLSRRPSTPRPAAPAPGIEP"
FT   misc_feature    complement(join(282436..282501,282532..282588,
FT                   282628..282693,282709..282774,282796..282852,
FT                   282892..282957,283030..283095,283111..283176,
FT                   283198..283263,283282..283347,283369..283434,
FT                   283480..283545))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BP0940 by TMHMM2.0 at aa 5-27, 42-64, 71-93, 99-121,
FT                   128-150, 155-177, 201-223, 236-255, 262-284, 289-311,
FT                   324-343 and 353-375"
FT   CDS_pept        complement(283776..284453)
FT                   /transl_table=11
FT                   /locus_tag="BP0941"
FT                   /product="putative phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /note="Similar to Alcaligenes eutrophus phosphoglycolate
FT                   phosphatase, chromosomal CbbzC SW:GPHC_ALCEU (P40852) (231
FT                   aa) fasta scores: E(): 2.9e-17, 36.316% id in 190 aa, and
FT                   to Neisseria meningitidis putative phosphatase Nma0828
FT                   TR:Q9JVI3 (EMBL:AL162754) (220 aa) fasta scores: E():
FT                   8.7e-29, 40.278% id in 216 aa"
FT                   /db_xref="GOA:Q7VZG8"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZG8"
FT                   /protein_id="CAE41243.1"
FT                   /translation="MSALILFDFDGTLADTAPDLAAAANRQRTRKGLEPMPYEALQPMA
FT                   SQGARGLLRAALGLLPDHPDYEPTRLQFLEDYAAESTVHSRLFPGIADLLEDIAQRGLS
FT                   WGIVTNKVTYLTLPIVEHLGLTRDSAVLVCGDTTAHAKPHPLPLLHAAEQAGFEAGRCV
FT                   YVGDDLRDIQAAHAAGMPAVAAAYGYVGMEEDVTTWQAEACAASPRELWSAIEPLLPTR
FT                   ATA"
FT   misc_feature    complement(283890..284450)
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase"
FT   CDS_pept        complement(284450..285175)
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /gene_synonym="pufX"
FT                   /locus_tag="BP0942"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /note="Similar to Escherichia coli 3-demethylubiquinone-9
FT                   3-methyltransferase UbiG or PufX or B2232 SW:UBIG_ECOLI
FT                   (P17993) (240 aa) fasta scores: E(): 3.8e-54, 62.281% id in
FT                   228 aa, and to Pseudomonas aeruginosa
FT                   3-demethylubiquinone-9 3-methyltransferase UbiG or Pa3171
FT                   TR:Q9HZ63 (EMBL:AE004741) (232 aa) fasta scores: E():
FT                   6e-59, 64.629% id in 229 aa"
FT                   /db_xref="GOA:Q7VZG7"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZG7"
FT                   /protein_id="CAE41244.1"
FT                   /translation="MTTATQSSAPGVNVDQAEVEKFSALAARWWDPESEFKPLHAINPL
FT                   RLGWIQETAGSLSGKRVLDMGCGGGILSESMAVAGAQVTGIDLAEKSLKIARLHGLESG
FT                   VKVDYRAVPVEELAAEQPGQYDVVTCMEMLEHVPDPASVVRACAALAKPGGWVFFSTLN
FT                   RNPKSFLFAIVGAEYVLRLLPRGTHSYDSFIKPSELATSARQAGLEPTGMRGMEYNPIT
FT                   QVYSLSANTSVNYLMSTRK"
FT   CDS_pept        complement(285301..285882)
FT                   /transl_table=11
FT                   /gene="ompA"
FT                   /locus_tag="BP0943"
FT                   /product="outer membrane protein A precursor"
FT                   /note="Highly similar to Bordetella avium outer membrane
FT                   protein A precursor OmpA SW:OMPA_BORAV (Q05146) (194 aa)
FT                   fasta scores: E(): 5.7e-67, 91.753% id in 194 aa, and to
FT                   Bordetella petrii OmpA protein OmpA TR:Q9S3M1
FT                   (EMBL:AJ242599) (152 aa) fasta scores: E(): 5.1e-49,
FT                   88.079% id in 151 aa"
FT                   /db_xref="GOA:Q7VZG6"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZG6"
FT                   /protein_id="CAE41245.1"
FT                   /translation="MNKPSKFALALAFAAVTASGAASAQTVDNWRNPFGDVWKNGTNEL
FT                   CWRDAFWTPATGIPGCDGVPVAQKEKSAPMAAKVVFNADTFFDFDKSTLKPEGRQLLDQ
FT                   VAQQAGTIDLETIIAVGHTDSIGTEAYNQKLSERRAAAVKTYLVSKGIDPNRIYTEGKG
FT                   ELQPIASNKTREGRAQNRRVEIEIVGSRKN"
FT   misc_feature    complement(285340..285627)
FT                   /note="HMMPfam hit to PF00691, OmpA family"
FT   misc_feature    complement(285394..285528)
FT                   /note="ScanRegExp hit to PS01068, OmpA-like domain.
FT                   Confirmed by InterPro eMOTIF pattern match."
FT   misc_feature    complement(285811..285882)
FT                   /note="Signal peptide predicted for BP0943 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.983 between residues 24 and 25"
FT   CDS_pept        286253..288934
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /gene_synonym="parD"
FT                   /gene_synonym="nalA"
FT                   /gene_synonym="hisW"
FT                   /gene_synonym="b2231"
FT                   /locus_tag="BP0944"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="Similar to Escherichia coli DNA gyrase subunit A
FT                   GyrA or ParD or NalA or HisW or B2231 SW:GYRA_ECOLI
FT                   (P09097) (875 aa) fasta scores: E(): 5.9e-124, 59.147% id
FT                   in 891 aa, and to Neisseria meningitidis DNA gyrase subunit
FT                   A Nmb1384 TR:Q9JYX5 (EMBL:AE002487) (916 aa) fasta scores:
FT                   E(): 3.2e-175, 59.333% id in 900 aa. Also similar to
FT                   BP1266, 37.268% identity (42.447% ungapped) in 754 aa
FT                   overlap."
FT                   /db_xref="GOA:Q7VZG5"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZG5"
FT                   /protein_id="CAE41246.1"
FT                   /translation="MDSFAKETLPVSLEEEMRRSYLDYAMSVIVGRALPDVRDGLKPVH
FT                   RRVLYAMHELNNDWNRAYKKSARIVGDVIGKYHPHGDQSVYDTIVRMAQDFSMRYMLVD
FT                   GQGNFGSIDGDNAAAMRYTEIRLAKIAHELLADIDQETVDFGPNYDGSEQEPLLLPSRL
FT                   PNLLVNGSSGIAVGMATNIPPHNLQEVVDGCLYCLRNPECSIDELIELIPAPDFPTGGV
FT                   IYGITGVREGYRTGRGRVIMRAKTHFEDMEKGNRQAIVVDAIPYQVNKKTLQERIAELV
FT                   NDKKIEGISDIRDESDKDGMRLVIELKRGEVPEVVLNNLYKNTQLQDTFGMNLVALVDG
FT                   QPRLLNLKQLIEYFLQHRREVVTRRTVFQLRKARERGHVLEGLAVALANIDDFIAIIKA
FT                   APTPPVARQELMARSWDSSLVREMLARVDGDAAGGVAAFRPDDLAPEYGLQGDGNYRLS
FT                   ETQAQEILNMRLQRLTGLEQDKIIGEYKDVMATIADLLDILARPDRITTIISEELQAIK
FT                   AEFSTSAKDTRRAEIEVNATELDTEDLITPMDMVVTLSHGGYIKSQPLSEYRSQKRGGR
FT                   GKQATAMKENDWVDQLFIANTHDYLLCFSNRGRVYWLKVWEVPQGTRNSRGKPIVNMFP
FT                   LADGEKVTVVLPVKEFSEDHYVFMATSRGTVKKTPLSDFSNPRKAGIIAVDLDDGDYLI
FT                   GADLTDGKHDVMLFSDAGKAVRFDENDVRPMGRNARGVRGMMLEEGQTVIALLVAGDET
FT                   QSVLTATENGYGKRTPITEYTRHGRGTKGMIAIQTSSRNGRVVGAVLVMPSDEIMLITT
FT                   GGVLVRTRVAEIREMGRATQGVTLISVDDGSSLSGVRRVVESDADADDEDGGEEGGEEG
FT                   GDQGGDDTGAQGKDSEPTEPTE"
FT   misc_feature    286346..287815
FT                   /note="HMMPfam hit to PF00521, DNA gyrase/topoisomerase IV,
FT                   subunit A"
FT   CDS_pept        288934..290067
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /gene_synonym="pdxF"
FT                   /locus_tag="BP0945"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /note="Similar to Escherichia coli phosphoserine
FT                   aminotransferase SerC or PdxF or B0907 SW:SERC_ECOLI
FT                   (P23721) (361 aa) fasta scores: E(): 1.1e-51, 52.533% id in
FT                   375 aa, and to Pseudomonas aeruginosa 3-phosphoserine
FT                   aminotransferase SerC or Pa3167 TR:Q9HZ66 (EMBL:AE004740)
FT                   (361 aa) fasta scores: E(): 3.5e-51, 53.846% id in 377 aa"
FT                   /db_xref="GOA:Q7VZG4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZG4"
FT                   /protein_id="CAE41247.1"
FT                   /translation="MMARPWNFSAGPSALPEAVLQQAAAEMLDWHGSGMSVMEMSHRGK
FT                   HFVQICDEAEADLRELLGLPADYAVMFMQGGGLGENAIVPMNLMGRRSTPAADFVVTGH
FT                   WSTRSHKEAGRYGDAQIAASAAEATEIDGQAQSSWTWLPPVDTWRVRKDSAYLHLCSNE
FT                   TIGGVEFTEWPDPASLGAPDVPLVVDVSSHFLSRPLDIARAGLVFAGAQKNAGPAGVTV
FT                   VIARRDLLGHALPICPSAFDYANVAADHSRYNTPPTFAIYVMGLVFKWIKAHGGVRGME
FT                   EANRAKAELLYGYLDGSAFYRNPVQASVRSRMNVPFVLRDESLNDAFLQGAEAAGLMQL
FT                   KGHKSVGGMRASIYNAMPLAGVQALIDYLKEFERRHG"
FT   misc_feature    288976..290028
FT                   /note="HMMPfam hit to PF00266, Aminotransferase class-V"
FT   CDS_pept        290060..291145
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="BP0946"
FT                   /product="p-protein [includes: chorismate mutase and
FT                   prephenate dehydratase]"
FT                   /EC_number="5.4.99.5"
FT                   /note="Similar to Escherichia coli P-protein [includes:
FT                   chorismate mutase and prephenate dehydratase] PheA or B2599
FT                   or Z3891 or Ecs3462 SW:PHEA_ECOLI (P07022) (386 aa) fasta
FT                   scores: E(): 4.9e-27, 33.773% id in 379 aa, and to
FT                   Neisseria meningitidis chorismate mutase/prephenate
FT                   dehydratase nmb0446 TR:Q9K0W1 (EMBL:AE002401) (362 aa)
FT                   fasta scores: E(): 3.3e-66, 50.276% id in 362 aa"
FT                   /db_xref="GOA:Q7VZG3"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR010957"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZG3"
FT                   /protein_id="CAE41248.1"
FT                   /translation="MDDSLQDKLRPLRDRIDAIDAQILDLLSQRARTAQEVGSVKHAAH
FT                   ADGPVLRPEREAEVIRRLQYSNPGPFPKAAVAAVWTEIMSACRGLERGMTVAYLGPQGS
FT                   FSEQAALEHFGHSVQQLPCPSFDEVFRAVEAGQADVGMVPVENSTEGAVNRSLDLLLNT
FT                   PLTILGERSLVIRHCLMSQSGTMDGIKTISAHPQALAQCQGWLTRHYPDLNRVAAASNS
FT                   EAARVAAEDPTVAAIAGEVAAPAWNLRVVAAGIQDDPQNRTRFLAVGHIEPLSSGKDKT
FT                   SLILAVPNRAGAVYDMLAPMAANGVSMTRFESRPARTGQWEYYFYVDVLGHRDDANVAR
FT                   ALAALQAQVAFFKVLGSYPAQ"
FT   misc_feature    290075..290335
FT                   /note="HMMPfam hit to PF01817, Chorismate mutase"
FT   misc_feature    290345..290878
FT                   /note="HMMPfam hit to PF00800, Prephenate dehydratase"
FT   misc_feature    290900..291130
FT                   /note="HMMPfam hit to PF01842, ACT domain"
FT   CDS_pept        291232..292131
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="BP0947"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="Similar to Bordetella bronchiseptica prephenate
FT                   dehydrogenase TyrA TR:Q9RND8 (EMBL:AF182427) (299 aa) fasta
FT                   scores: E(): 4.1e-108, 99.331% id in 299 aa, and to
FT                   Rhizobium meliloti putative cyclohexadienyl dehydrogenase
FT                   and adh prephenate dehydrogenase protein TR:CAC47240
FT                   (EMBL:AL591791) (307 aa) fasta scores: E(): 1.2e-33,
FT                   43.110% id in 283 aa"
FT                   /db_xref="GOA:Q7VZG2"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZG2"
FT                   /protein_id="CAE41249.1"
FT                   /translation="MSANNSANGQGPLVPVLAVAGVGLIGGSFAAALRHAGQVGTILGV
FT                   GRNPASLARARELGLIDEAVSPEEAAARADLVLLSTPVGGLGAMLARMRDHLRPGCLLT
FT                   DAGSTKSQVVMAARQALGEQVSCFVPGHPIAGGERTGPEAADAGLYVRRAVVLTPLPEN
FT                   AAASVARVRACWHACGAHVVEMDDAAHDRLLASVSHMPHFLAAVYMAQVAGSDDAQARM
FT                   DLAGSGFRDFTRIAAGSPEMWRDIFLSNQAAMQSELAALRRVLDEAEQALGAGDGARLQ
FT                   ALLERAAHARRNWRKDSK"
FT   misc_feature    291232..291321
FT                   /note="Signal peptide predicted for BP0947 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.880) with cleavage site
FT                   probability 0.781 between residues 30 and 31"
FT   misc_feature    291268..291327
FT                   /note="1 probable transmembrane helix predicted for BP0947
FT                   by TMHMM2.0 at aa 13-32"
FT   misc_feature    291286..292104
FT                   /note="HMMPfam hit to PF02153, Prephenate dehydrogenase"
FT   misc_feature    291730..291765
FT                   /note="ScanRegExp hit to PS00436, Peroxidases active site
FT                   signature."
FT   CDS_pept        292128..293456
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="BP0948"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis 3-phosphoshikimate 1-carboxyvinyltransferase AroA
FT                   SW:AROA_BORPE (P12421) (442 aa) fasta scores: E():
FT                   2.5e-170, 99.774% id in 442 aa, and to Bordetella
FT                   bronchiseptica 3-phosphoshikimate 1-carboxyvinyltransferase
FT                   AroA SW:AROA_BORBR (Q9RND7) (442 aa) fasta scores: E():
FT                   4.8e-169, 99.321% id in 442 aa"
FT                   /db_xref="GOA:P12421"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12421"
FT                   /protein_id="CAE41250.1"
FT                   /translation="MSGLAYLDLPAARLARGEVALPGSKSISNRVLLLAALAEGSTEIT
FT                   GLLDSDDTRVMLAALRQLGVSVGEVADGCVTIEGVARFPTEQAELFLGNAGTAFRPLTA
FT                   ALALMGGDYRLSGVPRMHERPIGDLVDALRQFGAGIEYLGQAGYPPLRIGGGSIRVDGP
FT                   VRVEGSVSSQFLTALLMAAPVLARRSGQDITIEVVGELISKPYIEITLNLMARFGVSVR
FT                   RDGWRAFTIARDAVYRGPGRMAIEGDASTASYFLALGAIGGGPVRVTGVGEDSIQGDVA
FT                   FAATLAAMGADVRYGPGWIETRGVRVAEGGRLKAFDADFNLIPDAAMTAATLALYADGP
FT                   CRLRNIGSWRVKETDRIHAMHTELEKLGAGVQSGADWLEVAPPEPGGWRDAHIGTWDDH
FT                   RMAMCFSLAAFGPAAVRILDPGCVSKTFPDYFDVYAGLLAARD"
FT   misc_feature    292152..293429
FT                   /note="HMMPfam hit to PF00275, EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT   misc_feature    292395..292439
FT                   /note="ScanRegExp hit to PS00104, EPSP synthase signature
FT                   1. Confirmed by InterPro eMOTIF pattern match."
FT   misc_feature    293175..293231
FT                   /note="ScanRegExp hit to PS00885, EPSP synthase signature
FT                   2. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        293471..294142
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /gene_synonym="mssA"
FT                   /locus_tag="BP0949"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="Similar to Escherichia coli cytidylate kinase Cmk or
FT                   MssA or B0910 or Z1256 or Ecs0993 SW:KCY_ECOLI (P23863)
FT                   (227 aa) fasta scores: E(): 8.1e-40, 57.674% id in 215 aa,
FT                   and identical to Bordetella bronchiseptica cytidylate
FT                   kinase Cmk SW:KCY_BORBR (Q9RND6) (223 aa) fasta scores:
FT                   E(): 1.5e-79, 98.655% id in 223 aa"
FT                   /db_xref="GOA:Q7VZG1"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZG1"
FT                   /protein_id="CAE41251.1"
FT                   /translation="MAIFASAGAAPVITIDGPTASGKGTIAHRVAKQLGWDVLDSGALY
FT                   RLTALAALRRGLPATDEPAVAAVAQALDVRFDGPHVYLEGRDAGHEIRQEEVGNYASRI
FT                   AAYPGVRQALLERQRAFRQPPGLVADGRDMGAVVFPDASLKIFLVADVEARAQRRCKQL
FT                   IEKGISANLDDLLRDMRERDARDTQRAVAPLAPAADAHVLDSSGLTIEQTVQAVLDFWC
FT                   A"
FT   misc_feature    293666..294127
FT                   /note="HMMPfam hit to PF02224, Cytidylate kinase"
FT   CDS_pept        294315..296045
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /gene_synonym="ssyF"
FT                   /locus_tag="BP0950"
FT                   /product="30S ribosomal protein S1"
FT                   /note="Similar to Escherichia coli 30S ribosomal protein S1
FT                   RpsA or SsyF or B0911 or Z1257 or Ecs0994 SW:RS1_ECOLI
FT                   (P02349) (557 aa) fasta scores: E(): 3.5e-133, 63.168% id
FT                   in 543 aa, and to Neisseria meningitidis 30S ribosomal
FT                   protein S1 Nmb1301 TR:Q9JZ44 (EMBL:AE002478) (561 aa) fasta
FT                   scores: E(): 4.1e-154, 72.890% id in 557 aa"
FT                   /db_xref="GOA:Q7VZG0"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZG0"
FT                   /protein_id="CAE41252.1"
FT                   /translation="MDSNLMSSVSTSAILGGENFADLFAESLKSQDMKSGEVISAEVVR
FT                   VDHNFVVVNAGLKSEALIPLEEFLNDQGELEVQPGDFVSVAIDSLENGYGDTILSRDRA
FT                   KRLSAWLQLEQALENGELVTGTITGKVKGGLTVMTNGIRAFLPGSLVDLRPVKDTTPYE
FT                   GKTLEFKVIKLDRKRNNVVLSRRQVLEASMGEERQKLLETLHEGAVVKGVVKNITDYGA
FT                   FVDLGGIDGLLHITDMAWRRVRHPSEVLQVGQEVEAKVLKFDQEKSRVSLGVKQLGEDP
FT                   WVGLARRYPQGTRLFGKVTNLTDYGAFVEVEAGIEGLVHVSEMDWTNKNVDPRKVVTLG
FT                   EEVEVMVLEIDEDRRRISLGMKQCRQNPWEEFATNFKRGDKVRGAIKSITDFGVFVGLP
FT                   GGIDGLVHLSDLSWTESGEEAVRNFKKGDELEAVVLGIDTEKERISLGIKQLEGDPFNN
FT                   FVATHDKGAVVPGTIKSVEPKGAVITLSVDVEGYLRASEISSGRVEDATTVLKAGENIE
FT                   AMIVNIDRKARSIQLSIKARDNAETAETIQRMSEASASSGTTNLGALLKAKLDQQRNDG
FT                   "
FT   misc_feature    294408..294620
FT                   /note="HMMPfam hit to PF00575, S1 RNA binding domain"
FT   misc_feature    294660..294872
FT                   /note="HMMPfam hit to PF00575, S1 RNA binding domain"
FT   misc_feature    294921..295139
FT                   /note="HMMPfam hit to PF00575, S1 RNA binding domain"
FT   misc_feature    295176..295400
FT                   /note="HMMPfam hit to PF00575, S1 RNA binding domain"
FT   misc_feature    295437..295661
FT                   /note="HMMPfam hit to PF00575, S1 RNA binding domain"
FT   misc_feature    295698..295919
FT                   /note="HMMPfam hit to PF00575, S1 RNA binding domain"
FT   CDS_pept        296047..296406
FT                   /transl_table=11
FT                   /gene="ihfB"
FT                   /gene_synonym="himD"
FT                   /locus_tag="BP0951"
FT                   /product="integration host factor beta-subunit"
FT                   /note="Similar to Escherichia coli integration host factor
FT                   beta-subunit IhfB or HimD or Hip or B0912 or Z1258 or
FT                   Ecs0995 SW:IHFB_ECOLI (P08756) (94 aa) fasta scores: E():
FT                   5.1e-16, 56.383% id in 94 aa, and to Pseudomonas aeruginosa
FT                   integration host factor beta-subunit IhfB or HimD or Pa3161
FT                   SW:IHFB_PSEAE (Q51473) (94 aa) fasta scores: E(): 4.3e-18,
FT                   62.637% id in 91 aa"
FT                   /db_xref="GOA:Q7VZF9"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZF9"
FT                   /protein_id="CAE41253.1"
FT                   /translation="MTKSELIAALAARYPQLAARDTDYAVKTMLDAMTQALASGQRIEI
FT                   RGFGSFSLSQRSPRIGRNPKSGEQVLVPGKQVPHFKAGKELREWVDLVGNDQGDDSSNG
FT                   SSDPLQSVMDMHAMH"
FT   misc_feature    296047..296319
FT                   /note="HMMPfam hit to PF00216, Bacterial DNA-binding
FT                   protein"
FT   CDS_pept        296598..296912
FT                   /transl_table=11
FT                   /locus_tag="BP0952"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Neisseria meningitidis putative inner
FT                   membrane hypothetical protein Nma2149 TR:Q9JST1
FT                   (EMBL:AL162758) (104 aa) fasta scores: E(): 0.0012, 33.981%
FT                   id in 103 aa, and to Bacillus halodurans Bh1239 protein
FT                   Bh1239 TR:Q9KDH4 (EMBL:AP001511) (105 aa) fasta scores:
FT                   E(): 7.1, 27.059% id in 85 aa"
FT                   /db_xref="GOA:Q7VZF8"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZF8"
FT                   /protein_id="CAE41254.1"
FT                   /translation="MRYLVWALRLLVFVAVLMFALKNTNPVAVTFYADYVVHDVPLIVV
FT                   MLVVFVVGALFGLLLTVPAAMRRRREALRLRREVERLQAAASGTPPAVTPEAVAPMSPL
FT                   "
FT   misc_feature    join(296598..296657,296715..296783)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BP0952 by TMHMM2.0 at aa 62-84 and 104-126"
FT   CDS_pept        296955..298175
FT                   /transl_table=11
FT                   /locus_tag="BP0953"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YciM precursor YciM or B1280 or Z2526 or Ecs1853
FT                   SW:YCIM_ECOLI (P45576) (389 aa) fasta scores: E(): 4.3e-21,
FT                   31.486% id in 397 aa, and to Xylella fastidiosa
FT                   hypothetical protein Xf2435 TR:Q9PAR0 (EMBL:AE004052) (398
FT                   aa) fasta scores: E(): 4e-25, 33.668% id in 398 aa"
FT                   /db_xref="GOA:Q7VZF7"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR030865"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZF7"
FT                   /protein_id="CAE41255.1"
FT                   /translation="MDFEPWWLIFVPVLFALGWLAARFDFRQMLRETRTLPDSYFRGLN
FT                   FLLNEQPDRAIDAFVEVAKLDPETTELHFALGSLFRRRGEMERAIRVHQSLLSRSDLPV
FT                   AEREHAQHELAQDFLKAGMLDRAEGAFEQLKDTRYALPALRSLIRIYESEHDWPRAIEA
FT                   VKTLHGLVDEPVPQIVHYYCEQAQAALTAKPVDFDAAHAALDAADHAAGMVERGNAPAK
FT                   ASLVRTAMLRARLAALENDPKRERLYLESILTQAPEFAGLVAEALLTNYRQADQAAAGL
FT                   AMLQQQYQRHASLDLFNVVFRELRVQQGSAPAWAFAREALRHHPSLLGLDRLLEAELAS
FT                   PGAPADAGPVTGADLTLLRSLIHKHTQRLDRYACRSCGFQARRFYWQCPGCNSWETYAP
FT                   RRLEELE"
FT   misc_feature    296967..297020
FT                   /note="1 probable transmembrane helix predicted for BP0953
FT                   by TMHMM2.0 at aa 5-22"
FT   CDS_pept        298172..299113
FT                   /transl_table=11
FT                   /gene="rfaE"
FT                   /locus_tag="BP0954"
FT                   /product="ADP-heptose synthase"
FT                   /EC_number="2.7.-.-"
FT                   /note="Similar to Salmonella typhimurium ADP-heptose
FT                   synthase RfaE TR:Q9AJ74 (EMBL:AF155126) (477 aa) fasta
FT                   scores: E(): 7.1e-50, 52.508% id in 299 aa, and to
FT                   Burkholderia pseudomallei putative ADP-heptose synthase
FT                   WaaE TR:Q9WWX7 (EMBL:AF159428) (307 aa) fasta scores: E():
FT                   6.6e-59, 59.603% id in 302 aa"
FT                   /db_xref="GOA:Q7VZF6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZF6"
FT                   /protein_id="CAE41256.1"
FT                   /translation="MNQYPAERIARARVLVVGDVMLDRYWFGEVDRISPEAPVPVVRVA
FT                   RREDRLGGAANVARNVAALGAQVTLIGVVGADEVGLRIERMAAEEGVRTDLVSDTEHPT
FT                   TLKMRVLGRQQQLLRVDFEQHPEPAALDGISAAVARQLAQHDIVVLSDYAKGVLDRVES
FT                   IIAAAVGHSLPVLVDPKGDHYERYRGATLVTPNRAEMREAVGRWKTEDELAERAQRLRL
FT                   DLDLEALLVTRSEQGMTLFTDAGRDHADAAAHEVYDVSGAGDTVLATLAVMRAVGLSWG
FT                   DAMRWANRAGGIVVGKLGTSVVTAAELAGEST"
FT   misc_feature    298322..298978
FT                   /note="HMMPfam hit to PF00294, pfkB family carbohydrate
FT                   kinase"
FT   misc_feature    298325..298396
FT                   /note="ScanRegExp hit to PS00583, pfkB family of
FT                   carbohydrate kinases signature 1."
FT   CDS_pept        299110..300099
FT                   /transl_table=11
FT                   /gene="rfaD"
FT                   /gene_synonym="htrM"
FT                   /locus_tag="BP0955"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /EC_number="5.1.3.20"
FT                   /note="Similar to Escherichia coli
FT                   ADP-L-glycero-D-manno-heptose-6-epimerase RfaD or HtrM or
FT                   B3619 or Z5046 or Ecs4497 SW:RFAD_ECOLI (P17963) (310 aa)
FT                   fasta scores: E(): 4.9e-49, 52.134% id in 328 aa, and to
FT                   Burkholderia pseudomallei putative ADP-glycero-mannoheptose
FT                   epimerase GmhD TR:Q9WWX6 (EMBL:AF159428) (330 aa) fasta
FT                   scores: E(): 2.2e-81, 62.346% id in 324 aa"
FT                   /db_xref="GOA:Q7VZF5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZF5"
FT                   /protein_id="CAE41257.1"
FT                   /translation="MIVVTGAAGFIGSNLVRGLNRRGIQDIIAVDDLTDGDKFRNLVDC
FT                   SIADYLDKDEFRERVRGGNLPALRAVLHQGACSDTTERNGRYMLDNNYRVTLELFEYCQ
FT                   AERVPFLYASSAAVYGGSSVYVEDPANEHPLNVYGYSKLLFDQVLRTRMDSLTAQVVGL
FT                   RYFNVYGPHEQHKGRMASVAFHNMNQFLAEGHVRLFAGWDGYEDGGQSRDFISVEDVVA
FT                   VNLHFLDNPDQSGVFNCGTGRAQPFNDVAAAVVNTLRAERGEAALPLAELVKKGLLRYI
FT                   PFPDDLKGRYQSYTQADVSRLRATGFSAPMRDVQTGVSEYVRYWRALK"
FT   misc_feature    299113..300096
FT                   /note="HMMPfam hit to PF01370, NAD dependent
FT                   epimerase/dehydratase family"
FT   CDS_pept        300230..300718
FT                   /transl_table=11
FT                   /locus_tag="BP0956"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Neisseria gonorrhoeae ComE TR:Q9EU10
FT                   (EMBL:AF268317) (99 aa) fasta scores: E(): 0.0033, 35.714%
FT                   id in 84 aa, and to Xylella fastidiosa hypothetical protein
FT                   Xf0593 xf0593 TR:Q9PFR4 (EMBL:AE003905) (109 aa) fasta
FT                   scores: E(): 0.07, 34.524% id in 84 aa"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZF4"
FT                   /protein_id="CAE41258.1"
FT                   /translation="MNPFLHDPVARCANAPAWPLVGRGRPWRPRPPGAAARAPAGKAPV
FT                   GRKPASEPLARWLVMAGCALAAAPAHALDVNTATVDQLETVRGVGPRTARVIIEERQRG
FT                   GRFLSLEDLSERVSGIGHKKMQSLQAAGLTAGPAAPAAGARPEARPAGGPRAKAAAGR"
FT   repeat_region   300715..300746
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   300715..301767
FT   CDS_pept        300817..301767
FT                   /transl_table=11
FT                   /locus_tag="BP0957"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA3"
FT                   /protein_id="CAE41259.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   misc_feature    301075..301140
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    301198..301731
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(301736..301767)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        301848..302759
FT                   /transl_table=11
FT                   /gene="cysM"
FT                   /locus_tag="BP0958"
FT                   /product="cysteine synthase B"
FT                   /EC_number="2.5.1.47"
FT                   /note="Similar to Escherichia coli cysteine synthase B CysM
FT                   or B2421 SW:CYSM_ECOLI (P16703) (303 aa) fasta scores: E():
FT                   7.7e-67, 64.407% id in 295 aa, and to Pseudomonas
FT                   aeruginosa cysteine synthase B CysM or Pa0932 TR:Q9I526
FT                   (EMBL:AE004527) (299 aa) fasta scores: E(): 2.2e-72,
FT                   67.442% id in 301 aa"
FT                   /db_xref="GOA:Q7VZF3"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005858"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZF3"
FT                   /protein_id="CAE41260.1"
FT                   /translation="MSTPTYPTIEQTVGNTPLVRLQRIPGAAGQARGNVILAKLEGNNP
FT                   AGSVKDRPALSMILRAEERGEIHPGDTLIEATSGNTGIALAMTAAMRGYRMVLIMPDNL
FT                   SLERRAAMTAYGAELILTPAAKGGMEYARDLATAMQAEGKGKVLDQFGNPDNPRAHIEG
FT                   TGPEIWNQTDGRVTHFVSAMGTTGTIMGVSTYLKSRNAAVQVVGAQPAEGSQIPGIRKW
FT                   PEAYMPKIFDRALVDAYESIAQAEGETMARRLAAEEGIFAGISSAGALVAALRVAERVE
FT                   NATIVFIVCDRGDRYLSTGVFN"
FT   misc_feature    301872..302723
FT                   /note="HMMPfam hit to PF00291, Pyridoxal-phosphate
FT                   dependent enzyme"
FT   misc_feature    301962..302018
FT                   /note="ScanRegExp hit to PS00901, Cysteine
FT                   synthase/cystathionine beta-synthase P-phosphate attachment
FT                   site. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        complement(302820..303965)
FT                   /transl_table=11
FT                   /gene="mltB"
FT                   /locus_tag="BP0959"
FT                   /product="membrane-bound lytic murein transglycosylase B
FT                   precursor"
FT                   /EC_number="3.2.1.-"
FT                   /note="Similar to Escherichia coli membrane-bound lytic
FT                   murein transglycosylase B precursor MltB or B2701
FT                   SW:MLTB_ECOLI (P41052) (361 aa) fasta scores: E(): 4.8e-28,
FT                   35.696% id in 381 aa, and to Pseudomonas aeruginosa
FT                   membrane-bound lytic transglycosylase precursor MltB
FT                   TR:Q9X6V5 (EMBL:AF147448) (336 aa) fasta scores: E():
FT                   5.8e-29, 39.172% id in 314 aa"
FT                   /db_xref="GOA:Q7VZF2"
FT                   /db_xref="InterPro:IPR011757"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZF2"
FT                   /protein_id="CAE41261.1"
FT                   /translation="MFNCRRFLQIGTLSALLAGCATSSQTPQAQHLPAQAATGQADRVR
FT                   IGPDKPVSSDEGPATLTPTGELRPDVRAFAEQLAAQRELPLPQVLASLESTRYNATVAR
FT                   LIAPSGASGKKIWRSWLTYRGRFVEPKRIAWGVEFWNANQDLLNRAAQRYGVPASIIAS
FT                   IIGVETLYGRNVGNFRVVDALATLAFDYLDPAKPERADMFRGQLGDFITLALQDKLDPE
FT                   TRGSYAGAIGMPQFMPGSIMRYAVDGDDDGHIDLTNSVADAVMSVGNFLVEHGWQRGLP
FT                   VFAPVALPADPAPLVAGGLTPTLDWNGLQAAGARPAAGAGRGAWQEHPMGIVDLVEEAR
FT                   GTVQYRTATPNFFALTQYNRSYFYATAVADLAAELQARTGY"
FT   misc_feature    complement(303858..303965)
FT                   /note="Signal peptide predicted for BP0959 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.694 between residues 36 and 37"
FT   misc_feature    complement(303906..303938)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        303976..304899
FT                   /transl_table=11
FT                   /locus_tag="BP0960"
FT                   /product="histone deacetylase family protein"
FT                   /note="Similar to Neisseria meningitidis histone
FT                   deacetylase family protein Nmb0605 TR:Q9K0J2
FT                   (EMBL:AE002416) (369 aa) fasta scores: E(): 2.4e-50,
FT                   44.156% id in 308 aa, and to Rhizobium meliloti conserved
FT                   hypothetical protein Smc00969 TR:CAC45455 (EMBL:AL591785)
FT                   (309 aa) fasta scores: E(): 9.7e-49, 45.192% id in 312 aa"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZF1"
FT                   /protein_id="CAE41262.1"
FT                   /translation="METMYLTHPSCRLHEMGDWHPESPQRLDAISDQLLASGLLPYLQE
FT                   RQAPEASRADILRVHTPAYLDSLRAHQPEHGYYAIDADTSMNRHTYEAALRAAGAGVAA
FT                   VDAVLGGEAITAFCSVRPPGHHAERDHAMGFCFLNNVAIAARHALDFHGLQRVALVDFD
FT                   VHHGNGTEHAFAGDPRVLMCSFFQHPFFPNSGADDPAPNMLNVPVAAYTGGASIRTIVR
FT                   EQWLPRLHAHRPELILISAGFDAHREDDMAQMGLVEADYAWITDRLVEVADQHCQGRIV
FT                   STLEGGYNLSALGRSVVAHIRSLSKL"
FT   misc_feature    303985..304893
FT                   /note="HMMPfam hit to PF00850, Histone deacetylase family"
FT   CDS_pept        304971..305720
FT                   /transl_table=11
FT                   /gene="etfB"
FT                   /gene_synonym="etfS"
FT                   /locus_tag="BP0961"
FT                   /product="electron transfer flavoprotein beta-subunit"
FT                   /note="Similar to Bradyrhizobium japonicum electron
FT                   transfer flavoprotein beta-subunit EtfB or EtfS
FT                   SW:ETFB_BRAJA (P53575) (249 aa) fasta scores: E(): 9.4e-59,
FT                   69.076% id in 249 aa, and to Pseudomonas aeruginosa
FT                   electron transfer flavoprotein beta-subunit EtfB or Pa2952
FT                   TR:Q9HZP6 (EMBL:AE004721) (249 aa) fasta scores: E():
FT                   3.5e-62, 74.297% id in 249 aa"
FT                   /db_xref="GOA:Q7VZF0"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZF0"
FT                   /protein_id="CAE41263.1"
FT                   /translation="MKVLVPVKRVVDYNVKVRVKSDQTGVDIANVKMSMNPFDEIAVEE
FT                   ATRLKEKGAVTEVVAVSCGAAQCQETLRTAMAIGADRAVLVQTDAELQPLAVAKLLKAL
FT                   VDKEQPQLVILGKQAIDDDANQTGQMLAALLDWPQATFASKVELGDGQVTVTREVDGGL
FT                   ETLSLNLPAIVTTDLRLNEPRYVTLPNIMKAKKKPLETVSPQDLGVDPAPRLKTLKVSE
FT                   PPARQAGIKVPDVATLVDKLKNEAKVV"
FT   misc_feature    304971..305717
FT                   /note="HMMPfam hit to PF01012, Electron transfer
FT                   flavoprotein beta subunit"
FT   misc_feature    305433..305495
FT                   /note="ScanRegExp hit to PS01065, Electron transfer
FT                   flavoprotein beta-subunit signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   CDS_pept        305720..306649
FT                   /transl_table=11
FT                   /gene="etfA"
FT                   /gene_synonym="etfL"
FT                   /locus_tag="BP0962"
FT                   /product="electron transfer flavoprotein alpha-subunit"
FT                   /note="Similar to Bradyrhizobium japonicum electron
FT                   transfer flavoprotein alpha-subunit EtfA or EtfL
FT                   SW:ETFA_BRAJA (P53573) (314 aa) fasta scores: E(): 4.3e-64,
FT                   68.065% id in 310 aa, and to Pseudomonas aeruginosa
FT                   electron transfer flavoprotein alpha-subunit EtfA or Pa2951
FT                   TR:Q9HZP7 (EMBL:AE004721) (309 aa) fasta scores: E():
FT                   2.5e-67, 70.550% id in 309 aa"
FT                   /db_xref="GOA:Q7VZE9"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZE9"
FT                   /protein_id="CAE41264.1"
FT                   /translation="MTTLVIAEHDNAQLKGATLNTIAAASRLGGEVHVLVAGSGAQAVA
FT                   EQAAQAARVSKVLLADAPQLAEGLAENLAAQVLAVAGGYSHILFAATASGKNVAPRVAA
FT                   KLDVAQISDIIGVESADTFQRPIYAGNAIATVQSGDAVKVITVRTTGFDAVAAQGGSAA
FT                   VEALDAVADSGLSRFVGREVAKSDRPELAGARVVVSGGRGLGSAENFKILDPLADKLGA
FT                   ALGASRAAVDAGYAPNDWQVGQTGKIVAPQLYVAVGISGAIQHLAGMKDSKVIVAINKD
FT                   PEAPIFGVADYGLVGDLFQVVPELTGAL"
FT   misc_feature    305723..306538
FT                   /note="HMMPfam hit to PF00766, Electron transfer
FT                   flavoprotein alpha subunit"
FT   misc_feature    306476..306556
FT                   /note="ScanRegExp hit to PS00696, Electron transfer
FT                   flavoprotein alpha-subunit signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   CDS_pept        306893..308719
FT                   /transl_table=11
FT                   /locus_tag="BP0964"
FT                   /product="probable acyl-CoA dehydrogenase"
FT                   /note="Similar to Rhizobium loti probable acyl-CoA
FT                   dehydrogenase Mlr6975 TR:Q987P3 (EMBL:AP003010) (583 aa)
FT                   fasta scores: E(): 2.9e-96, 50.984% id in 610 aa, and to
FT                   Rhizobium meliloti putative acyl-CoA dehydrogenase protein
FT                   Smc00977 TR:CAC45447 (EMBL:AL591785) (593 aa) fasta scores:
FT                   E(): 1.2e-95, 48.571% id in 595 aa"
FT                   /db_xref="GOA:Q7VZE8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZE8"
FT                   /protein_id="CAE41265.1"
FT                   /translation="MTYATPLQDFRFALNELAGLEEILKLPGFEEVTPDLVDAILEENA
FT                   RFVQQAIAPLNVAGDTKPPVWNDGQVTTTPGFSQGFADYTAGGWQGLQHPQKWGGQGLP
FT                   KVVAAPAGENIQAASLAFSLCPMLTDGVIEALLTVGSEAQRQTYVPKLIGGQWTGTMNL
FT                   TEPQAGSDLAQVATRAVRQDDGSYRLSGQKIFITYGEHDLAENIIHLVLARTPDAPAGV
FT                   KGISLFIVPKYLVNEDGSRGKRNDVWCASLEHKLGIHGSPTAVLLYGAGKGEVGEGAVG
FT                   YLVGEANRGLEYMFIMMNAARYSVGQQGIGVSERAYQHAQAYARERVQGRAIEGSAAPV
FT                   TIAHHPDVQRMLLTMRALTEAARAVSYVAAAAHDKGTHHPDAEVRARNRAFYEYLVPIV
FT                   KGFSTESAVEVASLGIQVHGGMGFIEETGAAQHYRDARILPIYEGTTAIQANDLVGRKT
FT                   LRDGGATAHASIAAMRDTLKAVAAEAQRADTADHTALRVLRDNFDQAIQSYEGAVEFIL
FT                   AHAASNVRAVYSSSVPYLMLAGVVHGGWQMARAALACRRHLAAGSGDAFHRHKLGTALF
FT                   YGAHILPRALALAAAVRAGDVADSCGSMADIA"
FT   misc_feature    307310..307588
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal domain"
FT   misc_feature    307646..308257
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal domain"
FT   CDS_pept        308802..309443
FT                   /transl_table=11
FT                   /locus_tag="BP0965"
FT                   /product="antioxidant protein"
FT                   /EC_number="3.1.1.-"
FT                   /note="Similar to Mus musculus antioxidant protein 2 Aop2
FT                   or Ltw4 or Prdx5 SW:AOP2_MOUSE (O08709) (223 aa) fasta
FT                   scores: E(): 1.3e-42, 55.605% id in 223 aa, and to
FT                   Pseudomonas aeruginosa probable antioxidant protein Pa3450
FT                   TR:Q9HYF6 (EMBL:AE004765) (212 aa) fasta scores: E():
FT                   6.9e-68, 79.048% id in 210 aa"
FT                   /db_xref="GOA:Q7VZE7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZE7"
FT                   /protein_id="CAE41266.1"
FT                   /translation="MGQLRLGDTAPDFEQKSSIGPLRLYDYLGDSWGVLFSHPADFTPV
FT                   CTTELGYTAKLAGEFAKRNVKVLALSVDPVDSHTKWIDDINDTQSTTVNFPILADDDRK
FT                   VSELYDMIHPNANATLTVRSVFVIDPAKKVRLTITYPASTGRNFDEILRVIDSLQLTDS
FT                   HSVATPVNWKDGEDVIIVPSLKDEAVIKEKFPKGYKALRPYLRITPQPNK"
FT   misc_feature    308817..309260
FT                   /note="HMMPfam hit to PF00578, AhpC/TSA family"
FT   CDS_pept        309633..310667
FT                   /transl_table=11
FT                   /gene="sbp"
FT                   /locus_tag="BP0966"
FT                   /product="sulfate-binding protein precursor"
FT                   /note="Similar to Escherichia coli sulfate-binding protein
FT                   precursor Sbp or B3917 SW:SUBI_ECOLI (P06997) (329 aa)
FT                   fasta scores: E(): 3.5e-85, 67.732% id in 313 aa, and to
FT                   Enterobacter cloacae putative sulfur-binding protein SbP
FT                   TR:Q9Z6C2 (EMBL:AF098509) (329 aa) fasta scores: E():
FT                   5.5e-87, 68.889% id in 315 aa"
FT                   /db_xref="GOA:Q7VZE6"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZE6"
FT                   /protein_id="CAE41267.1"
FT                   /translation="MPRNTAGIRGAIVALATVFSLGLPWAVQAQDKQTLLNVSYDPTRE
FT                   LYRAVDEAFIKEYQARAGVDLTVRQSHGGSGRQARSVIDGLDADVVTLALAYDIDAIAD
FT                   RGLLPQDWQKRLPRNSSPYTSTIVFLVRKGNPRQIHDWDDLVKDGVQVITPNPKTSGGA
FT                   RWNYLAAWAYALARNEGSEAKAREFVGQLLSHVPVLDTGARGSTTTFVERGVGDVLLAW
FT                   ENEAFLAREELGPDKFDIVVPSLSILAEPPVAVVDKVVDRKGTRAAAQAYLEYLYTPAA
FT                   QEIIARNFYRPTDAGVAAKYASRFPKLKLVTIDDPIFGGWRKAQKDHFSDGGTFDQVYQ
FT                   PQRK"
FT   misc_feature    309633..309719
FT                   /note="Signal peptide predicted for BP0966 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.993) with cleavage site
FT                   probability 0.970 between residues 29 and 30"
FT   misc_feature    309648..309716
FT                   /note="1 probable transmembrane helix predicted for BP0966
FT                   by TMHMM2.0 at aa 13-35"
FT   misc_feature    309654..310655
FT                   /note="HMMPfam hit to PF01100, Prokaryotic sulphate- and
FT                   thiosulphate-binding protein"
FT   misc_feature    310098..310124
FT                   /note="ScanRegExp hit to PS00757, Prokaryotic
FT                   sulfate-binding proteins signature 2. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   CDS_pept        join(310683..310889,310893..311588)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="cysU"
FT                   /gene_synonym="cysT"
FT                   /locus_tag="BP0967"
FT                   /product="sulfate transport system permease protein
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS contains an in-frame TAG stop
FT                   codon. The sequence has been checked and believed to be
FT                   correct. Similar to Escherichia coli sulfate transport
FT                   system permease protein CysT or CysU or B2424 SW:CYST_ECOLI
FT                   (P16701) (277 aa) fasta scores: E(): 4.5e-44, 49.638% id in
FT                   276 aa, and to Cucumis sativus hypothetical 31.4 kDa
FT                   protein TR:Q9G4F7 (EMBL:AF285185) (296 aa) fasta scores:
FT                   E(): 9.8e-79, 83.498% id in 303 aa"
FT                   /db_xref="PSEUDO:CAE41268.1"
FT   variation       310890..310892
FT                   /note="TAG stop codon in pertussis; TGG in parapertussis
FT                   and bronchiseptica"
FT   misc_feature    311235..311465
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   misc_feature    311238..311324
FT                   /note="ScanRegExp hit to PS00402, Binding-protein-dependent
FT                   transport systems inner membrane comp. sign. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   CDS_pept        join(311585..311698,311700..312485)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="BP0968"
FT                   /product="sulfate transport system permease protein
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 38. The sequence has been checked
FT                   and believed to be correct. Similar to Escherichia coli,
FT                   and Escherichia coli O6 sulfate transport system permease
FT                   protein cysw cysw or b2423 or c2957 SWALL:CYSW_ECOLI
FT                   (SWALL:P16702) (291 aa) fasta scores: E(): 3.3e-55, 49.65%
FT                   id in 286 aa"
FT                   /db_xref="PSEUDO:CAE41269.1"
FT   variation       311699..311700
FT                   /note="(G)2 in pertussis; (G)1 in parapertussis and
FT                   bronchiseptica"
FT   misc_feature    join(311784..311852,311895..311963,312000..312068,
FT                   312318..312386)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BP0968 by TMHMM2.0 at aa 28-50, 65-87, 100-122 and 206-228"
FT   misc_feature    312084..312320
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   misc_feature    312087..312173
FT                   /note="ScanRegExp hit to PS00402, Binding-protein-dependent
FT                   transport systems inner membrane comp. sign."
FT   CDS_pept        312510..313574
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="BP0969"
FT                   /product="sulfate transport ATP-binding protein"
FT                   /note="Similar to Escherichia coli sulfate transport
FT                   ATP-binding protein CysA or B2422 SW:CYSA_ECOLI (P16676)
FT                   (365 aa) fasta scores: E(): 5.3e-56, 56.190% id in 315 aa,
FT                   and to Cucumis sativus hypothetical 39.3 kDa protein
FT                   TR:Q9G4F5 (EMBL:AF285185) (350 aa) fasta scores: E():
FT                   7e-85, 88.929% id in 280 aa"
FT                   /db_xref="GOA:Q7VZE5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041193"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZE5"
FT                   /protein_id="CAE41270.1"
FT                   /translation="MSIEVRGLSKRFGAFRALDEVSLHIETGELVALLGPSGCGKTTLL
FT                   RIIAGLESADAGSVLFAGEDATEVDVRQRQVGFVFQHYALFKHMTVFENVAFGLRVRHR
FT                   SQRPSEARIRAKVLDLLGLVQLDWLADRYPAQLSGGQRQRIALARALAVEPRVLLLDEP
FT                   FGALDAKVRKELRRWLRRLHDELHVASVFVTHDQEEALEVTDRVVLMNAGRIEQVGSPR
FT                   EVWERPATPFVYGFLGDVNQLHGHATRGVWRLGEVALPAPDLPEADNQRAIAYVRPHDI
FT                   DLARAGTAAPGIPVRLNHVYLAGPSAYLELARQDDQAIIEAQVPEPLFRSLGLKEGEAL
FT                   LAQPRRARVFAVQP"
FT   misc_feature    312591..313148
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    312612..312635
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    312918..312962
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   misc_feature    313571..313621
FT                   /note="Signal peptide predicted for BP0970 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.951) with cleavage site
FT                   probability 0.421 between residues 17 and 18"
FT   CDS_pept        join(313574..314314,314317..314322)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="BP0970"
FT                   /product="phosphoadenosine phosphosulfate reductase
FT                   (Pseudogene)"
FT                   /EC_number="1.8.4.8"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 247. The sequence has been checked
FT                   and believed to be correct. Similar to Burkholderia cepacia
FT                   5' adenylylsulfate Aps reductase CysH TR:Q9RFS6
FT                   (EMBL:AF170343) (250 aa) fasta scores: E(): 5.2e-56,
FT                   58.678% id in 242 aa, and to Rhizobium meliloti
FT                   phosphoadenosine phosphosulfate reductase CysH or R00944 or
FT                   Smc00092 SW:CYSH_RHIME (P56891) (265 aa) fasta scores: E():
FT                   6.1e-41, 49.787% id in 235 aa"
FT                   /db_xref="PSEUDO:CAE41271.1"
FT   misc_feature    313685..314281
FT                   /note="HMMPfam hit to PF01507, Phosphoadenosine
FT                   phosphosulfate reductase family"
FT   variation       314315
FT                   /note="(C)1 in pertussis; (C)2 in parapertussis and
FT                   bronchiseptica"
FT   CDS_pept        314372..315280
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="BP0970A"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /EC_number="2.7.7.4"
FT                   /note="Similar to Escherichia coli sulfate
FT                   adenylyltransferase subunit 2 CysD or B2752 SW:CYSD_ECOLI
FT                   (P21156) (302 aa) fasta scores: E(): 1.4e-47, 45.485% id in
FT                   299 aa, and to Neisseria meningitidis sulfate
FT                   adenylyltransferase, subunit 2 Nmb1192 or nmb1154 TR:Q9JS34
FT                   (EMBL:AE002467) (307 aa) fasta scores: E(): 1.8e-90,
FT                   75.839% id in 298 aa"
FT                   /db_xref="GOA:Q7VZE4"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZE4"
FT                   /protein_id="CAE41272.1"
FT                   /translation="MSAVMTRSHLDWLESEAIFILREVAAECARPALLFSGGKDSVVLL
FT                   RLAEKAFRPGRFPFPLLHIDTGHNYDEVISFRDARAAELGETLLVRSVEDSIARGSVAL
FT                   RRETDSRNAAQAVTLLEAIEELGLDACIGGARRDEEKARAKERIFSFRDEFGQWDPKAQ
FT                   RPELWNLFNTRVHRGENMWVFPISNWTELDVWQYIQRERLALPSIYYSHTREVVRRKGL
FT                   LVPVTRLTPPAEGETVEQLAVRFRTVGDISCTCPVASDAADPAAIIAETAVTDITERGA
FT                   TRMDDQTSEASMERRKREGYF"
FT   misc_feature    314465..315124
FT                   /note="HMMPfam hit to PF01507, Phosphoadenosine
FT                   phosphosulfate reductase family"
FT   CDS_pept        join(315333..315710,315716..316579)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="cysN"
FT                   /locus_tag="BP0971"
FT                   /product="sulfate adenylyltransferase subunit 1
FT                   (Pseudogene)"
FT                   /EC_number="2.7.7.4"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 126. The frameshift occurs within
FT                   a polymeric tract of (CGACG)3. The sequence has been
FT                   checked and believed to be correct. Similar to Escherichia
FT                   coli sulfate adenylyltransferase subunit 1 CysN or B2751
FT                   SW:CYSN_ECOLI (P23845) (475 aa) fasta scores: E(): 2e-50,
FT                   46.387% id in 429 aa, and to Pseudomonas aeruginosa
FT                   CysN/CysC bifunctional enzyme [includes: sulfate
FT                   adenylyltransferase subunit 1 CysNC or CysN or Pa4442
FT                   SW:CYSN_PSEAE (O50274) (633 aa) fasta scores: E(): 2.9e-56,
FT                   50.000% id in 420 aa"
FT                   /db_xref="PSEUDO:CAE41273.1"
FT   misc_feature    join(315372..315710,315716..316303)
FT                   /note="HMMPfam hit to PF00009, Elongation factor Tu family"
FT   misc_feature    315399..315422
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    315543..315590
FT                   /note="ScanRegExp hit to PS00301, GTP-binding elongation
FT                   factors signature."
FT   variation       315710..315724
FT                   /note="(CGACG)3 in pertussis; (CGACG)2 in parapertussis and
FT                   bronchiseptica"
FT   variation       316304..316306
FT                   /note="57 bp deletion in pertussis relative to
FT                   parapertussis and bronchiseptica following this codon"
FT   CDS_pept        316831..318042
FT                   /transl_table=11
FT                   /locus_tag="BP0972"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa0069 TR:Q9I763 (EMBL:AE004446) (352 aa) fasta
FT                   scores: E(): 3.3e-66, 56.818% id in 308 aa, and to
FT                   Rhizobium meliloti hypothetical protein Smc00866
FT                   TR:CAC45412 (EMBL:AL591785) (385 aa) fasta scores: E():
FT                   6.7e-62, 45.170% id in 383 aa"
FT                   /db_xref="GOA:Q7VZE3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZE3"
FT                   /protein_id="CAE41274.1"
FT                   /translation="MRGRGAVTNVPHRFQQADRVRVDDGWANPDYTAGSDAAALPSVAE
FT                   ALGQGGRRAIPIAVEGADASPNTCAQAPAPRTIVQAEEARKMLSRNDSPDIPFDVAANP
FT                   YRGCEHGCVYCYARPTHAYLGYSPGLDFETRLVAKANAVAALRAELARPGYRASPINIG
FT                   SATDAYQPIERTWRLTRGMLELLLQTRHPLTVVTKNALVERDLDLLQDLARQKLVTVFV
FT                   SITTLDAAMARTLEPRASAPYRRLQTVRTLAQAGVPVGVLVAPVIPFINDESLEHILQE
FT                   ASAAGACYASYTVLRLPWEVKEVFETWLQAHFPDRAQRVLHRIEDLRNGRRNDTAFGSR
FT                   MRGTGIWADLLRQRFALATRKLDLNRHRPELDTHRFVPPLEPGLPPARGRREARAQPGQ
FT                   LALF"
FT   misc_feature    317212..317856
FT                   /note="HMMPfam hit to PF01932, Domain of unknown function
FT                   DUF85"
FT   CDS_pept        318244..318576
FT                   /transl_table=11
FT                   /locus_tag="BP0973"
FT                   /product="putative membrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="GOA:Q7VZE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZE2"
FT                   /protein_id="CAE41275.1"
FT                   /translation="MPGRTLGALRRLARAWAGAAVPQRKWPFPPTPPGQAQPCTPCTDS
FT                   QPRSVQAVQPAQARALHAQAELSGAATQAATQVLSTKAKIIDVLLVAVWGAMIPALMWL
FT                   GAAGGF"
FT   misc_feature    318496..318564
FT                   /note="1 probable transmembrane helix predicted for BP0973
FT                   by TMHMM2.0 at aa 101-123"
FT   CDS_pept        complement(318584..319456)
FT                   /transl_table=11
FT                   /locus_tag="BP0974"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative integral
FT                   membrane protein Sce87.15C TR:Q9RKC3 (EMBL:AL132674) (281
FT                   aa) fasta scores: E(): 4.3e-14, 29.537% id in 281 aa, and
FT                   to Rhizobium loti Mll3062 protein Mll3062 TR:Q98H24
FT                   (EMBL:AP003001) (281 aa) fasta scores: E(): 1.9e-18,
FT                   31.849% id in 292 aa"
FT                   /db_xref="GOA:Q7VZE1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZE1"
FT                   /protein_id="CAE41276.1"
FT                   /translation="MSYTSLILVVLAAMAHAAWNLLAKRAAMVGPMFVFAYGLAATILY
FT                   APWVIWVLAHDGMVWSWPVVLCILASSMLHLGYSLCLQRGYQVADLSVVYPIARGTGPL
FT                   LSTMGAFTLLSEPTTTTGIAGMLCVVGGVLLIATQGRLGMFRQAQAWIGVRWGVVIGLF
FT                   IAAYTVVDAYGVKILLIMPVLFDWFTCATRTLMMTPHVLRRRAQYWPAMRGYWHLAIAV
FT                   GVLSPLGYILVLYALRNGAPLSLVAPAREMSMMLGTLAGMFLLREKVGIGRLAGCLAIL
FT                   AGVVLLGSS"
FT   misc_feature    complement(join(318593..318649,318746..318811,
FT                   318851..318916,318947..319000,319022..319087,
FT                   319118..319183,319220..319285,319301..319366,
FT                   319388..319444))
FT                   /note="9 probable transmembrane helices predicted for
FT                   BP0974 by TMHMM2.0 at aa 4-23, 30-52, 57-79, 91-113,
FT                   123-145, 152-170, 180-202, 215-237 and 269-288"
FT   misc_feature    complement(319043..319417)
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6"
FT   misc_feature    complement(319406..319456)
FT                   /note="Signal peptide predicted for BP0974 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.888 between residues 17 and 18"
FT   CDS_pept        319762..320142
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="BP0975"
FT                   /product="50S ribosomal protein L19"
FT                   /note="Similar to Escherichia coli 50S ribosomal protein
FT                   L19 RplS or B2606 or Z3900 or Ecs3469 SW:RL19_ECOLI
FT                   (P02420) (114 aa) fasta scores: E(): 4.2e-23, 64.103% id in
FT                   117 aa, and to Neisseria meningitidis 50S ribosomal protein
FT                   L19 RplS or Nmb0589 SW:RL19_NEIMB (Q9K0K5) (121 aa) fasta
FT                   scores: E(): 5.8e-31, 77.049% id in 122 aa"
FT                   /db_xref="GOA:Q7VZE0"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZE0"
FT                   /protein_id="CAE41277.1"
FT                   /translation="MNLIAILEQEEIARLTGGNAVTEFAPGDTVVVSVNVVEGTRKRVQ
FT                   AFEGVVIAKRNRGLNSSFIVRKISSGEAVERTFQLYSPQIAGIEVKRRGDVRRAKLYYL
FT                   RSRSGKSARIKEKLVLKKAKSA"
FT   misc_feature    319762..320115
FT                   /note="HMMPfam hit to PF01245, Ribosomal protein L19"
FT   misc_feature    320029..320076
FT                   /note="ScanRegExp hit to PS01015, Ribosomal protein L19
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        320413..321078
FT                   /transl_table=11
FT                   /locus_tag="BP0976"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Caulobacter crescentus MutT/NudiX family
FT                   protein Cc0407 TR:Q9AB27 (EMBL:AE005713) (216 aa) fasta
FT                   scores: E(): 6.1e-27, 47.959% id in 196 aa, and to
FT                   Rhizobium loti Mll2727 protein mll2727 TR:Q98HS8
FT                   (EMBL:AP003000) (204 aa) fasta scores: E(): 4e-24, 42.640%
FT                   id in 197 aa"
FT                   /db_xref="GOA:Q7VZD9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZD9"
FT                   /protein_id="CAE41278.1"
FT                   /translation="MAQPWETANQGLARVDERLLTPPELRSSLRPADHWRLDPLCAAEP
FT                   RAPGREGSLVAAAVLIPLVMRADGVRVMLTQRAAHLHDHAGQVSFPGGRIEVSDATPVA
FT                   AALREAQEETGLPVQQVEVLGSMPQYFTATGFAITPVVSLVQPDFELAPDAFEVAEVFE
FT                   VPLSFLMDPANHRLYRAALPDGYVRQYYAMPWQRYFIWGATAGMLRNLYQTVREALPG"
FT   misc_feature    320569..320964
FT                   /note="HMMPfam hit to PF00293, MutT-like domain"
FT   CDS_pept        321180..322229
FT                   /transl_table=11
FT                   /locus_tag="BP0977"
FT                   /product="probable oxidoreductase"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   oxidoreductase Pa4434 TR:Q9HVY1 (EMBL:AE004857) (345 aa)
FT                   fasta scores: E(): 1.1e-83, 61.318% id in 349 aa, and to
FT                   Vibrio cholerae oxidoreductase Tas, aldo/keto reductase
FT                   family Vc0667 TR:Q9KU57 (EMBL:AE004153) (352 aa) fasta
FT                   scores: E(): 1.6e-81, 60.172% id in 349 aa"
FT                   /db_xref="GOA:Q7VZD8"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZD8"
FT                   /protein_id="CAE41279.1"
FT                   /translation="MKYRKLGHTDLDVSLIGLGTMTWGEQNTEAQAHEQLDYALAHGIN
FT                   LVDAAEMYPVPPKPETQGRTESCIGSWLARTGRRHEVVLASKAAGPVRDAKRPSHIRDG
FT                   KTFLDRKNLTQALDASLKRLQTDYLDLYQLHWPDRTTNTFGKLAYPWVDDAHTVPIEET
FT                   LEVLQDFVRAGKVRHVGLSNETPWGVARFLQAAEKHGLPKVATIQNPYNLLNRIFEIGL
FT                   AEFSHREGVGLLAYSPLAMGILSGKYLDGARPEGSRLALFTRFTRYSNPQAEAAARDYV
FT                   MLARDHGLAPAQMALAWVNQRPFVSSNLMGATTLAQLKENIESVEVTLSDEVLQGIEAI
FT                   HARQPNPAP"
FT   misc_feature    321495..321728
FT                   /note="HMMPfam hit to PF00248, Aldo/keto reductase family"
FT   repeat_region   complement(322338..323568)
FT                   /note="Insertion sequence"
FT   CDS_pept        complement(322367..>323413)
FT                   /transl_table=11
FT                   /locus_tag="BP0978"
FT                   /product="transposase for IS1663"
FT                   /note="Similar to Neisseria meningitidis putative
FT                   invertase/transposase nma1800 TR:Q9JTF3 (EMBL:AL162757)
FT                   (318 aa) fasta scores: E(): 2e-17, 28.48% id in 316 aa and
FT                   Acinetobacter spSE19. pilin inverting protein chnY
FT                   TR:Q9F7E1 (EMBL:AF282240) (324 aa) fasta scores: E():
FT                   8.2e-50, 47.516% id in 322 aa"
FT                   /db_xref="GOA:Q7VZD7"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZD7"
FT                   /protein_id="CAE41280.1"
FT                   /translation="DPVCTRQVGAVADSSLLSAGGQVHVFIGIDVSKAKLDCTLLTAEA
FT                   DKRKTKVVVNTAAGVQALLAWCAKHGAQPAQLHAILEPTGLYHEQAATALPQVRVSLVN
FT                   PAQARDFAKALALRSKNDALDSYVLARYGQTLSPALWHPAPLHARQLRALLTRREALSK
FT                   DLLRELNRKEKSQFSPSAPLVDGSIDKAIAFLREQIKQIERAIDQHIDNHPDLKQDCEL
FT                   LNSIPAIGPQAGNAILAVMHNRHIDSAQSLAAYLGVVPVQRQSGSSLNSCARLSKAGPS
FT                   QVRATLYMAALVGTRHNPHIRALYQRLLKAGKSKKAALGAAMRKLVHLCFGVLKNRIPY
FT                   QPNYAMNG"
FT   misc_feature    complement(322499..322831)
FT                   /note="HMMPfam hit to PF02371, Transposase
FT                   IS116/IS110/IS902 family"
FT   misc_feature    complement(322844..323131)
FT                   /note="HMMPfam hit to PF01548, Transposase"
FT   CDS_pept        complement(join(323640..323846,323848..324825))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP0980"
FT                   /product="conserved hypothetical protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 326. The sequence has been checked
FT                   and believed to be correct. Similar to Rhizobium loti
FT                   Mlr8412 protein Mlr8412 TR:Q983A8 (EMBL:AP003014) (405 aa)
FT                   fasta scores: E(): 9.4e-56, 46.053% id in 380 aa, and to
FT                   Agrobacterium tumefaciens Agr_c_2168p TR:AAK86976
FT                   (EMBL:AE008046) (407 aa) fasta scores: E(): 5.8e-51,
FT                   42.440% id in 377 aa. Also similar to BP2600, 49.746%
FT                   identity in 394 aa overlap."
FT                   /db_xref="PSEUDO:CAE41281.1"
FT   variation       complement(323847)
FT                   /note="frameshift (A) in pertussis and parapertussis; no
FT                   frameshift (-) in bronchiseptica"
FT   CDS_pept        complement(324892..325464)
FT                   /transl_table=11
FT                   /locus_tag="BP0981"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa5357 TR:Q9HTK1 (EMBL:AE004947) (178 aa) fasta
FT                   scores: E(): 3.5, 35.519% id in 183 aa, and to Pseudomonas
FT                   putida hypothetical 20.6 kDa protein TR:Q9FD32
FT                   (EMBL:AF292094) (182 aa) fasta scores: E(): 2.3, 34.884% id
FT                   in 172 aa"
FT                   /db_xref="GOA:Q7VZD6"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZD6"
FT                   /protein_id="CAE41282.1"
FT                   /translation="MTTPIPLARGWLPAAPSTLDPLRKYWLFRPGALTAGLRQLGHVRL
FT                   RVLAEYPTGAPRDEADGMRIAAQSPVWVREVLMSIDGVDSVVARSLTPLRASHGVWQGM
FT                   RRLLTRPLADMLYHDPGIHRSVFVCRRLAAGVPFHATAIARAPAGGPEPALWARRSAFW
FT                   RAGQPLLVAECFLPAFWSLARAPVAPR"
FT   CDS_pept        325524..326255
FT                   /transl_table=11
FT                   /locus_tag="BP0982"
FT                   /product="putative RNA pseudouridylate synthase"
FT                   /note="Similar to Caulobacter crescentus RNA
FT                   pseudouridylate synthase, putative Cc0855 TR:Q9A9V6
FT                   (EMBL:AE005762) (255 aa) fasta scores: E(): 5.2e-38,
FT                   49.587% id in 242 aa, and to Neisseria meningitidis
FT                   putative RNA-binding protein Nma1016 TR:Q9JV32
FT                   (EMBL:AL162754) (252 aa) fasta scores: E(): 1e-57, 66.116%
FT                   id in 242 aa"
FT                   /db_xref="GOA:Q7VZD5"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZD5"
FT                   /protein_id="CAE41283.1"
FT                   /translation="MEKVRISKLMSERGLCSRREADSYIERGWVRVDGVVVSELGARAL
FT                   PDQVITLERAAAARQTARVTILLHKPVGYVSGQAEKGYTPAVALIDARSRYAGDRAPQR
FT                   FERGQLQGLAVAGRLDIDSQGLLVLTQDGRIAKKLIGEDSEVDKEYLVRVQGRLSEAGL
FT                   ALLNHGLSLDGKPLRPAQVRWQNADQLRFVLREGKKRQIRRMCELVGLRVVGLKRVRIG
FT                   RVSLGDLPAGQWRYLRADERF"
FT   misc_feature    325533..325673
FT                   /note="HMMPfam hit to PF01479, S4 domain"
FT   misc_feature    325713..326147
FT                   /note="HMMPfam hit to PF00849, RNA pseudouridylate
FT                   synthase"
FT   CDS_pept        complement(326307..327242)
FT                   /transl_table=11
FT                   /locus_tag="BP0983"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="Similar to Rhizobium meliloti putative LysR-family
FT                   transcriptional regulator Sma1602 TR:AAK65531
FT                   (EMBL:AE007274) (302 aa) fasta scores: E(): 3.4e-51,
FT                   51.020% id in 294 aa, and to Pseudomonas aeruginosa
FT                   probable transcriptional regulator Pa3135 TR:Q9HZ90
FT                   (EMBL:AE004737) (306 aa) fasta scores: E(): 4.3e-30,
FT                   39.322% id in 295 aa"
FT                   /db_xref="GOA:Q7VZD4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZD4"
FT                   /protein_id="CAE41284.1"
FT                   /translation="MNRLQGMELFVEVARTLSFGRAAENLAIPKSTLSRQVAELERSVG
FT                   LRLLSRTTRRVELTEAGQLYFERCQRIVAEARIAHEELQNLVETPSGPLRVNMPADFGT
FT                   DFLSEAFTEFSRRYPEVTFYLDLASPEHAERVFQTCDVSIEIGDLPDSTHIARLLGVLP
FT                   AHLYASPDYLARHGEPQHPDDLPRHECIQFRAGTGRVTRWPLNSGERHVEITPGNRFSV
FT                   NSVSMVRNLATLGAGIAILAPMGNVREDIESGRLKRILPDWLAGPFPVYAVTDTRMLPA
FT                   KTRIFVEFLMERLSNKTLAGQNNPAFLNLR"
FT   misc_feature    complement(326811..327233)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    complement(327099..327191)
FT                   /note="ScanRegExp hit to PS00044, Bacterial regulatory
FT                   proteins, lysR family signature."
FT   misc_feature    complement(327129..327194)
FT                   /note="Predicted helix-turn-helix motif with score 1228
FT                   (+3.37 SD) at aa 17-38, sequence LSFGRAAENLAIPKSTLSRQVA"
FT   misc_feature    complement(327159..327206)
FT                   /note="ScanRegExp hit to PS00063, Aldo/keto reductase
FT                   family putative active site signature."
FT   CDS_pept        327475..328074
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /gene_synonym="mtcA"
FT                   /gene_synonym="lir"
FT                   /locus_tag="BP0984"
FT                   /product="acriflavine resistance protein a precursor
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS contains a large deletion,
FT                   following codon 158, relative to B. parapertussis and B.
FT                   bronchiseptica. The sequence has been checked and believed
FT                   to be correct. Similar to Escherichia coli acriflavine
FT                   resistance protein A precursor AcrA or MtcA or LiR or B0463
FT                   or Z0578 or Ecs0516 SW:ACRA_ECOLI (P31223) (397 aa) fasta
FT                   scores: E(): 5.8e-23, 52.318% id in 151 aa, and to
FT                   Caulobacter crescentus HlyD family secretion protein Cc0808
FT                   TR:Q9AA03 (EMBL:AE005757) (388 aa) fasta scores: E():
FT                   1.3e-23, 55.556% id in 153 aa"
FT                   /db_xref="PSEUDO:CAE41285.1"
FT   variation       327946..327948
FT                   /note="large deletion in pertussis relative to
FT                   parapertussis and bronchiseptica following this codon"
FT   CDS_pept        328032..331211
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /gene_synonym="acrE"
FT                   /locus_tag="BP0985"
FT                   /product="acriflavine resistance protein B"
FT                   /note="Similar to Escherichia coli acriflavine resistance
FT                   protein B AcrB or AcrE or B0462 SW:ACRB_ECOLI (P31224)
FT                   (1049 aa) fasta scores: E(): 0, 67.143% id in 1050 aa, and
FT                   to Pseudomonas aeruginosa multidrug resistance protein MexB
FT                   or Pa0426 SW:MEXB_PSEAE (P52002) (1046 aa) fasta scores:
FT                   E(): 0, 71.539% id in 1033 aa"
FT                   /db_xref="GOA:Q7VZD3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZD3"
FT                   /protein_id="CAE41286.1"
FT                   /translation="MAKFFIDRPVFAWVIAIVLMMAGALSILSLPVAQYPNIAPPAISI
FT                   NVTYPGASAQTVQDTVVQVIEQQMNGIDNLQYISSESNSDGSMSITLTFSQGTNPDTAQ
FT                   VQVQNKLAVAQPLLPLEVQQQGIRVTKATKNFLIVAGFVSTDGTMDKSDLADYVASYIQ
FT                   DPISRTPGVGNFQLFGAPYAMRIWISPEKLVNFGLTASDVTTAIREQNVQVSSGQLGGQ
FT                   PAVRGQQLNATVIGPSRLQTPEAFGRILLKVNRDGSQVRLKDVASIELGAQTYAIDSYY
FT                   NGKPASGLAIKLASGANALDTAQAVRETINGLKPYFPPGMDVVYPYDTTPFVSLSIEGV
FT                   VKTLFEAVLLVFLVMYLFLQNVRATLIPTLAVPVVLLGTFGVLAAFGYSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLSPRQATRKSMGQITGALIGIAMVLAAVFVPMAF
FT                   FGGSTGVIYRQFSITIVSSMVLSVVVAIVFTPALCATMLKPIPKGHHGSKKGFFGWFNR
FT                   TFERSSQAYANNVARSMGRTKRLLLIYVVILLGMAWMFMRIPTAFLPDEDQGILFAQVQ
FT                   APAGATSERTQATIDAAVKYLLEDEKESVASVFAVNGFSFGGRGQNAAILFIKLRDWNE
FT                   RKGAEHRAAAVAARANAKFRAELRDAQAAVFAPPAVMELGNATGFDFQLQDRAGVGHEK
FT                   LLAARNQLLQEAGASPMLVAVRPNGIEDAPQYQLDIDREKARALGVSITEINNTLATAW
FT                   GSSYVNDFIDRGRVKKVFVQGEASSRMLPQDLDKWYVRNNAGDMVPFSAFSSAQWTFGP
FT                   QKLNRYNGVPSYNIQGQAAPGYSSGDAMAEMERLADKLPLGIGYDWTGLSFEERLSGAQ
FT                   APALYAISLIVVFLCLAALYESWSIPTAVMLVVPLGVVGALLATMTRGLSNDVYFQVGL
FT                   LTTIGLAAKNAILIVEFAKEHYEEGASLTEAAVHAARQRLRPILMTSLAFILGVVPLAI
FT                   STGAGSGSQNAIGTGVIGGMLTGTFLAIFFVPLFFVLTLRLFKVKRASENREDDDPHGG
FT                   AQPATHGGQPQ"
FT   misc_feature    328032..328133
FT                   /note="Signal peptide predicted for BP0985 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.961) with cleavage site
FT                   probability 0.721 between residues 34 and 35"
FT   misc_feature    328032..331115
FT                   /note="HMMPfam hit to PF00873, AcrB/AcrD/AcrF family"
FT   misc_feature    join(328068..328136,329040..329108,329127..329195,
FT                   329205..329273,329343..329411,329439..329507,
FT                   329649..329717,330636..330704,330723..330791,
FT                   330804..330872,330945..331013,331041..331109)
FT                   /note="12 probable transmembrane helices predicted for
FT                   BP0985 by TMHMM2.0 at aa 13-35, 337-359, 366-388, 392-414,
FT                   438-460, 470-492, 540-562, 869-891, 898-920, 925-947,
FT                   972-994 and 1004-1026"
FT   CDS_pept        331208..332590
FT                   /transl_table=11
FT                   /gene="cusC"
FT                   /gene_synonym="ibeB"
FT                   /locus_tag="BP0986"
FT                   /product="probable outer membrane lipoprotein"
FT                   /note="Similar to Escherichia coli probable outer membrane
FT                   lipoprotein CusC precursor CusC or IbeB or B0572
FT                   SW:CUSC_ECOLI (P77211) (457 aa) fasta scores: E(): 4.9e-38,
FT                   39.655% id in 464 aa, and to Pseudomonas aeruginosa outer
FT                   membrane protein OprM precursor OprM or OprK or Pa0427
FT                   SW:OPRM_PSEAE (Q51487) (485 aa) fasta scores: E(): 5.3e-67,
FT                   55.717% id in 481 aa"
FT                   /db_xref="GOA:Q7VZD2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZD2"
FT                   /protein_id="CAE41287.1"
FT                   /translation="MKPVVMRTLLSLAVATALAGCSLAPTYERPQAPVDAAYPSGPAYG
FT                   APGQAAAGAPAAADVGWRDFFGDPLLQELLALSLANNRDLRVAALNVEAARLNPSGQAG
FT                   ISRSYQVGASLSTWELDLFGRIRSLSEQALQLYLAQDETRLATQLTLVAETANAYPTLR
FT                   ADQELLALTRQTLAAQQESYKLTRQSYDLGVATELDLSQAEISLRTAERNLSQYTRMAA
FT                   QDRNALVLLVGQPLPAGIGAQLDQAVALPDGVVLADLPAGLPSDLLARRPDIRAAEHQL
FT                   QAANASIGAARAAFFPRISLTGSAGTASASLGGLFDAGSGAWSFAPQISVPIFAGGALR
FT                   ASLDLAKIQKDIGIARYEQAIQSGFREVSDALAGRGTLQEQIRSQELLVQANQRAYDLS
FT                   QQRYQQGIDNYLSVLDSQRSLYTAQQTLVETRLARLSNLIQLYKALGGGWSERTVAAAQ
FT                   AG"
FT   misc_feature    331208..331279
FT                   /note="Signal peptide predicted for BP0986 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.995) with cleavage site
FT                   probability 0.604 between residues 24 and 25"
FT   misc_feature    331238..331270
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    331418..331939
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein"
FT   misc_feature    331985..332578
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein"
FT   CDS_pept        complement(332660..332911)
FT                   /transl_table=11
FT                   /locus_tag="BP0987"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Sma1766 TR:AAK65633 (EMBL:AE007284) (83 aa) fasta scores:
FT                   E(): 3.7e-12, 52.439% id in 82 aa, and to Pseudomonas
FT                   aeruginosa hypothetical protein Pa5424 TR:Q9HTE0
FT                   (EMBL:AE004955) (81 aa) fasta scores: E(): 2.6e-11, 51.250%
FT                   id in 80 aa"
FT                   /db_xref="GOA:Q7VZD1"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZD1"
FT                   /protein_id="CAE41288.1"
FT                   /translation="MNIIIMIIVGFVVGLITRAIMPGDQNMGYIMTTILGIIGSVVAGF
FT                   LGQQLGWYAPGEPAGWIGSVVGAIIVLFVVGLVAKKRA"
FT   misc_feature    complement(join(332675..332731,332762..332827,
FT                   332849..332914))
FT                   /note="3 probable transmembrane helices predicted for
FT                   BP0987 by TMHMM2.0 at aa 24-46, 53-75 and 85-104"
FT   CDS_pept        complement(333057..333671)
FT                   /transl_table=11
FT                   /locus_tag="BP0988"
FT                   /product="putative exported protein"
FT                   /note="Similar to Neisseria meningitidis putative
FT                   lipoprotein Nma1767 TR:Q9JTI0 (EMBL:AL162757) (217 aa)
FT                   fasta scores: E(): 1.6e-19, 39.490% id in 157 aa, and to
FT                   Caulobacter crescentus Sco1/2 family protein Cc3503
FT                   TR:Q9A2Q3 (EMBL:AE006008) (190 aa) fasta scores: E():
FT                   6.8e-18, 37.173% id in 191 aa"
FT                   /db_xref="GOA:Q7VZD0"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZD0"
FT                   /protein_id="CAE41289.1"
FT                   /translation="MYSPLSGRAWRGLLLAMLMLLAACSERSADWSLYNVKGHLPDLKF
FT                   SLPGAHGKTVSSDDLKGKTVLLFFGYASCPDVCPTTMAQLTAVLQQLGEQARDVRILFV
FT                   SVDPHRDTPDILQAYVNEFNSNAIGVTGNEKQIADLARRYRVAYQIEKPKPGDDADIYD
FT                   VTHSRGVYIFDNQGKARLLASDTDTIDTMVKDLRQLIAQTQ"
FT   misc_feature    complement(333111..333635)
FT                   /note="HMMPfam hit to PF02630, SCO1/SenC"
FT   misc_feature    complement(333585..333671)
FT                   /note="Signal peptide predicted for BP0988 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.995) with cleavage site
FT                   probability 0.749 between residues 29 and 30"
FT   misc_feature    complement(333600..333632)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(333858..335918)
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /gene_synonym="opdA"
FT                   /locus_tag="BP0989"
FT                   /product="oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="Similar to Escherichia coli oligopeptidase A PrlC or
FT                   OpdA or B3498 SW:OPDA_ECOLI (P27298) (680 aa) fasta scores:
FT                   E(): 7.2e-123, 46.009% id in 689 aa, and to Xylella
FT                   fastidiosa oligopeptidase A Xf0127 TR:Q9PH19
FT                   (EMBL:AE003866) (674 aa) fasta scores: E(): 2.1e-134,
FT                   54.839% id in 682 aa"
FT                   /db_xref="GOA:Q7VZC9"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZC9"
FT                   /protein_id="CAE41290.1"
FT                   /translation="MTQNPLLAPVADLVDYAAVKPEHIVPAVQALVDIARAAVEHAADP
FT                   ALPATWDAVVAPLDSASERLWRAWSVAGHLNAVVNTPVLREAYNAALPLVTEFSTWVGL
FT                   HEGLYRQYQRLQAAEDFAAWPPVRRRVVELALRDFRLSGVELQGAARERYAEISDREAQ
FT                   ASQKFSENVLDAIDAWSLLVDDQARLDGIPADVLAAARKAAEDDGATGWKLTLKMPCYL
FT                   PVMQYARDRALRETLYRAYGTVASEHGDAAYDNSPLIEELLQLRADEAGLLQYPTFAAL
FT                   RLQTRMARDATEVVDFLRDLARRAKPYAERDLAELQAFAAGELGLAELQPWDVPFAAER
FT                   LRESRYAYSEDEIKQYFTEPRVLAGLFEVIETLFDVRLREVPVSSWHADVRGVRVESPD
FT                   GATLGHLYLDLYARAGKQSGAWVDSERSRRRVQGDLQTPVAYLTCNFSRPNGDKAALLT
FT                   HDDVITLFHETGHALHALLSEVDEPGAAAFASVEWDAIELPSQFMENFCWEWSVVQKLS
FT                   AHVETGQPLPRDLYDRLVAARNFQSGMQTVRQIEFALFDMMLHDRPQGAPIADVLALLQ
FT                   QVRQEVAVLFPPAWHRLPHSFSHLFAGGYGAGYYSYKWAEVLSADAYEAFEEAARQGEP
FT                   AATTLDGATGARFRKEILAVGGARPAADSFRAFRGREPRIDALLRHSGMQA"
FT   misc_feature    complement(333867..335759)
FT                   /note="HMMPfam hit to PF01432, Peptidase family M3"
FT   CDS_pept        complement(336048..336899)
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /gene_synonym="ads"
FT                   /locus_tag="BP0990"
FT                   /product="FolD bifunctional protein [includes:
FT                   methylenetetrahydrofolate dehydrogenase and
FT                   methylenetetrahydrofolate cyclohydrolase]"
FT                   /EC_number="1.5.1.5"
FT                   /note="Similar to Escherichia coli FolD bifunctional
FT                   protein [includes: methylenetetrahydrofolate dehydrogenase
FT                   and methylenetetrahydrofolate cyclohydrolas] FolD or Ads or
FT                   B0529 SW:FOLD_ECOLI (P24186) (287 aa) fasta scores: E():
FT                   5.3e-50, 54.348% id in 276 aa, and to Bacillus halodurans
FT                   methylenetetrahydrofolate dehydrogenase Fold or Bh2784
FT                   TR:Q9K966 (EMBL:AP001516) (279 aa) fasta scores: E():
FT                   9.4e-56, 55.197% id in 279 aa. Also highly similar to
FT                   BP2522, 76.241% identity in 282 aa overlap."
FT                   /db_xref="GOA:Q7VZC8"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VZC8"
FT                   /protein_id="CAE41291.1"
FT                   /translation="MTARIIDGAALSQRIREEVAQRVQALTAKGVRPGLAVVLVGDDPA
FT                   SQVYVRNKVAACEKAGLHSVKEQYPADLTEAQLLERIDALNRDPSIHGILVQLPLPRHM
FT                   DAHKVIEAIAAEKDVDGFHISNAGLLMTGQPLFRPCTPYGVMKMLESEGVALRGAEAVI
FT                   VGASNIVGKPMAMLLLQAGATITICNSKTRDLGAQTRRADVLVVATGKPGMIDGSMIKP
FT                   GAVVIDVGINRGADGKLCGDVDMASAREVAGAISPVPGGVGPMTIAMLLVNTVEAAERA
FT                   AA"
FT   misc_feature    complement(336066..336857)
FT                   /note="HMMPfam hit to PF00763, Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, catalytic domain"
FT   misc_feature    complement(336099..336125)
FT                   /note="ScanRegExp hit to PS00767, Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase signature 2. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   misc_feature    complement(336600..336677)
FT                   /note="ScanRegExp hit to PS00766, Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase signature 1. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   CDS_pept        complement(336896..337522)
FT                   /transl_table=11
FT                   /locus_tag="BP0991"
FT                   /product="two-component response regulator"
FT                   /note="Similar to Bradyrhizobium japonicum transcriptional
FT                   regulatory protein FixJ SW:FIXJ_BRAJA (P23221) (205 aa)
FT                   fasta scores: E(): 3e-26, 41.146% id in 192 aa, and to
FT                   Pseudomonas sp transcriptional activator StdR TR:O50213
FT                   (EMBL:AF031161) (207 aa) fasta scores: E(): 1.2e-27,
FT                   47.644% id in 191 aa"
FT                   /db_xref="GOA:Q7VZC7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZC7"
FT                   /protein_id="CAE41292.1"
FT                   /translation="MNTPHLSSTVFIVDDDEAVRDSLRWLLEANGYRVRAYASGENFLD
FT                   EYDASQIGVLIADVRMPGMSGLELQEQLIARNAPLPIVFITGHGDVPMAVSTMKKGAVD
FT                   FLEKPFNESDLREIVARMLEQAVQRISKFQAQKDHEAMLARLTAREQQVLERIVAGRLN
FT                   KQIADDLGISIKTVEAHRANIMEKLEVTTVADLMKVALAKPEAHT"
FT   misc_feature    complement(336899..337096)
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR family"
FT   misc_feature    complement(336962..337045)
FT                   /note="ScanRegExp hit to PS00622, Bacterial regulatory
FT                   proteins, luxR family signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   misc_feature    complement(337166..337501)
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain"
FT   CDS_pept        complement(337519..339273)
FT                   /transl_table=11
FT                   /locus_tag="BP0992"
FT                   /product="tw-component sensor kinase"
FT                   /note="Similar to Azorhizobium caulinodans sensor protein
FT                   FixL SW:FIXL_AZOCA (P26489) (504 aa) fasta scores: E():
FT                   1.7e-37, 47.893% id in 261 aa, and to Caulobacter
FT                   crescentus sensory box histidine kinase FixL Cc0759
FT                   TR:Q9AA47 (EMBL:AE005751) (504 aa) fasta scores: E():
FT                   2.4e-35, 45.059% id in 253 aa"
FT                   /db_xref="GOA:Q7VZC6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZC6"
FT                   /protein_id="CAE41293.1"
FT                   /translation="MSSPPKSNIPMSFRDHARARRRGVYWLTPALVLVLYICVMGVFFW
FT                   LQRIHDDSVMFVTIDQELRQQRLIWVVLALSCVIVISLLMLWRYTRFRSEAEAALIAET
FT                   GFRRAMENSMSTGMRVLDMEGRIAYVNPAFCRMIGWNEADLIGRSPPFPYWVPGRHDQH
FT                   QHTLEVLTSGKTPSSGLEVEAQRRDGSRFTARMYVSPLLDPNGDQIGWMTSMTDITEPK
FT                   RIREALTAAHERFMTVLEGLDDAISVTADTHDGLELLFANRTYRRVFGAQTGGHDELLA
FT                   GRRGRFTDESVEVFAPSVQRWFEVHHRMLAWTDGRRVRMQVARDITERRVHEEASRVQQ
FT                   EKIQLTSRLTTMGEMASSLAHELNQPLTAIANYSMGAVALVKAGHTSPNMLLPALEKAA
FT                   SQAERAGKIISRIREFVKRSEPRRQRVAISRIVDNAIGFAEIDARKRRIRIERFVPSNA
FT                   PDVLADPILIEQVLLNLLKNGLEAMEKSESDELKVAVIPHEQHIEVAVVDRGHGLPEPE
FT                   RLFEPFFSTKSQGLGMGLNICRTIIESHHGRLWADPNPAGGTIFRFTLPCATPQSQAQN
FT                   DQSEELHA"
FT   misc_feature    complement(337567..337887)
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, phytochrome-like ATPase"
FT   misc_feature    complement(338011..338223)
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain"
FT   misc_feature    complement(338464..338577)
FT                   /note="HMMPfam hit to PF00989, PAS domain"
FT   misc_feature    complement(338611..338739)
FT                   /note="HMMPfam hit to PF00785, PAC motif"
FT   misc_feature    complement(338764..338961)
FT                   /note="HMMPfam hit to PF00989, PAS domain"
FT   misc_feature    complement(join(339007..339072,339136..339201))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BP0992 by TMHMM2.0 at aa 24-46 and 67-89"
FT   CDS_pept        339566..342271
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="BP0993"
FT                   /product="pyruvate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.1"
FT                   /note="Similar to Escherichia coli pyruvate dehydrogenase
FT                   E1 component AceE or B0114 or Z0124 or Ecs0118
FT                   SW:ODP1_ECOLI (P06958) (886 aa) fasta scores: E(): 0,
FT                   60.787% id in 890 aa, and to Alcaligenes eutrophus pyruvate
FT                   dehydrogenase E1 component PdhA SW:ODP1_ALCEU (Q59097) (895
FT                   aa) fasta scores: E(): 0, 65.286% id in 893 aa. Also
FT                   similar to BP1121, 54.711% identity (56.243% ungapped) in
FT                   881 aa overlap."
FT                   /db_xref="GOA:Q7VZC5"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZC5"
FT                   /protein_id="CAE41294.1"
FT                   /translation="MSSFAQAGALAAANDEDTLETQEWLEALAAVLDREGPQRAHYLLE
FT                   RLIDEARRSGAHIPFSPNTAYVNTIPPGLEPAHPGNLELEARIRSYVRWNAMAMVVRAN
FT                   KHNPPDGGDLGGHIASFASLATMIGCGQNHFWHGETEEHGGDLVYFQGHTSPGMYGRAY
FT                   LEGRLTEDQLNHFRQEVDGKGLSSYPHPKLMPDFWQFPTVSMGLGPLMAIYQARFLKYL
FT                   HARGIADTSNRKVWVFCGDGEMDEPESLGAIALAAREKLDNLIFVINCNLQRLDGPVRG
FT                   NGKIIQELEGDFRGSGWNVIKLIWGGYWDPLLAHDKEGILRRIMEEAVDGEYQAYKAND
FT                   GKYVREHFFGKHPKLLEMVARMSDEDIWRLNRGGHDPHKVYAAFDAASKHAGQPTVILA
FT                   KTIKGYGMGHVGQAKNPTHQQKKLELDSIREFRDRFGIPIPDDKLEELPYYKPAEDSPE
FT                   MQYLHERRKALGGYLPKRRAKADEQLKAPALDAFKAVLEPTAEGREISTTQAFVRVLNQ
FT                   VLRDKDLGPRVVPILADESRTFGMEGLFRQIGIYAPEGQKYTPVDKDQVMYYKESADGQ
FT                   LLQEGINEAGAMSSWMAAATSYSTNNRIMVPFYIYYSMFGFQRVGDLAWAAGDMQARGF
FT                   LLGGTAGRTTLNGEGLQHEDGHSHLLASTIPNCVSYDPTFAHELAVIIQHGLKRMVEDQ
FT                   ENVYYYLTVMNENYPQPGLTAGDEEGIIRGMYKLKSHGKGKQRVQLMGSGTILCEVMAA
FT                   QELLEADWGVASDIWSVTSFTELRRDGLDAERHNLLHPEGKQQVPYVTTQLAKSDGPII
FT                   ASTDYMKLFADQIRPFVPKDRTYKVLGTDGFGRSDFRYKLREHFEVDRHFVVLASLRAL
FT                   ADEGKIPAAKVAEAIKKYGINPNKANPHHA"
FT   misc_feature    340682..340783
FT                   /note="HMMPfam hit to PF00456, Transketolase, thiamine
FT                   diphosphate binding domain"
FT   CDS_pept        342284..343945
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="BP0994"
FT                   /product="dihydrolipoamide acetyltransferase component of
FT                   pyruvate dehydrogenase complex"
FT                   /EC_number="2.3.1.12"
FT                   /note="Similar to Escherichia coli dihydrolipoamide
FT                   acetyltransferase component of pyruvate dehydrogenase
FT                   complex AceF or B0115 SW:ODP2_ECOLI (P06959) (629 aa) fasta
FT                   scores: E(): 1.9e-69, 56.835% id in 556 aa, and to
FT                   Alcaligenes eutrophus dihydrolipoamide acetyltransferase
FT                   component of pyruvate dehydrogenase complex PdhB
FT                   SW:ODP2_ALCEU (Q59098) (553 aa) fasta scores: E(): 1.2e-81,
FT                   63.636% id in 572 aa"
FT                   /db_xref="GOA:Q7VZC4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZC4"
FT                   /protein_id="CAE41295.1"
FT                   /translation="MSNIVEIKVPDIGDFKEVEVIEVLVSAGDTIKAEQSLITVESDKA
FT                   SMEIPASAAGVVKSVKVKVGDKIAEGTVILEVEAAGEAAAAPKAEAPKAEAPKAEQAAE
FT                   TPKADAAKAEAPQAQAAQAEAPAAAGPIEVKVPDIGDFKEVEVIEVLVAEGDTIKAEQS
FT                   LITVESDKASMEIPASAGGVVQSLKVKVGDKVAMGTVIAVVQGQGAAAAPAAAEPAAPA
FT                   SPVAPASAPAQRPAPAAALQDEDLKPGQLPHASPSVRKFARELGVNLSRVTGSAAKGRI
FT                   TADDVRAYVKQALSAGAPAGASGGGDGAALGLLPWPKIDFTKFGPIEAKPLSRIKKISG
FT                   ANLHRNWVMIPHVTNNDEADITDLEALRVALNKENEKSGVKVTMLAFLIKAVVAALKKF
FT                   PEFNASLDGDNLVLKQYYHIGFAADTPNGLVVPVVRDADKKGILELARETSELARKARE
FT                   GKASPAEMQGGCFSISSLGGIGGTHFTPIINAPEVAILGVSRSAHKPVWDGKQFVPRLT
FT                   LPLSLSYDHRVIDGASAARFNAYLGQLLVDFRRIAL"
FT   misc_feature    342296..342514
FT                   /note="HMMPfam hit to PF00364, Biotin-requiring enzyme"
FT   misc_feature    342365..342454
FT                   /note="ScanRegExp hit to PS00189, 2-oxo acid dehydrogenases
FT                   acyltransferase component lipoyl binding site. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   misc_feature    342677..342895
FT                   /note="HMMPfam hit to PF00364, Biotin-requiring enzyme"
FT   misc_feature    342746..342835
FT                   /note="ScanRegExp hit to PS00189, 2-oxo acid dehydrogenases
FT                   acyltransferase component lipoyl binding site. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   misc_feature    343289..343942
FT                   /note="HMMPfam hit to PF00198, 2-oxo acid dehydrogenases
FT                   acyltransferase (catalytic domain)"
FT   CDS_pept        343958..345748
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /gene_synonym="lpd"
FT                   /locus_tag="BP0995"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="Similar to Escherichia coli dihydrolipoamide
FT                   dehydrogenase LpdA or Lpd or B0116 or Z0126 or ecs0120
FT                   SW:DLDH_ECOLI (P00391) (473 aa) fasta scores: E(): 7.8e-97,
FT                   63.713% id in 474 aa, and to Alcaligenes eutrophus
FT                   dihydrolipoamide dehydrogenase PdhL TR:Q59099 (EMBL:U09865)
FT                   (594 aa) fasta scores: E(): 4.8e-147, 75.541% id in 601 aa"
FT                   /db_xref="GOA:Q7VZC3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZC3"
FT                   /protein_id="CAE41296.1"
FT                   /translation="MSNIVEIKVPDIGDFKEVEVIEVLVAAGDTIKAEQSLITVESDKA
FT                   SMEIPASSAGVVKSVKVKVGDKVAEGTVILDVEAAGEAAAAPKAEAPKAEAPKAEAPKA
FT                   DAPKAPAAKASAPAAAAYSGSADLECDMLVLGAGPGGYSAAFRAADLGMDTVMVERYAT
FT                   LGGVCLNVGCIPSKALLHNAAVIDEARALAAHGISFGEPKVDLDKLRGYKDSVVAKLTG
FT                   GLAGMARARKVRVVTGTGEFADPHHLTVTDGEGKKQTIRFKQAIIAAGSQSVKLPFLPD
FT                   DERIVDSTGALQLRAIPKKMLIVGGGIIGLEMGTVYSTLGARLDVVEMLDGLMQGADRD
FT                   LVKVWQKMNAPRFDNIMLKTKTVGAEARKDGIYVSFEGEGAPKEPQRYDLVLQAVGRSP
FT                   NGKKIGAERAGVAVTERGFIEVDRQMRTNVPHIYAIGDVVGQPMLAHKAVHEGHVAAEA
FT                   AHGEKSYFDARVIPSVAYTDPEVAWVGLTEDEAKKQGVKVEKGLFPWAASGRAIANGRD
FT                   EGFTKLLFDAETHRIVGGGIVGTHAGDLISEIALAIEMGADMVDIGKTIHPHPTLGESV
FT                   GMAAEVAEGVCTDLPPMRKK"
FT   misc_feature    343970..344188
FT                   /note="HMMPfam hit to PF00364, Biotin-requiring enzyme"
FT   misc_feature    344039..344128
FT                   /note="ScanRegExp hit to PS00189, 2-oxo acid dehydrogenases
FT                   acyltransferase component lipoyl binding site. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   misc_feature    344351..345271
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT   misc_feature    344450..344482
FT                   /note="ScanRegExp hit to PS00076, Pyridine
FT                   nucleotide-disulphide oxidoreductases class-I active site.
FT                   Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        complement(345970..347145)
FT                   /transl_table=11
FT                   /gene="flaA"
FT                   /locus_tag="BP0996"
FT                   /product="flagellin"
FT                   /note="Identical to Bordetella bronchiseptica flagellin
FT                   FlaA SW:FLAA_BORBR (Q06064) (390 aa) fasta scores: E():
FT                   4.1e-116, 97.949% id in 390 aa, and similar to Salmonella
FT                   typhimurium flagellin TR:Q9R4Q7 (EMBL:UNKNOWN ACCESSION)
FT                   (397 aa) fasta scores: E(): 5.5e-57, 55.309% id in 405 aa"
FT                   /db_xref="GOA:Q7VZC2"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZC2"
FT                   /protein_id="CAE41297.1"
FT                   /translation="MAAVINTNYLSLVAQNNLNKSQSALGSAIERLSSGLRINSAKDDA
FT                   AGQAIANRFTANVKGLTQAARNANDGISIAQTTEGALNEINNNLQRIRELTVQASNGTN
FT                   SASDIDSIQQEVNQRLEEINRIAEQTDFNGIKVLKSNATDMTLSIQVGAKDNETIDIKI
FT                   DRNSNWNLYDAVGTVPGGTVNGEARTVNALGFDVLSAVTTTIASDTVTFDAAVAAAEQA
FT                   AGAAAGDGSVVSYGDAANPQYAVVVDNAGTLTSYALTFDKDGKAALGDQLGAVASQAAE
FT                   AAVGVNDVASGDNVTVSGGNANALSKLDDAMKAVDEQRSSLGAIQNRFESTVANLNNTI
FT                   TNLSAARSRIEDSDYATEVSNMTKNQILQQAGTSVLAQANQVPQNVLSLLR"
FT   misc_feature    complement(346039..346254)
FT                   /note="HMMPfam hit to PF00700, Bacterial flagellin
FT                   C-terminus"
FT   misc_feature    complement(346630..347061)
FT                   /note="HMMPfam hit to PF00669, Bacterial flagellin
FT                   N-terminus"
FT   CDS_pept        complement(347188..348138)
FT                   /transl_table=11
FT                   /locus_tag="BP0997"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTC0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTC0"
FT                   /protein_id="CAE41298.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHN"
FT   repeat_region   347188..347219
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(347188..348240)
FT   misc_feature    complement(347224..347757)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(347815..347880)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   repeat_region   complement(348209..348240)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(348237..348977)
FT                   /transl_table=11
FT                   /locus_tag="BP0998"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa0419 TR:Q9I694 (EMBL:AE004479) (240 aa) fasta
FT                   scores: E(): 6.3e-33, 44.672% id in 244 aa, and to Xylella
FT                   fastidiosa hypothetical protein Xf0190 TR:Q9PGV8
FT                   (EMBL:AE003872) (244 aa) fasta scores: E(): 2.9e-28,
FT                   40.984% id in 244 aa"
FT                   /db_xref="GOA:Q7VZC1"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VZC1"
FT                   /protein_id="CAE41299.1"
FT                   /translation="MSLPRFYCDARLAPGECVALPEALAHHAVRVLRLRAGAALVLFDG
FT                   AGGEYPATLEIEGKAAWAQLGAHVPREAELPGRITLVQGLPAGDKMDWVVEKAVELGAW
FT                   RVSPIAAQRSVLQLNGARAEKRLAHWQRIAQAAAEQCGRNRLMAVDAPQALAAWLAQAP
FT                   GAALRLLCHPEAELDLAGALARHAAHDDICLLVGPEGGWSDEELEQARAAGVQAVRFGP
FT                   RVLRTETAGIALIAAVSAIRGWNG"
XX
SQ   Sequence 349028 BP; 56117 A; 115139 C; 120074 G; 57698 T; 0 other;
     tgcgcgcgcc agaccccgcc ttcgcggcgg gcgttcgtgc gccgggcgtc cgcttgtgtc        60
     cattctttcc tgataccgaa cgcccatgaa accgtccatg cgcagccgac tcgagcagtt       120
     ggcccaccgt ctcatcgaag tcgacgcctt gctggccgag ccggaaacgg cggccgatat       180
     ggaccgtttt cgcaagctgt cgcgcgagcg cgccgagctg gagccggtcg tcgaggcgtt       240
     caatgcgttc ctgggcgtcg aggccgatgt ggccaccgcg caggagatgc tgtccgatcc       300
     cgacatgaag gccatggccg aggacgagat caagaccggc cgcgcgcgca tcgaggagat       360
     ggaggcggcg ctgcagttgc tgctgctgcc gcgcgacccc gacgatggcc gcagcctgtt       420
     cctggaaatc cgtgccggca cgggcggcga cgaaagcgcg ctgttctccg gcgacctgct       480
     gcgcatgtat acgcgctacg cggaaacgcg gggttggcgc gtggagatca tgtcggagag       540
     cgagtcggag ctgggcggct acaaggaagt gatcgcgcgc atcgatggcg acggcgccta       600
     tggccggctg aagttcgagt ccggcgcgca tcgcgtgcag cgcgtgccgg ccaccgaggc       660
     gcagggccgc atccatacct cggcatgcac ggtggcggtg atgcccgagg ccgacgcgat       720
     gtccgacatc gtgatcaacc ccagcgatct gcgcatcgat acgttccgcg ccagcggggc       780
     gggcgggcag cacatcaaca agaccgattc ggcggtgcgc atcacgcacg tgccgaccgg       840
     cctggtggtg gagtgccagg acgaccgctc gcagcatcgc aacaaggaca aggccatgca       900
     ggtgctggcc gcgcgcctga aggacaagga aatgcgcgaa cgccagagca aggaggccgc       960
     cgagcgcaag agcctgatcg gctcgggcga ccgctccgag cgcatccgca cctataacta      1020
     tccgcagggc cgcgtgaccg accatcgcat caacctgacg ctgtacaagc tgcagcagat      1080
     catggaaggc gacctggacg agctgaccgg cgcgctgctg gccgagcacc aggccgagca      1140
     actggcggcg ctgggccacg atctgtgatg cgcgggcgat gaccttgctc aaggacctgc      1200
     tggccgaccc gggcctgccc cggctggagg cgcgcatgct cgccgagcac gtgctgggcc      1260
     gctcgcgcgc ctggctgctg gcgcacgata ccgacccggt cgagcccgcg cacgaggcgg      1320
     cctggcggca gctggcggcg cgccgcctgg ctggcgagcc catggcctat ctgctgggcg      1380
     ggcgcgagtt catggggcat tggtacgcgc tgacgccgga tgtgctgatt ccgcgcccgg      1440
     ataccgagct gctggtggag acggcgctgc attggctgca aggccgcgct gcgccgcgcg      1500
     tgctggacct gggcaccggc agcggcgcca tcgccgtgtc ggtggcgctg ggttgcccgc      1560
     aggccgaggt gacggccacc gacctgagcg cggccgcgct ggcggtggcc gagggtaacg      1620
     cgcagcggct gggcgcgcgg gtgcgctgcc tggcgggcga ctggtacgag gccttgccgg      1680
     cgcaggaccg ctacgacctg atcgtctcca accctcccta tatcgcgcgc gaggacgcgc      1740
     atctggcgca gggcgacctg cgtttcgagc cgcgcggcgc gctgaccgac gaaaacgatg      1800
     ggctggcggc gctggcgcgc atcgccggcg gggcgcccgg gcgccttctg cctggcggcg      1860
     ccatctggat ggaacacggc tgggaccagg ccgaggcggc acgggcgctg ctgcgccagg      1920
     ccgggctgcg cgaggtgcac agccggcgcg atctggccgg gatcgagcgg atttccggtg      1980
     gatacctata attgagctgt tgagctactt ccctttgcga gccccctatg agcgacgtgc      2040
     aagaatttat ccgcgaaacc gtgacgcagc accccgtcgt gctgttcatg aagggcacta      2100
     cccagtttcc gcaatgcggc ttttcgggcc gcgccatcca gatcctgaaa ggctgcggcg      2160
     tcaagaagct ggtgaccgtc aatgtgctgg aagacgacga agtccgccag gccatcaaga      2220
     cgttttccaa ctggccgacg attccgcagc tgtacgtcgg cggcgaattc atcggcggtt      2280
     cggacatcat gtccgagatg aacgaaagcg gcgagctcaa gcagctgctc gatgactccg      2340
     gcgcgacggc ctgagtccat gcggcggctg gtcgtcggca tcacgggcgc caccggcgcc      2400
     atctacgccg tgcgcctgct gcaggcgctg cgtggcgtgt ccgacgtcga gtcgcacctg      2460
     atcgtgtcgg cctcgggcgt gctcaatatc aagcacgaac tggacgtggg ccggcacgat      2520
     gtccaggcgc tggccgacca cgtgcacagc gtgcgcgatg tcggcgccac gctggccagc      2580
     ggcgcgttcc agaccgccgg catggtgatc gtgccgtgct cgatgcgcac gctggcggcc      2640
     gtggcgcacg gcctgtccga taatctcatc acccgcgccg ccgacgtcac gctcaaggag      2700
     cgccgccggc tggtcatgat ggtgcgcgaa acgccgttca acctggccca cttgcgcaat      2760
     atgaccgccg tcaccgaaat gggcggcatc atctttccgc cgctgcccgc gttctaccat      2820
     cgcccggcct ccatcgaaga aatggtcgac cacaccgtgg cgcgcgtgct cgaactgttc      2880
     gacatcgaag tgcccggccc gcactgggcc ggcatgtagc gcatccgcct tcgcctgcct      2940
     gtacctgaag cctgccccga tggggcaggc ttctttgcgt acggccgcag gcagccgcgg      3000
     cagggaatcc cccgatattg acaccggaca attattcagt actatgcgca attaactcag      3060
     tgtactaagt agaagcatag aagcaccaag gctgtttgtt gttccggtca agatccagcc      3120
     gcccgcattc tgcgggcggt ggccacaagg ggaatacaga tgcaacgccg tagttttcta      3180
     gccaaagtcg cccacatcgc cgccgctgtc ggcgtcagcg cctgtgccgc gaccagttcc      3240
     ttcgccgcca ccggcgactt cccgaacaag ccgctcgaca tcatcgtcac ctttccgcct      3300
     ggcgggggga ccgacatgct ggcgcgtttg atcggcaact atctcaccga gagcctgggg      3360
     cagaccgcgg tggtcgagaa ccggccgggc gccagcggca acgtgggcgc gcgcctggtg      3420
     gccgaccgtg cgccggacgg ctactcgctg ctgatggtca acagctcgtt cgccgtcaat      3480
     ccgggcgtgt tccgcaatct gccgttcgac ccgaagaagg acttcgccgc cgtcatcaat      3540
     gtggcctatg tgccgtcggt gttcgtggtg ccggccggtt ccaagtacaa gacgctgggt      3600
     gagctgatgg ccgcggccaa gcagaccaac acccaggtca cctacggctc gtgcggcaac      3660
     ggcacgccgc agcatctggc cggcgagctg ctcaacgtca gcgccaagac gcatatggtg      3720
     cacgtgccgt acaagggttg cggaccggcg ctcaacgacg tgctgggcag ccagatcggc      3780
     ctggccgtgg tgaccgcctc gagcgcgatt cccttcatca aggcaggcaa gctgcaggcc      3840
     ctggcggtga cctccaagga gcgctcggcg ctgctgcccg aggtgcccac ggtggccgag      3900
     cagggcgtgg ccgggtacga gctgaaccag tggcacggcc tgctggtgcc gggcgccacg      3960
     ccgatggcgg tgcgccagaa gctgtacgac ggcatcgcca aggtgatgca gcgcgatgac      4020
     gtgcagaaga aactggccga cctgggctac agcaccgcca gcgacggccc ggaagtgttc      4080
     cagaaaatgg tggaaaccga tatcgaccgc ttttcggcgc tgaccaagca gatcggcctg      4140
     aaagtggact gacccctggg agatgcaagc atgagcagca aactgaagat cagcctttcc      4200
     tgcggcgact acgatcgcac gcgcgccttg ttcgacgggc gcgcgcccat cgagggctgc      4260
     gaggtcacgg ccgtgccgct ggagccggag gaggcgtttc atcgggcctt ccgctaccac      4320
     gagtacgacg tcaccgagat ctcgatgagc agtcatatga tgaccacggc tcgcggcgac      4380
     aacgaataca tcgccattcc ggcgttcctg tcgcgcgtgt tccgccattc gggcatttat      4440
     gtgcgcacgg accgcgacat cgacaagccg caggacctgc gcggcaagac catcggcgtg      4500
     cccgagtacc agatcaccgc caacgtgtgg atccgcggca tcctggaaga cgcctatggc      4560
     gtcaagccgc aagacatcaa gtggcgccgg ggcggcatcg aagagccggg ccgcggcgag      4620
     cgggcgccga tcgagctgcc cgacggtatc gacctgcagc agattcccga cgacaagacg      4680
     ctgtcggaca tgctggaggc gggcgagatc gatggctata tcggtgcgcg ggctccctcg      4740
     tgctttctgc gcggcgcgcc caacgtgggg cgcctgttca acgactacct gaagaccgag      4800
     caggattact tccgcgagac ccgcatcttc cccatcatgc atatggtggg catccgcagg      4860
     tccctggtcg agcagaatcc ctggctgccg gtcagcgtct acaaggcctt cctcaaggcc      4920
     aagatgctgg cggtcaagga gctcaacgag atctgccacc tggcggtgac gctgccttgg      4980
     atggtgcacc actacaacgc ggcgcgcgaa ctgatgggcg acgattactg gccgtacggg      5040
     ctggatgcca atcgccatgt gatagagacc ttcgcgcgct atcactacgg ccagggcctg      5100
     tcgcgccgcc tggtcaagcc cgaggagctg ttcgcggcct cttcgctgga cttgtccaag      5160
     atctgagagg ctgtccgaac catgaaagcg ccggccttgc agtatcacgc gcctgcttcg      5220
     ttgccgcagg ccctgcagtt gctcagcgag cacgacaatg cgcgcgtgct ggccggcggc      5280
     cagtcgctgg tggcgatgct gaacatgcgg ttcgcgttcc cggactgcct gatcgacatc      5340
     aaccgggttc ccgagctggc gtacatccgc cacgagcagg gcgcggtctg cattggcgcg      5400
     atgacgcgcc agcgcgagat cgagttctcg ccgctggtgg cgcagcattt gccgctgtgg      5460
     cgcgaggcgg cgctgcaggt cggccatcgc cagacccgta accgcggcac ggtgggcggc      5520
     agcctgtgcc agctggatcc gtcggcggag atcccgaccg tggcgctggc catggacgcg      5580
     accctgtcgg tggccagcgt acgcggcacg cgcaccctgg cgatggcgga ttttccggcc      5640
     ggctacatga cgccggcgct cgaacccgat gaaatgctgg tcggcctggc ggtgacgcca      5700
     tggccggccg gccatggcca tgccttcgtg gagttcgcgc gccgccatgg cgatttcgcc      5760
     attgtgtcgg tggcggtgct gctgctgctc gacgacgccg gctgcgtggc gcgcgcctcg      5820
     atcaccctag gcggggtggc ggccacgccc gtgcgcatgg cgcaggccga agccgcgctg      5880
     ctggggcagc cggccgagcc cgccacgctg gcgcgggcgg cggcgctgtg cgccgccatc      5940
     gacgccaagg ccgacagttt atgtgccgtc gtggtaccgc cagcggctgg cgcgcgtgtt      6000
     gaccgagcgc gccctcacgc aggcggtggc gcgcgccaag gaaagcgaat gagcgatatc      6060
     accgaatcca ccgcgcagca cgtttcgttg acggtcaacg ggcgcgcatg cggcggttgc      6120
     gccgagccgc gcatgcatct ggccgatttc ctgcgcggcg agctggggct gaccggcacg      6180
     cacatcggtt gcgagcacgg ggtgtgcggc gcctgtaccg tgctggtcga tggctattcg      6240
     acgcgcagtt gcctgatgct ggcggtgcag gcgcaggaca gccggatcga taccatcgag      6300
     ggactggccg gcgaagacga cgcgttgcat ccgatccagc aggcgttcca tgaactgcat      6360
     gcgctgcaat gcggttattg cacgccgggc atcctgatgt cggtggccga gctgctggcg      6420
     gccaacccta atcccgatga ggcgcaggtg cgcgacgtgc tctcgggcca cctgtgccgc      6480
     tgcaccgggt atcagaacat cgtggccgcg gtgctgcgcg cggcgcagct gatgcgcgcg      6540
     gaggccggtc atgactgatg cgacaagccc cggactgggc cgcagcgcgc cccgtatcga      6600
     ggacgatgcg ctgctgcgcg gccaggcgcg cttcctggac gatatcgagg tcgagggcgt      6660
     gctgcatgcc tgcttcgtgc gtagcccgca tgcccatgcg cgccttgtct cgatcgacct      6720
     gtcggccgcc cgcgcggtgc cgggcgtggc cgcggtctat ggggcgcgcg acctgttcgg      6780
     ccagttgacg tcctggcgca tgccgctggg gttcccgctg gcggcgctgc ccgatgacac      6840
     gacgccgttc gtgctggccg agcgcgaggt ggcgttcgtc ggcgaggcca tcgcggtggt      6900
     ggtggccgac agccgccaca tcgccgagga cgcggcggcg cgggtggcga tcgaatatga      6960
     agtgctgggc gcggtggtgg attgccgcga tgcgttgcgg cccgatgcgc cgctggtgcg      7020
     cggcgagctc gcgtcgaaca ttctgcagca gtacacgctg gcctatggcg actgcgagac      7080
     ggctttcgcg caggcgcacc gggtgctgga agacgatttc tgggtgcatc ggggctgcgc      7140
     gcatcccatg gaagggcgcg gcgtgctggc gcgcatggac cgcgccaccg acacgctgac      7200
     cgtgtggtcc tcgacccaga tggcccacga actgcattac acgctggccc tgatgctggg      7260
     ccagcccgag gaccgcctgc gcgtggtgac gcccgacgtg ggcggcgggt tcggcgccaa      7320
     gttcatgatt tatcccgagg aaatggcgat tcccgccgcc gcgcgcaagc tgggccgccc      7380
     ggtcaagtgg gtggaggacc ggcgcgagca tttcacgacc tcgatccagg agcgcgacca      7440
     gtactggaag gtggcgatgg ccatcgacga ccagggccat gtgctcggca tacgcggcaa      7500
     cttcgtgcac gacaacggcg cgtatacgcc gcagggcacc aatgtgccgt acaacgccgc      7560
     ctcgtccatg accggcccct acgtggtgcc ggcgttctcg ctcgatgtga gcgtggccta      7620
     taccaacaag gtgccggtgg ccacggtgcg cggcgcggga tatccgcagg cggccttcgt      7680
     catggagcgc atgatggaca gggtggcggc cgagttgggc atcgacccgg gcgaatgccg      7740
     ccgccgcaac ctgatcggcc cggccaagat tccctacacc aagccgttga agtcgcgcgc      7800
     gggaatgccg ctgaccatag acagcggcga ttttcccgcc ctgcaggcat gcgcgctgca      7860
     ggcgtccgat tatgacggct tcgcggtgcg gcgcgatgcg gccctggcgc gcggccgctg      7920
     gcgcggcatc gcggtggcca acagcgtcga gcccaccggg cgcggcccgt tcgaggtggc      7980
     gcgcgtgcgc gtccagccgt cgggccaggt gtcgatctac accggcgccc tggccatggg      8040
     ccagggcatc aagacgacgc tggcgcagat ctgcgccggg cacctgggcg tgccggtcgc      8100
     ggcggtcgag gtgcaggccg gcgataccgc ctacgtgggc tacggcatgg gcggtttcgc      8160
     cagccgccag gccatcatgg ccggttcggc ggtcgaccag gccgccgccc aggtgcggcg      8220
     gcaggcgctg gagacggcgg cggcggtgct caaggccgag gccgaaacgc tggaactggc      8280
     cgatggcgaa gtgcgcgcgc ccgacggaca gtcggtgtcg ctggcgcggc ttgccatgct      8340
     gcgcaaaggg gtgccgggct atgcgctggt cagcccgggc gatcccgggc tggacgccac      8400
     cgcgtacttc cactgcgacg cgcagaccta cgccggcgcc tcgcatgtat gcgaggtcga      8460
     ggtcgacccc gccaccgggg ccatagagat cgtgcgctat gtggcggcgc aggacagcgg      8520
     ccgcatcatc aatccgcagc tggccgaggg ccaggtgcac ggcggggtcg tgcacggcat      8580
     cggcaatgcc ttgttcgagt ggatgggcta tgacgccgcc ggccagcccc tgagcactac      8640
     gtttgccgaa tacctgctgc ccaccgcgcc ggaagtgccg cccatcgagg tggtgttcca      8700
     gccctctccc acccccttga acccgctggg cgtcaagggc gtgggagagt gcgccaccat      8760
     tccggtggcc gtggccgtgg tcggcgccgt ggagcacgcc gtggcccatt gcggggtgcg      8820
     cgtgaccgag tttccgctta cgccggtgcg actgctggag ctgctgacgc aggccgaagc      8880
     gcgcgccgcc gcgcctactg attcagggga gtttgtcgat ggagttcact aacaccttcc      8940
     atgtgtcctt gccgctggac gaggcatggc agttgatgct ggatgtgccg cgcatcatgc      9000
     cctgcctgcc cggcgcgcgc ctgaccgaag tgctgggtcc ggacaaatac cagggttcgg      9060
     tgacggtgcg cctggggccg atcaagctgg gcttcgaagg ccaggccgaa ctggtgcgca      9120
     aggacgaagc cacgcacact gcctggctgc agggctcggg catggatccg aaggggcgcg      9180
     gctcggccaa gtccgagttc agcttcgcgt tgacgccggc cgcccatggc ggcacggacg      9240
     tcacggtcaa tacccagctg gcgctgtcgg gggcggtggc gcaatatggg cgcggcagcg      9300
     gcatgatcgc ggaagtggcc gcgcagatcc tgggatagtt cgagcagaac ctggcgcgct      9360
     cgctcagcgg cgaggcgcag caggacccgg cgcaaccggc tggcgccatg cctgcgcggc      9420
     ccgggtccgc ggcgcctgta gccgcggccg cgcccgcggg cagcgtggtc agcccggatg      9480
     cgcaggctgt gttgctgcag gcgcaggccg tgctgagcca ggcgcaggcc gtgctggcca      9540
     tggctcaggc cagcctggcg cgcccggccg gcggcgcgcc gtcgcgggcc gccgcgccca      9600
     gcgccgagct caacatgctg ggcataggca tgcgcgccat gtgggcgcgc gtccgctata      9660
     ccgtgggggg ctggttcgga aggcgggaga gctgaccgca cgggcgcccg ccccgttccg      9720
     atacgcgagg cgcctgtccc gcatgggaac tggcgtctgt ccgtgcagtg tgcctgtccc      9780
     cgctgggaca ggcacactgc tagctgtgaa ctgtcaatag gttgtattcg tccaggttga      9840
     gtctggagat gggtacagcg cgcccgatgc cttggtgggg tcgatgccag ttgtagtggt      9900
     gtagccagga tttcatggca tcggctcggt gttgggagtt ctggtaggtg tgagcgtaag      9960
     cccactcacg caaggccgac tggatgaagc gttcggcctt gccattggtc tgtgggcggt     10020
     aaggtcgggt aaagcggtgc ttgatgccca gctcatggca cagcgcggcg aaggcgcggc     10080
     tgcgaaaggc cgagccattg tcggtgagca agcgctggat ggtcacgccc aggcgctggt     10140
     agtaggccac tgcgtccttg aggaactgga cggcgctggg gaagcgctcg tcggggtgga     10200
     tgtcggtgaa ggccacgcgg gcgtggtcat cgatggccac gaagacgaag tcccagccgg     10260
     ccccctcaac ggtatcgcgt cggttgcccg tgacccggtg gccagggcgc tggatacgtc     10320
     ccagcttctt gatgtcgatg tgcagcagat cgccgggggc ctgatgctcg tagcgcacca     10380
     ccggctcggc cggctccagg tcggccaggt gcgacagacc ggcgcgggcc aggacgcggc     10440
     tgacggtgct ggctgacacg cccagcgcct gggcgatgcg cgcttgggtc agccgcttgc     10500
     ggcgcagctc cacgatagcc agcgccttgg ccggcgcaat cgctcggggc gagaccgtcg     10560
     ggcgcgagga cgcatcggcc aagcccgcct ggccctgagc caggaagcgg cccagccatt     10620
     tgcgcacagt cggcgcggtg accccatagg cgcgggccgc ttcaggcaca caaacttgat     10680
     gggcgatcaa ttgctggacc atttcgagtc gacgtaggaa ggtcaatcgg gcatgcttat     10740
     gggtgttcat ccggccgggc tccttgagtg aactgggggg gtggcgattt ccagtttctc     10800
     aaatccggtt cggatgaacc atgcatacaa cctattgaat cttcacacct agggcgtggc     10860
     gctgagactg ggcaggatgc cggtgcggtc ggccaccggc tgcaccgcgc ccagcgccgc     10920
     ttcgcgcgtg gcgtaggggc cgatgcgtac gcggtacagg ttgttggcct gctcgaccac     10980
     cgccggcgga atgccgctgg ccggatccag ttgcccgttg atgcggctga ccagcgattc     11040
     ggcgttggcc ggctggctga aggcgcccag ttgcaggtag acgccgctgc ccgcgcccgc     11100
     ggccgggcgc ggcggcgtcg gcgcgttcga ggcgagctgg gtcgcggggt gcagctcgac     11160
     ggcggcggcc gcgctgggcg cggcaacggg cagcggcccg gtggccgagg cgggcccggg     11220
     ccgtggcgcc gccgcgccgc cattcatcgc gaggatctcg gcaggcagga tgcgctcgac     11280
     ggtgacgggc ccgctgcccg ggccgatgat gcccagcttg tgggccgcca cataggacag     11340
     gtccatgatg cggtcgctgt ggaacggtcc gcggtcattg acccgcacga tgaccgtgcg     11400
     cccgttgatc ttgctggtga cgcgcgcgta gctgggaatc ggcatcgtcg gatgcgccgc     11460
     cgtcatggcg tacatgtcgt acgactcgcc gttggaggtc gagttaccat ggaacttctt     11520
     gccgtaccag gaggccaggc cctgctggcg gaacgggcgt tcgctggtgt cgggcacata     11580
     gcgcttgccg aacaccacat agggccggtt cgggccgctg gccagcggtt cgaggcgcgg     11640
     cgtcgcgtcg ggcacgttgt cgaggttgga cggcgggttg gcgtcggggc cgtcgtcctt     11700
     gtagtagccg ccgcgtttct tgcctggcgt ggagcagcct gcgatggcca gcgccagcag     11760
     cagtgtcgac aggagggcaa gcggacgcga acggatcatg cggggtcgtc gggcagttgg     11820
     gtgcggtggc gcaccagcag cgggtcgtgg tcggagaagc gccgcgccag ttgctcgacc     11880
     acgtataccg agcggtgctg cccgcccgtg cagccgatgg cgacggtgag gtagttgcgg     11940
     gtgtcctgcg tgtactgggg cagccagcgg cggatgaacg cggcgatatc gtcgatcatc     12000
     tgggtcacga tatcgaagcc gcccagccag gtggccaccg gttcgtcgcg gccggtcagg     12060
     gggcgcaggg tgcggtcgta gtaggggttg ggcaggcagc gcacgtcgaa catcaggtcc     12120
     gcgtcgctgg gcacgccgcg cttgtaggcg aacgattcga aagtcagcac cagcggcggc     12180
     cggtcggcct ggatcaggtc gcggatccag gcgcgcaact ggcccggcgt gagatccgag     12240
     gtgtcgatga cgtgttcctg gtcgcgcagc ggcgccatca gctcgcgttc cagcgcgatg     12300
     cactcggcca gcgacggggt cttgccgccg cgcgccaggc ggtcggtcag cgggtggcgg     12360
     cgccgcgact cggaatagcg ctgcaccagc gtgtcggtgt tggcgtcgag gaagatcacg     12420
     ctcaggctgg tgcccatggc gcgcgaggcg gtgatgacat cgggcagttc ggccagctcg     12480
     ccgggtgagc gcacgtcgat ggcgacggcg acccgttcca tggcgtcatc gcgggcattg     12540
     gcgatgaatt cggccagaaa gcgcaccggc aggttgtcga tgcaggtgaa tcccgcatct     12600
     tcgagcaggc gcagggcgac cgacttgccg gagccggaaa tgccggtaat aaggacgact     12660
     ctcaacatgg ctgtgattgt ggcatggaat tcgatcgccc gtgcgcgccg gccggcatct     12720
     gctatggtct cggctgccgg atctgcgcct gtcccgatgg cgggcaggcg ggtatcctgg     12780
     cagtcggcca agcggccgac gttccggcgg gccgggcccg cgtcaacttc gacagtccga     12840
     tgttagcctt caaatccgat ttgcgtattg caatgcgagc ctggcgcgcc gcgtgtggcg     12900
     tgctggccgc agccgcgggc atgctggcga tgtcccaggc cgtggcccag agcgaggccg     12960
     cgctgcggcc cgacaccatg gccgcccggg tcgccgcctg tacggcctgc catggcgaac     13020
     agggccgcgc cggccccgac ggctactatc cgcgcctggc gggcaagccg caggattatc     13080
     tgtaccacca gttgctgaat tttcgcgatg cccggcgcca gtatccgccc atggcgcatc     13140
     tgctcaacgg cctgcccgat gcgtatctgc gcgagatggc ggtatacttc gccggccagg     13200
     acgtgcccta tccgccgccg gcgcgcgtcg aagcctcggc cgccctggtc gagcgcggcc     13260
     gcttgctggt gcgcgagggc gacccggccc gcgctatccc ttcctgtgcg tcctgccatg     13320
     gcgcatcgct ggccggcgtc gcgccggcca tcccgggcct gctcggcctg ccgcgcgatt     13380
     acctcgtggc gcagatcggc agctggcaga acggcctgcg gcgcgccgcc gagcccgact     13440
     gcatggcgca ggtctcgctc aagctgacgc ccgaggatat cggcgcggtg tcggcctggc     13500
     tggccagccg gtgggacatc cgtacacgcc gcaaccggcc ggctcgctga cgctgccgct     13560
     ggagtgcggc agccaggcgg ggcattgagg aggcggccat gaagatcatc aagcgcgtcc     13620
     tcgtcgtcgc catcctggcc ctgctggccg ccgtcgccac cctgtattgg ctgggcaccc     13680
     gcgaccacgt gcccgccggc ccgcaagccg cgccggccac cggatcagcc gacgagctgg     13740
     tcgagcaagg gcgctacctg gcgcgggccg gcaattgcat ggcctgccac accgcgcgcg     13800
     gcgggcaggc ctacgcgggc ggcacgccca ttcccacgcc gttcggcacc ttgtatggac     13860
     cgaacatcac gcccgacgcc gaaaccggca tcggcggctg gagcgccgac gatttctggc     13920
     aggtattgca caacggcaaa ggccccggcg gacggctgct gtacccggcc tttccgtaca     13980
     ccgaatacac ccgcatgacg cgcgccgacg ccgatgcgct gtacgccttc ctgcgcacgg     14040
     tcgagccggt gcgccaggcc agtcgcccgc acgagctggc gtcgccgtac gaccagcgcc     14100
     tgctgctggc ggcgtggcgg gcgctgtatt tcgagccggg cgggccgcag gccgatcccg     14160
     ggcagtcgct gcagtggaat cgcgggcgct acctgaccga agggctgggc cactgcgcgg     14220
     cctgccatac gccgcgcaac agcctggggg ccacccgcgc cgccgaggcg ctgggcggag     14280
     gcatgatcga cgggctgggc tggtacgcgc cgccgctgac cggccagccg ggcaccggcc     14340
     tgggcgactg gagcgcgcag gacatcgccg cgctgctgac gaccggcatc gcgccgcact     14400
     cgaccgtggc cggccccatg gccgaagtgg tgctgggcag cacgcagtat ctcagcggcg     14460
     acgacgcgct ggccatcggc acctacctca agtccttgcc ggcggcggcg tcgccgcccg     14520
     ccaggcgcgg cgccccgtcc gcgacggtga tggagctggg cggcaagctg tacggccagc     14580
     attgcgcgca gtgccaccag gccgacggca agggcagttt ccccgcctgg cccgcgctgg     14640
     ccggcaaccc cagcgtcatc gcggccgaac cggccaacgt gatacgcatg gtgctcgatg     14700
     gcggcttcgc gccagcgacc gcggccaacc cgcgcccgca tggcatgccg ccgttcgcgc     14760
     aggcgctgcc ggacaacgac atcgccatgc tggtttcgta cgtgcgcaac agctggggca     14820
     accaggccgg cgcggtcacg ccgctggacg tgaaacgcac gcgggagagc ggagcggggc     14880
     ggtagggcgg ggttcggtgt gggtgccagt ccccgcaagg gggacaggca ccgtggcgtt     14940
     acttgctgct ttgcaggatc gccatggcct ggcgttccat gaattcgccc agcgtgtcga     15000
     tgccgcgcag cttgaggatg gtattgcgta cggcggcttc gaccaggacg gcgagattgc     15060
     ggccggcggc cacttgcagc atgactttgc ggatcggcag gccgagcatg tcctgggtga     15120
     tgtcctgcag cggcaggcgc tcgaacttgt cctgcgcggt ggcccgcacc aggtgcacga     15180
     tcagcttcag gcgcatcttg cggcgcaccg aggtctcgcc gaagatggtg cggatatcga     15240
     gcaggcccag gccgcgcact tccagcaggt tctgcagcag ttgcgggcaa tggccctcga     15300
     tcacgccggg ggcggtgcgc gagagttcga ccgcgtcgtc ggccaccagg ccgtggccgc     15360
     gcgagatcag ttccagcgcc agttcgctct tgcctaggcc cgattcgccg gtgatcagca     15420
     cgcccaggcc cagcacgtcg aggaagacgc cgtgcacggt cgtggtgggc gccagtttct     15480
     tgcccaggta gatgcgcagc aggtcgatca gctgggcggc cgccacgggc gtggacagca     15540
     gcggcacctg gtgctgcgcg cattggtcga tcaggtcttg cggcggcgtc aggccgtctg     15600
     ccagcaggat ggccggcacg ccgccgatca gcagctcgtc catgtggtgc atgcggcggc     15660
     gcaggtcgaa gcgcgtgtag tacgccagtt cttcctggcc gaacacctgg atgcgggacg     15720
     ggtggatcag gttcaggtgg cctaccaggt cggcggcggc catgccgtcg tcggagatgg     15780
     cccggtcggc ggcgtcatgg ccggcgatcc agctgaaggg gattttgtcg gcgttgtcgt     15840
     cgaccagttc ctggaccgta agcatggcaa gtttcgcgtg gcgtcagagt tggccggtgg     15900
     tcagcatgcg gtgcaccgcg gccggatcgg tttcgctggc cagcgcttcg cgcagcggct     15960
     tgttggacat gagctgggcc agttcggcca ggatgtccag gtgctgctgc gtggcggctt     16020
     cgggaacgag cagacagagc agcatggaaa ccggctggcc gtcgggcgcg tcgaagggga     16080
     tgggctgggc caggcggatg aacgcggcca gcgcctggtc caggcccttg acccggccat     16140
     gcggcacggc gacgccctgg cccagcgctg tcgagcccag ccgctcacgc gagaacaggc     16200
     tatcgaacac gaccgagcgg gccaatccgt gatggttttc aaaaagtagg ccggcctgtt     16260
     cgaacgcccg tttcttgctc gtggcgagca tgtcgagcac gacattgccg gcgggtagga     16320
     tgcgcgacaa gtgattcatg cgggtcatta tatggttata tgtcgcagtg caaaaaatcg     16380
     ttgcctttcc tgccctgccg ggactgcgca agcatagtcc gaaccgggca attatgggag     16440
     ggcggacgca tgcatgcaac gcggcatgac gaggaccaat tgagggacag atgggggagt     16500
     ttgcttgccg atgtcccgcg gagtacttcc tgggacatcg gtcgcgataa cggatccggt     16560
     ggtccggatc acgatggggg caagctcacg ctacgagcgt tcgcaaggcg cgggactacg     16620
     gttgctgcgc ggccagcgca gcggcttgtc gctttgcgga ctcggcggag tggctctgaa     16680
     ccttgtcttt gtgcttgatg acctgacggt ctattttgtc gaccagtaga tcgatggctg     16740
     catagaggtt ctcgtcgacg gcttcgcaat ggatatcctt gccgcgcaga cgcatggtga     16800
     tttcggcctt gtgccgcagg ggctctaccg aaagcatgac ctgtgggtat cgataacatg     16860
     atcgaaatgc cgcagcactc gcgccagctt gttcatgaca tattcccgga ttgccagggt     16920
     gacgtcgagg tgacgaccgc agatgctcag gttcatagtc tgctctcctt ccgaaaagag     16980
     aaaaaagggt gcgcatgagc gcgggtaaat ggggggcgtc ctcctgtagg gcaggtggat     17040
     ccgcgtgcgg gatccttgag tactagtgta tagactctat tggccaatac aagttgcgct     17100
     agcgcaagat tgtgtacgtt tgatggcggc cccagagggg cgcgcgcagg gcttagggct     17160
     ttccccgaga ggacgcggcg cagcccccgc ttacatgcgg aaatgctcgc ccagatagac     17220
     gcggcgcacg gccggatcgc cgacgatttc gtcggggtgc ccatcggtga ggaccttgcc     17280
     ttcgctgatg atgtaggcgc ggtcgcagat gcccagggtt tcgcgcacgt tgtggtcggt     17340
     gatcagcacg ccgatgccgc ggcccttcag gaagcgcacg atgcgctgga tctcgatcac     17400
     ggcgatcggg tcgaccccgg cgaagggttc gtcaagcagg atgaagcgcg ggctggtggc     17460
     cagggcgcgc gcgatctcga cccggcgtcg ttcgccgccg gacagcgaaa tggcggtgtt     17520
     ggcgcggata tggccgatct gcagttcttc cagcagggct tcgaggttgt cgcggatcct     17580
     ggcctcgggc agcggcttgc cgttggggcc gagctgcagc tccagcacgg cgcggatgtt     17640
     ctgctccacc gtcaggcggc ggaacaccga ggcgtcctgg ggcaggtacg acaggcccat     17700
     gcgcgcccgc ttgtggatgg gcatggacgt gatgttcgag ccgtcgatct cgatgcgccc     17760
     ggagtcggcc ggaaccaggc cgacgatcat gtagaagctg gtggtcttgc ccgcaccgtt     17820
     gggcccgagc aggcccacca cctcgccgct gaccaccgac agcgagacat cctgcaccac     17880
     ggtgcggccg ttgtaggtct tgcgcagccc ggtggcgcgc aggctgccgg cggcggcgcc     17940
     ggcagcggtg gcggtggaca gagtggcgtg ggagtcggtc atcgtgcaac gtgataggag     18000
     agggaggcgc ggttcactgc ggcttcttgg gcgcttgctt cttggcgcgg cattccgcga     18060
     tcgcggcgtc ggccttggcg cgcggctcgg ccagcgagcg tacgcgcccg cctgcggccg     18120
     atgagttcgg gccgccctgc gcctggtaga tgccggtctt ctcgttgtag cgcacccggt     18180
     cgccgcgaat cgtgtcgaac ggtttgccgc agatgtagcg ggtgacgatg gcctggccga     18240
     tcaggtcgaa ctggctcttg ctgctttcgt attcggcgcg caggcccttg ccctcgatca     18300
     gctcgaaggt ctcgggacgg tcctggcgga tggtgacgat cttgcccttg tcggccgtgg     18360
     cgaccccgaa ctggttgccc gccgcgtcct cgttgacttc cagcttgtcc gaggtcagcg     18420
     tcatcagccc gcgcgtgagg atgacgttgc ccgtgaagat gctctggcgc ttgatgtcgt     18480
     cgtagtgcag cgtgtccgag aggatcagcg tgctcggctc ttcggccggc gcggcctggc     18540
     cggattgcgc ctgcgcctgc gcagcgccgg cagcggccag cagcaggatg ctgcacaacc     18600
     gcagcggggc aagggaaagc ctcaggtggg tcatggtttg ttctggttgg agttggcggg     18660
     cgtctcggtg gattgccgct tgcgcccctc ggttcctgca atttcgacgt cggcggccgc     18720
     cgatacgcgc aattgccggg tcttgttgtt gtaatgcatg ccggtgccgt tcatgcggga     18780
     attgcccttg ttgacctggg cgggcaagtc ggtgaacacc acgtcttcgt cgggcagcag     18840
     gatcagctgc tggctgcgta cgtccagcgt ctcgttgcgg gcgtcgggct gccggtgcac     18900
     gtgcgtgtcg ccgttcatga cgatgcgctg gccgccctgt tccatgatgg cggttttcga     18960
     taccccgatg gtgatcgggt tgccggcctg ttggccgatg gcgcgcggcg tggtcacgtg     19020
     gtaggagtcg tcgtcgggga agtgctcgac atagacgcct tccaggcggt tgatcgggtg     19080
     gccctggacg tcggtgcgca gcatcacgaa atcgcgcgcc cacgagtcca tctcgtgcgt     19140
     cagccggcgc ggcggatcga cctggacggc gcgttgcgca tagtcggccg cccaccacgt     19200
     gccgacgacc agcgccagca gcaggaacaa ggcgatcagc gagggaaagc gttctttcat     19260
     gcctgataac ggttactgga tggcgccggg cccgagcagg gccggcgtgc ccaggaaggt     19320
     gcccaggcgg ccctgggcgg caagcagcag gtcgcagcat tcgcgcaccg cgccctggcc     19380
     gcccggctgg ctggataccc agtgggcggc ttgcgccacg tagcccggcg cattggcgac     19440
     gctggcggcg aagccggcgc gctgcatggc aggcaggtcg atgatgtcgt cgcccatata     19500
     gccggtctgg ttgagttgga cgcccacgcg ctgggcaagt tcactcaggg cgccgccctt     19560
     gtcgcgcacg ccttgcagca cttcggcgat gcccagctcg gcggcgcgcc ggtcggcgat     19620
     ggggccggag cggccggtga tcagggcgac tttcaggccg ccttccatca gcagccgcag     19680
     gccatggccg tccagcgcat ggaaacgctt gaacatttcg ccgtgctcgc catagtacag     19740
     gccgccatcg gtcagcacgc cgtcgacgtc gaaaaccatc aggcgcaccg cggcggcgcg     19800
     ttcgcgcacc gaggcgggga tgcgggcgag caccagggct tcggcggggt gcggcacgga     19860
     aacaggagag ttcttggtca tactactttg gctgccatca agtcgtgagt atgcagggcg     19920
     ccgatcagca cgccggcggt gtccaccacc agcatctggt tgaggcggcg gtcgtccatt     19980
     tgctgggcgg cctcggcggc cagcgcgtca ggcccgatgg tacgcggagc ccgggtcatg     20040
     ccgtcggcta ccgtcaggct gcggatgtcg ccgacgcgct cgatcaggcg gcgcaggtcg     20100
     ccgtcggtga agatgcccac gggcttgcgc tgtgcgtcga cgaccgccgt catgcccatg     20160
     cccttggccg agatttcctc gagcgcgcgg ggcagggggg cgtcttcggc gacgatgggc     20220
     agcgcgggcc cgtgccgcat cacgtcgcgc acgtgggtga gcaggcggcg gcccagggcg     20280
     ccgccggggt gggaacgcgc gaaatcctcg cggccgaagc cgcgcgcctc caggcaggcg     20340
     accgccaggg cgtcgcccag ggccagcgcc gccgtggtgc tggcggtggg cgccagattg     20400
     agcgggcagg cctcctggga cacgctggcg tccaggtgca cgtcggccag gcgggccagt     20460
     tcggattcgg cgttgccggt aatggcgatc agtcccgcgc ccatgcggcg caccaccggc     20520
     agaatggtca gcagctcctg gccggtgccg gaataggaaa tcgcgatcag gacatcgtcg     20580
     cgggtgacca tccccaggtc gccgtggatg gcttcggcgg cgtgcacgaa aaaggccggc     20640
     gtgccggtgg aggccagggt ggcggccagc ttgcgggcaa tgtgcccggt cttgccgatg     20700
     ccgctgacca cgacacggcc gcggcaggcc agcagcatgc cgacgacctg cacgaagctg     20760
     tcgtcgagcc gggcggcgag gtcggcaatg gcttgcgcct cggtctgcag cgtgcggcgt     20820
     gccgaggcga gaatggcctc gggcgtgggg tcgggatgag cgctcatgga gcggatttta     20880
     atcgcagtgc gccaagttgc cgggtccggg cccctatggc atgctggcgg ctcctttttg     20940
     cgcccttttt cttttcaggc aggcccgtcg tcatgtccac ctttcccgcg ccggttctcg     21000
     gcaccccgct gtctccaacg gctacccgcg tcatgttgct gggcgcaggc gagctaggca     21060
     aggaggtggt gatcgccctg cagcgcctgg gggtggaggt catcgcggtc gaccgctatg     21120
     ccgacgcgcc gggccaccag gtggcgcatc gcgcccacgt ggtctccatg accgatccgc     21180
     aggcgctgcg gcaggtcatc gagcaggagc gcccgcatgt ggtcgtgccc gaaatcgagg     21240
     ccattgccac cgacctgctg gtcgcgctgg aggacgaagg cgccgtgcac gtcacgccca     21300
     ccgcccgcgc cgcccacctg accatgaacc gcgaaggcat ccgccggctg gccgccgaga     21360
     ccctgggcct gcccacctcg ccctaccgct tcgtcgatac cgagcaggcg ctgcgcgagg     21420
     ccatcgacgg cggcatcggc tatccgtgcg tgatcaagcc ggtcatgtcc tcctcgggca     21480
     agggccagtc gatcatccgc tcggccgatg acatcgccgc cgcgtggcgc tacgcccagg     21540
     agggcgggcg cgtgggcgcc ggacgcgtga tcgtcgaggg tttcatcgag ttcgactacg     21600
     agatcaccct gctgacggtg cgcgcccgcg gcgccgacgg gcagatcgtg acgcagttct     21660
     gcgagcccat cgggcatcgc caggtcgatg gcgactatgt cgagagctgg cagccccatc     21720
     ccatgtcgcc ggtcgcgctg cagcgctcgc gcgagatcgc cctggccgtg accggcgacc     21780
     tgggcggcct gggcatattc ggggtggagc tgttcgtggc cggcgaccag gtctggttct     21840
     ccgaagtcag cccgcgtccg cacgacaccg gcatggtcac cctgatttcc caggtgcaga     21900
     acgaattcga gctgcatgcg cgcgcgctgc tgggcctgcc ggtggacacg cgcctgcgcc     21960
     agccgggcgc aagcagcgtc atctacggcg gggtcgatgc ccgcggcgtg gccttcgagg     22020
     gcgtggcgca ggcgctggcc gagcccggca ccgacatccg cctgttcggc aagcccgagt     22080
     cttacgccaa gcggcgcatg ggcgtggggc tggccgtggc cgacgacgtc gaccaggccc     22140
     gggccaaggc ggcgcgcgtg tcgcaggccg tgcgcgtgcg cgcctgaggc aacccgccct     22200
     tgccagggcc tggcacatcg gccctggcaa gggggttcgc ggaaacgtcc tattcgggaa     22260
     tgatgcgcat tatcgctagg atcgcgagtg cttccaatcc ggaagtcgca atagctcgca     22320
     tccatgattc caccttgccg cttatccctg atcccggcgc tggccgccat ggcgctggca     22380
     ggcgcctttc ccgcgccgag cggggccgcg ccggctgaat tggcgcccat cgcggtcatc     22440
     ggcgacgatc ccgacgatcc gcgggtattc gaaggcagca ccgccacccg taccgccaca     22500
     ccgctgcggg aggtgccgca gacggtcgac accgtgaagg tgccggacgc cctgaactat     22560
     ggcgcgcgca cgctgggcga ggcgctggcc ggcgtgccca atgtcaccga cgccagcgat     22620
     acccgcttcg acggcttgcg catacgcggg ttcgacgccg gcagcgactt ctacctggac     22680
     ggggtgcgcg atgacagcca gtacgtgcgc gacctgcaca acatcgagcg catcgaggtg     22740
     ctcaaggggc cggccggcgt tctgtacggc cgcggcagcc agggcggcat cgtcaatcgg     22800
     gtgagcaagg cgcccgggcc gggccgcgct tccaccctcg aagtccggct gggcggcgag     22860
     gactttcgca gcctgtacgc cgacctgagc gcggaccctt ccgacacggt cagcctgcgc     22920
     ctgaacgtgg gcggcgagaa tgcgggcagt ttcaggcacg gggtcagctc gcgccgccgc     22980
     ctggcgtcgc ccgccttggc gtggcgcatt acgccacggc tcgattggct ggcgcagtac     23040
     gaacacagcc gctacgaccg cgtgcccgac cgcggcattc cctcggtgga cggccggccc     23100
     gcgccggtcg ggcgctcgac cgtctacggc gaccccgggc gcgacaatat cgacgatcgg     23160
     gtccaggtgc tgcgctcgcg cctgcgctac cgggcggcca atggatggga gctgcgccat     23220
     accctgtcga cgttccggct gcatagcgat ttcgacaaca cctatctgtc cggctggcgc     23280
     gccgagaccg ggctggtgca acgccagcgc tggcagcagc acctgcgcgc ccggcatctt     23340
     tacaacgtct tcgaggccga gggcacgttc gccaccggct ggctcgaaca ccgcttgctg     23400
     gccggcgtcg agctgggcag ccagcatcgc gatccgacgc tgcaccgcgc ggccaccaaa     23460
     ggccccggcg cgcagccggt gcccgggctg gcgctgcacc accccgactt gagccagcag     23520
     caccacggcc gcatggagcg cgccagcgat gcgcgtcacc gcgtgcgtac gcaaggctac     23580
     tacttgcagg atcaactgcg attgagcgag tcctggcagg tggtggcggg cgcgcgcctg     23640
     gaccggttcg gggtgcgcac gcgcaatcgc ctgctgggcc tggaaggcag ccgtggcgac     23700
     cgcagtgtga gtccgcgcct gggagtggtc tggacgccct ggccggcgca cgcgttctac     23760
     gcgtcgtaca gcaagacttt ctcgcccacc ggcggcggca ccataggcat cacgccggac     23820
     gcgcggggca acgccaatga tctgccgccc gaacatacgc gccagtacga agccggggtc     23880
     aagagcgact ggctggacgg gcgcctgagc accatgctgg ccgtctacca gctcgaactc     23940
     tacaaccgcc gcacgcgcgc gccccacgat cccacgcgga tactcctgac gggcctgcag     24000
     cgctcgcgcg gcctggaaat gagcggggcg gggcggctag ctgtgaagat tcaataggtt     24060
     gtatgcatgg ttcatccgaa ccggatttga gaaactggaa atcgccgacc ccccagttca     24120
     ctcaaggagc ccggccggat gaacacccat aagcatgccc gattgacctt cctacgtcga     24180
     ctcgaaatgg tccagcaatt gatcgcccat caagtttgtg tgcctgaagc ggcccgcgcc     24240
     tatggggtca ccgcgccgac tgtgcgcaaa tggctgggcc gcttcctggc tcagggccag     24300
     gcgggcttgg ccgatgcgtc ctcgcgcccg acggtctcgc cccgagcgat tgcgccggcc     24360
     aaggcgctgg ctatcgtgga gctgcgccgc aagcggctga cccaagcgcg catcgcccat     24420
     gcgctgggcg tgtcagccag caccgtcagc cgcgtcctgg cccgcgccgg tctgtcgcac     24480
     ctggccgacc tggagccggc cgagccggtg gtgcgctacg agcatcaggc ccccggcgat     24540
     ctgctgcaca tcgacatcaa gaagctggga cgtatccagc gccctggcca ccgggtcacg     24600
     ggcaaccgac gcgataccgt tgagggggcc ggctgggact tcgtcttcgt ggccatcgat     24660
     gaccacgccc gcgtggcctt caccgacatc caccccgacg agcgcttccc cagcgccgtc     24720
     cagttcctca aggacgcagt ggcctactac cagcgcctgg gcgtgaccat ccagcgcttg     24780
     ctcaccgaca atggctcggc ctttcgcagc cgcgccttcg ccgcgctgtg ccatgagctg     24840
     ggcatcaagc accgctttac ccgaccttac cgcccacaga ccaatggcaa ggccgaacgc     24900
     ttcatccagt cggccttgcg tgagtgggct tacgctcaca cctaccagaa ctcccaacac     24960
     cgagccgatg ccatgaaatc ctggctacac cactacaact ggcatcgacc ccaccaaggc     25020
     atcgggcgcg ctgtacccat ctccagactc aacctggacg aatacaacct attgacagtt     25080
     cacagctagc gcgccgacta cgacggctgg gcggcgcagg gcaacccggg ctgggggtgg     25140
     acgacgtgct gccgctgttc aaggccagcg aggaccacca tggcggcgcc agcgccttcc     25200
     acggcgcggg cggcgaatgg cgggtcgagc gccagcgcct gtcctggaaa ttgctcgacg     25260
     cgttccgtgc ggcggccgcg caggccggca tcgcctcgat cgacgacttc aaccagggcg     25320
     acaacgaggg ttgcgactat ttcgaggtca accagcgccg cggcgtgcgc tggaacaccg     25380
     ccaagggttt tctgcggccg gccatggacc gcggcaacct gaaggtcctg accggcgcgc     25440
     gggtggcgcg cgtggtgttc cagaaccgcc gcgcggtagg ggtgcgcttc atggcggagg     25500
     gcggcggcga acagtatgcc caggcgcgcg gcgaggtggt gctggccgcc ggcgccatcg     25560
     ggtcggcgca actgctgcag gtgtccggcg tggggccggc ggcgctgcta caggcgcgcg     25620
     gggtgcccgt gctgcatgac ctgcccggcg tgggcgcaaa cctgcaggac cacctgcagc     25680
     tgcgcctgat ctaccgggtg cggggcgccc gcaccttgaa cggggtggcg ggcaccctgt     25740
     ggggcaaggc atggatgggc ctgcaatacg ccgtgcagcg gcgcggcccg ctcagcatgg     25800
     cgccgtcgca gctgggtgcg ttcgcccgct cgggccccga gcagtcgcgc gccaatctcg     25860
     agtaccacgt ccagccgctg tcgctggaga agttcggcga cccgctgcat gattttcccg     25920
     ccttcaccgc gtcggtgtgc aatctgcgtc cgaccagccg gggccacgtg cgtatcgtct     25980
     cgcccgatcc gggcgaccat cccgagatcc tctgcaacta tctttccacc gaggccgacc     26040
     gcaaagtcgc cgccgacagc atccgcctga cccggcgcat cgtggctcag cccgcgctgg     26100
     cgcgctacca gccgcaggaa tacaggcccg gcgagcaatg gcagagcgag gaagacctgc     26160
     agcggctggc cggcgagatc ggcacgacca ttttccatcc ggtgggaacc tgcaggatgg     26220
     gcgacgacgc gcaggcggtg gtggatgccg cgttgcgcgt gcatggcctg cagggcctgc     26280
     gggtgatcga cgcatccatc atgccgacca tcacctcggg caataccaac tcgccgacca     26340
     tcatgatcgc ggaaaaaggc gcccaactgc tgcgcgaagc ccgccggcaa acatgaaggc     26400
     cgccgcatcg ggtgtattca cgggttcgcc gcggcgcgcg gctgcgttat attccgacac     26460
     ttgtttaaca cgtgcagcat gccgaggcct ggcgccccgc gcagcgcctt cgacagagcc     26520
     ccatgcccca cgctattgaa atcgtggcca cgctgttgtt cagcgtggcg gtactacaca     26580
     cgttttccgt tcccttcttt gctcgcctgg ctcaccgcaa cgggccgcat gccggcgtat     26640
     ggcacctgct ttccgaggtc gaggccgtct ttggcgtatg ggcgttcgta ctgatcgcct     26700
     gtatggcgct gatggccggc accgatcgcg cagtccagta catggatacg cgcaacttca     26760
     ccgagccgct gttcgtcttc gcgatcatgg tggtggcgtc cagccggccc atcctggagc     26820
     tggtgggcag cgtggtgcgg ctgctggcgg ccatggtgcc gatacggcgc gagctggcca     26880
     ccttcttcat cgtcatgtcg atcgtgccgc tgggcggctc gttcatcacc gagccggcgg     26940
     ccatgacgct ggccgccatc ctgctgcgcg acggctactt ccgctgcagc ggccgcgccg     27000
     gcttcaagta catgacgctg ggcgtgctgt tcgtcaacgt gtccatcggc ggcgtgctga     27060
     cctcctacgc ggcgcctccc gtgctgatgg tggccgcgac cttcggctgg gataccgcct     27120
     acatggctac ccatttcggc tggcgcgccg ccgtcgccgt cttcctgaac gccggcgtgc     27180
     tgaccatgct gtgccgccag gccctgctgg agggcgcggt gggcaccggc gccggcgtca     27240
     atgcgtccgg cgacgcatcc gagaagcggc cgcccgtgcc ggcgccggtg acgctgatgc     27300
     acctggcctt cctggtgggg atcgtcctta ccgcgcatca tcccgctgtg ttcctgggca     27360
     tgctgatgat gttcatcggc ttcgcgcacg cctaccagcg ccatcagagc cggctgatga     27420
     tcagggaagg cctgatggtc ggtttcttcc tggccggcct ggtcgtgctg ggcggcttgc     27480
     agaaatggtg gctgcaggat ctgctgggcg ggctggaacc cacggtgctg ttctggggcg     27540
     cgactgcgct gacggccatc accgacaatg ccgcgctgac ttacctgggc tcgttggtcg     27600
     aaggaaccag cgaggcctgg cgctacatgc tcgtggccgg cgcggtcacc ggcggcggcc     27660
     tgacggtgat cgccaacgcg cccaatccgg ccggtttcgc catcctcggg aagtacttcc     27720
     cggacggcag catatcgtct gggcgtctgt tcatcgcggc gctggtaccg acgctggtgg     27780
     ctgctgccat gttcatgttg ccggtataag acagggcagg gccgcgccgc cgccaggcgg     27840
     cctttccttg aaaaaccgct aaaattcaag aatttcccgt atttcgccgg cccagccgcc     27900
     gtgccgcccg gaccttcccg gccaggcaca gaggtggaat tccacgcgcc ggttcgcctg     27960
     ggagttttcg ttaaatgccc atttatgcat ataaatgcag cgcgtgcggc catgccgagg     28020
     acgtgctgca aaagatctcc gatgcgccgc tggcggactg tcccgcctgc ggccagagca     28080
     cgtattccaa gcaggtgacg gccgccggct tccagctcaa gggctcgggc tggtacgtca     28140
     ccgattttcg caacaacaac ggagcgggca agccggccgc tggccaatcc gccgcgccgg     28200
     ccgccagcgg cggcgacgcc ggcggtgcgt ccgcctcggc cgccacgccc gcacccgcgg     28260
     cgccggcagc cacctccacc tgattgcggc acagcgtcat gcgcgtgttc aagaagtact     28320
     tcatcaccgg cttgttgatc tgggtgcccc tggccatcac ggtatgggtg ctgggcctgc     28380
     tcgtcgcgac gctggagggg ttcgttcccg gcttcttgtc atcgcagtcg ttgtttggcg     28440
     tggatatccc cgggttccgc ttcgtcctcg tcatcaccgt ggtgctgctg acgggcgtgt     28500
     ttgccgccaa cctgctcggg cgcagcctgc tcgagcactg ggagcgcatc ctggggcgca     28560
     ttccgctggt gcgctcgatc tacaactcgg tcaagcaggt cagcgatacc gtgctggcgc     28620
     ccaatggccg ggcgtttcgc caggccgtgc tgatccagta cccgcgcgcc ggctcgtgga     28680
     ccatcgcctt cctgaccggc acgcccagcg gcgaggtggc ctcgtacctt cccggcgaac     28740
     acctcagcgt ctacgtgccc accacgccca acccgacgtc cggctttttc ctgatgatgc     28800
     cgcgcgacca ggtcatcgat ctgcagatga gcgtcgacgc ggccctgaag tacatcgttt     28860
     ccatgggggt cgtggcgccg gcggatcgcc ggcccgtatc cccgcccacg acgcctggtg     28920
     cgcccctggc gccgggcgcc gaaccgtaac cttttacgct tacacagcct atacacggag     28980
     ttatcccgca tgcgtacctg ctacaccggc caggtttgcc gtgaccatct cggccagact     29040
     gtcaccctgt acggctgggt gaaccgccgc cgcgaccacg gcggggtcat cttcatcgac     29100
     ctgcgcgatc gcacgggcct ggcgcaaatc gtgttcgacc ccgacaatgc cgaggctttc     29160
     ggcacggccg agcgcctgcg caacgagttc tgcatcagca tcaccggcct ggtgcgcctg     29220
     cgccccgaag gcacggccaa cgccgagctg gcctcgggcg aggtcgaagt gctgtgccag     29280
     caggtcgaga tcctcaacgc gtcggtgacg ccgccgttcc agctggatga cgacaacctg     29340
     tcggaaacca cccggctgac ccatcgcgtg ctggacctgc gccgcccgca gatgcagcac     29400
     aacctgatgc tgcgctaccg cgtctcgatc gaagtgcgca agtacctcga ccagctcggc     29460
     ttcatcgaca tcgaaacgcc gatgctgacc aagagcacgc ccgagggcgc gcgcgactac     29520
     ctggtgccgt cgcgggtcaa cgccgggtat ttctttgccc tgccgcaatc gccgcagctg     29580
     ttcaagcaga tgctgatggt ctcgggtttc gaccgttact accagatcac caagtgcttc     29640
     cgcgacgaag acctgcgcgc cgaccgccag cccgaattca cccagatcga ttgcgagact     29700
     tcgttcctga acgaagtcga gatccgtgaa atcttcgaag gcatgatccg ccatgtattc     29760
     aaggtggtgc aggacgtgga cctgcccacg ccgttcccca tcatgagctg gacggaggcc     29820
     atgcagcgct atggctcgga caagcccgac ctgcgcgtca acctggaatt caccgacatg     29880
     accgacgtca tgcgcgacgt ggatttcaag gtgttcgcct cggccgccac caccgcgggc     29940
     agccgcgtcg tggcgctgcg cgtgcagggc ggcggcgaga tgtcgcgcag cgagatcgac     30000
     gcctacacgc aattcgtcgg catctacggc gccaagggcc tggcctacat caaggtcaac     30060
     gacgtggcca agggccgcga gggcctgcag tcgcccatcg tcaagaacct gcacgatgcc     30120
     gcgctggccg aactggtcaa gcgcaccggc gcgcagaacg gcgacatcat cttcttcggc     30180
     gcggatcgcg ccaaggtggt caacgacgcc atcggcgcgc tgcgcgtgaa gatcggccac     30240
     agcgaattcg gcaagaaggc cggcctgttc agcggcggct ggaagccgct gtgggtcgtc     30300
     gacttcccca tgttcgagta cgacgaggag gaaaaccgct ataccgccgc gcaccacccg     30360
     ttcaccagcc cgaaggacgg ccacgaggac ttcctcgaaa gcgatccggg caaggccgtc     30420
     gccaaggcct acgacatggt gctcaacggc tgggaaatcg gcggcggctc ggtgcgtatc     30480
     caccgcgagg aagtgcagag caaggtattc cgcgcgctca agatcgacgc cgaggaggcg     30540
     cgcgagaagt tcggcttcct gctggacgcg ctgcagtatg gcgcgccgcc gcatggcggc     30600
     atcgcgttcg gcctggaccg catcatcacc atgatggccg gcgccgaatc catccgcgac     30660
     gtgatcgcct tccccaagac ccagcgtgcg cagtgcctgt tgaccggcgc gccgtcggaa     30720
     gtcgacgaga agcaattgcg cgagctgcac atccgcttgc gcaacgtcga agtgaaatga     30780
     agtaagctgg cgaagcgccg acgccatggg cggcggcgcc gccagcggcc ggaatcgggc     30840
     aggccgggca atggcgtggc ttcgcccgtt tcgataacgc gccatacctc ctatgtcgct     30900
     tattcgcgta gtcagctaca acatccacaa aggccgctcg gccctgggcc ggcgcgagtc     30960
     cctcaacgat ctgcgcctgg gcctgtatgg cctgcgtccg gacctggtct tcctgcagga     31020
     ggtccaggga cgcaacgagg tatcctcggt cctgcacgcc cagcacgaat cgctggccgc     31080
     cgcactgcgc ctgcaggcgg cctatggccg caatgccatc cgtaccggca ccgatcacgg     31140
     caatgccttg ctgtcgcgct ttgacatcct cgatcacgag aaccaggaca tctccgacca     31200
     tcgtctggag cagcgcggcc tgctgcacgc gcgcatcgac gtcggcggca ccgaggtgca     31260
     ctgcttcgtc gtgcacctgg gcttgttcgc cggcagtcgt ggccgccaga tccaggccct     31320
     gacggaccgc atccggcaat cggtcccgga cggcgcgccg ctgctgatcg tgggcgactt     31380
     caacgattgg ggtgaccgcc tggcgccgat gttcgtgcag cagctgggcc tgtacgaagt     31440
     gttttcgcac gcgccgcgct cgcacggcgg cgacctgccg cgcctgcgcg actcggtcag     31500
     gcgcttgggc aacgtactgc gcggcgtgcc caacagcgtg gcggtgctcg aacgcaacaa     31560
     ccagctgggc atgggcggcg cctattgtcc cctgccgccg ccgcggactt tcccggcggt     31620
     gttcccgtgg ttccgcctgg atcgcatcta ccaacgcggc ttcgccgtgc gcagcgcccg     31680
     cgtcctgcgc gggcgcgagt gggcgcgcct gtcggatcat tcgccgctgc tggccgagct     31740
     cgaattgccg tgaaggccca gatcgtcagg ttgcactgga ccgatggcaa cgccatccgc     31800
     ctgctgcaaa acggcggcga tttctttccc gcgctatgcg aggccatcga cgcggcgcgc     31860
     ctgtcggtgc atatggagac ctacatcttc ctgctcgacc gcaccgggcg acagatgctc     31920
     gaatgcctgg agagcgctgc ccgccgcggc gtcaaggtgc gcgtggtgct cgacggtttc     31980
     ggcagcgccg gcacggccga gacgatacgc ctgcgcatca cccaggccgg cggccagtgc     32040
     cgcatcttcc ggcccgagcc ccgctggctg ggccacctgg cgttctcgcg cagccgcttg     32100
     cgccgcctgc atcgcaaggt ggccgtggtc gacgccgagc tggcgttcgt cggcggcatc     32160
     aatatcgtcg acgactacga cgacctcgac cccggcgacg acatccccgc gccgcgcttc     32220
     gacttcgccg tggcggtgca gggccccctg gtgccgcaca tactctatgc ccaggacctg     32280
     ttgtgggtac ggctgaactg ggcccgcctg cgccgccacc caggggactg gatgcgcctg     32340
     ttcaagccgg tgcacgccga cgcctcgccg gccggcaagc tgcgcgcggc attgctgctg     32400
     cgcgacaacc tgcgctttcg gcagaccttc gagcaggcct acctttatgg catccagcat     32460
     gcgcgccgcg acatcctgat cgccaacgcc tatttcttcc ccgggcatca attccgcaag     32520
     agcctcatgc aggccgccgc gcgcggcgtg cgcgtgcggc tgctactgca gggcaagccc     32580
     gaataccgca tgcagtactt cgccacgcgc gcgctgtacg accggctgct gcgcggcggc     32640
     atcgagatct acgaatacat gccgggctac ctgcacgcca aggtcgccgt catcgacaac     32700
     atggctaccg tcggctcgtc caatctcgat cccttcagcc tgctgctggc ccgcgaagcc     32760
     aacgtggtcg tcgacgacca gcccttcgcc tgggacctgc aggaacgcct agagcgcgcc     32820
     attgccctgg gcggccagtt catccggccc ctggactacc agcggcgcgg ctggctgcgg     32880
     cgatgcgtcg acgtcgcggc ctacaccatg ctgcgcatcg gcgtggcgct gaccgggcgc     32940
     gcggggcggt actaatcggc tgccgcgacg cgccgggcgc ccaccaggcc cagcgccagc     33000
     gcggtgccga ccaggatcac gccggcgccg gccaggatgc gcggcgtcac cgcttcgtcc     33060
     aggaaccaca cgccccatag cacgccgaac accggcacca ggaatgtcac gctgaccgcg     33120
     gcggtcgggc cgacacgggc gatcaggcgg aagaacacga tataggccgc gccagtgcag     33180
     acgattgcca gcagcaccgt ggcgcgccac gcctcgaacg ataccgcctg ttcgggccag     33240
     tggatgatcg ccaggggcgc cagtaccagc gaggcggcca ccatgctgcc cgttgcgttg     33300
     gtcagcgcgt ccacgtggcc gagatagcgc ttggtccagt tggccgccat gccgtagaac     33360
     accggcgcgc tgatggcggc cagcacggct ggccccgtgc cgccgtcatg gaaatccagc     33420
     ttgtcccata ccagtacgat gatgcccgac aggctgatca gcaggcccag ggcgcgcatg     33480
     cgcggcaggc ggtcccccag ccacagccag ccgatcaccg cgccccacac cggcgtgacc     33540
     gcattggcca ccgacagaaa gcccgcgccc agcgactggg ccgcataggc atacagcagg     33600
     aagggcagcg ccgaattcag cgtgcccacc accaatatcg ccttccagtg ccgtgcgatc     33660
     aacgccggct tgccgcgcca cagggccagc ggcagcagga acagcgcggc cagccccacg     33720
     cgcagctcca tcagggcggc gggcccgaac tcgggcaccg ccacgcgcat gaacaggaac     33780
     gacccgcccc atacggcggc cagcgccagc aagtccagca gatcacgacg cggcatggga     33840
     tcagttccag gtcaggcggc gggcgtggcc gcgacgttct tcattttcac gcggtgcgcc     33900
     accacggcgc tgaacagcga cagcagcaca cagagaatca ggccggcacg caccccatcg     33960
     agcaccgaac tgtgcgaaat cgcgataccc accagagccg tgccggcggc gctgcccatg     34020
     gcgcgggtgg tctgcaccag cgccgaggcc acccccacgt cacgccgttc gctgagcatc     34080
     tgcatgaaca gcgtcaggtt cggcagcagg aatcccagcg ccgtgccgtt gacgaagaat     34140
     gccgccacga tccaccaggc cgacgtcccg gcgctcacgg ccagcatcat ggcggaaccg     34200
     gccgccagca ggcagctgcc gaacaccatc aggcgctgcg gctcggtctg cttgggaaac     34260
     aggcggccat tgatgatact gccgaacgaa atcgccgcca ccagcggcgt cagcagcagt     34320
     cccgcctcgc tcggggagta atccagctcg gggaataatc cagctcgtgc tgcagcagca     34380
     gcggactgta gaaaatcagg atgaacatcg tcgcgcccac cgccaccgca gccaggttca     34440
     gcagccgggg ttcgaggccg gccagcacgc gcagggggaa aataggggac cgtacgcgac     34500
     gctcgatagg caccagcagc gccaccgcgg cgattccggc caccgccagc gccagcgcca     34560
     cgcgcggatg ggcgccatcg ccaggcgcga aagccagttc gatggccgcc agcggcgcgc     34620
     ccaccaccac gatcagcaac aggccgccca cccagtcgat gcggcggctg gccgtctgcg     34680
     ccggccggat gcgggggaaa tagcgcgcca gcagaaacaa cgccgccacc gcggccagcg     34740
     gcgaaatgaa aaacgccgcg cgccagccca gcgcctgcgt ggccgcgccg cccagcacgg     34800
     ggcctatccc gctggccatc gcgaacgtcg ccgacaccag cgccatccag cgcacccgct     34860
     ggccggcgtc gggaaacagg tccgccgggg cggcgaatgc cgtcgcgatc atcatgcccc     34920
     cgcctatgcc ctgcagggtc cggaacgcga tcagctgcgg catgctctgc gccaggccgc     34980
     aggcgatcga gcccagcgcc accagcgaca ccgacaccag catcaggggt ttgcggccgt     35040
     acatatcgcc cagccggccg aaaatcagga tcgaggcggc ggtcgccaac agataggccg     35100
     tgccgaccca cgcgtacaac gccatcccgt tgagcgcagc cgccacgcgt ggcagcgtgg     35160
     tcgtgacaat ggtcgagtcg aacgccacca gcaccacggt ggcggacacg cccgccatcg     35220
     ctcgtaacaa atcgcgccga gaatgggggg attcttgagt tgtcgtcgta atttctgggt     35280
     cttgagtagg cggcgcgctc atgctctcaa gcatagcacc gccaacctag ggaaaacacc     35340
     gattcttgct gcctatttga agaaggtgtg atatcccaga atcaccagca ccacgcacag     35400
     cgcaaccgcc caggaccagc gcgaattggt caggccgcgc ggttcgggct ccggcggcgg     35460
     cggtgacggc gccaggcggg gctggccggc catatggtcg atgaacgcgg cgaagaactt     35520
     ctccacgatc ttgttgccgg ccttcatgat ggtcgattcg cccagctcgg ccagcttgcc     35580
     gccggccatg gccgccaccg tatagctcag gcgcgtcccg tcgtccttgg ggctcaggtt     35640
     gacctgggcg gtaccgatag ccaggccgct ggccagcccc ttgccttcga aggcaacggt     35700
     acaggaatgg ggaggatcca gatcagaaag caggatctcg ccctggtaat cagtctccag     35760
     gccggccacc ttggcgcgca ccaccagttc gtactcggta ggtgtgaact gtcaataggt     35820
     tgtattcgtc caggttgagt ctggagatgg gtacagcgcg cccgatgcct tggtggggtc     35880
     gatgccagtt gtagtggtgt agccaggatt tcatggcatc ggctcggtgt tgggagttct     35940
     ggtaggtgtg agcgtaagcc cactcacgca aggccgactg gatgaagcgt tcggccttgc     36000
     cattggtctg tgggcggtaa ggtcgggtaa agcggtgctt gatgcccagc tcatggcaca     36060
     gcgcggcgaa ggcgcggctg cgaaaggccg agccattgtc ggtgagcaag cgctggatgg     36120
     tcacgcccag gcgctggtag taggccactg cgtccttgag gaactggacg gcgctgggga     36180
     agcgctcgtc ggggtggatg tcggtgaagg ccacgcgggc gtggtcatcg atggccacga     36240
     agacgaagtc ccagccggcc ccctcaacgg tatcgcgtcg gttgcccgtg acccggtggc     36300
     cagggcgctg gatacgtccc agcttcttga tgtcgatgtg cagcagatcg ccgggggcct     36360
     gatgctcgta gcgcaccacc ggctcggccg gctccaggtc ggccaggtgc gacagaccgg     36420
     cgcgggccag gacgcggctg acggtgctgg ctgacacgcc cagcgcctgg gcgatgcgcg     36480
     cttgggtcag ccgcttgcgg cgcagctcca cgatagccag cgccttggcc ggcgcaatcg     36540
     ctcggggcga gaccgtcggg cgcgaggacg catcggccaa gcccgcctgg ccctgagcca     36600
     ggaagcggcc cagccatttg cgcacagtcg gcgcggtgac cccataggcg cgggccgctt     36660
     caggcacaca aacttgatgg gcgatcaatt gctggaccat ttcgagtcga cgtaggaagg     36720
     tcaatcgggc atgcttatgg gtgttcatcc ggccgggctc cttgagtgaa ctggggggtc     36780
     ggcgatttcc agtttctcaa atccggttcg gatgaaccat gcatacaacc tattgaatct     36840
     tcacagctag caagcggcag acggcgcact cgaaacattt tgtatattcc tgccggccca     36900
     cccggaatca cgcatccttg tagcgttcct ccagctcgtc atacaacggc ttgcccacca     36960
     gccgttgccg ctccaggaaa ggcgcgagca acgccgggtc ctcgtccagc ttgccgtcgc     37020
     gcctgagcgc gcccagcgcg cgctgcatgc ccagcaccgc cccctgcaat gtcgcattgg     37080
     cgtacagcac cacgctgtag cccaggcgcc cgagttgcgc ggccggcatg ggcggcgtct     37140
     tgccgcccac cacgatattg accagcagcg gctggctcag cagttgcggc agcttgccca     37200
     cctcgtcctg gtcgacgatc gcctcgacga acaggatgtc cgcgcccgcc tcggcgaaac     37260
     gccgggcgcg ctcgatggcg gcgtcgaaac cctcgacagc gcgcgcgtcg gtgcgggcga     37320
     tgatgaggaa atcctcgtcg cgccgcgcgt cggccgccgc cttgatcttc gacaccatct     37380
     cggacagcgg cgccacgctc ttgccggcga agtggccgca gcgcttggga aacacctggt     37440
     cttccagctg gatggcatcg gccccggcgc gctccagcac ccgcacggta tgccatacat     37500
     tgaccgcgtt gccgaagccg gtgtcggcgt cgacgatcag gggcaactcg accgcatcgc     37560
     ggatgcgcga ggtcgcgtcg gccacgtcgc gcaagccgat gatgcccagg tccggcgcgc     37620
     cgtaatgcat gttggtcagg cccgcgccgg tcaggtagac cgcctcgaac ccctggtccg     37680
     ccacgatcct ggcgctcatc gcgttgaacg cgcccgccac cagcatgcca ttgcgctgcg     37740
     cgacccgttc gcgcagcacc cgtttggtcg aattgctcat tgcccatgct ctccttgcag     37800
     gaagccggcc tgcgccgggc cgccgttgat gatgcgctcc ccacgccgcg cggcttcacg     37860
     cgcaggtcgg gctggcccca gcagcatata ccaggcggcc ccgaatgatt cttggcgcca     37920
     cgcccaggac aggaatggca gatgcaaacc cttaccaggc gcgcgtgcgg gcgccacggc     37980
     ggcgcaggcc gcgcgagctt ataatttttc ctggatcgcc cgcccggtgc gacgcgccat     38040
     cgggaacggc gccagcaaga tcgcgcgtcg attcctcatg cgccgccggc agcatcgccg     38100
     cggcgcgcaa ggggcacacc atgtcacgca aatatatcga ctgccgtgag tttcccagcg     38160
     aaatgaactg ctcggtcgcg ctgtcggccg acagcgacgc cgaactcctg gaagccgcgg     38220
     tccagcacgc caccaccgtg cacaagcacg ccgacacccc ggagttgcgc gcgcaactca     38280
     agaccatgtt ccatgagggc acgccgccgc tcgcggcgca ggccggcagc cgcgcctgac     38340
     cacgggccgg gccgcacgcg gcccggccgc aggcgccgtc aaccgaagac cgtggccagc     38400
     gcccggtcga tcgcgccgca cagttcgtcc acctcgtcgc gcgtcaggat cagcggcggg     38460
     gccaggcaca aggtcgtatt gagaccgggc agcgcgcgcg tgatcacgcc gatcagcacg     38520
     ccctgcgcct tgcactgcgc caccacgcgc ttggcgtcgg cctcggaaac cggcgttttc     38580
     gccgcccggt cgctcaccag ttccacgccc tgcagcaaac ccttgccgcg cacgtcgccg     38640
     atgacggcat gcttgtcggc cagttggcgc aggcacgcct gcaagtagtc gcccacctgc     38700
     gcggcatgct cgaccagccc ctcctcctcg aggatgcgca gattctccag cgccgccgcc     38760
     gcgctgcccg cgcagccgcc gaaggtggag acgtcgcgga agaaactgag gggatcgtcc     38820
     ggttcgtcct tgaactgctc gaagatgcgc tcgtgcgtca ccgtgcaggc aatggccgca     38880
     tagcccgagg ccgtgccctt ggccagcgtg acgaaatccg gctcgatgtc gaaatgctgg     38940
     tagccgaacc atttgccggt gcgccccagg ccgcacacga cctcgtcgat atgcagcagc     39000
     acatcgtagc gccggcagat ctcctgcacg cggcgccagt agccctcggg gggcacgatg     39060
     atgccgccgc cggcggtgat gggttcgagg cagagcagcc cgaccgtttc cgggccttcg     39120
     cgcaggatga cctcctcgat ggcgtcggcg gcgcgctcgc cgtagttcgc cacatcccat     39180
     tgcttgcggt actccaggca gtgcggcacc tggacgaaac cgtcgggaaa cggaccgtac     39240
     tgcgccgccc gctcgggctg gcccgccgcc gccagcgtgg caatcgacga tccgtgatag     39300
     tcccgctcgc gaaacaggat cttgtatttc ctgccggcat ggtggcgcgc ggagatctgg     39360
     cgcaccatct tgaatacctt ctcgttggcc tcggagcccg agttcgaaaa atacacccgg     39420
     ctcatgcccg gcatcttcga gaccagctgc ctggcgaaca gcgcgccggg cacattgccc     39480
     gcgctttgcg cgaaatagtt cagcttgagc atctggtcgc gcatggcgtt ggcgatccgc     39540
     tcccgcccgt agccgacatt gacggtccag aatccgccgg ccgtggcgtc caggtactcc     39600
     ttgccgctgg catcgcggat acgcgtgccc tttccttcga ccaccaccca gggggccgtg     39660
     gcctgcaggg cgtcgtgctg cagcatgtga tgccagatgg cattgcggtc gtcttcgacg     39720
     acgctgtgaa gatcattgat cgttgccaag tcgttcatgg aaaccttccg ctgaaagtag     39780
     gggctgggaa ataaacgggt tacacggggt ccaccgggac gggcggcatg ccgcgcgcgg     39840
     cgatgtcctc ggccgccagg aacagcaagt cctcgcggta acggccggcc gccagctgga     39900
     tacccacggg cgccgagccg cacatgccgg tcgccacgct catgcacggc aggcccatga     39960
     aggccaggcc aagctgcggc atctgcgcct cccagacgct gtcgtaatcg gccgcggacc     40020
     gggtatccag gtcgttggcg aaggtcaggc gggccgacac cggcagcatc atcaagggat     40080
     agtcctcgaa gaacagcatc cactggcgca gataggacgc ccgcgccttg agcgccgaac     40140
     agtagctttg cagggtgacg ccggccgact gcggctggcc ccgcagcatg gccagggcgc     40200
     ccgggtcgcc ctcggcctgc gcctcggcca gcaaggccgg atattcgtcg cccagccaca     40260
     gggtcacctg ggccacggcg gcatcgcgca tgggcggaat gtcgtccagc tcggccactt     40320
     cccagccggc gtcgcgcaag cgcgccgccg catccagcag cgcatcggcc accgcggcgt     40380
     cgatctccag gccgtcgggc cgcaggcaca gcgccacccg gcgcggccgg gccgggccgg     40440
     ccagcggcgc gggcacccac cacgggtcgc gcgggtccgc gtgggccagc gcggcgaacg     40500
     acaattcgat gtcggccacg gtgcgggcca gcggaccgga gaccgacatg agctgcccgc     40560
     ccaggccgcg ttcggggaac gaagcgttgt agttgggaat gcgccccagg gtcggacgca     40620
     ggccgtgcac gccgcacgcg taggccggat accggatcga gccggcgatg tccgtgccat     40680
     gcgcgatggc gccgatgccc gaggcaaccg ccgcgctggc gcccccggaa gagccgcctg     40740
     gcgtcaggct gcggtcgaac gggttgtagg tgtcgccgtg caggcggcca ttggtgaacc     40800
     agcgcaggcc gaacgccggc atgttggtgc gcccgatggg aatcgccccg gcccgctcga     40860
     agttgtccac gatggggctg ttggccgcgg cgcggtggtc cttcagcttg cggatgccca     40920
     tggtggtcgc gaaacccgcc tggtcgtgcg tgaccttgac cgtcaccggc acgccggcca     40980
     gcgggccggg gtcctcgccg gcggcgatgc gcgcgtcgac gcgggccgcc gccgccagcg     41040
     ccgcctgggg gtcgctgtcg accacggcat tgatgcgccc attgacggcc tccatgcggt     41100
     ccagcgcggc gcgcaccgcc tcgcttgccg agaacgcccc cgacttcacg cccgcgacaa     41160
     tctcgcaggc cgacagccgc cacaattctg atgtcacgcc ccttccccct cgatgcttcg     41220
     caagccggac agatggctac cgttcgcgaa agttggcaaa gtcccaatcg cgtcccggcg     41280
     cggcctcgat caacgcgcgc gtgtaggcgt gcgcgggccg cgccaggaca ttctcggccg     41340
     tgtcgtgctc caccacgcgg ccatgccgca tcaccatgac ctcgtcgcag atctgcgcgg     41400
     ccacccgcag atcgtgcgtg atgaacagaa tcgcgatgtc cagcttgcgc tgcagcgtgt     41460
     cgagcaattc gagcacctgc gcctgtaccg agacatcgag cgcggacacc gcctcgtcgg     41520
     ccaccaggac gtcgggccgc atggcgatgg cgcgcgcgat ggcgatgcgc tgccgctgcc     41580
     cgcccgagaa ctgatgggga tagcgcgcca gggcgtcggc cggcaggccc accagctcca     41640
     gcaattcggc cgcctgcgcc agcgcggcct gcctgtcctg cccgaagttc accggtcctt     41700
     cgatcaggct ggcgccgatg gtgcggcggg ggttgagcga acggtacgga tcctggaaga     41760
     cgatctgcag atgcttgcga aacggcttga gctgcctggg gcccagccgc gcgatatcgg     41820
     catcgccgac acggatggcg ccttcgctcg gctcgatcag ccgcatcacg cagcgcgcca     41880
     ccgtggactt gcccgagccg ctctcgccca cgatgcccag cgtacggccg ggctggatgc     41940
     tgaacgcgac atcgtgcgcg gcctggactt cccgccggcg gcccgggaac ccgcccatcg     42000
     catagcgttt cgcaagcccc tgcacctgca gcgtggcgca cgcctgcggc gcggcccggc     42060
     cgggccgcgg aatcaggctg ggcaccgact tgagcaactt gcgggtgtag tcctgccgcg     42120
     gttcgcgcaa caattgctcg accggcgcgc tctcgacgat ttcgcccagg cgcatgacat     42180
     agacccggtc ggcgatctcg gccaccaccc ccatgtcatg ggtgatgaac agcaccgccg     42240
     tatcgtgctt gtgctgcagc tcgctgatca gcttgagcac ctggttctgc gtggtgacgt     42300
     ccagcgcggt ggtcggctcg tcggcgatca gcagccgcgg ctccagcacc agcgccatgg     42360
     cgatcatgat gcgctggcgc tgcccaccgg agagctggtg cggataggac tcgtagatac     42420
     gcgccacgtc gggcaggtgg acctgctcca tgatgtcgag cacgcgctgc tttttctcgc     42480
     gcctgggcag cgccgtgtgg ctgtccagca cctcttcgat ctgcggcccc accttcatga     42540
     ccgggttcag ggccgtcatg ggctcctgga aaatcatgga aatgcgcttg gcgcgcaagt     42600
     cccgcaaggc ggccggcccg aggtcgagca ggttctggcc atcgagttcg atgcgtccgc     42660
     ctgtcacccg cagatgcccc ttgggcagca ggcccatgac cgccagcgag gtcatggact     42720
     tgcccgagcc gctttcgccc accaggcaga ccgtctcgcc ctgccggata tcgacgtcga     42780
     tatcccgcaa gatggcgctg ccggcgcccg gctgcccgtc caccagggac aggcccgcga     42840
     tgcgcagcac caccgggcga tgttggagat cgcgcttgcg aaatatcatc gtttactccc     42900
     cccgccgctt caggcgcgga tcgagcatgt cgcgcgcggt gtcgcccagc aggttgatgg     42960
     acaggatgca cagcgacagc agcaggcccg gccacagcat cagccccggg cggatctgga     43020
     agtacatgcg cgcttccgcc atgatgttgc cccaggtcgg tatctcggtg gagacgcccg     43080
     cccccaggaa cgacagcacc gcctcggtca ggatggccga ggcgcagacg taggtggcct     43140
     gcaccatgag cggcgccagg gtattgggca tgatgtgccg ccagagaatg ccgggcatcg     43200
     acgtgcccag cgccagggcc gcctcgacat agggctcttc gcgcgccgac agcaccaccg     43260
     agcgcaccag gcgcaccacg cgcggcacct ccggcaccgt aatggcgatg atgaccgacc     43320
     agatgctcgg cccgttgagc gcgaccaggg cgatcgccag caggatggac ggcaccgaca     43380
     tcacggcgtc cgtgatgcgc atgaccacgc cgtcgagcac gcggaagaac cctgagacca     43440
     ggccgatgca cagccccgcg gcgatggaga tgacggccgc cgccacaccc accagcagcg     43500
     agacctggcc gcccgccatc acgcgcgaga acacgtcgcg ccccagcgca tccgtgccca     43560
     gccaatgatc cgcgctggcc ggcttcaggc gcatcagcgg gttgatcgcg atcggatcgt     43620
     gcgggatgta cagataggcg gccgccgtgg ccaggaccag gaccgccagc accagcgcgg     43680
     cggcaatcgg cggccagccg aagcggcacc atgcgggcag ctgggtgacc cggaatacgg     43740
     cctgcagggc gctggccggc tgcggtagcg tggtcatcag tagcggatcc tcggatcgaa     43800
     aatggtatag gacagatcga tcaacagatt gatgaacacg tacagcgcgc tggtcagcag     43860
     gatcatcgcc tggatgaccg gatagtcgcg cgccagcacc gcgtccacgg tcaggcggcc     43920
     gatgccggga atgttgtaga cgctctcggt caccaccacg ccgacgatca gcagcgcgaa     43980
     ccccgtgccg atgatggtga cgatgggcac cgccgcgttg cccagcgcgt ggcgaaacag     44040
     cacgatgcgc tccttgacgc ccttggcccg cgccgtacgg atgtagtcct cgcccagcac     44100
     gtcgagcatg ctggccctgg tcatgcgcgc gatcagcgcc acgaataccg tggccagcgt     44160
     catgcagggc aggaccgccg tgcacaggaa ctgctgcgga tcctggaaca ccgaggtaaa     44220
     gccctgcacc ggcagccagc gcaggtccac ggcgaagatc ttcatcagga tgtagcccac     44280
     cacgaaagcc gggatcgaaa agccgatgac cgagaacgcc atcaccgcgt agtcgagcca     44340
     gctgcgatgc cgccatgcgg ccagcacccc cagcggcacc gcgatcagca ccgacaggat     44400
     gatggtcagg gtggcgatct gcagcgtcgg cccgacccgc tggccgatca gtttggtgac     44460
     cggctgcctg gaaatgatcg acgttcccag gtcgccggac gcaagctgcg tcatccaggt     44520
     gcggaactgc accgtcagcg gctcggtcag gcccagcgac ttgcggatgt tctcgatctg     44580
     ggcgggcgtg gccgaatcgc cggcgatgat ggccgccgcg tcgcccggcg tcaggcgcag     44640
     cagcaggaat acgaacaccg ccacgatcac cacgaccgga atcgtggcga gcacgcgccg     44700
     caggatgtaa ccgaacatcg gccgcccctt gtggattgag tcaggatggg gcggaccgcg     44760
     gcctctccag gccgccggtc cgccatggtg cgatggctac ttcttgtcca tctgccagaa     44820
     cacgggaacc ggcgacgcaa tgatgtcgac caggttggcg cggcgcccct ggaccgtctg     44880
     gaactggccc agcggcaggt aggtgacctc gtccatgacg cgcgcctgga tccgcttggc     44940
     cacgtccagc tgcgcctgcg gcgatccggc cgtgatgtac tcgccgcgca tcgcctccag     45000
     ctcgggatcc tgcgcccagc cgaagaagcc ctcgtcgccg cgcgcgttga gcgtggcgtt     45060
     gatcaacggc gtcgtaacct cgggcaccat ccagtaactg aagaacatgc tccagccgcc     45120
     ctgcgacggc gcgcccttgt tggtgcggcg ggtcaccagc gtctgccagt ccatcggctg     45180
     caggtccacc ttgaagccgg cggcgcgcaa ttgctgggcc gccaccagcg gcggcgcggc     45240
     gagaatgggc acatcggtcg gctgcaggat cacgacgggc gatccgtcat agcccgcctc     45300
     cttgagcagg gcgcgcgcgc cctccacgtc gcccttgccg gtcagggccc cggcgccggc     45360
     ttcggaggcc agcggcgtgc cgcagcccag caccgcgccg catacctggt aatacttggg     45420
     attgccgacc atggccgcca ggatgggctc ctggctcatg gccttgagcg cggcctggcg     45480
     tatccgcttg tcgttgaacg gcggctgctt gaaattcatg cgccccaggg cctggtagcc     45540
     cagttggtcg cgcacttcca gcaccacgtc ggcgttcgac tcgaggatgg gcagcagatc     45600
     ggtcggcgtc tgctccagat agtcgatctc gcccgacgac agcgcgctga ccgccgtctg     45660
     cgcgtccggc atggtcaccc agttggcccg gtcgaccttg accaccttgc cgcccgccat     45720
     ccagttggcc ggttcgttgc gcggcacgta tttgtcgaac ttcgcatacg ccaccttcac     45780
     gccgggcgag aactcgtcca ggacgaagcg gaacgggccg gagccggtgt agtcggtaat     45840
     ggcttcgctc gacggcgtcc tggccacccg cttgggcatg atgaacggcg gcaccgtcga     45900
     ctgcttgccc agggtttcca gcatcgggcc gaacggcttg ctcagtttcc aggtgatcgt     45960
     ccgggcgtca gtggcggcca ggctttcggt ctggtcgaaa atgtgctggc cgccggtgtc     46020
     gcgctcgccc cagcgcttga gcgaggccac cacatcggcc gccgtgaccg gcgccccgtc     46080
     gtggaaccac aggttctcgc gcagcgtgaa ggtgtaggtc agcccgtcgg gcgacacact     46140
     gaaatccgcc atctgcggcc ggacattgaa gtccttgtcc atcgagacca gcacgtcata     46200
     gatcatgtac ccatgattgc gcgtgatgtg ggccgtcgtg atgatggggt ccaggacgcg     46260
     cagccccgag tgcatgacgg ccgtcaccgt cttgggcgcc tgcgccgccg cggggaccgt     46320
     cgcggccagt ccgcagagcg cggccgccac ggccgccagg cgtgcgccgg cgcgtatctt     46380
     cacagcggga tcagccgcat tgcgtgcgat gaacatcgtt tcttcccctt gttgtgtcga     46440
     ctacatcaga gatgacttcg gtgaccggga acaactaaca tcgaaaacaa acttcggaac     46500
     ttaagtatcg ctgtaagata cttatatatt gtttgtgaca atcctaaatg agatatcgtc     46560
     agcccgtcaa taggaggaat tcatgcggcg cagtattgtc aacagcgaac tgggcgtcag     46620
     gtctcccacc gaagaagagc tcgaagaccc gttgttcgtg caggccgcgg cgagaaccct     46680
     gcaggtgctg tccgccttcc atcgcgcggt gcggcccatg agcctggacg aaatcgccga     46740
     ggcgtcggga gtgggccgca gcagcaccca gcgcattctc aacaccctgc gcgtgctcgg     46800
     ctatgtcgag cgcagcgacg gaggacgcgg ctacgtcccc ggcatacgca tcctcgacca     46860
     tgcgctggac tacctgcggc tcaataccct gatttcgcgc gcctcccccg tcctgctcga     46920
     cctgcggcgc aatgcgctgg agcgtgtcga cctcagcgtg ttcgacgacc tgcgattggt     46980
     ctacgcctcg cgcctgcaga gcaagcggga gaccttcttc gccaccctgg tggggcacag     47040
     cgtgcccacg ttctgcaccg ccggcgggcg agccatcctg tcccacctgc ccggcgccga     47100
     ggtcgacgac atcatcgccc gctccgaccg cgccccgttc acggacaaga ccatcaccgc     47160
     gctcagggag atccgcaaga aagtcgaaca ggcgcgcgtg tccggctacg ccgtcaccat     47220
     cgaggaggtg ctggtgggag agataggcat aggcgtggcg gtgctgggcg ccgacggccg     47280
     tccggtcggc gcgatacata tcgcgggctc gctgagcgag tggacgcccg aagccttcac     47340
     cgcgcgattc gcgccgctgg cggtggaagc cgccacggcc atcaatcgcc tgagctgaga     47400
     cggcgcccgc gccggcagcc cgtatccggg ccatgggctc gcgcgggcat gcccatggcc     47460
     gcgccttacg cggccgagcg cgccgcgccg cccacgggtt cggccacgaa gtccagcaga     47520
     tcgtggaaca gctcgcgcca gagccgatcg gacatcggaa atccagccac atgccgcatg     47580
     aaaaacgcac cttcggcagc aagaaaagca atgcgcaaca gccgctcttc ctgagtttcc     47640
     gccgagaact tgccgacgcg cgacgcgtac cacttcgcca tcacgccctc ggtcgcatcc     47700
     gagccgacca gcgccgtcag gaccgccgcc agccttgagt tggcctcgga cgattccttg     47760
     ccggtgatct tgacatgcct gcgcacacgc tcgcgcagcg acgattgcgg gccgatcttc     47820
     ttctggtagg cgcgctgttc cttgcgcagc cacctttcca gcaaggcctc catcatggcc     47880
     tcgcgcgtgc cgaacacgga ctggacgctc gccttggaca ggccggccgc ctcggccagc     47940
     ccgccaaagg agatcgtcac ggcgcccgcc tccgaaatga tggattcggc gatatccagc     48000
     aaacgctctc gatctatcgt gcggggtctg accatctagg tgtgaactgt caataggttg     48060
     tattcgtcca ggttgagtct ggagatgggt acagcgcgcc cgatgccttg gtggggtcga     48120
     tgccagttgt agtggtgtag ccaggatttc atggcatcgg ctcggtgttg ggagttctgg     48180
     taggtgtgag cgtaagccca ctcacgcaag gccgactgga tgaagcgttc ggccttgcca     48240
     ttggtctgtg ggcggtaagg tcgggtaaag cggtgcttga tgcccagctc atggcacagc     48300
     gcggcgaagg cgcggctgcg aaaggccgag ccattgtcgg tgagcaagcg ctggatggtc     48360
     acgcccaggc gctggtagta ggccactgcg tccttgagga actggacggc gctggggaag     48420
     cgctcgtcgg ggtggatgtc ggtgaaggcc acgcgggcgt ggtcatcgat ggccacgaag     48480
     acgaagtccc agccggcccc ctcaacggta tcgcgtcggt tgcccgtgac ccggtggcca     48540
     gggcgctgga tacgtcccag cttcttgatg tcgatgtgca gcagatcgcc gggggcctga     48600
     tgctcgtagc gcaccaccgg ctcggccggc tccaggtcgg ccaggtgcga cagaccggcg     48660
     cgggccagga cgcggctgac ggtgctggct gacacgccca gcgcctgggc gatgcgcgct     48720
     tgggtcagcc gcttgcggcg cagctccacg atagccagcg ccttggccgg cgcaatcgct     48780
     cggggcgaga ccgtcgggcg cgaggacgca tcggccaagc ccgcctggcc ctgagccagg     48840
     aagcggccca gccatttgcg cacagtcggc gcggtgaccc cataggcgcg ggccgcttca     48900
     ggcacacaaa cttgatgggc gatcaattgc tggaccattt cgagtcgacg taggaaggtc     48960
     aatcgggcat gcttatgggt gttcatccgg ccgggctcct tgagtgaact gggggggtgg     49020
     cgatttccag tttctcaaat ccggttcgga tgaaccatgc atacaaccta ttgaatcttc     49080
     acatctaggc gtccaaattc aattatgata cgatcatatg ataacaagtc ggagtcccgg     49140
     ggttcgtgtc gcctcgtgcc tccacctcgt gcctccatat ggcgcgtgac gccgcgcccg     49200
     ttgtcccgcc gcgagtccgg cctcactggc cgccgttggc gtaatgcaat atgaagtctc     49260
     ggccccgtct cggcaggggc ccatctactg gttggagagg acgctatgaa tagtgacgcc     49320
     ctcttccaat tggggatcgt tccggcatcg ctgaacacga cccaaacgga agacagaact     49380
     atcgtgaccg caacgcgaat cgcattcgcg tcggccgcgc gtgcgctgca tccgttgcat     49440
     ggcgcgctgc accacaaggc tggcacgctg cttccccact cggaccgaat gcgtacctga     49500
     ggccagcgcc gcgctgcggc gcgcctccac ccgccatcgc cttcacgggc tcccggcttc     49560
     gcggccgatc gcccggccac tttcctattg caacactcca cgcatggcct tgcgagcccc     49620
     gtgcgtggca ttgccccgcc atgttgaaaa cgccttacta cctgatcgac aaacgtgccc     49680
     tgctccagaa cctggaggtc atacgccgca tccgcgagcg atccggggcg aaggtcctgc     49740
     tcgcgctcaa gtgcttcgcc acctggagcg tattcgacct gatgcgcgag tacatggacg     49800
     gcacgacatc gtcgtcgctg ttcgaagtcc gcctgggccg cgagaaattc ggcggcgaga     49860
     cccatgccta cagcgtggcc tatgccgagg acgacatcga cgacgtggtc gcctgcgccg     49920
     acaagatcat cttcaactcg ctgtcgcagc tcgagcgcta cgcgccgcgc gcctcggcca     49980
     taccgcgggg gctgcgcctg aaccccggca tcagcgtgtc cggctatgac ctggccaacc     50040
     ccgccaggcc cttcagccgc ctgggcgaaa cggacctgga caggatcgcg caagccatgc     50100
     cgatgatcga cggcttcatg gtccacaaca attgcgagaa ccgcgatttc acccgcttcg     50160
     acgccctgct gaccgaactc gagcatcgct acggccacct gcttgggcaa atcaactgga     50220
     tcagcctggg cggcgggatc cacttcaccg agcccggata cgcgctggac gctttctgcg     50280
     accgcttgcg ccgcttctcg gagcagtacg gcgtccaggt atacctggag ccgggcgaag     50340
     cggccatcac caatacggcc acactggaag tgacggtgct ggacgtgatg cgcaacgaaa     50400
     agaacctggc catcgtcgac gcggcgaccg aagcccacat gctcgacctg ctgatctacc     50460
     gcatgagcgc gcgcgtgcag cccgaccagg gcccgcaccg ctatgtcatc tatggcaact     50520
     cctgcctggc gggcgacgtg ttcggcgaat tcagcttcga atcgccgctg caacccggtt     50580
     cgcggatttc catccaggac gccgcggggt acacgatggt caagaagaac tggttcaacg     50640
     gcgtgcgcat gcccgccatc gcgatccggg aactggatgg agaaattcgg ctggtgcggg     50700
     agttcggcta ccaggattac gtagacagcc tgtcctgagg aactggctct gttgattgaa     50760
     gcgaggtcaa aatgaaacga aacgtcctga ttatcggcgc cggcggcgtg gcgcacgtgg     50820
     tcgcgcacaa atgcgcgcag cacaacgcca cgctcggcga aatccacatc gcgtcgcgca     50880
     cgctggacaa ggcccaggga atcgtccgct cggtccatgc catgggcaac ctgcaaacca     50940
     acggcgtcgt gaaagcgcat ggcctgaacg cactggacat caaggcgacc gccgcgctca     51000
     tccgcgccac caatgcgcgc atcgtcatcc aggccggcac ctcgttcctg aacatggccg     51060
     tgctcgccgc atgcatcgaa accggcgcgg cctacatcga cacggccatc cacgaagacc     51120
     ccgcgaagac ctgcgaggcg ccgccctggt acgcgaacta cgagtggaag caggcgcagg     51180
     cctgcgccga cgccggcgtg accgcgatcc tgggcgcggg cttcgacccc ggcgtggtca     51240
     acgcctacgc taagctggcg gtcgacgaac tgttcgacga ggtcagctcg atcgacatca     51300
     tcgataccaa cgcgggctcg cacggcaagt acttcgccac caacttcgat cccgagatca     51360
     acttccgcga gttcaccgga tccgtctggt catggcagga aggccgctgg tgcgagaacc     51420
     gcatgttcga agagcagcgc gcctgggacc tgcccgtggt cggccgccag accacctacc     51480
     tgaccggcca tgacgagatc cactcgctgt cgacgcacct gaacgtcccc aacatccgct     51540
     tctggatggg cttcagcgac cactacatca acgtcttcac cgtgctgaac tccctcggcc     51600
     tgctgtccga gcaaccggtg cgcacggccg agggccagca ggtcgtcccg ctgaaagtgg     51660
     tcaaggccgt gctgcccgac cccgcgtccc tggcccgcac ctacaagggc aagacctgca     51720
     tcggcgacct ggtccgcggc gtcaaggacg gccgccccca tgaggtcctg atctacaacg     51780
     tgtgcgacca cgagcaggcc taccgcgaag tgggcagcca ggccatctcg tatacggccg     51840
     gcgtgcccgc caccgcggcc gcgctgctga tcgccgacgg cgcgtgggac aaccgcaaga     51900
     tgaacaacat cgagcaactc gcgccgcgcc cgtggctgca gctgctggag accatggggc     51960
     tgccgtcccg gatccgcgat gcgcacggcg accgcgcgct gctcagccca tgcgggaagc     52020
     tgctgaaagc cgcctgacgc cgccatcgcc ccggcctgcg ccatcccggg ccgggccccg     52080
     cgcgctggtc agctaggtgt gaagattcaa taggttgtat gcatggttca tccgaaccgg     52140
     atttgagaaa ctggaaatcg ccaccccccc agttcactca aggagcccgg ccggatgaac     52200
     acccataagc atgcccgatt gaccttccta cgtcgactcg aaatggtcca gcaattgatc     52260
     gcccatcaag tttgtgtgcc tgaagcggcc cgcgcctatg gggtcaccgc gccgactgtg     52320
     cgcaaatggc tgggccgctt cctggctcag ggccaggcgg gcttggccga tgcgtcctcg     52380
     cgcccgacgg tctcgccccg agcgattgcg ccggccaagg cgctggctat cgtggagctg     52440
     cgccgcaagc ggctgaccca agcgcgcatc gcccaggcgc tgggcgtgtc agccagcacc     52500
     gtcagccgcg tcctggcccg cgccggtctg tcgcacctgg ccgacctgga gccggccgag     52560
     ccggtggtgc gctacgagca tcaggccccc ggcgatctgc tgcacatcga catcaagaag     52620
     ctgggacgta tccagcgccc tggtcaccgg gtcacgggca accgacgcga taccgttgag     52680
     ggggccggct gggacttcgt cttcgtggcc atcgatgacc acgcccgcgt ggccttcacc     52740
     gacatccacc ccgacgagcg cttccccagc gccgtccagt tcctcaagga cgcagtggcc     52800
     tactaccagc gcctgggcgt gaccatccag cgcttgctca ccgacaatgg ctcggccttt     52860
     cgcagccgcg ccttcgccgc gctgtgccat gagctgggca tcaagcaccg ctttacccga     52920
     ccttaccgcc cacagaccaa tggcaaggcc gaacgcttca tccagtcggc cttgcgtgag     52980
     tgggcttacg ctcacaccta ccagaactcc caacaccgag ccgatgccat gaaatcctgg     53040
     ctacaccact acaactggca tcgaccccac caaggcatcg ggcgcgctgt acccatctcc     53100
     agactcaacc tggacgaata caacctattg acagttcaca gctaggcctg cctgcgccgc     53160
     cgcggtttgc caattcgcgc gaagtcttgg cgatttccac gctcggcccc acggcgccgg     53220
     gcggcctcca ttggtgccgg cagcgcaacg ctgtggccgt ttcgtacggc taccgcttca     53280
     atcgaacatt ccttatcctt atgccatgtc ccggcggcca gctggcctgg ccgccgccat     53340
     gaaccagggc gcttccgatt tccggaggcc aggcaccaac gcgcatccat gaagaaaaac     53400
     taccctgcct atttcgccgc cacgctcctg gcgctggctg gcctgtcggc gcaggccgcg     53460
     ccggtcgatt accggatcga tccggagcac accgaagtcg tggtcacctg ggaccacctg     53520
     ggcttctcca agcccacggc gcacgcgggc ggcgtcaccg gcgtggtgcg ctacgacgcg     53580
     gccagtccgg cggattcggc ggtcgatctg cgcataccgg tgtcgaagct gacttcgcac     53640
     gttcccaagc tggacgggat gctgcagggc gtccagttct tcgaggcagc caggtatccc     53700
     gatatccgct tcaagagcac ctcggtgacc gaccggggcg acggcaggct gcagatcgac     53760
     ggcatcctgc gcatcaaggg catcgacaag ccggtggtcc tgcaggcgcg ccggaacggg     53820
     cagggcatgc acccgatggc gcagcgtccc gccatcggtt tcgacgccac gacgacattg     53880
     aagcgcagcg atttcggcgt ggacgcgttc gcgccggatg tcagcgacga ggtccagctg     53940
     cgcatcacca tcgaggcggt cgcggaagcg gcgcgctgac gccggccgcg ttccctacca     54000
     tttgtacgtg acccggccca gcacggtcct gccttctccg tagaagcagg cataggtgca     54060
     cgaggccacg tagtccttgt cgaacaggtt gcgcacggtg agatcggccg tccagccttt     54120
     cagggacggg ctgcgcgccc cgaagtcgta gcgcagggcg gcgtcgaaca cggtgtagtc     54180
     gccgaccttg gcggcattgg tgttgttgta ggtcgagccc atgtagcgca cgccggcgcc     54240
     gatattcagc cccgccagcg caccggacgg gacggtgtag tcggaccata gcgacgccat     54300
     gttgcgcggc acggcctcgg gcgtgttgcc tagcgtgttg gagttgctct tggtgatttc     54360
     cgcgtcggta tacgtgtagg ccgcgatcag gttccagccc gaggccaggt tggcggtggc     54420
     cgacaattcg aggccgcgcg agcgcacctc gccttcctgc acgctgtaga cggggttggc     54480
     ggggtcggtc gtggggacgt tggtgcgcgt cagctcgaag acggatgcgg tgatgaacga     54540
     gttcgaacca ttgggctggt acttcacgcc ggcttcccac tgcttgccct tggtcgggtc     54600
     gaagggcgtg gtgccgcgtg cgggcgaggt ggtgccggcc tgcggctgga acgaagtcga     54660
     atagctggta tagggcgcca gaccgttgtc cgcaaggtag agcaggccgg tgcgccacgt     54720
     gaacgcgttg tcgccggtgc gggtattgac gccgctcagc ttgttcagcg tcgagccgtc     54780
     ggcattgtcg tagcggccgc tgagcaccac caccagtttg tcgtcgaact ttatctggtc     54840
     ctgcaagtac aggccgagct ggctgcgctt ctcgttggtg taggtgtccg gcttcgccgg     54900
     cagcagtacg tccgagccgt acgccggatc gaagaagtcg atcggggcga ggttgttgta     54960
     gccggcgtac tgtttgcggg tgaacgaggt ttcggtgtaa tcgaggccga acagcgtgtt     55020
     gtgcctgaag cggccggatt gccacgtggc ctcgaactgg ttgtcgatgc tcacgccgtg     55080
     ggcgtcatcg tcgcggcggt aggcgccgcg ctcggccgtg gagaagtcgc ttccgggcac     55140
     ccaggtccac cagtaggcgt ggttgacgcg gttgcgcgac tgggcgtagc ccaggttctg     55200
     cttgaattgc caggtgtcgt tgaagcggtg cgcaaactgg taccccacgt tggcgacctc     55260
     ctggtcccac ttgctccagt ccggctcgcc ggtgaagcgg tgacgcggga tgcggccgtt     55320
     ggggttgtac ttgaccgtgc cttcgagcgg gtagccggcg ttgttgatgg tcttgttctt     55380
     catgtagctc gccagcagcg tcagcgaggt gtccgggctg atgcgccagg tcagcgcggg     55440
     ggcgagatag tagcggtcgt ccgggacatg gtcgatcatc gtgtcggcat tgcgcgccag     55500
     gccggtcagg cggtaggtca gccgtccctc gtcgtcgatg cgtccgccga agtcgccggc     55560
     gagctgcctg ttgctgtgcg agccgccgct cagctgcagc tcgcgcagcg ggctgtctgt     55620
     cggccgcttg gataccacgt tgacgatgcc gcctggcgag gcctgtccgt acagcaccga     55680
     agcggggcct ttcacgacct cgatgcgttc gagcgcgtag ggttcggaca tcgcgctgta     55740
     atggggcagg gggattttca gcccgtcgcg gaacatgacg ccgggattgg tgcggacgtc     55800
     gaagccgcgg atgatgaaag gatcgtcggt gcggttgaat ccttcctgca ccacgatacc     55860
     gggcgtgtag cgcacggcgt cgcccagcgt ctgcggattc tgctcgcgga tctgcgcggc     55920
     ggtcaccacc gaaatggatt gcggtatttc gatcagcggc gtgtccgtct tggtgccggc     55980
     tgtcgtgcct gtggccacgt aggtgtcgga gtcaggcagg gcgccgacca cgctgattgc     56040
     cggcagcgtc gcagtcagcg gcatgggcgt gagcgtgacg gtgttgtgct ggatcgaata     56100
     gcggatgttg cggcctttca gcaggcgttc cagcgcttcg gcaggttcca tgcggccctg     56160
     cacggcgggg ctgcgctggc catcgaccag gtcctggctg tacaggacct gcaggttggc     56220
     ttgccggcca agctggtgca gggcttgggc caggttctgg ggcgggatat cgacgtcgat     56280
     gggcgcggcc tgtacgccag tgcccaggca ggcaagcgcg cccagcaggg cagggatcag     56340
     gcggcggggg cgcgacgatg agtgcagggc gcgggttgcc gcgctcggtc tggctcgcat     56400
     ggaatgttta accgaaaaga gattgaaagt aattaccact accaatctct aagacggaac     56460
     ggccagacct cctgggaatg caaaattgaa acaaaatgaa acgtcacgcg agtctcggcc     56520
     ggccgctgcg cggcgctatc gcaaacgtgc gccgcggctt atcgaggcgg gttgggaacc     56580
     agcgccaggc tgccgtcggc cttgcgtacc gtacgcacgg gcaggatgtc aggcagcgcg     56640
     cgggccagtt cgcccacatt gcgcacatcg taggtgccgc ccaggcgcag gcccgcgatg     56700
     gcgggatcca ccgccgtgta gcgcgcctcg gcgggcaggt agcggttgat ctgcatgatg     56760
     gcgtcgcgca gcgtggtgtt gtcgagcacc agcttgccgt ggcgccaggc cgcggactgc     56820
     gcgccgtcga cggcgcgcgt gacaggctcg ccgcgcccgg cgtagcgtgc ctgcgtcagc     56880
     ggttgcaggc ttaccgtctt gccggtggcg ctggcgcgca ggtccacgcg gccctcgacc     56940
     agcgtgacga cgacgttgtc gcccgatttc cagacattga atgccgtgcc ggtaacggtg     57000
     atcgtcccgg ccccggcttc gaccacgaag ggatggctgg cgtcgtggaa cacgcggaaa     57060
     taggcctccc cgtcgctcag gcgcacacgg cgcgcgtccc ggtagttgcg atacaccatg     57120
     gccgtgtcga tgttcatgtc gacttcggtg ccgtcgccca gcgtgaccgt ggccacccgc     57180
     gcatcgctgg cgtagcggtg gtaggaactg ggcagtacgg cgaaccacca gccggctgcc     57240
     cagcaggcca ggcccagcgc gcaggcgccc agcgcccggc gggcggcggg atagggacgg     57300
     cgccgcggcg cgcaggcctt ggccggcgcc tcatgggccg gcaggtcctg cgccagcgtc     57360
     cagatatcgc gcaccgcttc gtactcgcgg gcgtggcgcg gatctgcttc gagccaggct     57420
     tgcagcgccg cgcggtcctg ctcggaacag cacgcatcgt ggatgcgcac gcaccattgc     57480
     acggcctgct cggtcaggag gtcgtcctgc ttgctgggtg ggacagccat ggctgttaat     57540
     ataaatgaga tttgttacac atttggcgcc gtgcacggcc tgggggagag cacggtttca     57600
     ggcggcatta tgcaggattc cgcatttgcg ccttggtcgg tcgacgcggg ggaaggcctg     57660
     gatggagcag tactacacgg agttgttgcg gttccttgcg cgaaaactcg gcaattcgca     57720
     tgacgccgcc gatgtcgccc aggaggccta tgcgcgcgtg ctcgatcgca atggcagctg     57780
     cgccatcgtc cagccgcgcg catttctgtt ccgggccgcc ctgaatcttt gcacggacct     57840
     gtatcgcaac cgtcgcggca gccaggtcat gccgctggac gccgccgcag aagccgtccg     57900
     gtgcgaagcg ccgctgcagg acgagcggct ctaccgccgg cagcaactgg cgcggctgga     57960
     acgggccctg caggagttgc cgccggcctg ccgtcaggcc ttcctgatgc ggcaggtcga     58020
     aggcatgtcg cacgatgaaa tcgccaacag cctcggcatt tccgttgata tggtgcacaa     58080
     gcacctcacg cgcgcgctac ggcactgccg ctcccgctgc gcgcgtggga acacggcgcc     58140
     gatgcctagc tgtgaactgt caataggttg tattcgtcca ggttgagtct ggagatgggt     58200
     acagcgcgcc cgatgccttg gtggggtcga tgccagttgt agtggtgtag ccaggatttc     58260
     atggcatcgg ctcggtgttg ggagttctgg taggtgtgag cgtaagccca ctcacgcaag     58320
     gccgactgga tgaagcgttc ggccttgcca ttggtctgtg ggcggtaagg tcgggtaaag     58380
     cggtgcttga tgcccagctc atggcacagc gcggcgaagg cgcggctgcg aaaggccgag     58440
     ccattgtcgg tgagcaagcg ctggatggtc acgcccaggc gctggtagta ggccactgcg     58500
     tccttgagga actggacggc gctggggaag cgctcgtcgg ggtggatgtc ggtgaaggcc     58560
     acgcgggcgt ggtcatcgat ggccacgaag acgaagtccc agccggcccc ctcaacggta     58620
     tcgcgtcggt tgcccgtgac ccggtgacca gggcgctgga tacgtcccag cttcttgatg     58680
     tcgatgtgca gcagatcgcc gggggcctga tgctcgtagc gcaccaccgg ctcggccggc     58740
     tccaggtcgg ccaggtgcga cagaccggcg cgggccagga cgcggctgac ggtgctggct     58800
     gacacgccca gcgcctgggc gatgcgcgct tgggtcagcc gcttgcggcg cagctccacg     58860
     atagccagcg ccttggccgg cgcaatcgct cggggcgaga ccgtcgggcg cgaggacgca     58920
     tcggccaagc ccgcctggcc ctgagccagg aagcggccca gccatttgcg cacagtcggc     58980
     gcggtgaccc cataggcgcg ggccgcttca ggcacacaaa cttgatgggc gatcaattgc     59040
     tggaccattt cgagtcgacg taggaaggtc aatcgggcat gcttatgggt gttcatccgg     59100
     ccgggctcct tgagtgaact gggggggtgg cgatttccag tttctcaaat ccggttcgga     59160
     tgaaccatgc atacaaccta ttgaatcttc acacctaggc gggtcaatcg cgcatgctta     59220
     tggttgttca tccagtgtcc tgccctgagt tgcgatggcg tggtaaccac ggcatcccag     59280
     gtccggcctg gatgaacaac ctattgagac atcacagcta gagcgaggcg cgctgcttga     59340
     tcgagaagcc gggcagcagg gcgctgacct ggccggccaa gtcgacgatc agcgccgcgg     59400
     tgtcggcatc ttccacggcg gcgcagttcg ccagcagggc gacgccctgg gcgatcagcg     59460
     ccacgccggc atcgtgctcg tgccagccgg cccgcaacag gctgcggtgc aggccgccgc     59520
     gcaggatggc gtcgaattgc gcctgcagcg ccgcgcgcgc cagcaccggc ctgggcgcct     59580
     gggcgcggcg cgccacgaag gtggtgcagg tgttgacggc ctcggatgcc agggcgcgcg     59640
     gccgcgcctt gcgctcgatg ctcaacggtt gcacgctgtt gatcgtgaag ggcgcggcgc     59700
     ggaacgccgt caccagggcg gcccagccca gtaccgaggc atggctgtag acgaaggcca     59760
     gcaggccgtc gggcttgagc acccgggccg cttcgcgcag cgcctggccc agccgtgcgc     59820
     agtattcgtc gtgagccgcg cgcgcgctgc cgccggcgcg ctgccgcgag gccaccagtt     59880
     cgtcatggcc gctattggcg gtcggcacat ggggcggcgt tgtcgggcgg ttttcgatag     59940
     cgtcgataag cggtttcttc catgcataga agaaatctgc cagaacgctg tagaaaatat     60000
     tgtcgtaata gggcgggtcg gtaacgatgg cgtcgaagct gtcgtccgga tagggcagcg     60060
     cggcggccga ggcgcgctgc acctgcaccg gccggcgcag cagcgccagc gcgtcgatgc     60120
     cggcgcagat gcgttccagc ttggcgtgga ggttgcccgg cccggtgccg accggatcga     60180
     cttcggcata gtcccacagc atggccacgc ccgggccgca gaaggcgcgt ccgacctgct     60240
     cgttctgcgg aatccacatc gacagccggc agttccagtc caccatctgg tcgatcaggc     60300
     cgctgagcga ggcgctgacg aagcgcgcga cgtcggcgcc gtgcgcggcc tgcagcgtac     60360
     gatgctcggc cagcagttcc tccagcagca tcagcgtgac caggcgttgg cgcggattga     60420
     acaggtcggc gtggccgcgc atgccgtaga gcgccgggtt gacgatgccc gaccaggccg     60480
     gcagggtggt cgcgggcagg gccaggccgg tgcgctgcag cagcgtttct tcctgttcgc     60540
     gcagcaggcc ggccgcgggc aaggcatcgt cgcgcagggc gaattgcttg cccacgccgg     60600
     ccgacgtgac caccgccacg caatggtcgg cgctgtcggc gatgccgggc gtggcggtgg     60660
     cgctgcagcg cgggcaggcc gtcgcgccgc gtccggccca gcgcgatggg ggcggctcgc     60720
     catccggcag cgacaccatg tcgacgccgt cgccatcggg gccgggcgtg gccaccatgg     60780
     ccagcgcctt gccggccttc ttcgacagcc agggccgccg cgacagcgta taggcgtagc     60840
     cgcattgcgg acaggcgtgg cggtaggtcc agagatagac gatgggtttt tccgcctggc     60900
     tggccaggcg gccgcgcaac ggatacaggg tctcggtgcg ccgggccagc cgttgcagca     60960
     ccgcctggcc gtgccggtgc gccagctgct tgagcaggcc atggtccagc gtggcgccgt     61020
     aggtcaggtt ggcctgctgc aggaataccg cgagttcatt gacgtcgatg gagtgggcgt     61080
     cgcagcccag cagcgccgcc tcgaaagcga tcgtgccgcc gccgccgaac atatccagca     61140
     cgcgcggcgc gccgccgtac tggccggcca gctccgcggc ggcctcggcc agcagcccgg     61200
     gctgcggcac gggggtggcg cccagttcgg acaggcgcgc cgcggcgcgc ttgtcggcgg     61260
     gcgcgcgtaa ggcggcgtag accagcgcgc gcatggccga atgggggcgg cgcgcccacc     61320
     atacgtggat ggtgtgcggc gtttcgccgc gcccgtagcg ttcggccttg ccggccaggg     61380
     acgcttcgta gaacgacagt ccttcgtcga tcagccggcc cggtccggcc accggcgcca     61440
     gccgcgggac gggggccgcg gcgggtcgac ggacgcggcg cggcgccgcg ggcttgcggg     61500
     aggggggcgg catgtatctc gctgaaataa aggcgcgcgc ccggtggggc gcggcagggg     61560
     cattattcca tatcgcgggc cgcgttcagc gctcgcgcgg ccacggcggc gcgcggccgt     61620
     agtcggcatg gcaggcgtcg atgaaggtgc gcacgagctg ttcgagcagc agcttgtcgc     61680
     gggcgctgag cgcctggtag cgggcgtggg cgacggcgcg aaacggccac ggcgcggcag     61740
     cacgttcgcc gcccggctcc atcaggccgg ggcgccaggc agccgggccg ctggggtagg     61800
     cttcgagctc catcgggccc acgccggttt cgaaccagtc caggtttacc tgcagggcga     61860
     tcgccagctt gcggatcgag cggctggatt ggcgcaggcc gttttcgtag ctggccacgg     61920
     cgctttgcga cagaccgctg atgtgcgcca ggttttcttg cgagagctgg cgcagtcgcc     61980
     gagcatgctt caatcggtcc gaaaatttct tcactaggtg tgaagattca ataggttgta     62040
     tgcatggttc atccgaaccg gatttgagaa actggaaatc gccaaccccc cagttcactc     62100
     aaggagcccg gccggatgaa cacccataag catgcccgat tgaccttcct acgtcgactc     62160
     gaaatggtcc agcaattgat cgcccatcaa gtttgtgtgc ctgaagcggc ccgcgcctat     62220
     ggggtcaccg cgccgactgt gcgcaaatgg ctgggccgct tcctggctca gggccaggcg     62280
     ggcttggccg atgcgtcctc gcgcccgacg gtctcgcccc gagcgattgc gccggccaag     62340
     gcgctggcta tcgtggagct gcgccgcaag cggctgaccc aagcgcgcat cgcccaggcg     62400
     ctgggcgtgt cagccacacc gtcagccgcg tcctggcccg cgcccgtctg tcgcacctgg     62460
     ccgacctgga gccggccgag ccggtggtgc gctacgagca tcaggccccg gcgatctgct     62520
     gcacatcgac atcaagaagc tgggacgtat ccagcgccct ggccaccggg tcacgggcaa     62580
     ccgacgcgat accgttgagg gggccggctg ggacttcgtc ttcgtggcca tcgatgacca     62640
     cgcccgcgtg gccttcaccg acatccaccc cgacgagcgc ttcccagcgc cgtccagttc     62700
     ctcaaggacg cagtggccta ctaccagcgc ctgggcgtga ccatccagcg cttgctcacc     62760
     gacaatggct cggcctttcg cagccgcgcc ttcgccgcgc tgtgccatga gctgggcatc     62820
     aagcaccgct ttacccgacc ttaccgccca cagaccaatg gcaaggccga acgcttcatc     62880
     cagtcggcct tgcgtgagtg ggcttacgct cacacctacc agaactccca acaccgagcc     62940
     gatgccatga aatcctggct acaccactac aactggcatc gaccccacca aggcatcggg     63000
     cgcgctgtac ccatctccag actcaacctg gacgaataca acctattgac agttcacaac     63060
     tagccgattg aatcttgcca atccattacg atggtagttg gaaaattacc ttagtgttga     63120
     tatgctcggg cttcggttcc aggcaggcgg gcggcgcaca ccggcatcag catttgcatc     63180
     agtgcttgcg cgcgcggccg cggccgtcgg cgtattcggc atggcaggct tcgacaaagc     63240
     tgcgcagcat ctgttcaagc aggcgtttgt cgcgggcggc cagtgcttcg tactgcgcac     63300
     gcgcaatggt cgtgaacggc cacggcggca gcgcgcgcgg cggcgcttcg ccactgcccg     63360
     gttccatcag gtagtaagcg ccgccagcgg gcgaagcgct gtagtcggcc aggctttcca     63420
     tcgagccctt gccggtctcc agccagtcca ggttcacctg cagggcggcc gccagcttgc     63480
     gaaccgaacg gctggattgc cgttggccgt tctcgtagct ggctaccgcg ctttgcgaca     63540
     ggccgctggc gcgcgccaga tcctgttgcg ttagcgaacg cagtgcccgc gcatgtttca     63600
     atcggtctga gaatgtcttc acggcctgat tgaatcgtgc gaatcaagca ctatggtggt     63660
     tgaatttatt acgttagtgt tgaaatgtcc acctattcca ttcctgacga ttcctgcgcc     63720
     ggccgcatat tgttggcgtt cagcagcgtg atgatcgaag cgcgcgtcca gctcgaggct     63780
     ggctggcggc aggccggctg gatcgtcgac tggtgcgagg gccagcatgc gctggcgcgg     63840
     ctgctggcca tgcacccgcc cgatgcggtg gctctgtgcg gcgtggccgg cacgctgtcc     63900
     ggcctggttc gcaccacccg caccagcgtg cccgccgcgg tggtggtggc cttgctgtcc     63960
     gagggcggcc tgccggagcg tatcgccatg atgcgcgccg gcgtcgacct gtgctggccg     64020
     atcgagacgc aggtcgaaga ggtggccgcg atggtggatg cgttcgcgcg ccggggcacg     64080
     gcctcggccg ccgcggccag cgcctggtac ctcagcaatg ccggccgggt cctggccggg     64140
     cctggcggcg tgcgcctgcc cctgaccgtc gccgagcgcg agttcatggc gcgcttgctg     64200
     gccgctcccg gccatcgcct ggcgcgccag cagcttgcct gcggtttcag gcagcgcggc     64260
     gttcaggatg gcgcgcctgt ctcgtccgag gtgctgcctt cgtggacggc caattcttcg     64320
     catgccgcgt cgtatgacgc ggccgcgggc ctgtcgcgca acgtcgacgt catggtctcg     64380
     cgtctgcgcg ccaaggcgca gcgcatgggc atcaatctgc ccttgctgtc ggtgcgccgc     64440
     tgggggtacc tgttcatcgc cgacagcgac gcgggctgac ttgctgcgcg aagccgccgc     64500
     tcgtactgcc tgataaacaa tccggggcat cgggcgcgca cggaactggc ctacacctgg     64560
     cacgccatgg acggtcagga atacaggaca aatcggaggg gcttgtccgg catgttggtt     64620
     ggtgttgccg gacagtccag cggctcaggt gacgaccagg ttgtcgcggt gcatcagttc     64680
     cgggtctgtc atgctgccca ggatgcgcgc gatctggctc gacggctggc gcaggatgcg     64740
     ccgggtatcg gccgacgaat aattgatcag gccgcgcgcg cactcgcgtc catgcatgtc     64800
     gacgcaggcc acgacgtcgc cgcgctcgaa ctcgccctgg acttcggcca cgccgatggg     64860
     cagcaggctc ttgccctcgt gcagcagggc atgcacggcg ccatcatcga gcaccacgcg     64920
     gccgcgcagg cgcaggtggt cggccagcca ttgcttgcgc gccgaccata ccggcaggac     64980
     cgcgcgcaat tccgtgccga tgcattcgcc ttgcgccagg cgggtcagca cattgcgttc     65040
     gcggcctgat gcgatgacgg tatgggcgcc gctgtgggcg gcccgcttgg ccgccaggat     65100
     cttggtgagc atgccgccgg tgcccacgcc gctgccggcg ccgccggcca tggcttccag     65160
     ggcggcatcg ccggcttgcg catgcgccac gaagcgcgcg gccgggtcgc ggcgcgggtc     65220
     ggcttcgtac aggccgcgct ggtcggtcag gatgatgagc gcatcggctt cgatcaggtt     65280
     ggtgaccagg gcgcccaggg tgtcgttgtc gccgaagcgg atttcgtcgg tgacgacggt     65340
     gtcgttttcg ttgacgatgg gcactacgcc caggcgcagc agggcgaaca gggtcgagcg     65400
     cgcattcagg tagcggtgcc ggtcggccag gtcttcgtgg gtgagcagga tctgcgcggt     65460
     gcgcaggccg aactcggcga aggcggcttc gtaagcctgg cacaggccca tctggcccac     65520
     ggcggcggcg gcctgcaatt cgtgcatggc cgaagggcgc ttgcgccagc ccagccgcgc     65580
     catgccttcg gcaatggcgc cgctggaaac cagcacgacc tgcttgccct gctggtgcag     65640
     ggcggcgatc tgggctgccc agtggcctac cgcggcgcga tcgaggcccc ggccttcgtt     65700
     ggtgaccagc gaggaaccca ctttggcgac cagccgattg gccgcggaaa tgacagaaac     65760
     ggcagaggtt tgggcagtca tggcgatgac cggtgtggcg tttcgagggc tgccgcgcga     65820
     tgcgcggcgg gtgacggagt gcgggaaagg gttattcgtc accgccaggc ggcgtggcgg     65880
     gcgcggcgcc gccacggctg gcgtcgaaac gcggatcttc gaacacatag gtgccgtcgg     65940
     cctggtcctg ggcgtcctgg tccttgcgct tttcggcgtc gaggtagtcc tgcagggccc     66000
     agatcaggtc ctgggtgcct tcgccgttga ggccggagat cgcgaagacc gggccggtcc     66060
     agccgaattc ggcgcagaag cgctgctggg cgtcctgggc gtcgggcacc atgtccagct     66120
     tgttgagcac cagccagcgg ggcttggcgg ccagctcggg atcgtagcgg cgcagttctt     66180
     cgacgatggc gttggcatcg acgaccgcct gctcgatggg atcggcttcc gggtcggggc     66240
     tggagatatc gaccaggtgc agcaatacgc gcgtgcgcgc caggtggcgc aggaacaggt     66300
     ggcccaggcc ggcgccctcg gaggcgcctt cgatcaggcc gggaatgtcc gccaccacga     66360
     agctgcgcga gggcgaggtg cgcaccacgc ccaggttggg gtgcagcgtc gtgaaggggt     66420
     agtcggcgat cttgggccgc gcgttcgaaa tgcggctgat cagcgtcgac ttgccggcat     66480
     tgggcagccc gagcaggccg acgtcggcca gcaccttgag ctccatgcgc aggcggcgct     66540
     gttcgccttc cttgccgggc gtccattggc gcggcgcgcg attggtgctg gacttgaaat     66600
     ggatgttgcc catgccgccg gcgccgcccg cggccagcgt gaccttctgg tcgtgccggt     66660
     ccaggtcgaa cagcacctcg ccggtatcgg cgtcgtgcac cacggtgccc accggcacgc     66720
     gcagggtgat gtcgggggcc gctgccccgt attggtccga gccgcggccg ttctcgccgt     66780
     tcttggcgcg atgcaggcgg gcgtagcgga agtcgatcag ggtgttgata ttgcggtcgg     66840
     ccacggcata gatgctgccg ccgcgcccgc cgtcgccgcc gtccgggccg cccttgggga     66900
     tgaatttttc gcgccgaaag ctggccacgc cattgccgcc cttgccggcg atgacttcaa     66960
     tggtggcttc gtctacgaat ttcatgatct ttggtggcta ttcggtgtct gcccgccagg     67020
     cgggcggatg ttgcgccgcg gcggcgcggc cgtgcggttc cggctattct gcctgaaaac     67080
     aaaaagccct gccgcgtgcg gcagggctcg ccgttccggg gaacgcgcag ccgattactc     67140
     ggcggcgacc accgagacgg tgggtttgtt cagggcgccc ttgacgctga agtgcacctt     67200
     gccgttggcc agggcaaaca gggtgtggtc cttgcccacg ccgacgttca cgccggggtg     67260
     aaagcgggtg ccacgctggc gcacgatgat cgagccagcc aggatgcttt ggccgccata     67320
     caccttgacg cccagtcgtt tcgattccga gtcgcggccg ttccgggtag aaccgccgcc     67380
     ctttttctgt gccatgttta gctcctgcta attaggtacc gggccgtatc aagccgtgat     67440
     ggcttcgatg cggatctcgg tgtagttctg acggtggcct tggtgcttct ggtagtgctt     67500
     gcgacggcgc atcttgaaga tcttgatctt gtcgtgccgg ccatgtgcaa gaaccgtcgc     67560
     cttgaccacg gcgccggaga cgagcggcgt gccaactttc agctggtcgc cttcgcccac     67620
     ggacagcact tggtccaggg tgatttcttg cccaatgtca gcaggtatct gttctacctt     67680
     gagtttttcg ccggtggcaa cgcgatactg cttgccgccg gtttttatga ccgcgtacat     67740
     gggatatatc cttaaattga aatgtggatt gcaggcattt gcatggcctg cggtgcaaca     67800
     ctggctctcg caaggtgcgc aaggcttggc cggcgcaccc gcgtgtttcc cagtaatgcc     67860
     catccaggca ccgtgcggtg cgggcaatcc aggcgcaatt cggccaaaga ccgaatcgac     67920
     gattctagtc cgcgcctgtg gaaaagtcaa aaagccgtgc tgggctaagg gcttagggcg     67980
     gcgggagagg gctgcggcgg cccgcgcgct gtggcgtgcg ggccacaggc gcggcgtcca     68040
     atcgccgcgg gcgcggtctt gcgcggcgcc gggtgcggcc ctagactcgc gcgattcttc     68100
     ctggcggccc tgccgtttgc aacggcccgg cgatgccccg gcgtcctctt ggagattgct     68160
     ggccatggcg gtacctcatg acgacttgcc cgaagacctg gagcgcgcct tgctggttgg     68220
     ccgcgtgtgg cagccggcgc ccgtcgacgg gccatgcgtg gtggcggtgc ggggcgggcg     68280
     gctgtacgac ctgaccgcgg tgacgccgac gctggccgac ctgctcgatc gcggcgaccg     68340
     cgttgcgctg gcgcgcaatg ccgccggcga atgcctgggg ccggcggccg attggctggc     68400
     cggccgcgcc gccggggcga tgctggcccc gtgcgacctg cagccggtca aggccgccgg     68460
     cgcgaccttc gcggccagcc tggtcgagcg gataggcgcg gaacaggccg gcggcgacgc     68520
     cggtcgcgcc gcggcggtgc gcgagcgcat cgccgggctg atcggcaccg acctgtcgca     68580
     gttgcggccg ggttcgcccg aggcggcgcg cctgaaggcc gtcctgtggg cgcggggaat     68640
     gtggtcgcca tatctcgaag tgggactcgg ccccgatgcc gaggtgtttt ccaaggcgcc     68700
     gcccatggcc tcggtgggat atgggtcctg gatcgggctg ttgccggagt ccgagtggaa     68760
     caacccggag ccggagatcg tgctggcggt ggacgcgcgc ggccaggcgg tgggcgcgac     68820
     cctgggcaac gacgtcaacc tgcacgatgt cgaggcgcgc agcgcgctgc tgcagaaccg     68880
     ggccaaggac aacaacggct cgtgtgccat ggggccgttc gtgcgcctgt tcgacgccag     68940
     ctacggactg ggcgatgtgc gccgcgccga cgtgcggctg cgcatcgagg ggcaggagga     69000
     cggtttcgtg ctggacgcca cgagccacat gcgcgagatc agccgcgacc cgctcgaact     69060
     ggtgcgccag acctgcggcg gccatcatca gtatccggat gggtttatgc ttttccttgg     69120
     caccatgttt tcgcccaccc aggaccgcgc cgccgccggc cgcggtttca cgcaccgccc     69180
     gggcgacctg gtacgcattg cctcgccgcg gctgggggcg ctggtcaatc gcgtaggcct     69240
     ggccaccgcc atcgcgccct ggacgttcgg cgtgcgggcg ctctatgcca atctgcgccg     69300
     ccgtggcctg tagcggtccg gcgggtcctg ggcagaccgt ataattcggc cgacgtgtgc     69360
     cggcgctgcg tgcgccgggt atgagtgtgc gagccgccgg ccggctccct tacctgtcgg     69420
     atacgccttg aatctccctg agttgattgc ccctattgcc gacgacatga aggctgtcga     69480
     cacggtcatc cgcgaccggc tgaattccga tgtcgtgctg atccgcacca tcggcgacta     69540
     catcatcggc gccggcggca agcgcatgcg gcccgccatg gtgctgatgg tggcgcgcgc     69600
     gctcggctac cagggcacgc accaccagtt gctggccgcg gtcgtcgagt tcatccacac     69660
     cgccacgctg ctgcatgacg acgtggtcga cgagtcggac ctgcgccgtg gccgcgacac     69720
     ggccaacgcc gtgttcggca acgccgccag cgtgctggtg ggcgattacc tgtattcgcg     69780
     ttcgttcgag atgatggtcg aggccgactc gatgcgcatc atgcagatcc tgtcgcaggc     69840
     caccacggtg atcgccgaag gcgaggtgct gcagctgctc aacgtgcacg accccgatgt     69900
     gtcgcaggag cgctacctgc aggtggtgcg ctacaagacc gccaagctgt tcgaggccgc     69960
     agcccaggtc ggcgcggtgc tggctggcgc cagccccgag caggagaccg ccgcggccgc     70020
     ctatgggcgc cacgtcggca ccgccttcca gctggtcgac gacgtgctgg actacagcgg     70080
     cgatgcccac gccttgggca agaacgtggg cgacgacctg cgcgagggca agcccacgct     70140
     gcccctgatc cgcgtcatgg agacgggcac gcccgagcag cgcgagctga tccgcgaggc     70200
     gatcaagacc ggccaggccg acttcgccgc ggtggcccag gccatccagg ccaccgacgc     70260
     cctggcgcat gcgcgccagg ccgccgaaaa cgaggccgaa cttgcccgac aggcgctgtc     70320
     ggccttcccg gtttcccttt atcaaaaatc tctgctagaa ttctgcgctt tcgcggtgaa     70380
     tagagatcgt tgatcgaaat ccaggcgccg gggaagaaaa aaagcaagac agcaagaatc     70440
     ggggcgtagc tcagcctggt agagtactgc gttcgggacg caggagtcgg aggttcgaat     70500
     cctctcgccc cgaccaactt ccgttggtcg aatttcccgg gtggcgccat gtgcgttgcc     70560
     agcccacaag ccgtacagcg aaggggcgca tagcgaaagc cgataccgca aacgtggtgt     70620
     cggctttttt gcgttcgcgc cgcgtcttcg gcgcggcggg ctcagcccgc ctggcgccgc     70680
     gcccgcttgc ggccggcgct gatttcatag cattcgcaga aggtctgggc cagcaggctc     70740
     agcgggctgc tggacggata caccaggtac gtcgagaagc ggatgtccgg cgcgaacggc     70800
     ttgatggcga tgtccagcga gcgaaagccg tcggccacgt ccgggttggc gatgctcacg     70860
     cccagtccca ggccgaccat gtggcagatg gcggcggcga agaccttgtc gatttccttg     70920
     cgcatggcgt cgttgggcga aagcgataga aagcgctcgc cggccaggtc cgccggcgcg     70980
     agggcgcgcg gcatcccggc cagccggtgg ccggccggga cgatgcatac gcccagcgct     71040
     tcgctggcca cgtggtggcc gatgccgggg ctgctgaata tgtccgaggc cacgccgatg     71100
     tcgctatagc ccgcggcggt ccattggcag accgtgatcg agtcggccac gtgcatggac     71160
     accgtgacgt cggggaagcg ctcggcgaac agctgcatgg cctcgggtac cgtgaccagg     71220
     gcgggcgagg gcacggccga gatgcgcagg tggccggtgc cgcgcctgcg cagggtggcg     71280
     gcggagcttt ccaggctgcg caggcccgcg aacgtcatct cgacgtcgcg aaagaacacc     71340
     tcgccttcgc gcgtgggcac cagcttgccg gccacgcgct cgaacaggcg caacccgatg     71400
     cgcgcctcca gctgggcgat gacccggctg acgttgggct gcgtggtatg caggtccttg     71460
     gccgcctgtg tcatggagcg cgtcagcatg actgcccgga aagtctcgac ctggcgaaag     71520
     ttcagcatgg gtcatatcaa ttttgcatgg accatgatga taatccaatt agtcatatgg     71580
     ggtgcgagtc cataacatgg ccgcatcgac atcagggagg gcgccaccgg gcctcccgac     71640
     tttaaggaac gtgccccaat gagccttcgg atcggagtgg acatcggcgg gtccttcgcg     71700
     gactttgccg tgctggatga atccacgcga acaattcaaa ccctgaaagt cttctcccgc     71760
     ccggacgcgc cgggcagcga ggtcctggct ggcatcgagc agctgaaggc gcggcatggc     71820
     ctggatccgg cccaggtgtc gtacttcacg cacggcacga cggtgggggt caacgccgtg     71880
     gtgcagcgcc gcggcttgaa gctggcgctg atcaccacgc gcaacttcga ggacgtgctg     71940
     gacatcggcc ggctgaagat tcccgacatg taccacctca tgtccaagcg gccggcgccg     72000
     ctgatttcgc gcgaccgggt gttcggcgtg gacgaacggc tgggcgccga tggcagcgtg     72060
     gtcgcgccgg tggacgaggc cagcgtgctg gcggcggccg aggcgctgcg cgaggccggc     72120
     tgcgaaggcg tggtcgtctc gctgctgcat gcctaccgca acccggccca tgaacggcag     72180
     gtcaaggcga tcctgcagcg cgcgctgccg ggaatgttcg tgtcctgctc gcatgaggtc     72240
     tggccgatca tccgcgaata cgaacgtacg ctgaccgcca ccatcggcgg ctatgtgcag     72300
     ccgcgcgtct cgcattacct ggaaagcctg cagggcgcgc tgcgcgagag cggggtgccg     72360
     gtggacctca aggtcaccaa gtccaacggc ggcgtgatga gcgccgagca tggcaaggcc     72420
     aattgcgtac agatgatcct gtcgggcacc gcctcggggg tgatcggcgc ggcctacatc     72480
     gccgatctgt gccatatccc gaactgcatg agcctggata tcggcggcac gactgccgat     72540
     atcgccctga tcgtcgacgg caagccgcag ttcgccacgg gcgagtacat cggcgacttc     72600
     cagatccata ttccctcggt atcggtgtcg tcggtgggcg acggcggcgg gtcgatcgcc     72660
     tgggtggacg aactgggcgt gctgaaggtg gggcaccaga gcgcgggttc cacgcccggg     72720
     ccggtgtgct acggcaaggg cggcacccaa cccaccatta ccgacgcgtt cgcggtcatg     72780
     ggcgtgatcg gctcgcagca actgggctac aacgcggtcc aggtcgacgt cgaggcggcg     72840
     cgccggtcga tcgagccgct ggccgaaaaa ctgggcaccg acgtgctgcg gaccgccgag     72900
     gccatcgtca acgtgtcggt gtccagcatg tacgcgggcg tgagccgggt gatttcgcgc     72960
     ttcggcatcg atccgcgcgt gttcagcctg atgccgttcg gcggcgccgg cccgatgctg     73020
     gcctgctacc tggccaaggc cctgaaggtg cagaaactgc tggtacccac cacgccgggc     73080
     gtgctgagcg cgctgggcgg gctgatcgcg gatgtgaaga acgatttcgt gcgcaccacg     73140
     tactgcgacc tcaatgccgc caccgtgggc tcgctggccc aggcggccag cgagctggag     73200
     gcgcaggcac gcgcgtggct ggtggccgag gtcggcaccg acgcggacgc cgagatcgat     73260
     atttccgccg acatgcgtta tcgcggccag tcgttcgaga tcgatacccc ggtcgagcgg     73320
     gcatggctgg aggcgggcgc catcgacagc ctgagccagg cctttcacaa ggagcacgaa     73380
     cggctgtacg ggcacggcga cgccagcgcg ggcgtgcagg tcgtggcgat gcggctggtc     73440
     attacgtcca ggacgcccaa gcccgagctc aaccatatcg cccagggcgc cggcgtgccg     73500
     ccgcgcgaat ccaccctgcg catctggctg gagggccagt accgcgacgt gccgctgtac     73560
     cggtgcgaga agctgctggc cggccaggcc ttcagcggtc ccgccatcgt ggcccaggac     73620
     gattgcacca cctgcgtgct gcccggcttc gacgcgcgcg tcgataccta cggcaacctg     73680
     gaactcaccg cgctcgcgct gaactgacct ggacagggca tcacatgaac ttcgacaaaa     73740
     ccgtactgca gatcttcgcg aactactgcg tggccgccgc ggaaagcatg gcgcatacgc     73800
     tcatgcgcac cgcgcactcc gcgttcgtga aggaaaccga ggacttctcc tgcaccatca     73860
     tgacgccgcg gggacagacg ttcgcctcgc ccaagacgtt gggcgcgacc tggtacccgg     73920
     gcctggattt cagcggcgcc atcgacatga tcgacggcta cgagccgggc gacatctgca     73980
     tgaccaacga cgcgtacagc ggctatgtgg ccacgcatac gcccgacatc atgatgtgga     74040
     agccggtgta ttaccagggc gagatggtgt gcttcgtggg cggccatatc cacaacaccg     74100
     acatgggcgg agcggtgccg gcgtccctgt cgcgcaccct gaccgaggtg caccaggaag     74160
     ggatacgctt cccgcccacc aagatcgtgc gccgcggcgt gctcaacgag gaactgatgc     74220
     gcctgatgga gctcaacgtg cgctcgcccg accagaaccg gggcgacctg caggcgcaga     74280
     cggccatgct catgaccggc gagcgccgta tcgtcgagat catcgagcgc ttcggactgc     74340
     aggctttcaa ggaaggcatg gcggcgatgc tcgattattc ggagcagcag gcgcgcgcca     74400
     ttgtgcgcgc catgcctgac ggcgaatatt tcttcgccga gtacgccaac gaggattcgc     74460
     tcaacggcaa gccgctgcgc gtggcgatca ccctgcgcat ccgcggcgac gagctggagt     74520
     tcgacttcac cggcagcgat ccgcagctga cctcgtcgct gaacatgccc accggcggca     74580
     aggagcgcca cgtgctggcc ctggtcggcc tgaactacgt gctgtattcg ctcaacccgg     74640
     agatcctgct caatgccggc atgctgcgcg tggcgcgctg catcctgccg gagggctcgg     74700
     tggtcaatcc gctggcgccg gcggcggtgg gcatgcgcag cctgacctgc aaggtggtgc     74760
     agtacgccac catgggggtg ttctcgcaag tggtgccgga ccgcctgccc gcctcgcccg     74820
     ccggcgggat gagcatcgtc aacgtgaaga cgaccgaccg cgacggcaag accatcatcg     74880
     ccgccatcga gccggtgggc ggcggcgcgg gcggcgatcc gtacagtgac ggcgccgacg     74940
     cgtccggggc catcgtggcg ttcctgcgca atacgccggt cgagatcaac gaaaccgaag     75000
     ttcccatccg catcacccgc tacggcatgg tgcccgacag cggcggcccg ggacgctacc     75060
     gcggcggcct gggcacatgc atggagttcc aggtgtacac gcccaattcg gcggtcaccg     75120
     cgcgcaaccg cgaccggtcc cgtttcgcgt cctggggcgt gctgggcggc aaggccggca     75180
     ccgtgtcgcg cttcctgcgc aaccccggca ccgcgcacga ggaggacctg ggcgtgcacg     75240
     atttcatcca ctgccagccg ggcgatgtga tccgtctgga gggctgcggc ggcgggggct     75300
     acggctcgcc ctgggagcgc gatccggcca gggtgctgca cgacgtgcgc tgcggctacg     75360
     tgtcggtcga gaacgcccgc gggcagtatg gcgtggtcat cgagggcggc gaggtcagcc     75420
     gggatgccac ggcgcggttg cgcgccgaac tggctgggcg cgatccggcc gtcgcgcact     75480
     atgaccacgg cgccggccgc gacgccttcg aggcggtctg gacgctggcc cgctacgaac     75540
     gcatgaccca tcaccttgcc ggcgtggcgc cgatctggcg ccacttcctg aagatcaaga     75600
     tcttcgatgc gctggagcag cgcctgggcg gcaacgttgc ggacacacgg ccggaaatcg     75660
     tcgacgagat tttcgcgcaa ctgctcaagg cctgtccgca gttgcaggcc gccagcgcct     75720
     gaggcgccga tcgcaacgct accgatacat accgtcatgc aacaactgaa acaggcattg     75780
     ctgcgcatcg acacgcccca cacgccgcca gccgaggtgg atgtggccat catcggcgcg     75840
     ggcgcggccg gggtcgcgac cgcgcacgaa ctgacgcggc tcggcgtgcg ggtcgcggtc     75900
     atcgagaagg gctgggtggc cgccgagcag agcagccgca attgggggtg gtgccgcacg     75960
     ctggggcgcg atatccgcga gctggagctg gccaggctga gcgtcgacct gtggcgcagc     76020
     gtgcaggccg ataccggcgt ggatgcgggc tttcgcgaga ccggcgtggt gttcgtgacc     76080
     gacgatccgt ccgagctgcg gacctgggag cgctggcagc aggccgccgc cgcgcgcggc     76140
     gtgccggccc ggatgctgtc ggcgcgcgag gccaacgcca cccacgcctg gggcaagacg     76200
     ccctggatag gcggcatccg taccgagcgc gatggctatg cggaaccggc gcgcgcgatt     76260
     ccgctgctgg cgcgccacgc catggacaac ggtgcgcagg tcatccagca atgcgcggtc     76320
     aatgaactgc tggtcgaggg cggccgcgtg gccggtgtgc agaccgagtg cggcctggtg     76380
     cgcgccagcc aggtggtggt ggccggcggc gtctggtcgt cgctgttctg ccgcaagcac     76440
     aagctgccct tgccgatcct gcaggtgcat tcctcggcct cgcgcagcag gcagttcgac     76500
     accggcgggg cggcgccggc aagagcgacg catttctcgt tccgccaccg cgaggatggc     76560
     gggctgacgc tggccaagag cggccggggc accatgcacg tcgtgcccga cctgttgcgc     76620
     tacggcatga aattccgctc gctctaccgc gcccgcaagg ccaacgtcag attgtcgatc     76680
     ggcaggcagt tcttcgcgca gtgctgggac gagtttcgct acttccacct cgacaggcct     76740
     ccctatgccc gccatcgggt gctggatccc gggccggaca tggccctggt gcgcagcgcc     76800
     tacgaggacg caggggccgt gtttcccggc atggggtccg acctgatcga ccaggcctgg     76860
     ggcggcgtca tcgacaacac gccagacggc atccccgtca tttccgacgt ggcccggatg     76920
     ccgggcctgt atttgtgtac cggtttcagc ggccatgggt tcagctcctc cctgggagcc     76980
     ggccgctgcc ttgcgcaatg gatcgcgcgg gggcgctccg acctgtcgct ggacgcgttc     77040
     tcgtacgcgc gcctggtcga cgggcggcgc ctgcaaccca gcattctgta ttgaacggcc     77100
     cgcacgtacc ggcggtcttg ggcagtcatc acttctgcaa ggggaatacc aatatgcgat     77160
     acaaccgaag agccttcctg ggcgcgatgg ccgcgctgcc ggcggcattg ggcgccgcac     77220
     gcctggcatc ggcggcgccg gccggcgagg ccggctatct gtgaagattc aataggttgt     77280
     atgcatggtt catccgaacc ggatttgaga aactggaaat cgccgacccc ccagttcact     77340
     caaggagccc ggccggatga acacccataa gcatgcccga ttgaccttcc tacgtcgact     77400
     cgaaatggtc cagcaattga tcgcccatca agtttgtgtg cctgaagcgg cccgcgccta     77460
     tggggtcacc gcgccgactg tgcgcaaatg gctgggccgc ttcctggctc agggccaggc     77520
     gggcttggcc gatgcgtcct cgcgcccgac ggtctcgccc cgagcgattg cgccggccaa     77580
     ggcgctggct atcgtggagc tgcgccgcaa gcggctgacc caagcgcgca tcgcccaggc     77640
     gctgggcgtg tcagccagca ccgtcagccg cgtcctggcc cgcgccggtc tgtcgcacct     77700
     ggccgacctg gagccggccg agccggtggt gcgctacgag catcaggccc ccggcgatct     77760
     gctgcacatc gacatcaaga agctgggacg tatccagcgc cctggccacc gggtcacggg     77820
     caaccgacgc gataccgttg agggggccgg ctgggacttc gtcttcgtgg ccatcgatga     77880
     ccacgcccgc gtggccttca ccgacatccc ccccgacgag cgcttcccca gcgccgtcca     77940
     gttcctcaag gacgcagtgg cctactacca gcgcctgggc gtgaccatcc agcgcttgct     78000
     caccgacaat ggctcggcct ttcgcagccg cgccttcgcc gcgctgtgcc atgagctggg     78060
     catcaagcac cgctttaccc gaccttaccg cccacagacc aatggcaagg ccgaacgctt     78120
     catccagtcg gccttgcgtg agtgggctta cgctcacacc taccagaact cccaacaccg     78180
     agccgatgcc atgaaatcct ggctacacca ctacaactgg catcgacccc accaaggcat     78240
     cgggcgcgct gtacccatct ccagactcaa cctggacgaa tacaacctat tgacagttca     78300
     cagctatccg gaccggccga tcaagttcct ggtgccgttt tccgccggca gcagcaccga     78360
     catcgcggcc cgcgcgtatg ccgaggtcac caccaaggcg atcaagggcg cgtccgtggt     78420
     ggtggagaac cgcgcggggg cgggcggcaa cgtgggcgcg gcggtcatcg cgcgttcggc     78480
     gcccgacggc tactcgctgc tctacagcgc cgccacgccc tatgcgatcg cgccgttcgt     78540
     ctatcccgat ctctcgtata acccgatacg cgacttcgcg cccatcgccg tcacgatcag     78600
     cgtgccggtg ttcgtggtgg tggccggcga cagcgacatc catacgatgg ccgacctcgc     78660
     cgcgcacatg aaggccgggc agcaggcggt cagctacggc tccaacggcg tggggacgtc     78720
     cagccacatc atctgcaagc tgatcgccat ggagctggga tatcccgacg tgctgcacgt     78780
     gccgtaccgc caggggtccc agggcgtcat ggccgatgtc atcggcaagc gcctgaccta     78840
     cgccgtcgat ccctggtcgg tcgtcggtcc gctggtgcag tccggacgct tgcgcgccat     78900
     cgccaccacc aacggacagc gcctgtcggt ggcgccggac atcccgaccc tcagcgagat     78960
     cttcaagaag gacttcgccg tcgtgacctg gaatggattg tgggcgccgg cgggtacgcc     79020
     gcagggcatc gtggaccggc tcggcaaggc gttcgagtcg gcccgcgaga accaggagct     79080
     ggtcaggcag ttcgagagcc agggcacgcc gctgatgccg gccatgtcgc tggcgcagac     79140
     cagaacgttc atgaccggcg aagtcgagcg ctggaagcgt ttcgtgcagg tatcgggcat     79200
     caagctctag gcaaaccggt gccgcggtcc gcggcgccgt ctccacattg caaaggaaga     79260
     cctcatgtcc ttatccgtcg gcaacgccgc gctgctgcct ggccgcaacc tgattggatc     79320
     ggaatggcgc gaagcggcgc tgggcgcgcg cttcgcggtt gcggatcccg ccaccggcaa     79380
     ggtgatcgcg catgtgcccg acagcggcgc gcgcgatgcg ggcgcggccg tcacggcggc     79440
     gcaccaggcc ttcgcggact ggcgccggac ccccgccaag gtccgcgcgc agatcatcaa     79500
     gcgctggaat gccctgttgc acgagaacgc cgaagacctg gcccgtctga tttcctcgga     79560
     gcagggcaag ccgctggccg aggctcgcgg cgaggtgagc tatgcggcca gttatgtcga     79620
     gtggttcgcc gaagaggcca cgcgcgccga cggcgacctc atccccagcc cggcgcaagg     79680
     gcggcgcatg ttcgcgctgc gcgagccggt cggcgtggtg gcggcgatca cgccgtggaa     79740
     cttcccggcg gccatgatcg cccgcaagat cgccccggcc ctggcggccg ggtgcacggt     79800
     cgtgtgcaag ccggccgagg acacgccgct gacgtcgctg gcgctgacgg ccctggcgca     79860
     gcaggcgggg gtgccgcccg gcgtgctcaa catcgtgacc gcctcgcggg gccgcgccgc     79920
     cgaagtcgcc gacgcctggc tggacgaccc gcgcgtgcgc aagatcacct ttaccggctc     79980
     cacccccgtg ggcaagcatc tggccaggcg cagcgccgac accttgaagc gggtctcgct     80040
     ggagctgggc ggcaatgcgc ctttcattgt gttcgacgac gccgacctgg acgccgcggt     80100
     cgagggcctg atggtgtcca agttccgcaa tggcggccag acctgcgtct gtcccaaccg     80160
     catcttcgtg caggccggcg tgcacgacgc gttcgtccgc aagctggcgg cgcgggtgga     80220
     ggggctggtc gtcgggccgg ccagcgaccc ggcttcgcag atcgggccga tgatcaacgc     80280
     gcgcgccgtc gagaagatcg agcatcacgt cgccgacgcc ctggagcgcg gcgctcgcct     80340
     ggcagtgggc ggcaagcgca tccactcggc ccgttgcgcc ggcgaccact attacgcgcc     80400
     gaccgtgctg acgggggtgg acgagaccat ggcgtgcttt cgcgaggaaa ccttcgggcc     80460
     ggttgcgccg atcacggtct tcgccagcga ggccgaggtg gtggcggcgg ccaatgcgac     80520
     cgcgttcggc ctggccgcct acttctactc gaccgacgtg cggcgcatct ggcgcctggc     80580
     cgacgcgctg gagaccggca tcgtcggcgt caacgagggc gcgctggccg ccgaggcggc     80640
     cccgttcggc ggcgtcaagg actcgggtta cggccgcgaa ggatcgcgcc atggcctggc     80700
     cgagtacatg cagatcaagt acgtctgcca gggccagctg gactgagggc gcgtcgcgcg     80760
     atcaggcggt gccccggcct cgcggcgcgt atccgccgtt gctcgcgcgc agtcctgcga     80820
     tcagttcggc atggtagcgg tccagctgcg cgcgagcggc ggccgcgtcc agcgcgcggc     80880
     ctcggtactc cttgacgcgc gcggtgtcgc cgccgcgccg aacgcgcagc gaacggccca     80940
     cgctgtcggg gtgccgttcg gccagcgcgc ggcgcagcgc acgattgtcg tcgcgcgaga     81000
     atggcgcgat ccagtcgatg atccacagtc ggtcgccgca gttccaggca ttcccgccca     81060
     gcgacgaggg cgccatgaca taggagagtt cggtgtcggc gtccattagg gcccagctgc     81120
     agtatgcaac cggcacgtca ttgcatcgca gcagaatgta ttggcccagt tgaatcggcg     81180
     cgagcgtgtt gcgtgcgagc agatgcaccg gccagtcgcg gtgcatggga gagttcatcc     81240
     acagccaggc aatattgccc agtgccgcga agtcgtcggt gggattgagg agggagggcg     81300
     cttgggcgga cggaagcatg acatcggtgc atggtggagc ggggggcata ttccgtgttg     81360
     ggtgcgcgca tggcaagccg ccggcgcatc atggttgcgc cggaatggct tttcttacat     81420
     gtttccagga tatgtccgta tttcgggcga tgcctcggtc gcggcgcctg cttttgtcga     81480
     acatgtgcaa tgttgttgtc gcgatcgcgt tcgcgcttgc tcgcttattt atctcccttg     81540
     aagccttgtt cttcttttca ttagaaagaa atatgcgctt tgtgtttagg atgattttcc     81600
     tgtccgagta gggtggatcc aaattttccg gattggtggg aatttgtgca ttttcattgc     81660
     gaatgttgga ataatttcgc ccatcgtcat acgacatgct ggatgtttgg ttcttgcaga     81720
     aggatgaggt tctgagcgct acacaccggt tgcgtcggtg cgaatccgtt caatcgacta     81780
     cttatcgaca gatccacatg cagcaatcgc atcaggctgg ttacgcaaac gccgccgacc     81840
     gggagtctgg catccccgca gccgtactcg atggcatcaa ggccgtggcg aaggaaaaaa     81900
     acgccacatt gatgttccgc ctggtcaacc cccattccac cagcctgatt gccgaagggg     81960
     tggccaccaa aggattgggc gtgcacgcca agtcgtccga ttgggggttg caggcgggct     82020
     acattcccgt caacccgaat ctttccaaac tgttcggccg tgcgcccgag gtgatcgcgc     82080
     gggccgacaa cgacgtcaac agcagcctgg cgcatggcca taccgcggtc gacctgacgc     82140
     tgtcgaaaga gcggcttgac tatctgcggc aagcgggcct ggtcaccggc atggccgatg     82200
     gcgtggtcgc gagcaaccac gcaggctacg agcagttcga gtttcgcgtg aaggaaacct     82260
     cggacgggcg ctatgccgtg cagtatcgcc gcaagggcgg cgacgatttc gaggcggtca     82320
     aggtgatcgg caatgccgcc ggtattccac tgacggcgga tatcgacatg ttcgccatta     82380
     tgccgcatct gtccaacttc cgcgactcgg cgcgcagttc ggtgaccagc ggcgattcgg     82440
     tgaccgatta cctggcgcgc acgcggcggg ccgccagcga ggccacgggc ggcctggatc     82500
     gcgaacgcat cgacttgttg tggaaaatcg ctcgcgccgg cgcccgttcc gcagtgggca     82560
     ccgaggcgcg tcgccagttc cgctacgacg gcgacatgaa tatcggcgtg atcaccgatt     82620
     tcgagctgga agtgcgcaat gcgctgaaca ggcgggcgca cgccgtcggc gcgcaggacg     82680
     tggtccagca tggcactgag cagaacaatc ctttcccgga ggcagatgag aagattttcg     82740
     tcgtatcggc caccggtgaa agccagatgc tcacgcgcgg gcaactgaag gaatacattg     82800
     gccagcagcg cggcgagggc tatgtcttct acgagaaccg tgcatacggc gtggcgggga     82860
     aaagcctgtt cgacgatggg ctgggagccg cgcccggcgt gccgagcgga cgttcgaagt     82920
     tctcgccgga tgtactggaa acggtgccgg cgtcacccgg attgcggcgg ccgtcgctgg     82980
     gcgcagtgga acgccaggat tccggctatg acagccttga tggggtggga tcgcgatcgt     83040
     tctcgttggg cgaggtgtcc gacatggccg ccgtggaagc ggcggaactg gaaatgaccc     83100
     ggcaagtctt gcacgccggg gcgcggcagg acgatgccga gccgggcgtg agcggtgcgt     83160
     cggcgcactg ggggcagcgg gcgctgcagg gcgcccaggc ggtggcggcg gcgcagcggc     83220
     tggttcatgc cattgccctg atgacgcaat tcggccgggc cggttccacc aacacgccgc     83280
     aggaagcggc ctcgttgtcg gcggccgtgt tcggcttggg cgaggccagc agcgccgtgg     83340
     ccgaaaccgt gagcggtttt ttccgcgggt cttcgcgctg ggccggcggt ttcggcgtgg     83400
     ctggcggcgc gatggcgctg ggaggcggca tcgccgcggc cgttggcgcc gggatgtcgt     83460
     tgaccgatga cgcgccggcc ggacagaagg ccgccgccgg cgccgagatc gcgctgcagt     83520
     tgacaggtgg aacggtcgag ctggcttctt ccatcgcgtt ggcgctggcc gcggcgcgcg     83580
     gcgtgaccag cggcttgcag gtggccgggg cgtcggccgg ggcggctgcc ggcgcattgg     83640
     ccgcggcgct cagtcccatg gagatctacg gcctggtgca gcaatcgcac tatgcggatc     83700
     agctggacaa gctggcgcag gaatcgagcg catacggtta cgagggcgac gccttgctgg     83760
     cccagctgta tcgcgacaag acggccgccg agggcgccgt cgccggcgtc tccgccgtcc     83820
     tgagcacggt gggggcggcg gtgtcgatcg ccgcggcggc cagcgtggta ggggccccgg     83880
     tggcggtggt cacttccttg ctgaccgggg ctctcaacgg catcctgcgc ggcgtgcagc     83940
     agcccatcat cgaaaagctg gccaacgatt acgctcgcaa gatcgacgag ctgggcgggc     84000
     cgcaagcgta cttcgagaaa aacctgcagg cgcgtcacga acaactggcc aattcggacg     84060
     gcctacggaa aatgctggcc gacctgcagg ccggttggaa cgccagcagc gtgatcgggg     84120
     tgcagacgac agagatctcc aagtcggcgc tcgaactggc cgccattacc ggcaacgcgg     84180
     acaacctgaa atccgtcgac gtgttcgtgg accgcttcgt ccagggcgag cgggtggccg     84240
     gccagccggt ggtcctcgac gtcgccgccg gcggcatcga tatcgccagc cgcaagggcg     84300
     agcggccggc gctgacgttc atcacgccgc tggccgcgcc aggagaagag cagcgccggc     84360
     gcacgaaaac gggcaagagc gaattcacca cattcgtcga gatcgtgggc aagcaggacc     84420
     gctggcgcat ccgggacggc gcggccgaca ccaccatcga tctggccaag gtggtgtcgc     84480
     aactggtcga cgccaatggc gtgctcaagc acagcatcaa actggatgtg atcggcggag     84540
     atggcgatga cgtcgtgctt gccaatgctt cgcgcatcca ttatgacggc ggcgcgggca     84600
     ccaacacggt cagctatgcc gccctgggtc gacaggattc cattaccgtg tccgccgacg     84660
     gggaacgttt caacgtgcgc aagcagttga acaacgccaa cgtgtatcgc gaaggcgtgg     84720
     ctacccagac aaccgcctac ggcaagcgca cggagaatgt ccaataccgc catgtcgagc     84780
     tggcccgtgt cgggcaactg gtggaggtcg acacgctcga gcatgtgcag cacatcatcg     84840
     gcggggccgg caacgattcg atcaccggca atgcgcacga caacttccta gccggcgggt     84900
     cgggcgacga caggctggat ggcggcgccg gcaacgacac cctggttggc ggcgagggcc     84960
     aaaacacggt catcggcggc gccggcgacg acgtattcct gcaggacctg ggggtatgga     85020
     gcaaccagct cgatggcggc gcgggcgtcg ataccgtgaa gtacaacgtg caccagcctt     85080
     ccgaggagcg cctcgaacgc atgggcgaca cgggcatcca tgccgatctt caaaagggca     85140
     cggtcgagaa gtggccggcc ctgaacctgt tcagcgtcga ccatgtcaag aatatcgaga     85200
     atctgcacgg ctcccgcctg aacgaccgca tcgccggcga cgaccaggac aacgagctct     85260
     ggggccacga tggcaacgac acgatacgcg gccggggcgg cgacgacatc ctgcgcggcg     85320
     gcctgggcct ggacacgctg tatggcgagg acggcaacga catcttcctg caggacgacg     85380
     agaccgtcag cgatgacatc gacggcggcg cggggctgga caccgtcgac tactccgcca     85440
     tgatccatcc aggcaggatc gttgcgccgc atgaatacgg cttcgggatc gaggcggacc     85500
     tgtccaggga atgggtgcgc aaggcgtccg cgctgggcgt ggactattac gataatgtcc     85560
     gcaatgtcga aaacgtcatc ggtacgagca tgaaggatgt gctcatcggc gacgcgcaag     85620
     ccaataccct gatgggccag ggcggcgacg ataccgtgcg cggcggcgac ggcgatgatc     85680
     tgctgttcgg cggcgacggc aacgacatgc tgtatggcga cgccggcaac gacaccctct     85740
     acggggggct gggcgacgat acccttgaag gcggcgcggg caacgattgg ttcggccaga     85800
     cgcaggcgcg cgagcatgac gtgctgcgcg gcggagatgg ggtggatacc gtcgattaca     85860
     gccagaccgg cgcgcatgcc ggcattgccg cgggtcgcat cgggctgggc atcctggctg     85920
     acctgggcgc cggccgcgtc gacaagctgg gcgaggccgg cagcagcgcc tacgatacgg     85980
     tttccggtat cgagaacgtg gtgggcacgg aactggccga ccgcatcacg ggcgatgcgc     86040
     aggccaacgt gctgcgcggc gcgggtggcg ccgacgtgct tgcgggcggc gagggcgacg     86100
     atgtgctgct gggcggcgac ggcgacgacc agctgtcggg cgacgccgga cgcgatcgct     86160
     tgtacggcga agccggtgac gactggttct tccaggatgc cgccaatgcc ggcaatctgc     86220
     tcgacggcgg cgacggccgc gataccgtgg atttcagcgg cccgggccgg ggcctcgacg     86280
     ccggcgcaaa gggcgtattc ctgagcttgg gcaaggggtt cgccagcctg atggacgaac     86340
     ccgaaaccag caacgtgttg cgcaatatcg agaacgccgt gggcagcgcg cgtgatgacg     86400
     tgctgatcgg cgacgcaggc gccaacgtcc tcaatggcct ggcgggcaac gacgtgctgt     86460
     ccggcggcgc tggcgacgat gtgctgctgg gcgacgaggg ctcggacctg ctcagcggcg     86520
     atgcgggcaa cgacgatctg ttcggcgggc agggcgatga tacttatctg ttcggggtcg     86580
     ggtacgggca cgacacgatc tacgaatcgg gcggcggcca tgacaccatc cgcatcaacg     86640
     cgggggcgga ccagctgtgg ttcgcgcgcc agggcaacga cctggagatc cgcattctcg     86700
     gcaccgacga tgcacttacc gtgcacgact ggtatcgcga cgccgatcac cgggtggaaa     86760
     tcatccatgc cgccaaccag gcggtagacc aggcaggcat cgaaaagctg gtcgaggcaa     86820
     tggcgcagta tccggacccc ggcgcggcgg cggctgcccc gccggcggcg cgcgtgccgg     86880
     acacgctgat gcagtccctg gctgtcaact ggcgctgaag cgccgtgaat cacggcccgc     86940
     ctgcctcgcg cggcggcgcc gtctctttgc gttcttctcc gaggtatttc ccatcatgac     87000
     gtcgcccgtg gcgcaatgcg ccagcgtgcc cgattccggg ttgctctgcc tggtcatgct     87060
     ggctcgctat cacggattgg cagccgatcc cgagcagttg cggcatgagt tcgccgagca     87120
     ggcattctgt agcgaaacga tacagctggc ggcgcgccgg gtcggcctga aagtgcggcg     87180
     gcaccgaccc gcgccggcgc ggctgccacg cgcgccgctg ccggccatcg cgctggaccg     87240
     gcagggcggc tactttgttc ttgcccgctt cgagcccggc gcggaccagg ccgtactcat     87300
     ccagcgtccg ggccaggcgc ccgcgcgcct ggggcaggcc gagttcgagg cgctgtgggc     87360
     gggggagctg ctgctttgtg cttgcgcggc cagcccgacg caggccctgg cgcgctttga     87420
     cttcagctgg ttcattccgg cgctggtcaa gcatcgccat ctcatcggtg aggtgctgct     87480
     gatctcgttg gtgctgcagt tcattgccct gttgacgccc ttgttcttcc aggtggtcat     87540
     ggacaaagtg ctggtcaaca acgccatgga aacgctcaat gtcatcgcag tggggttcct     87600
     ggcggccatc ctgttcgagg ccctgttgac cggcatccgt acttacctgt ttgcgcatac     87660
     cagcagcaag ctggatgtgg agctgggtgc gcgcctttac gcgcatctgc tgcgcttgcc     87720
     gctggcgtac ttccaggcgc gccgggtggg cgactcggtg gcccgcgtgc gcgaactgga     87780
     gcatatccgc gcctttctta ccggcaatgc cgtgacggtg ctgctcgatg tggtgttttc     87840
     cgtggtgttc atcgccgtca tgttcttcta cagcgtgaag ctgacgctgg tcgtgctggc     87900
     ggcgttgcct tgctattttc ttctgtcgct ggtgctgacg ccggtgctgc gccgccgcct     87960
     ggatgtcaag ttcaaccgtg gcgccgagaa ccaggccttt ctggtggaga ccgtcagcgg     88020
     catcgacacc gtcaagtcgc tggcggtcga gccgcagtgg cagcgcaact gggaccggca     88080
     gctggccggt tacgtcgcgg ccggcctgtc ggtggccaac gtcgccatgc tggccaacac     88140
     cggggtgacg ctgatcagcc ggctggttgc gctgggagtc ctgtgggtgg gcgccaccga     88200
     ggtggtcgcg cagcgcatga ccgtgggtga gctggtggcc ttcaacatgc tgtccggcca     88260
     tgtgacgcaa cccgtgatcc ggttggcgca gctgtggaac gatttccagc agaccggcgt     88320
     ttcgatgcag cgtctgggcg acatcctgaa ctgccgtacc gaggtggccg gcgacaaggc     88380
     acaattgccg gcgctgcgcg gttccatcga gctggaccgg gtatcgtttc gctatcggcc     88440
     ggacgccgcc gatgcgctgc gcaatgtcag cctgcgcatt gcgccgggcg aggtggtggg     88500
     tgtggtaggg cgttccgggt cgggcaagag tacgctgact cggctgatac agcgcatgtt     88560
     cgtcgccgac cgcggccggg tgctgatcga cggccatgac atcggcatcg tggacagcgc     88620
     ttcgctgcgg cgccagctgg gcgttgtgct gcaggaaagc acgctgttca accgcagcgt     88680
     acgcgacaac attgcgctga cccgccccgg cgcgagcatg cacgaagtgg tggcggcggc     88740
     gcggctggcg ggagcgcacg agttcatctg ccagttgcct gaaggctacg acaccatgct     88800
     gggcgagaac ggcgtgggat tgtcgggcgg tcagcgccag cgcatcggca tcgcccgcgc     88860
     gctgatccat cgcccgcgcg tgctgatcct ggacgaggcc accagcgcgc tggactacga     88920
     gtcggagcac atcatccagc gcaacatgcg cgatatctgc gacggccgca ctgtgatcat     88980
     catcgcccac cggctctccg ccgtgcgctg cgccgatcgc atcgtcgtga tggagggcgg     89040
     cgaggtggcc gagtgcggca gccacgaaac gctgctggcc gccggcggcc tgtacgcgcg     89100
     cttgcaggcg ctgcaggcag gggaggcggg atgagacgcg cactgcgcga actcgcggcc     89160
     cgccacggcc gggtgctggc ggccagctgg cgtcagcgcc atcgacgccc ggcgggctgg     89220
     ttcgatccgg tggagaccga gttcctccct tccgcgttgt cgctgcagga gcgtccgata     89280
     tcgcccacgg cccgttggct ggcgcgcata ctgatggcgc tggcggcggg cgcgctggtc     89340
     tggtcggtag tgggcaagac cgagatcgtc gtgcatgcgg cgggcaaggt ggtgccggtg     89400
     ggccagagca agatcatcgc ggcgtccgaa accggtcgcg tcgcgcgcgt gctggtcgcc     89460
     gacaatagcc gcgtggccgc cggcgacgtg ctgctgcggc tcgacgcggg cgtgacggag     89520
     gcggaagaac gcaaatggcg tgtccaggct gcgcaggcgc gccaggacga ggcccgctcc     89580
     cgcgccatga tcagggcgct ggataccggg cgcgcgccgg tattggccga gctgccggcc     89640
     gatcccggca tgatggcggc ccagtcatac ttggacagcc agtatgccga ctatcaggcg     89700
     caattgcgct ccatcgaggc ggcaatcgcc acctatcggc gcgagcttgg gctggtgacg     89760
     cagatcgccc atgctcatcg tggcctgcgg cgcgacggcg acgtatcgca gcaggcctac     89820
     ctggaaaaag agcaggcgcg catgaccctg gaaggccggt tgcgccagag cgaggcgcag     89880
     cgcgccgcgc tgcagaccca gacgcgacgc caggcgttcg agacgctggt cctggcgcgc     89940
     aagctggctg cgcaggccga gcaggagatc gcgcgcacga gtgcccagcg cagccggttg     90000
     gtgctgaccg cgcctgtcga tggcgtcgtg cagcagctgg ttgcgctgac cgagggaacg     90060
     gcggtggccg cgacccagcc cttgatgatg gtggtgccca gcggcgccgg catccaggtc     90120
     caggctcagc tcgacagcaa ggacatcggc tttgtcaggg cgggcgcgcc agctaccgtc     90180
     aaggtcggcg cctacgacta tacgaagtac ggaacgctcg aaggcaaggt gttgtatgtg     90240
     tctccggata cggtggtcga cgaccgccaa cagcactcgt accgcgtgac gatcgcgctg     90300
     gcgcaccctg ccctggaggt ggacggcaag ccgcggctgc tcaaggaagg catggcggtg     90360
     caggccgata tccggaccgg ctcgcggcgc ctcatcgagt atctgctcag cccggtggcg     90420
     cggcatgccg gcgaaagcct gggggagcgc tagcatggcc gcggtgcaag tcaggcgacg     90480
     cggccgggcc ctggcgttgg cgctgtgggc cgggttcgcg ctgagcgtgg gaggcggggt     90540
     gcgggcgcgc gatggcctgg caacgccgcc cgcgttcgag ggccaggcgg cgcctgccgt     90600
     ctcgtggcct tgtccgccgc cggcggatcg gctcgacgac ctggccttgc tcgaggcgat     90660
     cgacctggcg ctgtgccaca gcccggcctt gcgccagggt tgggcgcgga tcaaggcgcg     90720
     gtcggccgag gtcgggctgg cgcgtgcgcc ctattatccc agcgtcgcgt tgagcgccgg     90780
     gcgttcggcg cagcggcgca gcacggggtt gggcgaggac ggggttcgca acaatgtgat     90840
     ggcggtaacg ctggcctggc gcctgttcga ctcgggcgcc cgttcggccg ccctgcgggc     90900
     ggcacaggcg caactggacg aggccgcgca ggcctatggc gcggtgctgc aggacaagct     90960
     ggccgaagtg gtcggcgcct attacgaggc ggccacggcg cggcaggcgc tgcatactgc     91020
     ggtggaagac acggagatcg cccggcgttc ggccagcatc gcggcgcgcc gcgcgcgcgc     91080
     aggcctggac agccacggcg atgtgctgca tgcgcaggct gccctggagc gcgcgcgcct     91140
     ggcgcaggcg caggccgaag gcgcgcaggc acgcgcgctg gccggcctgg cgcaggtcct     91200
     gggcgtcgat ccggccacgc cgatcgtcct ggcgccgggt ccgctggcgc cgcaacggat     91260
     cgaagatcgg gagctggccc aatggctgcg ggacgcccgg cagcgtcatc ccgcgatcaa     91320
     ggcagcgcag gcgggcctgg cagcggccac cgcccaggtc gatgtggcgc gggccacgga     91380
     tatgccgacg gtggatcttt cgctgggcca ttatcgcaac agtagcgaga acgtctcggt     91440
     gttcgccggt tcgtcgcgca gcgtgtccgc cagtctgaac ctgcggattc cgctgttcga     91500
     cggattcgcc cggagacatc ggatccaggg cgcgcgcgcc gaagtgcagc gccaggaggc     91560
     tctgctcgac caggcccgcc tggcgaccgg cgcggccgtg gcgcgcgcct atgccgatct     91620
     gcgggctgcg cgcgccagcc atgaggccag cttgcgctgg ctgaaggccg cgcgagccgc     91680
     ttacgagtcg gacctgcgcc gctacgaggc gggggtgggc ggcgtcgcgg agctgctgcg     91740
     cgcgcaatcc gactggctgt cggcccggca gcgccacgtg ctgtatgccg cccagctgcg     91800
     cacccgcgcg ctggccctgc tggccgcggc gggagagctg ggccgttcga cgatcgacgg     91860
     cgatccgcct aaggagtaac cctgcaaatc gccgcgttat gcagatttcg cataaccggc     91920
     caggcaccca tccctatact gccctgcatt cggcgcttcc gattacgcgg tgatggtgat     91980
     ggatctacgt tggttccagg attttctgac cctggccgaa tgcggccagt tcacgacggc     92040
     tgccgagctg cgccatgtgt cgcagtcggc cttcagccgg cgcatccagt cgctggagac     92100
     ctgggtcggc acgcctctga tcgaccgggg ctgcttcccg acacgcctga cggcggcggg     92160
     cgagcagttc cgctcggccg ccgccgagat cgtacgcaag gtgatcgacg cgcgcggcga     92220
     agcgggcgcg accgggcacg acagcatggt gttgcgcgtg gccatgccgc attgcctggc     92280
     gacctcgcgc tttcccgcct ggtgcgcgcg ctggcagcag gttggcggcg cggcgtcgct     92340
     gcgcctgcac gtgggcaatg tgcatgactc ggtcgaatgg ctggccgccg gcgtggtgga     92400
     cctgctggtg tgctttcgcc atgccgtgga ggacatccag ctcgatgcgc agagttatat     92460
     gcgggcaggc gtcgaggccg atgtcttgcg cctgtatcgc ccggcgggca tggcgctgga     92520
     cgaggccgag ctggcgtgcg aggcgccgca ggcgcgctat ccctatgtgt cgtatgcgca     92580
     gggcgcctat ttccggcgcc tgatcgagct gtcgtgcggg ccgctgctgc agcgcgccgt     92640
     cctgcagcgg gtgtgcgaga ccgatttcgt cgacggcgcg cgcgacctgg tgcgcgccgg     92700
     cgtggggctg gcgtggctgc ccgattccag cgcccgcgcg gccgtggagc acggcgagat     92760
     cgtcgcggtg gcggaccggc gttgcgccat tccgatggaa atctgtatgt acgcgcgacg     92820
     ccacgggccg gcgcaggaag ccgtggagcg cgtgttcgac cagttcgggc gcggctagcg     92880
     cctgatcgcc ggcgcggccg gcatcgcagt ccataacaac agcccttata ggagacacca     92940
     ccatgaaacg ccttctcaat gcgctgacgg cagcgctggc catcggcgcg gcggccgccg     93000
     gccaggccca tgcggccgac ctcgacggaa ccctgaagaa aatctccgat accggcgtca     93060
     tcaccatcgg gcaccgcgag acttcgatcc cgttctcgta ctatgacgcc aaccagaagc     93120
     cggtgggcta ttcgatcgac atctgcacgc gcatcgtcga cgcggtgaag acgcgcatca     93180
     agcgcgacga tatccaggtc aagtacctgc cggtgacctc ggccacgcgc attccgctga     93240
     tgggcaacgg caccatcgac ctggagtgcg cctcgacgtc caatacgctg gactgccaga     93300
     agcaggtggc tttctcggtg acgaccttcg tgaccggcaa ccgcttcatc agcctgaaat     93360
     ccgccaacct gaagaccatc gacgacctca agggcaagac ggtggcctcg acctcgggca     93420
     cggccaacat ccgccaggcc aatgagatca acgaggcgcg cagcctgggc atgaaggtgg     93480
     tgccggtcaa ggagcacgcc gaaggcttcc tgatggtcga gaccggccgc gccgccgcat     93540
     tcatcatgga cgacatcctg ctctacggcc tggccgccaa cgccaaggag ccggaccgct     93600
     atcaggtgtc cggcgactcg ctgtcgatcg agccctacgc catcatgctg cgccgcgacg     93660
     atccccagtt caaggccctg gtcgacgaca ccatcaagtc gttgtatgcc agcggcgatt     93720
     tcgaggcctt gtacaagcgc tggtaccaga gtccgttgcc gcccaagggc atcaacctga     93780
     acgtggccat gagcgaggtg ctcaagcgcg tggtcgccac gccgaccgac tcgggcgatc     93840
     cggtcgccta caagtaagaa gaagcaaggc cgccatgcag gcgcggcgcc ggccccgcga     93900
     gggccggcgg ccgcatgcgg cctgaataca gagaatcacc acgggatatc aatggaactg     93960
     gggcgtgctg ttcgcccttt ccccggatgg cgggcagacc tatctgcaga cgctgctcgc     94020
     tggcctggcg gtcacggtgc agaccgccgc gctggcctgg gcgctggcgc tgggcctggg     94080
     catcgccgtc ggcgtggcgc gcaccctgcc gtacccgctc gtcaagcggc tggcggccgt     94140
     ctacgtggag gtgtttcgca acatcccgct gattgtccag atgttcctct ggtatttcgt     94200
     gttgcccgag ctgttgccca aggcgttggg cgactggatc aagcagctgc ctgaggggtc     94260
     gttctatacg gcggcgctgt ccatcggggt gtacatgtcg gcgcgtatcg gcgagcagtt     94320
     gcgtgccggc atcgaggcgt tgccgccggg ccagcgccag gccggcctgg cgctgggcct     94380
     gaccctgccg cagctgtacc gccatgtgct gctgcccaat gccttgcgca tggtgctgcc     94440
     gaccatgacg tccgattgcc tgaacaccat caagaatacc tcggtggcgc tgaccatcgg     94500
     cctggccgac ctgaccgcgc aggcgcatgc catgcaggag tactcgttcc aggttttcga     94560
     ggccttcctg accgcgaccg tggcctacct ggcgctgaac ctgatcgtga tcgtggcgat     94620
     gcgcgcgctg gagcgctggg tgagcatccc cgggcagtcg ccgcgccgcg cgcaggcggc     94680
     caagggggaa gggcatgagc agcttcgact atcaggccat catcgacgcg ttgccgtacc     94740
     tgtttctcac cggcttgcgc ttcagcctgc tgctgaccct gtcttcggcg gccggcgggg     94800
     tggtgctggg cgcgctgctg gccatcgcgc gcctgtacgg ccggcgctgg gtggcgtggc     94860
     cggccgccat ctacgtgaac ctgttccgtt cgctgccgct ggtgctggtg attttcctga     94920
     tctatttcat cctgccctat ctgctgcagt ggatcaccca ggccgagcgg cccatcgtgc     94980
     tgggcgccac cggttcggcc ttcgtgacct tcatcctgtt cgaggccgcg tacttctcgg     95040
     agatcatccg cgccggcatc ggcagcgtgg ggccgggcca gtatgccgcc ggcagcgccc     95100
     tgggcctgac gcacggccag gtgctgcgca aggtgatcct gccgcaggcc gtgcgcaaca     95160
     tgctgccggt gctgctgacc caggtgatcg tcattttcca ggaaacggcg ctggtgtacg     95220
     tgctgtcgct gcccgacttc ctgggcgcgg ccaccaagat cgcgcagcgc gacaaccgcc     95280
     tggtcgagat gtacgtgctg gtggcggtgg tgttcttcgt gctttccttt accgcctcgc     95340
     gcggggtgcg cgccctgcgc gcgcgcctgg gcgcctgagg acgggcgtat cccgatggag     95400
     ttgttgtcca tgatagaaat cgaacggctc ggcaagtgct acggcgatct gccggtgctc     95460
     aaggattgct cgctcgccgt ggcgcgcggc gaggtggtgg tggtgtgcgg cccgtccggc     95520
     tcgggcaagt cgacgctgat caagtgcgtc aatcggctcg aaccgttcga gtccggccgc     95580
     atcgtggtcg atggcaccga tgtgggcgcg ccgggcaccg acctgccggc gctgcgcgcg     95640
     cgcgtgggca tggtgttcca gcatttcgag ctgtttccgc acctgagcgt attggagaac     95700
     gtctgcctgg gccagatgag cgtgctggga cgcagccgcg cccaggcgcg ggccaaggcg     95760
     gatgcgctgc tcgagcgcgt gggggtggcc gcgcaccgcg acaagcatcc cgggcaattg     95820
     tccggcggcc agcagcagcg cgtggcgatc gcgcgcgccc tggcgatgga cccggtggtc     95880
     atgctgttcg acgagccgac ctccgcgctc gacccggaaa tgatcggtga agtgctcgac     95940
     gtcatgactg gcctggcgcg cgacggcatg accatgatgg tggtcaccca cgaaatggga     96000
     ttcgcgcgcc gggtggccga ccgcatcgtc ttcatggaag ccggcgagat catcgacgac     96060
     gtcgcgtcgg ccgagttctt cggcagcgcc gcgtcgccgc gttcgcgcga attcctctcg     96120
     cgcatcatca gccattaacc gttatccaat actcaggcgg tagccgcatg tcttcccttt     96180
     tctacatcaa cggcagtttc gtgcctgccg agcaggcgcg cgtcccggcc atggaccggg     96240
     ggttcctgtt cggcgacggc gtctatgagg tcatggcggt catcgatggc atgctgctcg     96300
     agttcgagcg gcatgccgcc cgcctggcgc gcagcctggg cgagatcggg atcgccaacc     96360
     cgctgccgcg cgagcgcctg ctggccgtat gccgcgagct ggtcagccgc gccggactgc     96420
     gcgaagggtc ggtctacgtg caggtgacgc gcggcgccga cgccaggcgc gatttcgcgt     96480
     ttccgtccgg cgtcgaaccg accgtcatgc tgttcaccag cgagaaagac ctgcgggtca     96540
     atccgctggc gcaaagcggc gtgcaggtgg ccaccgtgcc cgacctgcgc tggcagcgcc     96600
     gcgacatcaa gagcgtgtcg ctgctggccc aggtgctggc caagcaggcc gcgcaggcac     96660
     gcggcgcctt cgaggcggtg atggtggacg cgcagggcgt ggtgaccgaa ggctcgtcgt     96720
     cgagcgtgct gctggtcaac gcggccggcg agatcgtggt gcgtccgctg tcgcaggaca     96780
     tcctgcccgg ctgcacgcgc gcggccgtgc tggagctggc gcgcgagcgc gacatggcga     96840
     tggtcgagcg cccgttcacg ctggacgaat gccgccaggc gcgcgaagtc atcctgactt     96900
     cggcgctgca gttcgtgctg ccggtcatcg ccgtcgacgg cgagccggtg gccgatggac     96960
     ggccggggcc ggtgtgcgcc gcgctgcgcg agctgtacct gcgccacacc ctggccacgg     97020
     cgctctgagc gcgcgttacg gttcgcgctg cggcggcttg agcggatcga agtcctgcca     97080
     gcggttgtcg cgccacacgc cttcggcgtg ctccacgtca tggccgttgg ccgcgcgcag     97140
     cacctggcag gccagggtct cgcgcgtggg gtcggtgtgc agcgccagca gcaggccggc     97200
     cggccgcact tcggggtgat ccacgggggc agcttcgccg cgcttgcgcg ccaggtgtcc     97260
     ggtgacccac agcgcgccga acagcgagcc gatataggcg cccacgccgg cggccgccag     97320
     catggcgatg gtcgattcgt tcaggccggc gacgatgaag ccgccggcaa tcgcgaaggc     97380
     caggccgaac agggcggcgc cgagaatggc gcccatgtcg gccctgccgg agtcgggatc     97440
     ggagcgtcgg tctccgccgt aggcatagcg gctgtgctcg ccggcgctgt tgacgtagaa     97500
     gacgtggacg tcctgtttgg tgaagccctc ggagaacagc cgctgggcgg cgttttcgac     97560
     gtcgggaaac gtgtcgaagc gggcggcgac gatcagtgac atggcaatct ccttgcgccc     97620
     gcgcgcgcgg gcagattgac atgccttgat cgtagcgccg gcgcccggcg ggcgccagcg     97680
     ccgtggccgg tcagttgatg cgcggcagat tggcgtcgcg gatcatgcgg cccatttctt     97740
     cgtggccctg cttcagcagc tcggcgtact cggagccctt gagcgaggcg ggatccaccc     97800
     ccagtttctc gaacgaatcg cgcgtgacgg gatcggccac cgccgccagg gccgcctgct     97860
     gcagcttggc cagcacgtcg gccggcgcgc cgcgcggcgt ggccaggccg atccaggagt     97920
     cgatctgcac cggccagccg ctttcctgga tggtcggcac ctcgggcagc tcgggccagc     97980
     gcatcggact ggccgaggcg atcatgcgca gcttgccgtc gcggatgtgc ggcagcacgt     98040
     cggaggggtt ctgcacgatc acgtcgacct gcccgcccag cagcgcggtc acggtttcgc     98100
     tgccggactt gtacgacacc tgctcgaact tgccgccggt caggcggccc agttccagca     98160
     gcgccaggtt gttgggcgag gacggcgcgc cgaagaacat gccgttgggt ttcttggcgg     98220
     cctcgaccag gtcctgcagc gtcttgtacg gggagtcggc gcgtaccgtg atgccgtagc     98280
     ggtagcggcc cacgccggcg acgaaatcga agtcgtccat ggtgtagggc agtttcatca     98340
     ggtgcggcat gatggcctgc gtggagtacg tgaccacgcc gaccgtgtag ccgtcgggag     98400
     cctggcgggc gacatagccg gggccgatgg tgcccagcgc gccgggcttg ttctcgacga     98460
     tcaccggctt gcccagcggc ttttccatgc ccttggccag ggcgcgcgag gccacgtcgg     98520
     tgttgccgcc cgcgccgtag ttcaccacca ggcgcacttc gttcttcggg aaatcggtcg     98580
     cggccgcgcc ggcggccagg cccaggctgg ccagggtggc ggccaggtac ttgtttatgc     98640
     ttttcattgc tcctcctagg gaagtccgtg tcgtgttggc ttgaacatgc ctcagggcat     98700
     gtagaagccg ccgttgatgt cgatgatggc gccgttgacg aagccggcgt ccgggccgca     98760
     caggaaggcg atcgaggtgc cgacctcctc gggcgtgccc aggcggcgca ccgggatctg     98820
     ctccgcgtag cgctggttca cctcggggcc ggcctgctgc gccatttcgg tcaggatgcg     98880
     gccgggcgcc acgcagttgg cggtgatgcc gtaggggccc atctccgagg cgatggcgcg     98940
     ggtcaggccg atgacccccg cctttgaggc catgtagctg gggcccgcca cgatggatcg     99000
     ggcgcgcccg gccagcgagg cgacgttgac gatgcggccg tagccctggt cgcgcatggc     99060
     cggcaggaac agctggcaca ggcgcatcac gcaggtcagg ttgatgccca gtacctgcgc     99120
     ccattcctcc tcgctgactt cgaggatgcc cgacgagcgg ccgtcgggac gcttgggcga     99180
     gacgccggcg ttgttgacca ggatggacac cggacccagc tcggcctcga cgcgcgcctt     99240
     cagcgcctgc agggcgggca ggtcctgcac gtcggcgctg gcggcggtga cgcggtcgtg     99300
     ctgcgcgccg aacagcgcct gcgtatcgat ggcgccgcga tcgatggtca cgacatggtt     99360
     gcccgcggcg agcagggcgc gcgcgctggc caggccgatg ccgcggccgg cgccggtgac     99420
     gacggcgatg cggggctcgc tcatgcctgc accccggcgt cgggcgtgaa gaaggtgatg     99480
     ggcgggaagg cgttttcgtc gcagatgact tcgatcagcg ccgagcccga ggcggcgcgg     99540
     gcctgcgcca gcgcgtcggc cagctgggcc gggtcctcga cgcggatgcc ggtgcagccg     99600
     caggcgcgcg cgatggcggt gtggttcacc ggcgcgaagg ccacggccga ggtatgggcg     99660
     ccgaatttga cgttctcggc gtgcttctgg aagcccagga tgccgttgtt gatgacgatg     99720
     agcgtgactt tcacgcccat gcgcgcggcg gtctccagtt cggaccagac gtggccgaag     99780
     ccgccgtcgc ccaccagggc gtagacctcg gccgccggat tggccagctt ggcgcccatg     99840
     gccatgggaa agccccagcc cagcccggcc aggccgcgcg gggtcagaaa gcgcatgccc     99900
     gggcgcagcg ccgtcaggaa gtgcgtgatc cagatcgacg aatagctggc gtcggccacg     99960
     acgatggact gctcgtcgag ctgttgctgc agttcgtgca tgatgcgttc gggccggatc    100020
     ggcgaggcgt ccgacaggcg cactgccgcc gagtcttcca ggtgcttttc gtggcccagc    100080
     gcgatggcct gctcgacgcc ggcgcgggcc tggcggcgcg cggccaggtc ctggccggcc    100140
     agggcggcgg tcagggcttc cagcgtcagg cgcgcgtcgc cgaccaggcg cagcgcttcg    100200
     tagttgcggc ccacttccag gccatccacg tcgatgtgga tgtactgggc atttttcgga    100260
     tagagctgcc aggagtcggt gccgttctgg ttggtgcggt tgcccaccag cagcaccacg    100320
     tcggcctcgg cgatcaggcg gcgctggaag cgcgtggggc cgttggggcc catgttgctg    100380
     ccgaccacgc cgatcgacag cgggtggcgc tcgtcgaccg cgcccttgcc catgaccgtg    100440
     gtggcgaccg gcaggtgggc ggtttcctgc agcgccgcca tggcggcgct ggcgtcggag    100500
     atgtgcaccc cgccgccggc gacgacgacc gggcgctgcg cctgcgccag caggctggcg    100560
     gcgcgggcga tggcctgcgg cgcggcgacg ctgcggtcca gcgggaagtg gcccagcgaa    100620
     ttgttgcgcg gcagggccgg cgcgggggcg gcggcggcca gcaggtcggc cggcagcagc    100680
     agggcgaccg gaccggggcg gccgctgcag gcggcggcga aggcctggtc gacgtagtcc    100740
     tcgatgcgcg aggcttcggt gacgcggcgc acccatttgg tgaccggctg gaacagcgcg    100800
     atgtggtcga gttcctggaa ggcgttgcgg tcggtctggt cgcggttgac gtcctgcacc    100860
     agcgcgatca ccggcaccga gactttcatg gcctcggcca gcggggccac cagcagggtg    100920
     gcggccgggc cgttctgggc ggtcacgatg gccggcttgc cgctgacgcg ggcgtaggcg    100980
     tcggccatgt agcccccggc gttttcggtg cggtaggcga cctggcgcat gccggcctgt    101040
     tcggcggcca gatgcagcag gctgggcagg ctttgcccga acagggtgtc cacgccgtgg    101100
     cgcgccagcg cacgcacgat tgcgtgggcc acggtgccgt ccagcgtgaa ccccggggcg    101160
     gaaaggggct tgggtagggt gctcatgagg cctcgtcctg aatgatggcc gcgccgtcgc    101220
     ggctatttag taatttatat tttataaagt atagcgggtt gccgaggaat atggcaacat    101280
     tggccaaccg cccccttttt gcgccgattc caccttccat gaacatgccg ctcgcgccca    101340
     tggcgcgcga aaacattgcc gccgtcatct atcgccagct caagcagctg ctgatgatgg    101400
     gcgagctcaa gcccggcgag atcctcacgc tgcgcatgct gaccgaacgc ctgggcgtga    101460
     gccagacgcc ggtgcgcgag gccttgctgc aactggtgtc cgagcgcgcg ctggccatgt    101520
     cgcgcggcaa gtccgtcagc gtgccggcgc ccacgcgcga gaagctgcag gagctgcgcg    101580
     atatccgcct gacgctggaa gtgctggcta ccgaacgggc cacgccgcgc atttcggatg    101640
     ccgagatcaa gacgctggag cgcctgcacc gcgaaatggt ccgctacaag aacagcgagc    101700
     agcgcgaggg cgtgctcaag accaactacg agttccactt cacgctgtac aacgcctccg    101760
     gcatgccgga cctggtggcc atcatcgagg ggctgtgggc gcagaccggc ccctcgctga    101820
     cctacctgta ccagaagccg tttgcccatc tgtacgacgc gcatccgcat ctgccgctga    101880
     tcgaggcgct gcgccggcac gatgtggagg cggctgtcgc ggcgatccgc cgcgatgtgg    101940
     cgggctacgg cgccgccctg atggagcgcc tgcccgccga agccggccag ccggccggcg    102000
     gctaggcgcg gcctgcagcg ccagcgcgat gcgcctgccc ttgccggcgg cccgcgagta    102060
     gcagcgtggc gaagtcgttg cgctgtccct ggtcgctggc gcgcacggtc atacaccggc    102120
     gagcaagccc caggcggcgc cggccgcctg ttgctcccgc catggcagcg tcatcaaccc    102180
     ggcccgatta tttatctata cttacgcgct tgcgcgccgc ggcatgcgga tcaccggcct    102240
     cgctcgaggc tggcgtggcg cgtcatcaca tggcctggcg atcgtgcaag cgccggggta    102300
     gtcctggaag cgtcgccaaa gatgtcgttg caccccgtag tctgtctgga ccggtcccgg    102360
     cggggccccg gtgattttcc ccttctttcg atgtctgccg tcgccatgcg ccgcggcgtg    102420
     tccgcgctgc tgggcgtggc ggggaccctg gcgcttgcgg cgccggcctg ggcgcaggcg    102480
     cgccaggagg ctgccagcgc cgcccacccc acctggatgg ccgccgccgg caattggcag    102540
     gtgctcgaag gcgggccagg cgtggcgcgc gtcaagcagc gcacgaccgg cgtgtatgcg    102600
     ggcagcgagc acgcgctggg cgccggactg cgcctgggcg gcgtgctggg cctgacgcgc    102660
     agcacggccc gcttcgacga cctgtacgcc aaggggcacg tgaacagcta cagcctggcc    102720
     ctgtatggcg cccgtaccgt ggccgccggc gcgggcgatt tcaacgctgt ggcgggcgcg    102780
     gcctatacct ggcatgacat ggacaccagg cgccatttcc attgggccgg cacgtcgcag    102840
     accctgacgg cggataccca tggcagcacc ttccaggcct tcggcgaact gggctatcgg    102900
     tggcgcgcgt cggcgcgggt gcagatcgag ccgttcgcgg cgctggcctg gcgcgacgtg    102960
     cggacgcgcg cctttgtcga atccggcggc tgggcggcga tcagcgcggg cccgagccgg    103020
     ctgacgcaga ccacgacgac cctgggcgtg cgcggcgagg ccggctacat gctggggccg    103080
     gcgccgggca agctgcgcct gaccctgggc tggcgccgcg ctttcggcga tgtcgatccg    103140
     caggccacgc tggtgctcga tggcggcaat gccctggcgg ccaccggtgc gcccatcgcg    103200
     cgcgacgcgg cgctggccgg cctgggcgcc gagctggcgc tgtcgcgctc ggccgcgatc    103260
     gggctggcct atatcggcca gtatagcggc ggcaaccgcg agcacacggg ttcgctcagc    103320
     ctgcgctggc tgttcggcgc ctgaacggcc ggcgcggctt caggcgcccg gcgaggtttc    103380
     gtcgtcgtcg aggtagatgt gcgccagtcc ctgcgcgatg cattccttga tctgttcggt    103440
     gcgcttggag atatggctgc gcaggttctg ctgcgcggtg gcgatgtcgc cggcgcgcag    103500
     cgcggcgagg atcgcggcgt gttcggcctg ggtcttgtcg cggccgatgc gttccatgtt    103560
     gatccagcgg atgaagcgga tgcgttcgtt gacgttgtgc aggatccgct gcagttcatg    103620
     gttgccggac atctcggcca gcatgtggtg gaacgtctcg tcgaggctga cgagctcggt    103680
     gaccggcagg tcgggcgact tggcgcggct ttcggccagg aaggcttcga gcgcatcgag    103740
     ccgttgcggg gtggcgcgcc cggcggccag ttgcaggcat gccacttcca gcacttcgcg    103800
     ggtttcgtac aggtcgatca tttccttgag gttgagcggg cggcggacat agccgcgccc    103860
     ggcctcggcc aggaagccgt cgcgcgccag gaaatgcagc gcttccctga ccggggtgcg    103920
     gctgacgccc aggcgttcgg ccagggccac ctcgttgagg cgttcgccgg gcttgatttc    103980
     ataggagatc accatctcgc gcagcttctc cagcacttgc gagaaggcgc gccggccttt    104040
     ctcggccggt tcagtggttg ttttgtacat tgttgtcgtc atgggcagcg aacgcctgcg    104100
     ccggcgcgca tcgcggtggc ggacccggcc tcgatcagtg agggcaagcg gattgtcatt    104160
     gtaataactc ctggccgggc gccggacggg ccggcggcgg gcgccgcgcg gcccgccgct    104220
     cgaggatcag ggcgtgacca cgaccttgcc catgacttcg cggtcctcga tcaggcgcag    104280
     cgcctcgccg gcatcctgca ggctcagcac gcggtcgatc ggcacttgca tcttgcccga    104340
     ctgcaccagg ccgagcaggg cgtccaggtc ttcgcgcatc cagccgttgg agccgcggat    104400
     gttcagctcg aaggtccaga tgaagcgcag gtcggtctgc ggatcgtagc cggcggtcgc    104460
     gccgcaggtc agcaggcggc cgccgcgccg caggcagcgc atcgacttga cccaggtatc    104520
     gccgccggtg aagttcaccg ccacgtcgac gccgccgtcg aacttgcggc gatgcggctt    104580
     gccgtagagc tcatagatcg ccttggcgaa atcggtgtcg gcgtagttga tgacgtggtc    104640
     ggcgcccagt tcgcgcagcc gctgcatttt ggcttcgctg ctggcgcagg cgatcacctg    104700
     cgcgccggca atcttggcca gcatcacgca acccacgccc acgccgccgc tggcgcccag    104760
     caccagcacc ttttcgccgg cctgcacctg gccgatggtg tgcatcatcc gataggccgt    104820
     gccgaaagcc accggcagcg cggccgcctg ctcgtagctg acgccgtccg gaatgcggat    104880
     cagctggtgc tcgcgcgcct tgcacagttc ggccaggccg ccgtgcacgg tctcgcccat    104940
     caggccgccc tcggcccggt tgatcgggtc gaccagcacg cggtcgccgg ccttccagcc    105000
     ctgtacgccc ggaccgactt cgacgatttc gccggccacg tccagcccca tgatgaccgg    105060
     aaagtccagc ttgatgcctg gcatcccccg ccgggtgaat acatcgtgat agttgatcga    105120
     cgttgccttg acgcgcagga tcacgtcgcc ttcgcccgcc ttcggatcgg gaaatgcggt    105180
     gtcgtattgc aggacttccg gaccgccgtg accgtgaatg acaactgcct tcatggattt    105240
     tccttactct ggttgagatg ggtgggttgc ttgctcatcg gcgcagggcg tggccgccct    105300
     gcgtcaaagg ggaggcggcc gcgatcagtt cggccgccag cagggccgcc ttgcggttga    105360
     ccttgccggt gctgctgatc ggcatttcat cgacgaagcg caccgcgcgc ggatgctggt    105420
     aggccggacc atgggccagc gcatagtcct tgacctcctg ttcggacagc gtcgcgtcgg    105480
     ggcgcgacac caccagcgcg accggcttca tgcccttgag cgggtcggcc agcgggacga    105540
     tgcacgcctg cgcgatggcg gggtgacgct ccagcatttt ttcgacttcg cccgggtaga    105600
     tgttttcgcc gccgcacacg aacatgtcgt cggcgcggcc gatgaagtaa tggaagccgt    105660
     gctcgtcgcg ccgcatcacg tcgccggtga tatagaaacc gtcgtgcgtc atggccgcgg    105720
     ccgtctgttc gggcaggccg tggtagccca gcatcagcgc cggcgagcgg acctgcagca    105780
     cgccggtggc ggcgtcgagg tctgcgccat cggccagccg cagctgcacc gccgggtgcg    105840
     gataaccaac cgacagcacg ggttgcgcca gtccttgcgg atgcgggccg aacaccagcg    105900
     cgccggtctc ggtcgcgccg tagccgttgc cgaacgccgc gcgcgggaac atggcgcgcg    105960
     cgctgtcggc gatgcgctgc gtcagcggct ccgatccgag gcgcaccatc gccacgctgg    106020
     ccaggtcggc gccggccagc gcgccggtct cgcgcgccag cagcgcgatc atggtcggaa    106080
     tggcggtcag ccaggtgcag cggtagcgct cgatcgcgtc caggtagccg gccggcgaga    106140
     actgcggcat cagtaccagc cggccctggc ccgccaacgc cagcttgatc gtgttgagcg    106200
     cgttcatgtg atagagcggc gcggccacca ggaagcagtg gccgccgtag tcggtgcttg    106260
     ccgtgcgctg gcgcaccgtc cacagatagc cggcgtgcga tatcttcacg cccttggggc    106320
     ggccggttga gcccgaggtg tagagaaaca gcgccggctg gtcgtcggcg ggccgtgccg    106380
     cctcgcaagg gccggggtcg aggaaccgcg catagccgcc ggcgccgccg gcgccgaatt    106440
     cgacgctcgg caaggcgacg gtgtaggcgt cgcggcgcgg gccatcgcaa aagaccagcg    106500
     cggcgccgct gtcgcgcagg atgaagtcga tgctgtccgg cggcagccgg tagttcaccg    106560
     gcacggcgat caggccggcg cgcatgatgc ccaggtaggc ggccaggaac tccatgcggt    106620
     tggccgacag gatcgccgcc cgcgccccgg ccggcaggcc gcgcgccacg ccgtcggcct    106680
     gcgcatcgag ctcggcatag gtgtattcgc gcggcccgga ctcgccgccc aggtcgatca    106740
     gggcaatggc ggcgggatcg cgcgcgggcg aaaacagcgc gcccaggttg gccggcgcgg    106800
     ccctcatgtc tcggtccagg ccgccaggcc cgccaccgcc tggcgcgtga tctcctgcgc    106860
     atggcgcagc gtgccctcgc gccatacctg gtcgtacgga cagaacgaat ccagcaggtc    106920
     ggcgcgcagc atcgcgtagc gctcgctggc ggggtcggcc ttgaatttca gccacaggtc    106980
     cagccgcagc agccggcgca tgtgccagcc gcgcgtgccg aattcgatga ccgcgccgca    107040
     catgggcaca tcgcccagca aggcctgcac gccgtggaac agcagcccct ggtagttggg    107100
     gcgcgccttg ccgtgcgggc gctggccgac gatgcggtcg cggccccacc agcgcgcggc    107160
     cagttcgtgc agggggccgc cttcctcgtt gaagcacagg aagaacggtt cgccataccc    107220
     gccgatgccg gtgtgccagt cgatcagggc caccttgcgc gcgccggcca ggtgatcgcg    107280
     cacgatgcgc tccagcgtca gattggacca ttcgcgcgcg gtgccgccgt agttcaggcc    107340
     gtccggatgc gaatactggc cgcgcgcgag ggtgtcgtac aggcggtctt cgccgtggcg    107400
     ggccgtgaaa tcctccatgg cctgctgggc ggccgccacc gcggcgctgc tccagtcctc    107460
     gcgcagcagc tgcggatgca ggatggcgta atccgggttg gcggggtgcg gctggccgtg    107520
     gtcgatgaag ttgcggttca ggtcgacatt gttctcggtg gtgcggctca ggtgcgcgaa    107580
     cccccacggg ttgatggcgt gcaccatgat gaccgccacg tcggggtcca gcgacgccgg    107640
     gccgtcgccc agcatccagc cgatctgcgc ggccgagccg aaaaaaccct ccagcccgtg    107700
     ggtgccgctg atcgccagca gccggcgcgg tgcgtcggcg cggccaaagc gcgcgacatc    107760
     ggtatgcagg ggccggccgt ccggcccggt ccggccttcg tgcaggtact gcgtcaggct    107820
     tgcgccggcc gcggccgccg cggcgcggaa cttgtcgcgc gcccggtgat aatcgagcgc    107880
     atagcactgg tggaattcca tggcgttttc cttgctcctc attccggctg taccgtggcg    107940
     gtggtcgatt gttcccagaa caccagcttg cggtgcagga accggatcag gttggtgccg    108000
     gtcaggccga tcaccaccag gctgaacagg caggcgaaca tcgtggccac atccatgttg    108060
     accgaggcgg actggatcag gtagcccagc ccctggctgg acgaaatgaa ctccgacacc    108120
     accgcgccga tcaggctcag caccaccgag atctgcagcc cggcaaagat gtgtcccgag    108180
     gcggccggca gcttgacgtg gaagaacacg tggctgcgcg aggccttgaa ggccttcatc    108240
     aggtccagca tggcgggatt ggcctgccgg atgccgacca cggtattgat gaacatcggg    108300
     aagaagctca tcagcgccac catcaccacc ttggacgcca tgccgaagcc gaaccacacc    108360
     agcagcaatg gcgcgatggc cactttcggg gtcgattgca gggcaatgat gtacgggtag    108420
     atgaactgct cgaaggtttc ggattcggcc agcacggtgc ccaccaccag cgccattccg    108480
     cagccgatca ggtagccgta cacggtgctt tgcagcgtga acaggaagtg cggccagtat    108540
     tggccttcga catagccgat ccgcagcgtg ttcagcacgg cctcgggcgt gggcagcagg    108600
     tagttcggca ccgagaaaat ccggatgctg gcgaaccaca ggatcaccag taccaccccg    108660
     gtgatcaggg ggtacaggaa ggatttgacg gacttggaca tgcgcgcctc ggctaatcga    108720
     attgcaccaa ctggtcgaac agctcccgca gctcgccgca caggcgggtg aactcgggat    108780
     cggtcagcgt ggccagcgtg cgcgggcgcg gcaggttcac cgtcacctcg cggatgatgc    108840
     ggcccggccg cgccgacatc accacgatgc ggtccgacag gaacaccgct tcggcgatgc    108900
     tgtgcgtgat gaacagggcc gacttgcgcg tggccatcca gatgcgctgc agctcgatgc    108960
     tcatgcggtc gcgcgtcatg gtgtccaggg ccgagaacgg ttcgtccatc agcagcagcg    109020
     ccgggtcgtg gatcaggccg cgcgcgatgc ccacgcgctg ctgcatgccg cccgacagct    109080
     cgctggggta gttgctggcg aacttctcca gcccgaccag gcgcagcagc tccatcgcct    109140
     tggcgcgccc ttcggccacg ttcatgccca gcgcccggat gggcaccagc acgttgtcca    109200
     gcaccgtctt ccagggcagc agcgtgggct gctggaagac gatgccgacg tcgccgcgcg    109260
     gctcgtcgat gggcgtgccg ttgagcaacg ccttgccgcc ggagggcttg agcagcccgc    109320
     tgaacacctt gatgagcgtc gacttgccgc agccggacgg gcccagcacc gatacgaatt    109380
     cacccgcgcc cagctgcagc gacagattgt cgacggccgt gatcggaccc ttgctggtgc    109440
     ggtagaccac gctcaggttg ttcgccgtca gcagcgcggc gccgtcgccg gcgccggcga    109500
     cggcgtcgag ggtggccgcg gcggcccgcg acgccggccg cccgccctcg atcatggata    109560
     ggttcaggga agtcatgtgc gttccagcct gcgtctactt gagctgcttg gcggcggaca    109620
     ccacggccgc ggcgtcgaag tcgttgatgt ccttgacgaa ctggttggta tagagcggct    109680
     tgacgtccac gtccttggtg ctcaactggc cgccctcgtg caggacatcg acatagtcat    109740
     gccaggattg ctcggtgtag tagcccattt gctgcggacc ttgctcaggc agcatggtgg    109800
     ccaggcgcac tttcaggatc tgcaccgcgt cggccagctt cttctcttcc gtgccgtcgg    109860
     ccggcttggt ggccggatac agcttccaga agttctgcac gcaggcctgc ggattggcgt    109920
     tgcacgccac gacgcccttg gcggcggcgc gcgcgaaggc caccaccagt tcgggccgct    109980
     cgcgcagcgt gtcctggtgg gcgatccagc cgctggagaa cagttcgcgg tagctctggt    110040
     ccatcggcag gcggcgcagg tcggcgccca tctgctccat ttgcacgtgg aaggtgtcga    110100
     acaggttcag cgcctgcacc ttgtcgtcgg ccagcgcgcg gaaggccgtc gcgcccaccc    110160
     cgaccggcac gaactcgtag tcgcgctgca gctccaggcc cagcttcttc atcatcgcct    110220
     tggtgaccgc caggttgccc cacgacatgg cgcccacgcc gatcttcttg cccttgaggt    110280
     ccgccagcga gcgggccggg ctgctcttgg tgacgaccac ctcgaacggc gacaggtaga    110340
     tgccgttgta gaacatcttc accggcaggg cgtcgcggcc gggctggcgc gagatgacca    110400
     ggggatcggg cgtgatccag ccgaaagtga tgtgtttctg cgtgacctgc ggcagcatga    110460
     ccgccgcgcc ctggaagaac gtggcctgca cgtccaggcc ggcttccttg aagtagccca    110520
     tgccgatggc catcagcgtg ggcgcgttgg acagggagat gttgatgcca taggcgaaag    110580
     tgactttctc cgccgcgttg gccgcgccgc ccgcggcggt cagggccatg gcggcggcgc    110640
     cggccaggat gccccgccgg gcgtggcgct tcaagtgttc gataccgatc atgctgctgc    110700
     tcctgttggt gagttcgtgc aacgggttat atcggtgctg ctggatggtt tttggctgta    110760
     tcagggttcc tcgggcgcgc ctgcaaaggc cgcctcggcg ttggcgcaga aaatgacggc    110820
     cgcgccgccc gcgtcgcggg cggccacggt cagttgcccg ccggcgcggc ggtaggcaac    110880
     ctggttgtcg tccagcaccg cggcggtgcg tgacagattg tccacttcga cggccagcgc    110940
     cgccggaaac ggcagggtcg gcgccgcgct gccgggcagg cgcgccgcga gcgcggcctg    111000
     gtcgaccagc gccagcctgc ccgaacgcag cgtgaaccag gcctcgccgc cgcgccgctc    111060
     ggccggcacg ccgaggtagc gcgcatagcg cgccgccgcg gcgtccacgt cttcgaccgc    111120
     cacgatggcc gcggccaggg cgcgcgcgcc gttcggatgg tccatgtagc gcgcctgcca    111180
     gagcagttcc ggcgtttcgt ggcgcaaggt caggatgagt ccttccggca tggcctggcg    111240
     cggcgtgcgc acctggctga agcgggccag ccgcgggccg tcggcggtgt cgatatagcg    111300
     ttgcagcacg ccgggctcgg ccgcgaagcc cgcctcgcgc agcgcggcga tgcgctgtcc    111360
     ggggtccggg gtgtcgaacg ccacgatgtg catgccggca tagcgcgcca gtccttccgg    111420
     aatgccgcgc aggtccagcg ccgggtcgac caccgcgacc agctcgatat agccgtgccc    111480
     gagcatggcg cagcgattgg cgatgccggc cttgaccacc tcgcgcgtga cggcgtgcgt    111540
     gccggaatgc tgtgacagcg gcgtcagcgt gaagcccagc cgctggtaca tggcggccgc    111600
     cgcgtccatg tcgtgcgcgt acagcccgac atggtccagg ccggccggag ccgcgcccat    111660
     cggttggtcc ggttctgttc tggtcatgtg cccgcccgtg tcgtgttcga ggaagcgggc    111720
     ctcagcccat ccactggctg accggggccg ccgcttcctg cagcggctgg acgatgatgt    111780
     cgaccagcgc cgggccgccg tactcgatgg cggccttgag cacgccgtcc agctcgcgcg    111840
     ggtcctcgac gcgccacgcc ttgacgccgt aggcctcggc gacgcgggca tggtcggtgc    111900
     ggttgaagtc gaccgagaag tagcgctcct ggtagccggc cttctggctg gccttgatcc    111960
     agccgtagac cgagttcgac agcacgatca tcagcagcgg caccttgcgg cgcacgatgg    112020
     tttccatttc gcccacggtg aagccgaagc tgccgtcgcc catgaccgac actaccttgg    112080
     cggacggccg gccgatggcc gcgcccatgc ccgcagccat cgagaagccc agcgcgccgt    112140
     gggcgcggtt ggtgatgaag tggcggcctg gcttggaggc ttcgaaatag gcggagaaat    112200
     aagggcaggg cgtgcccggg tcggccacca ccaccgactc ggccggcagc aggcgattga    112260
     gcgcatcgac cacgcgctcg ggcctgatgg gcgcatccag cgaggcggcc agcggctgca    112320
     gggccgccaa tttggcgccc ttcgccttgg ccgccacggc cttgccgtcg accgcgtccg    112380
     tggggcgggc gtcgatgcgc gcgtgcactt cgcggttgag cgcctgcagg gccagcagcg    112440
     cgtcgcccac catcgccacg tcggtgcggt aattggcggc gatcaccatc gggtcggagt    112500
     cgatgtgcag gatgggcacc tcgcggctgg ggaagcgcca gtgttcggtg gacgtggagc    112560
     cggcgcggca gccgatcaac agcaccacgt cggcatcggc cagcaccgcg cgggtggcca    112620
     ggatgccgcc gttggagccc accacgccgg cgttcagcgg gtgcgtgtcg gccaggctgc    112680
     cctggccgct gacggtggtg cagaccggcg cgttgagggt gacggccagt tcctcgaggg    112740
     ccgcgcaggc gcccgagatg accacgccgc cgccgcacag gatgaccggc gcgcgcgcgc    112800
     ccaccaggcg ggcggcggcc tgctcgatgg ccgcggggtc gggcgcgaag cgcatcgccg    112860
     gaaagcggtc gtgcccgggc tgggcccaca cgtcggcggg gtcgacctcg tgcttctgca    112920
     cgtcgtacgg caggcacagg tgcgccgtgc cggggcggcc ggtcgtcatg gcgcggaagg    112980
     ccgcgcgcac cgcgccggga atctggtcgg cgcggtcgat ggtggtgttc cacttggtca    113040
     gcgggcgata gagcgcctcc tggtccagct cggtcagcgg gtacttgccg cgcgagccca    113100
     ccgatacgtc ggaagtaatc cccagcacgg ccaccgacga ctcgttggcc tcgaccaggc    113160
     ccggcagcag gtaggtggcg ccgccgccgc tgggcccctc gcacacgccc accttgcccg    113220
     ttacccgcgc gtaggcgtcg gccatgtagg cggcgctgcg ctcgtcgcgc gtcaggatgt    113280
     gctccatgcc gtggtccagc cgttgcagcg cgtcgcagaa cggcaggctg gtgtcgccgc    113340
     acagcccgaa aatgtgcttg accccattca gttggagcat gcgcaccatg gcttcggcgc    113400
     cgttgagttg tgtcatggat ctgtccttgg tgagggaggg atgtgtgggg aaatatcaat    113460
     gtatacatga ctatatacat caatggatat cggcgccgca acgcttttgc gggttcgcgg    113520
     catgagggat ttcacgggtg gcgcgggcgg cggacacgcg ccagcgcccg ccccgtcagg    113580
     tcaacggggc gggtcggcga ggcggcggga aagggtcagg cgcccgggtt gtcgggcgtg    113640
     tcgggctggc gcagcgcgat ggcttgcggc cgaggcggcg tggcgacggg cagcgccagg    113700
     ccctggctgc ggatcgcgtc gtcgatggcc accaggatgg cgtcgcggca gtcggtgctg    113760
     tcggagaact gggggaccca gtacttgatc ttgtaagtca cgccttcggc ggtgtacgcg    113820
     gtggcgcgga cccgcggctt ctgccctggc gccaggcttt cggcgggcga agtggacagc    113880
     gccgcgtcga acagcagctg cttgccgtcc gaaatcgaaa tatcatggct caggacgatt    113940
     tccagctcgc cctggtattg cttgcggggg gcgctgtaat tggtcagcat ctgccgcgag    114000
     atctggctgt tgggcaggat catgtaggtg tcgttgggcg tcaggatgcg cgtggtgcgc    114060
     cagccgattt ccgtgacgcg gccccgtatg gtggcgtcga agcccaccca gtcgccgatc    114120
     cggtaggggg cctccacgcc gatggcgatg cccgacagga cgtcggccag cacgttgcgg    114180
     atggcaaagc ccaggatggc gatgatcagg cccgagctgg ccaggatgcc gccggccgac    114240
     tggcccagga acacgccgat ggtggccacc gtggcgatcg cgaacagcgt ggccgagacc    114300
     agctcgcgca acaggcgcgg ggtcttgcgc tttttcttgg ccttgcgcgt gagcgcggcg    114360
     gcggccatgc gcgccagcag ccaggcgaag gcgtagaagg cggccgccgc gctgaaacgc    114420
     cggaacgact cggggttcga tcccggcaga tagcgttgga acaggtacgc atggaacaca    114480
     tacaccacga ccgacaggct gcacagcacg gtcggccaca gcagccacgc gattcttgaa    114540
     ccgggtatca aggcaaatcc tcttcttgtg cgatgggccg cgcgggcgcg gccggcaata    114600
     cgcccggctc gacgtccggg cgctgccgat tgtagagcgc ccgggccgcc cgcgggctag    114660
     ctgtgaactg tcaataggtt gtattcgtcc aggttgagtc tggagatggg tacagcgcgc    114720
     ccgatgcctt ggtggggtcg atgccagttg tagtggtgta gccaggattt catggcatcg    114780
     gctcggtgtt gggagttctg gtaggtgtga gcgtaagccc actcacgcaa ggccgactgg    114840
     atgaagcgtt cggccttgcc attggtctgt gggcggtaag gtcgggtaaa gcggtgcttg    114900
     atgcccagct catggcacag cgcggcgaag gcgcggctgc gaaaggccga gccattgtcg    114960
     gtgagcaagc gctggatggt cacgcccagg cgctggtagt aggccactgc gtccttgagg    115020
     aactggacgg cgctggggaa gcgctcgtcg gggtggatgt cggtgaaggc cacgcgggcg    115080
     tggtcatcga tggccacgaa gacgaagtcc cagccggccc cctcaacggt atcgcgtcgg    115140
     ttgcccgtga cccggtgacc agggcgctgg atacgtccca gcttcttgat gtcgatgtgc    115200
     agcagatcgc cgggggcctg atgctcgtag cgcaccaccg gctcggccgg ctccaggtcg    115260
     gccaggtgcg acagaccggc gcgggccagg acgcggctga cggtgctggc tgacacgccc    115320
     agcgcctggg cgatgcgcgc ttgggtcagc cgcttgcggc gcagctccac gatagccagc    115380
     gccttggccg gcgcaatcgc tcggggcgag accgtcgggc gcgaggacgc atcggccaag    115440
     cccgcctggc cctgagccag gaagcggccc agccatttgc gcacagtcgg cgcggtgacc    115500
     ccataggcgc gggccgcttc aggcacacaa acttgatggg cgatcaattg ctggaccatt    115560
     tcgagtcgac gtaggaaggt caatcgggca tgcttatggg tgttcatccg gccgggctcc    115620
     ttgagtgaac tggggggttg gcgatttcca gtttctcaaa tccggttcgg atgaaccatg    115680
     catacaacct attgaatctt cacatctagg tcggcgttct cgtcgtagaa gctggcccgc    115740
     gcggccatgt agtcggcggt ggcgaacagc gccaccgaca tcgcctggcg ctcctcgcgc    115800
     agccagaaca ggcggctgaa ggccaggctc cagccgaggt agaacagcgc cccgcccagc    115860
     gtggcggccg agtgcagcag cacctcgtgc ggggccagcg gcgaatgcat ggtcagggtc    115920
     atcagcagca ggccggcaaa gccgatcagg ccgccgcgct tgccgaacac cgagaatatc    115980
     gagaacgtga agcactgggc gatcaccgcc agccacagca ggatggggta ggtggaggcc    116040
     gcgccggtca gcgtgaccgt ggcggtgccc agcagggcgc cgcccagcat ttcgttggtg    116100
     cgatggcgct gcggcccgcc cggctggtcg atgatggcca ggcactgggc gccgaaggtg    116160
     gcgaccaggc cgatgctgta ctggccgaac agcccgccca gcaccaggac gggcagaagc    116220
     atgccgatcg cctgtcggat accgccaaag aagtagtggc tgtatagaaa gcgccggatg    116280
     ctggcgatgc gcaaatccat ggagatgggg cgatttgtcc gcgacaacgc cagtatagag    116340
     agatgtgcgc cacttttggg gccggatcgg aaaacgacgg gttgcggggc tttcccaaca    116400
     cccgatttgc tccggatgcc gcaacgcggt aaattgcccg tcttgcgccg gcgtgactat    116460
     ccgaagccgg tgcgccggct tacagctgcc ccgggccacc ttccgggcgg attgcgccag    116520
     ttacacctgc cgttggccgc gccacaagcg tgtgctgcca aggcttccat ttcgacctcc    116580
     agcgccccca gggcgtttgc actgcgtttc tgacgagcgt gtgccgggtc gacaatgtgt    116640
     ccgggtggcg tggctccgtg agccgcaaag cgccggatca tgttgttgtc gccggttcgg    116700
     gttcagctgc cgtcgtatcc gggcgggcag cgctcaggcg tgcagggccg gtactgaaag    116760
     gaaagacaac atggaactca atggcgccga catcgtcgtg cgctgcctgg ccgaagaagg    116820
     cgtggaacac gttttcggct accctggcgg cgcggtgctt tacatctacg acgcgatttt    116880
     caagcaggac aaattccagc acattctggt gcgtcacgag caggctgccg tgcacgccgc    116940
     cgacgcgtac tcgcgcgcct cgcagaaagt gggcgtatgc ctggtgacca gcggtccggg    117000
     cgtcaccaat gccgtcaccg gcatcgccac cgcctacatg gactccatcc ccatggtcat    117060
     catcagcggc caggtgccga ctgcggccat cggcgaggat gccttccagg aatgcgacac    117120
     cgtgggcatc acgcgtccct gcgtcaagca caacttcctg gtgcgcgacg tcaaggacct    117180
     ggccgagacc atgcgccgtg ccttcttcat cgcccgcacc ggccgtcccg gccccgtgct    117240
     ggtcgatatc ccgaaggaca tcaccgtcgc gcagtgcaag tacgcgccgc ccaagggcga    117300
     gatctcgatg cgctcgtacg cgccggtgaa caaggggcac cagggccaga tcaagaaggc    117360
     cgtgcagatg ctgctgcacg ccgagcgtcc catgatctac acgggcggcg gcgtgatcct    117420
     gtccgatgcc gccgaggcct tgcgccacct ggtggaccag accggcgcgc cgtgcaccaa    117480
     caccctgatg ggcctgggcg cgatgccggc caccgaccac cgcttcctgg gcatgcccgg    117540
     catgcacggc acctacgagg cgaacatggc gatgcagcac tgcgacgtgc tgctggccat    117600
     cggggcgcgc ttcgatgacc gcgtcatcgg caatccgcgc catttcgcgc agaacgcgcg    117660
     caagatcatc cacatcgaca tcgatccctc gtcgatctcc aagcgcgtgc gcgtcgacgt    117720
     gcccatcgtc ggcaacgtca aggacgtact ggccgatctg agcgcccagt acgacctggc    117780
     gcgcgccgac gccaagccgg cgccgatcga gaagtggtgg cagcagatcg aggcctggcg    117840
     cggcaaggag tgcctgaagt acgccggctc cgacgaggtc atcaagcctc agttcgtggt    117900
     cgagaaactg tgggaagtga ccggaggcga cgccttcgtg acctccgacg tcggccagca    117960
     ccagatgtgg gccgcgcagt actacaagtt caacaagccg cgccgctgga tcaactccgg    118020
     cggcctgggc accatgggcg tggggctgcc ctatgccatg ggcgtgcaga tggccaatcc    118080
     gggcgccgac atcgccgtga tcaccggcga ggcgtcgatc cagatgaaca tccaggaatt    118140
     gtccacctgc caccagtacc acctgacgcc caagatcatc tgcctgaaca accgtttcct    118200
     gggcatggtg cgccagtggc agcagatcga ctacggctcg cgctattccg agtcgtacat    118260
     ggattcgctg ccggatttcg tcaaggtcgc cgaggcctat ggccacgtcg gcctgcgcat    118320
     cgagcggccc gccgacgtcg agccggcgct gcgcgaagca ttcaagaagc acaaggatcg    118380
     cctggtcttc ctggacttca tcaccgaccg caccgaaaac gtgtggccca tggtgaaggc    118440
     cggccgcggg ctgaccgaga tgctgctcgg ttccgaggat ctgtaaggag gccaccatga    118500
     aacacgtgat ttctgtgctg atggaaaacg aacccggcgc gctgtcgcgc gtggtcggcc    118560
     tgttctccgc gcgcggctac aacatcgaga cgctgaccgt ggcgcccacc gaggacgcga    118620
     ccctgtcgcg cctgaccgtg gtgaccgtcg gttcggacga ggtcatcgaa cagatcacca    118680
     agcacctcaa tcgcctggtc gacgtggtca aggtcgtgga cctcaccgaa ggcgcgcaca    118740
     tcgagcgcga gctcatgctg atcaaggtgc gggcagtggg caaggagcgc gaggaaatga    118800
     agcgcatggc ggatatcttc cgcgggcgca tcatcgacgt caccgacaag tcctacacga    118860
     tcgagctgac cggcgttcag gagaaaatcc aggctttcat cgaagccctc gaccgcagtg    118920
     ccatcctgga aaccgtgcgc accggcgtgt ccggcatcgg gcgcggcgaa cggatactga    118980
     aaatctgacc ggcgcgcctg gcggcgcgcc accctgcatt agcattcacg attaccaaaa    119040
     ttcaagaacc ggagcacaac atgaaagttt tctacgacaa agactgcgat ctctccctgg    119100
     tcaagggcaa aaccgtcgcc atcatcggct acggctcgca aggccacgcc cacgcgctga    119160
     acctgcatga ttcgggcgtc aaggtcgtgg tgggcctgcg caagggcggc gcctcgtgga    119220
     acaaggccgc caacgccggc ctggaagtcg ccgaagtggc cgaggccgtc aagcgcgccg    119280
     acatcgtcat gatgctgctg cccgacgaga acatcgccgc cgtctaccgc gacgaagtgc    119340
     acgccaacat caaggccggc gccgcgctgg ccttcgccca cggcttcaac gtgcactacg    119400
     gccaggtcgt gccgcgcgaa gacatcgacg tcatcatggc ggcgcccaag gccccgggcc    119460
     acaccgtgcg ctcgacctac agccagggcg gcggcgttcc gcacctgatc gccgtctacc    119520
     aggacaagtc gggcagcgcc cgcgacgtgg ccctgtcgta cgccagcgcc aacggcggcg    119580
     gtcgtgccgg catcatcgag accaacttcc gcgaagagac cgagaccgac ctgttcggcg    119640
     aacaggccgt gctgtgcggc ggcaccgtcg agctgatcaa ggccggcttc gacacgctgg    119700
     tggaagccgg ctacgcgccc gaaatggcct atttcgagtg cctgcacgag ctcaagctga    119760
     tcgtcgacct gatctacgaa ggcggcatcg ccaacatgaa ctactcgatc tcgaacaacg    119820
     ccgaattcgg cgagtacgag accggcccga aggtcgtgac cgacgcgacc cgccaggcga    119880
     tgcgcgagtg cctgacggcc atccagaccg gcgaatacgc caagaagttc atcctggaaa    119940
     acgccgccgg cgccccgacc ctgacctcgc gccgccgcat caacgcggaa tcgcagatcg    120000
     agcaggtcgg cggcaagctg cgcgccatga tgccctggat cgccgccaac aagctggtgg    120060
     acaaggccaa gaactaaagg ccacggccac gccgggtccc gcagggcccc ggcaggctgg    120120
     tccagacgcg ccccacgggg cgcgtttttt cttttccgcg gtgcaaacga cacggtgatg    120180
     cgcgcccgca agtggggtca tatgggttaa actttcactt ccgctgcaag cgattctgtc    120240
     atctatgccc aatttctcca tgcgcgatcc cgaaaatcgc catcgcagca tctacctgct    120300
     gcccaatgcc ttcaccacgg cggccctgtt cgcggggttc tacgccgtcg tgcaggccat    120360
     gaacgaccgc ttcgagaccg cggccatcgc catcttcgtg gccatggtgc tcgacggcat    120420
     ggacggccgg gtggcgcgcc tgaccaacac ccagtcggcc ttcggcgagc aatacgattc    120480
     gctgtccgac atgacctcct tcggcgtcgc gcccgcgctg gtcatctacg aatggatcct    120540
     gcaggacctc ggccgctggg gctggctggc cgccttcgtg tacgtcgccg gcgcggcctt    120600
     gcgcctggcg cgcttcaaca ccaacatcgc ggtggtcgac aagcgcttct tccaggggct    120660
     gcccagcccc gctgccgcgg cgctggtggc cggcttcgtc tggctggcca tcgacaacaa    120720
     actgcccatc cacgacagca tcatggcctg ggtggccttt gtcctgacga tgtacgccgg    120780
     cgtggcgatg gtcagcaacg cctcgttttt cagcggcaag aacttcgcct tgggccgcag    120840
     cgtgccgttc tggggcatcc tgctggtggt ggccgtgttc gtgttcgtct ccagcgatcc    120900
     gccggtggtg ctgttcggcc tgttcgtgct ttatggcctg tcgggctggg tggtgatggc    120960
     atggcgctgg aaccgcgccc gcaggctgca gcaggagcgc cgcagcggcc atcattctcc    121020
     gtgatggccg ggcgctgtcc gctcagtgcc agcgccagtc ttcgtcgtac atcgggtccg    121080
     gcccgggatg aaagcgcgtg acgcggtctc cctcgcggcc catgtacacg tacatcagcg    121140
     aattccagac ccgcgattcg cggtagcggt acgaccacac cacctggcgc acgctgggca    121200
     ggccgacctg cttgatctcg gctggcgggc cgaattcgca gcgcacctgg tcggccgtcc    121260
     aggtgccggt gcccagcacc ttgaaatgct cgtcggtcag cacctcgacg acgcggtcga    121320
     cgcgcccgtc ggggcctacg ttggcgcccc aggcgaactg gccgtatggc tgctgggtcc    121380
     agatcacccg ctgcccgcca ttgggcagat cgcaggcgaa attgggcgcg ccgaattgcg    121440
     cctgcacgtc ggccaggggc gtgccgggcg gcacctggtt caggttggcg caggcggcca    121500
     gggcggccag cagcatgccc gcgccggcca ggcgcagggc gcggccgatg gggcggcgaa    121560
     tcgggggcat ggcggtctcc ttcaataagg ggcggatcat cgcggccgga atccgcccgc    121620
     gtgcggcctc actgggcaat tctaccgaat cggctataat catcgtcgct tttgcggtca    121680
     aggttgtcga agttgctttt ccggccgcaa gacacgccag cctgccgagt ccgagaatga    121740
     tcaagaatgg atccggcgcg gcggcaacag cgtaacaggg cgcccggttg tctcggggct    121800
     cgtttttctt gaaacccacg tccgggcgcc tcggccctga cgcatgtccg tagaggtcat    121860
     caaatgtctg tagctgacat caaaaaatcc gaaatcgtcg cgcaattcca acgcgctcaa    121920
     ggcgataccg gctcccctga agttcaggtg gcactgctta ccgctcgcat caacgaactg    121980
     accggtcact tcaaagaaca catgaaggac caccactcgc gccgcggcct gctgcgcatg    122040
     gtcagccgtc gtcgcaagct gctcgactat ctcaagggcc gcaatcccga ttcgtaccgc    122100
     gcactgatcg aaaaactcgg tctgcgcaag tgatcgacga ggctggctcc ccatgacgca    122160
     accgtggtcg gggcgacgca tgtcgcaacg gccacggttt ttcatttgta aggaatcacc    122220
     gtcatgttca ataaagtgac caagaccttc cagtacggcc agcattcggt cgtgttggaa    122280
     accggcgaga tggctcgcca ggcgtccggc gcggtgctgg tgtccgtgga ggacaccgtc    122340
     gtgctggcaa cggtcgtggc ggccaagaaa gccaaggccg gccaggactt ttttccgctg    122400
     accgtcgact acatcgagaa gacctacgcc gccggccgca tcccgggcgg tttcttcaag    122460
     cgcgaaggca agccctccga aaaggaaacg ctgacctcgc gcctgatcga ccgtccgctg    122520
     cgtccgctgt tcccggaagg cttctataac gacgtgcaag tggtcatcca cacgctgtcg    122580
     gtcaatccgg acatcgatcc cgacattccc gccatgatcg gcgcctcggc cgcgctggcc    122640
     atctcgggca tcccgttcaa cggccccatc ggcgccgccc gcgtcggcta tgtcgacggc    122700
     cagtacgtgc tcaaccccac cgcgacgcaa ctgaagtcgt ccaagatgga cctggtggtg    122760
     gccggcaccg agaacgccgt gctgatggtc gaatccgagg cgaagcagct gtccgaggaa    122820
     atcatgctgg gcggcgtggt gttcggccac gagcagatgc aggccgccat caacgccatc    122880
     catgacctgg tgcgcgatgc cggcaagccc gactgggact ggcaacccgc ccccaagaac    122940
     gaagcgctga tcgccgccgt gagcgccgcc gcccaggaag ggctgaacgc cgcctaccag    123000
     atccgcgaaa agcaggcccg caccaccaag ctgcgcgaag tctacgccgc cgtgcaggcg    123060
     gccatggccg aacaggccgc gcaggctggc cagcccgcgc ccgacagcgt cggcgtggac    123120
     aacatcctgt tcgacctgga agcgcgcatc gtgcgcagcc agatcctcaa cggcgagccg    123180
     cgcatcgacg gccgcgacac ccgcaccgtg cgtccgatca gcatccgcct gggcgtgctg    123240
     ccgcgcgcgc acggcagcgc gctgttcacc cgcggcgaaa cgcaggcgct ggtggtggcc    123300
     acgctgggca ccaagcagga tgagcagatc atcgacgccc tgatgggcga gtaccgcgac    123360
     cgcttcatgc tgcactacaa catgccgccg ttcgccaccg gcgaaaccgg ccgcatcggc    123420
     gtgcccaagc gccgcgaaat cggccatggc cgcctggcca agcgcgcgct gctgccgctg    123480
     ctgccggccc cggaagactt ccagtacacc atccgcctgg tgtccgagat caccgaatcc    123540
     aacggctcct cgtcgatggc ctcggtgtgc ggcggttcgc tggccatgat ggacgccggc    123600
     gtgcccacca acgatcacgt ggccggcgtg gccatgggcc tgatcctgga cagcggcaag    123660
     ttcgccgtgc tgaccgacat cctgggcgac gaagaccacc tgggcgacat ggacttcaag    123720
     gtggcgggta ccgaaaccgg tatcacggcg ctgcagatgg acatcaagat ccagggcatc    123780
     accaaggaaa tcatgcaggt cgcgctggcc caggcccgcg aaggccgcct gcacatcctc    123840
     ggcaagatgc gcgacgcgct ggaaggctcg cgtaccgagc tgtcggcgtt cgcgccgcgc    123900
     atgctgacca tcaagatcaa ccccgagaag atccgcgacg tgatcggcaa gggcggcgcc    123960
     accatccgtg cgctgaccga ggaaaccggc acgcagatcg atatctcgga cgacggcacc    124020
     atcgtgatcg ccagcgtgga cgagacccag gccaaggaag cccagcgccg catcgtcgaa    124080
     ctgaccgctg acgtcgaagt gggccagatc tacgacggct cggtgctgcg cctgctggat    124140
     ttcggcgcca tcgtgcaagt gctgccgggc cgcgacggcc tgctgcacat ctccgagatc    124200
     gccaactacc gcatcgccaa catcaacgat gtgctgaagg ttggccagcc ggtccgcgtc    124260
     aaggtcatcg aggccgacga caagggccgc ctgcgcctgt cgatcaaggc gatcggcggc    124320
     atcgagcagc agcagtccgg tacggccgag ccggccgccc agtcggagcc gcaagccgaa    124380
     taaggtttgc gattcctgac gcaagaacgg cgcccgcggg cgccgttttt gcgtccgcat    124440
     acggtaaagt catgccacgc gcggccaggc cgcctcagga caagggacac ggacggatat    124500
     ggcatgacga gcaggcggct ggccgcactg tcaggatggg ccgccagcgt gctgctggcc    124560
     ggctgcatcg cgcccggcgg cagcggtggg ccgcgcggcg aatcgatgtc ggccgaccag    124620
     ttcatgcaga ccgacttcaa ccgcacggtc acgctggaga tccgcgacaa cctggccagc    124680
     ctcgacacgc tgctggacaa gctgtaccgg cgcaatccgc gcgaatggcg caagagcggg    124740
     gtggcggacc aggctgccgc ggtggcgcgg gtcaagcgcc tgatcgaaga gcgccgtcct    124800
     ccggcgggcc tggcgggcct gcgcgacatc caggtgctgg ccgtgtcgct cgatccggcc    124860
     tacggcggcg atcgcgtggc ggccttcgtc tatggcctgg ccgacaccct gatcgcggcg    124920
     cacaacgaca agacccgcat ctacctctcg gacgtgctcg acggccagcg catctacaac    124980
     gcggcgcgca atgtcgaggc ggccgcctgg ctgctggcct cgcgccgcac cgcccagggc    125040
     gagccgctat tgctggccaa cgagatgtcg gccgcggcca cgaatctcag cttcgagcgc    125100
     gaattcggcg ctatcatcgg caggctggac ttgattgcca acctgctcgg cgaaaactcc    125160
     cggcgcatcg gcatcaacta cgcacagggc ctgctgttct tcaatttcct gccagtccgc    125220
     taggtgtgaa ctgtcaatag gttgtattcg tccaggttga gtctggagat gggtacagcg    125280
     cgcccgatgc cttggtgggg tcgatgccag ttgtagtggt gtagccagga tttcatggca    125340
     tcggctcggt gttgggagtt ctggtaggtg tgagcgtaag cccactcacg caaggccgac    125400
     tggatgaagc gttcggcctt gccattggtc tgtgggcggt aaggtcgggt aaagcggtgc    125460
     ttgatgccca gctcatggca cagcgcggcg aaggcgcggc tgcgaaaggc cgagccattg    125520
     tcggtgagca agcgctggat ggtcacgccc aggcgctggt agtaggccac tgcgtccttg    125580
     aggaactgga cggcgctggg gaagcgctcg tcggggtgga tgtcggtgaa ggccacgcgg    125640
     gcgtggtcat cgatggccac gaagacgaag tcccagccgg ccccctcaac ggtatcgcgt    125700
     cggttgcccg tgacccggtg gccagggcgc tggatacgtc ccagcttctt gatgtcgatg    125760
     tgcagcagat cgccgggggc ctgatgctcg tagcgcacca ccggctcggc cggctccagg    125820
     tcggccaggt gcgacagacc ggcgcgggcc aggacgcggc tgacggtgct ggctgacacg    125880
     cccagcgcct gggcgatgcg cgcttgggtc agccgcttgc ggcgcagctc cacgatagcc    125940
     agcgccttgg ccggcgcaat cgctcggggc gagaccgtcg ggcgcgagga cgcatcggcc    126000
     aagcccgcct ggccctgagc caggaagcgg cccagccatt tgcgcacagt cggcgcggtg    126060
     accccatagg cgcgggccgc ttcaggcaca caaacttgat gggcgatcaa ttgctggacc    126120
     atttcgagtc gacgtaggaa ggtcaatcgg gcatgcttat gggtgttcat ccggccgggc    126180
     tccttgagtg aactgggggg ttggcgattt ccagtttctc aaatccggtt cggatgaacc    126240
     atgcatacaa cctattgaat cttcacagct aggctgcggg atatcgcgca ctcacccaga    126300
     cgccgccatc gtgatcgatc ttgccgccat ccagaccgcc cgggacatcc tgcggggaca    126360
     ggtcctcaat acgccgttca cgcattcccg cacgctgtcc gatatcctcg gcgccgaaat    126420
     ctggctgaag ttcgagaacc tgcagttcac cgcctcgttc aaggagcgcg gcgccctcaa    126480
     ccggatgctc aacctgaccg aggccgagcg cgccgccggc gtgatcgccg tgtcggccgg    126540
     caaccatgcc cagggcgtgg cgtaccacgc gcagcgcatg ggcgtgccgg cggtgatcgt    126600
     catgccgcgc ttcactccca cggtcaaggt ggccaacacg cggcgcttcg gcgccgaagt    126660
     cgtcctggcc ggcgacacct tcgacgacgc caaggcgcgc ggctacgaac tggcgcgcga    126720
     gcgcggcctg gtcatgatcc atccctacga cgatccagcc gtgattgccg ggcagggtac    126780
     ggtggcgctc gaaatgctgc aggcgcgccc agacctggac gccatagtgg tgggcatcgg    126840
     cggcggcggc ctgatcgcgg gcatcgccac cgccgccaag gccatcaagc cggacatcga    126900
     gatcatcggc gtgcagaccg agcgctttcc gtccatgtac gccgccgtca agggcgtggc    126960
     catggaaagc ggccactaca cgatcgccga gggcatcgcc gtcaagtcac ccggcacgct    127020
     gacccaggag atcgtcacgc gcctggtcga ccacatcgag ctggtcaacg aaagcgatat    127080
     cgagcatgcc atcgtggtcc tgctggaaat cgagaagacc gtggtcgaag gggccggcgc    127140
     ggccggcctg gcggcgctgc tgcggctgca ggaacgccgc gacgagcggt tccgcggcaa    127200
     gcggctgggg ctggtgctca cgggcggcaa catcgatccc ctgatgctgg gcgagctgat    127260
     cgagcgcggt atggtgcgcg ccgggcgcct ggcgcgcatc cgggtcgacc tgcgcgacct    127320
     gccgggcgcg ctggcgcagg ccaccaagct gatcgccgac gcgcacgcca acattaccga    127380
     ggtgcatcac cagcgcgcct tcaccacctt gccagtgcgc aatgtcgagg tcgatttcgt    127440
     gctgcagacg cgtggccatg accacatcca ggaagtcatc gcggtgctca atgccgcggg    127500
     cttcgcggcc agcaaccacg atcactgatc cgcatcggcc aggcgcctga gccgatacag    127560
     gcgctcgcgc tgcaggatcg cggccagcgg caggggctcg cgcccgagcg ccacataatc    127620
     gtcggcaacc gtcgccagcg cgtcgcgtag cgcggccggg tcggcctgcc accagcgcgc    127680
     cagcagatga tccggactga acgcgtccag gccctggcgg cgcagttcgg agcggttgaa    127740
     atccttcagg ttccaggtca tcaccagggt ggcgggcgcc tgcggcaggc cgcagcgggc    127800
     ccgtcgcgcc aggccggcgg cgatcacatg gaaatccttg gggtcgctgt agcgcagccc    127860
     cgtttcgtaa ggctgcgtat caacttccag cgcccgcgga aagctggcgt tcgtcgcctc    127920
     ccattgcgcg gccagggctg cggcgggaat gtcccacagg cgcgcggcgt tgcggcgcca    127980
     ttcttcgccg atgcgctcgg tccagacggg ctggaagacg cctgtccgcg ccactcgcaa    128040
     cagcagctgg cgggcgatgc cggacatcag tacgcaggca tcgagaacga caaacggagg    128100
     cgcggggttc ggtatcaagt tgaggtaggg catgcgcggc ccgttggcgc ggcgcgtcta    128160
     tcgggcctgg ggaaaacagc ggtgccgttt gatggtgcac ccacccggaa tcgaaccggg    128220
     acgccttgcg gcgagggatt ttaagtccct tgcgtctacc aatttcgcca tgggtgcggc    128280
     tgtccggcag ggcgacaatg ataacgtgct ttaacgggcc gctggccgcg ccgcgggcct    128340
     gaatcctata caatgcgcgc cgtggaaggt tggcagagtg gttgaatgca ccggtcttgt    128400
     tcaatcgagc gccacgcggg aaaccgcatg gctgtaagga gtcaaattcg gcgaagcccc    128460
     tggccctgtc cgaggtaacg ccgagcgaag gccacccctg ccggggcggc aacgtgtaga    128520
     gacttgacgg ctcccaccta aggtcgcccg actatggtga aggcaaagtc cagaccagca    128580
     aacagacatc gttctggtgg cgaaagccat agcggtacgg aaaaccggcg gggcttcacg    128640
     gccctcgtga gttcgaatct cacaccttcc gccatttcat cgcggcgcca tgcccgcctg    128700
     cggcaggggc cgtgcaaaaa agcgcataat tgccgtttcg atatcgactc tggttggagg    128760
     cgcgacatgc gagccgtaga aatcacccgt cctggcggtc ctgaagtcct ggtgcccacc    128820
     gagcgcagcg ttcccgagcc tgcttccggc gaagtgctga tcaaggtgtc cgctgccggg    128880
     gtcaaccggc ccgacgtgct gcagcgcaag ggcaactatg ccccgccgcc gggcgcctcg    128940
     gacctgcccg gcctggaagt ggccggcgag atcgtcggcg gcgatgccgc cgcggggggc    129000
     tttgccatcg gcgacaaggt ctgtgccctg gtggccggcg gcgggtacgc cgaatacgtg    129060
     gtggcgccgg cgccgcagtg cctgccgatt ccgcgcggcc tgaccgagat cgaggcggcc    129120
     ggcctgcccg agacctattt caccgtctgg agcaacgtgt tcgaccgcgg ccgcctggcg    129180
     gccggcgaag cgctgctggt gcacggcggc gccagcggca tcggcaccac ggccatccag    129240
     ctggcgcgcg ccatgggcaa caaggtctac gccacggtgg gcagcgacga gcgcgcgcgc    129300
     gccgtcgaag cgctgggcgc cgcgctgggc atcaactaca agacgcagga ctacgtcaag    129360
     gaagtgctgg acgccaccgg cggcgccggc gtggacgtgg tgctggacat ggtggccggc    129420
     gagtacatcg gccgcaacct caagtgcctg gccgacgacg gccgcatcgt catcatcgcg    129480
     ctgctgggcg gcgcgcatgc aaacgtggat tgcaatcagg tgctgcgccg ccggctgacc    129540
     atcaccggtt cgacgctgcg tccgcgcccg gtcgagttca agggcgaaat cgctcgcgcg    129600
     ctgcgcgagc gggtctggcc cttgctggaa aacggcaccc tcaagccggt ggtgcacgcc    129660
     acgctgccgc tggagcaggc cgccgcggcc catgccatga tggaagccgg ggaaaacatc    129720
     ggcaagatca tcctgaccgt atagcgccag ccggacggcg ggcgcgccgg atcgcccggt    129780
     gcgcccggat tttcttgccc tggtaacggc gcatcggccg gcaacaggat acaatctcag    129840
     gtttgacccg accccgggtc aggccttttg actctttttt ctgcgccatg accacagctg    129900
     agaatcgcgc ccgcctggtg ctgggcaact ggaagatgca cggcaacctg gccgagaacg    129960
     ccgccttgct ggccgagttg cgcgccgccg atgccgccgc ccattgcgaa atgggggtgt    130020
     gcgtgccgtt tccgtacctg gcccagaccg ctgccgcctt gcagggcagc gccatcggct    130080
     ggggcgcgca ggatgtcagc gcgcacgcca agggcgccta caccggcgaa gtcgccgccc    130140
     ccatgctggc cgaattcggc tgccgctggg tgctggtggg ccactccgag cggcgcacgc    130200
     tgcatgccga gagcgaccag ctggtggccg acaaggcccg cgccgcgctc gaggcaggcc    130260
     tgaccccggt ggtttgcgtc ggcgaatcgc tgcaagagcg cgaaggcggc aacaccctgg    130320
     gcgtgatcga gcgccagctc gaacccgtcc tggccctggg ccgcgatgcc ctggtccgca    130380
     tggtcctcgc ctacgaaccc gtctgggcca tcggcaccgg ccgtactgcc agccccgagc    130440
     aggcgcagga agtgcacagc gccatccgcg tggcgctcga cggcctgcaa gccagccagg    130500
     tgcgcgtgct gtacggcggc agcgtcaagg gggccaacgc cgccagcctg ttcgccatgc    130560
     ccgacatcga cggcggcctg gtgggcgggg cctcgctcgt cgctgaagaa ttcctgcgca    130620
     tcgccgcagc ttaagtttcc gttccggagt ctgtaatgtc tttgatgctt actgtcctgc    130680
     tggtcgtcca ggttgtatcg gcgctggcta tcatcgttct ggtcctgctg cagcagggca    130740
     agggcgccga catggggtcg gcgttcggta gcggctcggc cggcagcctg tttggcgcca    130800
     ccggcgcggc caacttcctg tcgcgcacca ccaagtgggc cgccgtggtg ttcttcgtca    130860
     gcaccgcggg cctggcgtac gtcacccaca aggggccgtc cggtcccgcc atcgattcgg    130920
     gcgtgatgca gaatttcccg caggatcgct cggtgccgca ggcacccggc agcgcgccgg    130980
     ccggcagcgg ctcgtcggtg ccgcaggccc cgggcagcgg cgtgccggcc gcccccgccc    131040
     agcctgacgc ctccgtgccc caggcgccct ggcggttttg cccatgggca tttacatgct    131100
     agaatgcccg actttccagg atcttcggat cctggtcgaa gttttgcagg atgccgacgt    131160
     ggtgaaattg gtagacacgc tatcttgagg gggtagtggc gaaagctgtg cgagttcgag    131220
     tctcgccgtc ggcaccaagg atttgtccag gcaggccctg gcgcgggaaa gacccgcaag    131280
     agaaagccag caaaaaagcc catatgcgtc agcgcctatg ggctttttgt cgtccaggca    131340
     gatgcccagg ctatcaatgg cctgggcatc tgccaatcca ggctcagtgg caatgcaccg    131400
     tgcctgcctt tctgtccatg tggcagcatt ttccaggcgg cgagtctttc cggcagccac    131460
     cgccgtgggc cgaggccgga aacggcaggg cgagtgccag aagcagccac gccgtggcga    131520
     aaagttggat ctttctcatt ggtctctccc ggatcgatga aggtgaacaa ccggctgttc    131580
     cagcgctatc cactgcctcc ctgggccggc cttctcgggc atgggtgctc ctgcgttctt    131640
     gtttcgcatg gttacattaa caacaaaatc gccaagcgtc gaatctgtgg gccgtgcggg    131700
     cgccaggggg cttgagcgcc gccgccgcga ggtctgaccg aatcggggac gcgtggcgca    131760
     taatggttcc gggcttggca tccaggatcc ggctgaaagg cgcgcgggac gggcacggca    131820
     tgtccacccg gctggcgcgt ccccggtgga cggttccgga gcggcgcccc ttctggaaag    131880
     gagtcagcca tgtcgatcac accacccgac gacgaggggg ccgagcccgg gccgtccagc    131940
     caggcgccgc acgcgcaggc cgcggcgttg cgccggccga tcgaacgcag ccggttcggc    132000
     ggctcgcagc gccgccctga acgccaggac ggcgacgatg cgccggtgtc gcgcagcgac    132060
     ctcagcaagg ggcccgagga ggtgctcgag cgccgtacgg ccagcataaa ttggcgtgtg    132120
     ctgctggtct cgtcggccgt gatcgtcgcg ttctcggtat gggcgatcct ggtgcccggc    132180
     gatgcgcgca tgaggatgaa gacggccgtc gactggattg cggccaatct gggctggtac    132240
     tacgtgctga ccatgacgct ggtgatcggt ttcgtgctgt gggtcgcgtt ttccaaggag    132300
     ggagacgtgc gcctcggccc cgatcattcg cggccgcaat accggctgtc gacctgggtc    132360
     gcgatgctgt ttgccgccgg cgtcgggatc gacatgcttt tcttctcggt caccgggccg    132420
     gtcgtgcagt acctgcattc gccgtccggc gagggcggca cggcggcagc catgcaggac    132480
     gcggtcgtct ggacgatgtt ccactacggg gtggcgggct ggtccatgta tgccttgctg    132540
     ggcatggcga tgggatactt cgcctaccgc tggggcatgc ccctgtccat ccgcgcggcg    132600
     ctctatccgc tgttgggcaa gcgcgtgcgc ggccccctgg gcgacggcat cagcatcatc    132660
     gcgctggtcg gcacggtgtt cggcgtggcg acctcgatgg gcatcggcgt ggtgctgctc    132720
     aacgtcggtt tctcgctgat tttcgggctg gagcaaggcc tgtcgctgca gatcgccctg    132780
     gtcgtgggcg ccgtgatcct gaccatcggg gccacgacgt ccggggtcga ccgcggcatc    132840
     cgctggattt ccgagctgaa cctctggagc gcggtggcga tgatggtcta catcctgctc    132900
     accgggcaaa cggcattcct cctgaatgcg ctatcggaga acatcggccg gtttctcgtg    132960
     acgttccccg cgcgcacctt gcagacgttc gcctacgagc ccggcgggcc ggagtggatg    133020
     ggcggttgga cgctgttctt ctgggcgttc tggctggcgt gggggccgtt cgtcggcgtc    133080
     tttctcgcgc gcatttcgcg cgggtggacg ctgcgcgaat tcgtgatcgc cgcgatcacc    133140
     gcaccggtgc tgtgcgactt catcatcgtt tcgctgttcg gcaactcggc cctttatcac    133200
     gtgctgcagg gcgacaccgc gttcgccgcg ctcgcggtcg aaagctccga gcgtggttgg    133260
     tacgcgctgc tggcgatgtt tccgggagcc atgttcctga taggcctggc cacgctgtcg    133320
     gggctgttgt tctaccttac cagcgcgaat tcgggcgcga tggtgatgtc gaacttttcg    133380
     gcgtcgatcc ccgacccctc gcacgacggg ccgaagtggc tgcgcatctt ctgggccgtg    133440
     ctgacggcag tgctgacggt ggcgatgctg ctggccggcg gcgtgacgac gatggagtac    133500
     gccacgctca tctttgcctt gccggtaacc atcattgcct acacggtcat ggcgtcgttc    133560
     tacaaggtgc tgaggatgga gcgggccgag cgcgaggggc aggtgctgcg caggccgtcc    133620
     atggcgccga tgggcggcca tctgccggag cgctcatgga agcagcgcct cgaacagctg    133680
     cacgcgttcg cgtcgctgcg gcaggctacc cagttcctcg accataccgt gcgcccggcg    133740
     ctcggcgacg ttgccgccga gttccgcaac cagggctacg aggtcgcgag cgaatccctg    133800
     gccagcgagc gcggcatcga ggaaccgctg ctgcgcgtgt cgatggacgg ttttcgcgcc    133860
     ttccagtacc acgtcgccgt cgtcgaggcg ccggtgccga tgttcagcgg ccgcatgtcg    133920
     cgcgagaccg acgtctatta ccggctcgag gtgttcaccc agaccggttc gggcggctat    133980
     gacctgatgg gtctgacccg gcagcaggtg atcgacgacg tgctcgagcg cttcgaggct    134040
     cacctcgcat tcctcacctt ttccaccaat accgatacgg catcggtgct gacgccgccg    134100
     gcgccggcca ggaacccgta gcccgcgcac gcccgacggt atctcagcgc gccgcgccgg    134160
     gcgcgccggc gggcgctgcc tgccggccgg ccagtacgtc ggacagggcc ccggcctccc    134220
     ggaccagcag ttgcgccagt tcggtttccc gatgctccgg gtagcggatg cgggggatga    134280
     acagcgagaa gcaaccgatg acgtgtcccc cggtgccgaa gatgggggtg gaaatgccgg    134340
     cggcgccttc gatcttctcg ccgcgcgtgc tgacggaata gccttgctcg cggatttgct    134400
     tcaggtcgcg attgagttcg cgcgccggca gggcggccag gccggtgggc gagaggggct    134460
     ctttcttgag caacgtgcgc acgcgttcgg gcggcaggtg cgccagcacg gcatgtcccg    134520
     aggcgcccca gagcaccgag accgggcggt acaggtcgag ttggtagcgc aactggttgg    134580
     ccgattcgac ctgcttggcg aacaccaggg tggcgtcctg gtcgcggtac agcgccagcg    134640
     cgcaggactc gttggtgtag gcgacgatgc gatgcagcgg cgcgctggcc agctgcacca    134700
     cgttcacctt gttggagatc atggcgccca gccggtacat ctccgggccg aacgcgtagc    134760
     ggcgcgcgcc ctgcacgcgc tgcatcaggt tcagcgccac cagttgctgc agcaggcggt    134820
     gcgccgtgct gtgcggcaac tgcaattcat cggcgatgtc tttcaccccg acgtcatcgt    134880
     cctgggaggc gagaaaggcg atcagcctga cgattcgttc gacggtaccg cgctcgtttt    134940
     ccatgtctgc gcattttccg agtgacccgg cccaggaggg gccagggtgc tgcgtgagtg    135000
     atcggccagt gccggcgaca gcgtgagtgt agagggtggc ggcgttgccc aagcgcgacc    135060
     gccggcgccg gccgggcacg ctttcgccac ggttccggct tgctttttgc cgattatata    135120
     ttccgttgtt cggaatttac atatcattta atgacatcca aatccggcgt gcctaaactg    135180
     gcctggcctc gagaagaagg cggatgccac aggagatagg acgacatgcg agtgcaacgg    135240
     ttgctggcga cggacgggat aggcgggtac tactggcgcg accaggaggc gatcgggcag    135300
     ggcgcgccgc gtgacggctt cttgtaccgg ggcgcgccgg tcacgcccgg ttttacgtcc    135360
     atcatccagg tgagttccac ggtgctgctg accggcgtgg ccgacgacgg cagcgaactg    135420
     tacggcgatt gcgcgacggt gaatcacgcc ttccggtcgg ggcgccagca ggcgccggat    135480
     gcggccagcc tgatcgcaca ggccgagggg ccgctgtcgc gctggctggc gcagtgcgac    135540
     ctgtcgtcgt ttcgcgacgc cgccgcgcaa ctcgatacca tgcggctcga cgggcagccg    135600
     ttgcacatgg cgctgcgcta cggcctgtcg caactgctgc tgcaggcggt ggccgcgcat    135660
     caccgagtca cgatggccga gatcctggcg cgcgagtatg gcctgacgct ggccgacacg    135720
     ccgtgcgacc tgttgggttc ctgcggcggc aactggtacg agaacgtcga caaggcgatc    135780
     gtgcgcgagc tgccttattt tccgcagacc gccatggtgc gcaccgacca gctcgacgaa    135840
     ctgccggcgt acgccgaatg gatcagccag cgcatccgcg cggtgggccg tccggatttc    135900
     ttcccgacgc tgcattacga cctgcacggg ctgctgtcgc agcgggtggg cgacgacctg    135960
     gatgcggcgc tggtctatct gcgcaaggtg gaggcggcca gcgcgccgta ccccgtgctg    136020
     ttcgaggatc cgctcgacgc gggcgagcgc ggcgcccaga tcgcgctgat ggggcggctg    136080
     cgcgaggccc tgcggcgcgc cggctcgggc attcgcctga tcgccgacga atggtgcaac    136140
     acccgcgagg acgtgcgcga gttcgtcgcg caagggtgtt gcgatctcat ccagatcaag    136200
     atgccggacc tggggggcgt ggacaacacc gtgcaggcct gcctgatctg ccgtgacggc    136260
     ggtgtcggcg tgtacctggg gggcagttgc aacgagacgg acatctcggc ccgcgtcgcc    136320
     gcgcacgtcg cgctggcggt gcgtccggtc gagttcctgg gcaagccggg gctggggctg    136380
     gacgagggcg tgatgatcgt caccaacgaa atgcagcgcg cgatccgctc ctatcggacg    136440
     cgcctgtccg cggcgtagcg tccgtccgca cggcgcgggc ggtttgtcgg catcactggt    136500
     tttgggggcc cgtcggccac gcatggcgtg cggccggcgc acaacatgat cgaaccaagg    136560
     acacagacat gacacgttgg cagcaatgga tcatcgccgc gctggggtgc ggcgcggcct    136620
     gcctgggcat tgcgacgagc gccctggcag ctccggccgg ctacccgaaa ggaccggtca    136680
     ccctggtggt gccgaccggc cccggcggcg gcaccgacct ggcggcgcgc gcgttttccg    136740
     agcggctctc cgccatactg ggccagcccg tggtggtgga caaccgcgcc ggcgccggcg    136800
     gcatcatcgg cacgcaggat gtggccaagt ccaggccgga cggacacacg ctgctcatct    136860
     ccagcaacca gttcggcatc ctgccggcgg tgcaggacaa cctgcctttc gatccggtca    136920
     aggatttcat ccccgtcacc tccatcggcc tgattccgac cctggtgctg gtgaacccgt    136980
     cgttgccggt gcggtcggtc gccgaactga tcgattacgc gcgcaagcag cccggcggcg    137040
     tgcagtacgc gtcggccgga atcggctcgc ccaaccatct gtttgcggca atgttcggtt    137100
     cgatggccga cgtgccgatg atgcacgtgc cgttccgggg cacatcgccg gcgctggtgg    137160
     ccgtcgccgg cgggcagacc gccgtggcct tcgcctccca gccggcctcg cagagtttcg    137220
     tcgccgccgg caagctgcgc gccatcgcgg tcacctcggc ccggcgcctg ccgtccttgc    137280
     cggacctgcc gccggtgtcc gataccgtgc ccggctacga cgccgatatc tggctgggcg    137340
     tgtgggccgt ggccggtacg ccggacacgg tggtggacgc cattcatgcc gcgttcgagg    137400
     aggccttgaa ggatccacgc gtgatcgaca gcctgggcaa gatgggcatc gtggtggcga    137460
     cccgctcccg ccaggacttc accgccatgg tcgagcgcga gatcggcaag tgggcccgcg    137520
     tcgtcgccga ggccggcgac ggtttccaga agcaatagcc gccaaccatc cgatcgctgg    137580
     agtgccgcat gcagctcgca tcgccgtcgc ccgccgtggg cgtcacccgg ccgctggccg    137640
     acgccatcgt ggccaccgca tcctccaggc tgggcgccgc cacgcttcag acggcgcagg    137700
     cctgcctgct cgacagcctg gcggtgacgc tggccggtgc gcaagagccg ctggttgccg    137760
     tgcttgaccg cacgctcgcc ggtttcggcg gcgcggggca ggccacgctg atcggccggg    137820
     gcaggcgtgc gccgttgccc gacgcggcgc tggtcaatgg cgccgcgggc catgcgttcg    137880
     atttcgacga tatgcacatc gagtcggcca tgcatccgag cgtgccggtg gtcgcggccg    137940
     ccctggccgt ggccgaacac gagggcgcgg acggagcggc gctgctgcgg gccctggcgc    138000
     tgggcatcga ggcgcagctg cgcatcggcg aggcggtgcg gccccaccat taccagcggg    138060
     gctggcatgc caccggcacg ctcggccatt tcggcgcggc ggtcgcggcg ggttgcctgc    138120
     tgggactgga cgcgcaacag acgacgatgg cgctcggtat cgccggtacg caggccagcg    138180
     gcccgaaaga gactttcggc accatgtcca agccgctgca tgccggccag gcggcgcgca    138240
     acggcgtgat ggccgcgctg ctggcgcgcc aggggtacac gagcaccgag gatatcctgg    138300
     acgggcatta tgggttcggc cgcgtgtgcg gcgatggcgc gcattgggac ggcctgctcg    138360
     acggctgggg cgagcgctgg tccatgcacg acattctcta caagccgcac gcctcgtcct    138420
     tttgcacgca ggcattgatc gaatgcgccc tggccctgcg tgcgacgccg ggctttgcct    138480
     ggacggcggt ggcgcggata catggcgaag tcagcgcgat gtccatggcc aatgcgcgca    138540
     tcgtcgagcc gcgcgacggc atgcaggcca agttcagcct gtcccatgcg attgcccagg    138600
     gcctcgtgca tggccaggcc acgattgcag atttctccga tgcccgcgcg cgcgagccgg    138660
     ccctgcgggc cttgcgcgcg cgcaccacga tcgcgcaagg ggccgggctg gcctggcccg    138720
     aagccatcgt caccgtgacg ctggccgacg gcagccagtt gcgccggcac gcggacctgc    138780
     gcgcgagtac cgctacgtcg caggacaaat ggcgcgtcac gctcggcaag ttcatgagcg    138840
     tggccggcgc cgtgcccggt ttcgcgtcct gtgacgcggt gcgcgacgcc gtgctgcgcc    138900
     tgcccgaggc gcccggcgcg gtagcggccc tgatggcgct gctgcggccg caggccgcga    138960
     cgccctccgg agcctgagac cgcctgcttt cccaacccca ttgccattac acgaggagac    139020
     ccgcatgacg actttgggag tcggggcgat cctgtcggcg gaacccgccg agatcgtccg    139080
     ccgcttgacc ttcgccacca aggaggccgc cgcagccggc cacgaggatc tgttccatgc    139140
     catgtcgcgc gtcaatctcg cgcatgccgt gatgctgcgc gaccgcaacc tgataccgcc    139200
     cgaggccgcg cgggcgctgg tggcgctgat ggccgaactg ttcgagcgcg gaccgtccag    139260
     cgtcgcgctg gaggccggcg ccggcgacct gtatcgcaga tcgaggcgca cgcggccgcg    139320
     ctgctgggcg ccgacgtggc gggctacctg cagctcgggc ggtcgcgcgg cgacgtcatt    139380
     ccgtcggcga tgcgcctgaa gctgcgtatc aagctgatgc gcctgctggc gtcggtgctg    139440
     gccctgcgcg aagcgattct cgatcgggcc gtcgagcatg ccgataccat catgcccgcc    139500
     tacacgcact ggcagcagtc gcagatcatg acggtggggc atttcctggg ccggttcagc    139560
     gcctggctgg agcgggatac gcagcgcctg ttcgaatgcg tgtcgcgcca caatctttcg    139620
     gtgctgggca gcgccaacgg cgtgggcacc agcgtgcggg tcgaccgcgc aatgaccgcc    139680
     gcctggctgg ggcacgacga gcccacgctg tccacgggcg acggcaccaa tgcctgggac    139740
     tacatgatcg aacccgtatc ggtggcggcg ctgctgtgct cccacctggc gcgcctgacg    139800
     ggcaacttca ttctctggca cacccaggag ttcggcatgg tgcggctaag cgatgcattc    139860
     tgcaccgcca gcacctatct gccgcacaag cgcaatcccg aaccgctcga gaccgtcaag    139920
     gtgttcgccg agcaggtgca gggggcgctg gccacggtct acctgatggc gcgcaacgag    139980
     gactggccgc acagcctcat caaccacggc ttcgacgcga tcaatggcgc cttgacgctc    140040
     agcggcgacg cggcggacct gaccggcgcc atcatgcgcg acatcagctt cgaccccgcg    140100
     cgcatgcgcg agctgctgga cctgagctat gccacggcgt cggaagtggc caacacgctg    140160
     gtggcggccg gcggcctgcc gtttcgggag gcgcacgaga tcgtcggcac ggcggtacgc    140220
     gcctgcatgg cggacggacg ggctgcgctc acgctggcgc gggtgcgcga cgcggcccgc    140280
     ggcatgggca tcgacctgcc gccgatcgac gatgcgcagc tggctgcctg catcgatccg    140340
     ggcaatttcg tgcaggccat ccattccagc ggcgggacgg cgcccgcgga ggtgcgccgc    140400
     gtgctcgccg tgtggcggga cgcgctgcac gcggaccagc gcgcgtggcg gcagtggcag    140460
     gaccgctacg acgaggcgga ccgcgcattg ctggcgagcg cgcgcggcgg cgcttgaatc    140520
     cggaccggcg cggcggccgc taccgtcgcc cggctgttta cttcaggagg tttgcatggc    140580
     tgacctgttt tcagtgctgc gtatcgcata cacccttgcg ctgggcgcgg cgctggccgc    140640
     gccggcggcc gtcgcggcgc cgtttcccga ccgtccggtg cgcctggtcg tgccctatcc    140700
     gccgggcggc ggcgccgaca tcttcgcccg caccctgtcc gagccgctgg cggcccagct    140760
     gggccagcca gtcatcgtcg agaaccggcc cggggccaac ggcatcatcg gcaccgatgc    140820
     cgtcgcccgc gccgcgcccg acggctacac catcctgctg ggcaacagcg ggcccaatgc    140880
     catcaaccag gccatttatc ccgaccttcc ctatgacgcg gtcgacagct tcgaggaagt    140940
     cagcctgatc ggctacacca cccatgtgct ggtggtgcat ccgggcgtgc aggcccgctc    141000
     ggtgaccgag ctgatcgcgc tggcgcgccg ctcgcccggg cagctgaact tcgcctcgac    141060
     cgggcagggc ggcacgccgc acctggcggg cgagctgttc aagctgatga ccggcacgga    141120
     catggtgcac gtgccctaca agggcgcgtc gccctccaac gcggacgtga tcgccgggca    141180
     ggtgcagctg acgttcaaca cgctgccgcc gttgatgacc tcgatcaggg ccggcaaggt    141240
     gcgcgcgctg gccgtcaccg gcaagcagcg ttcgcaactg ctgcccgagg tgcccaccat    141300
     cgatgaggcc ggcgtggccg gctacgatgt gcagacctgg tacggcatcc atgcgccggc    141360
     gggcacgccg gcggcggtcg tggatcggct caaccaggcc ctggtggccg tcctgtccaa    141420
     cgcccaggtg cgcgcggcgc tggtggggca gggctatgag gttgccacca gcacccccgg    141480
     cgagttttcc cggatggtgc gcgacgacgt ggcgaagtgg cgcaaggtcg tgaaggaggc    141540
     caaggtcaag gtcgactgag ccggcgcgca ggtgtcttgt atctttcctc cggtggtgat    141600
     tagctatcac caccgcacgc cgatgaccgc gagttggtgc ccaaagcgag gactttgtgg    141660
     gacagatagc ggctcggcag cgcactgctg ggccggcgag acactggacg gtatcgtagg    141720
     gcgaggaccc tgtatgtaca aggcaagtgg gcgcagtggc tgacagcagt ttgttatctg    141780
     caggaggcca agtccatgtt ttcataggta ttgatgtatc aaaggccaag ctggattgca    141840
     cgttgctgac ggctgaggct gacaagtgta agaccaaggt ggtggtcaac accgccgcgg    141900
     gcgtacaagc cctgctggcg tggtgcgcca aacacggcgc acagccggcg cagttgcacg    141960
     ccatcctgga gcctacgggt ctgtatcacg agcaagcggc cacggcgctg ccccaggtcc    142020
     gggtctcttt ggtcaatccc gcccaggccc gggactttgc caaggccttg gcgctgcgct    142080
     ccaaaaatga tgcgctcgac agctacgtgc tggctcgcta tggacagacg ctgagcccgg    142140
     cgctgtggca cccggcgccc ttgcatgcgc gtcaactgcg cgccttgttg acgcgacgcg    142200
     aggcgctgag caaggatctg ttgcgtgagc tcaatcgcaa agagaagagc cagttcagcc    142260
     cctcggcgcc cttggtcgat ggttccatcg acaaggccat cgcgttcttg cgcgaacaga    142320
     tcaaacaaat cgagcgggcg atcgatcagc acatcgacaa ccaccccgac ctcaagcaag    142380
     actgcgagct gctgaactcc atccccgcca tcgggcctca ggccggcaac gccatcctgg    142440
     ccgtcatgca caatcggcat atcgactccg cccagagcct ggccgcctat ctcggggtgg    142500
     tccctgtgca gcgccaatcc ggcagcagtc tgaacagctg cgcacgcctg tccaaagccg    142560
     gcccctccca ggtgcgcgcc acgttataca tggcggccct ggttgggacc cgccacaacc    142620
     cccacatccg cgccctttac cagcgcctgc tcaaagcagg aaaaagcaaa aaggccgcgc    142680
     tgggcgcggc catgagaaaa ctggtgcatc tgtgcttcgg ggtcctcaaa aaccgcatcc    142740
     cctaccagcc caattacgcc atgaacggtt gactgccaag acggtatctg tccccgcagg    142800
     ggggctggcg cctgcaagat ttcatggcgt ctgcccgtgc gtgtgcctgt ccccgctggg    142860
     acaggcacac tgccgtacgc catcgacgct tgacgactaa gacagtatct gtccccgcag    142920
     ggggactgac acctgctgat tgtcgacacc cgccccgtgc gccagcgctc agtacgtgcc    142980
     ggggtacgcg ccgccatcga tcagcatgtt ctgcccggtg atgtagccgg cgtgcacgct    143040
     gcacaggaag gcgcagagcg cgccgaactc gtcgggacgg ccgaagcggc cggcggggat    143100
     gcccagctgc tgttcctcgc gcagcgcttc gatgctttgg ccgcacgcct gcgccgcgac    143160
     gcgcatcgtg ctcttcagcc tgtcggtgtc gaacctgccc gggaggatgt tgttgatggt    143220
     gaccccgcgg gccgcgatct ccgagcgggc caggccggcg ataaagccgg tcaggccgga    143280
     gcgggcgcca ttggacaggc ccagcgtgct gatcggcgcc ttcacggcgg tcgaggtgat    143340
     gttgacgatg cgtccgaagc cgcgcgcctg catgccgtcc accgtggcct tgatcagcgc    143400
     gatgggcgtc agcatgttgg cgtcgatcgc cttgatccag tcatcgcggt cccagtcctg    143460
     gtattgcccc ggcggcggac cgccggcgtt ggtcaccacg atgtcgaagt ccggcccggg    143520
     gccgcccggc gcttcgagcg cggcctgcct gcctggctcg gtggtgatgt cgcaggcgac    143580
     ggcgatgacc ttgcctgcct ggccgcccga ttgccgggcc tggttttcgg cgtccttgcg    143640
     cagcgcggac gccgcgtcct gcaagacgcc gtcgttgcgc gcgttgatga cgacgttgac    143700
     gccgttctgc agcagcgcgc tggcgcagcc atagccgagc cccttgctgg cgccgcatac    143760
     cagcgcccac cgtcctgcaa tgccgagatc catgtgtgtc ttccttgggt tggatggccg    143820
     gtccgagcgg gaacgggcct gaattacgaa aggcgtgggg ggcgccgccg tcagcctgcg    143880
     gccgggccgg cgcgcgccgc cggcactgcg tcgaccagct cccaggcctg gcgcagcatc    143940
     tcgtaggcct ggcgcgcggg cgagtcgtcc gcatgcgggc gtatccacag gtgataggtc    144000
     atctcgggca gcggcggcag gccgtcggcc tcgtccagca tgcgcatgtc gggcgcgagc    144060
     aggtcgatgc tgcgcggggt gacgcccagt ccggcgcgga tcgccgcctt gatgccgacc    144120
     aggtcgggca cgatgcgcgt gaccgtccag cgtatatggt gctgctcgag cgccgccagg    144180
     gccatttcgc gatagatgct ggagccgtcg gccaggatca gcggcaaggc cttgtcgggg    144240
     cggtgcacat agtccgcggc gcatagccag accaccggcg agcgtttcag gatcagcccc    144300
     tcgaattcct ggtgaaagcg ggccgagatg gccatgtcga tttcgccgcg ctgcagcagc    144360
     tcgaacagcc gcggcgcgct gtctatgcag acgtcgatgt tcaactgcgg caaggcctgg    144420
     ctggcctgcc gcaggatgga gggcagcagg gtctcgacgg cgtcgtgcgg cgagccgatg    144480
     cgcagcgtgc cctgcaggcg ttcctggaaa acgcggaaga cctcgtcgtt gagcgccagc    144540
     acctggcttg cgtacttgag catcttctgc ccgtcctcgg tcaggacgcg gctgcgcccc    144600
     tgcttctcga acagggcggt gcccagcgtc gcttccagct gatgcatctg gtgggtaatg    144660
     gccggctgtg tcttgaacag cttttccgcg gtggcggaaa agctgccggt ctgcgcaatg    144720
     gtcaccagag tgcgcaactg ctgcatgtcc agatggcgca cggatcgtat cccctgtctt    144780
     gatttattaa tcattttaat ggttcaggaa aatctttcat tagtagacgc tgcgccggct    144840
     acctagaatt cctctcgttg tctgtgcccg ccgcatgcgc gggcgcgcat ttcgctcctg    144900
     cccgggcggc gcctgtcgcg ccgcgggcag gtccgtccga acactttcac ttctgcaggt    144960
     gctcatgaag ttcgatacgc tgctgaccca tggcggtcgc gacccgaagg cgcacaaggg    145020
     gatggtgaac acacctgtct accgcacctc aaccgttgta ttcgagtcca tggccgagta    145080
     caaggcaacc cgtggcgcga agttcgacca cgtacgctac gggcggctcg gcacgcacac    145140
     cgtgaaggag ctggagaacc tggtggccgc catcgaaggc ggccatcggg cggttctcac    145200
     gccctcgggc gtttcggcca tcgccacgac cctcaatacc ctggcccgtc cgggctcgca    145260
     catcctggtg ccagacaacg tctattaccc ctgtcgcgag ttctgcgaaa aggtgctggc    145320
     gccgcgcggc gtgcgcgtcg agtactacgc cggttcggag gtcgagcgcc tggtccgccc    145380
     cgatacctcg gtcgtgtact gcgagagccc tggttcgctg accatggaaa tgcaggattt    145440
     cgcccgcatc gccgccgccg cgcatgcggt cggcgccaag gtggtggccg acaacacctg    145500
     ggcgacgccg gtattcctgc agccgttcga gcacggcatc gacgtctcca tccatgccgc    145560
     caccaagtac ctggtgggcc attcggacgt gatgatgggg acggtgacgg cgcatgaccc    145620
     cgagctgtgg ctggccatcc gcacggaagc ggccgcgcag ggcctgtcca tcagccccga    145680
     cgacgcctat ctggccacgc gcggtatccg cacgctgggg gtgcgcatgg cggcgcacta    145740
     ccgcaacgcg ctggacgtgg cgcaatggct ggccgggcat ccacgggtgg cgcaggtgct    145800
     gtatccggcg ctgccgcagc accccgacca cgcgctgtgg cgccgccaga tgcgcggcgc    145860
     ctcgggcctg ctgaccctcg aactggagcc ctgcagcctc gagcagcgcg acgccttcat    145920
     cgaccggctg acgctgtttg ccatcggcgc gagctggggc ggctacgaga gcctggtgct    145980
     gccggccgat accgccggca agcgcagcct ggcgggcagg gactatgccg ggccgctggt    146040
     gcggctgcat atcggattgg aagatgtcga agacttgaag cgcgacctgg accaggcgct    146100
     gcgccgggag gattgaaccg tgtcgaaaat acaagacttg ttgtccggca tgcagccggg    146160
     aaccgtggcg catgactacc tgccggtggg caccatgagc tcgggcatgg ccatcgccat    146220
     cccggtgacg gtgatcaagg gggcggcgcc gggaccttgc ctgtgggtca atggacaggt    146280
     gcatggcaat gaactcaacg gcgtgatcgc cgcggtggag ctgggccgcc gggtggatcc    146340
     ggccgcgctg tcgggcagcc tggtcatcac gcccacggcc aaccccctgg ggctggacaa    146400
     ccgcaccaag acggcgccgc aggatctgca ggacctggac cagactttcc cgggcaatcc    146460
     gcaggggatg gtgaccaacc atatggccca tgccctgttc caggaagttc gggcggtggc    146520
     ctcgtgcctg gtgaacatgc atacgatggg ctcgatccac gacagcaagc cgtactgtgt    146580
     ctacaaggtc tttccgggca gcgcggtcac cgaggcgcag ctgctgcgca tgacctcgtt    146640
     cttcgaaccc tcggtcagct gccgcatgga cgtgggcggc gcgggcgaac tgcccggcaa    146700
     cattgccggc gggctggatt accagtgcct ggccatcgat gtgccggcct tcatggtcga    146760
     actgggccag ggcagctggt acacgccgga gaacgtcgag caggcgctga ccgggctgct    146820
     gcgcctggcg agccacctgg gcctcatcga cgaaagcggc gtatccgccg gcgctcccgc    146880
     gcccgccagc gtgcgccggg tcacccggcg ccgctgggtg atggcgcgcc atgggggctt    146940
     gttcctggcg gccgggcggg ccggccagat cgtgccggcc ggcgcgccgc tgggccgcat    147000
     cgtggatttg catggcgccg aggtggaggc cgtcagcctg gataccgatt gcatcgtcat    147060
     cggcatgcga cgcgatccgg tggtgcacac cggcgaccgc gtggcgttcg tggcaacgca    147120
     atgggaccag gccgatatcg gcgccggctg aggcgcggcg ccgcgatacc cgtccattcc    147180
     gattcgagca ggtccggcgc cgcgggcggc gccggtggtt gcgttcggcc cgcgcccgcg    147240
     gcgcgtggcc tttttcaacg aagaacagag gggaatacca tgcaacatac tctcgcgaag    147300
     tatctggccg ccgccgtcgc ggtactgccc tggaccgccg gggcgcagga caaggccgcc    147360
     aagccctggc agccggacgg cccggtgacg ctcatcctgg gctatggcgc gggcggcggg    147420
     cactatgccc tggcgcaggt gctccaggcc cgcatggccg aggaactggg ccagccgctg    147480
     atcgtcatgc ccaagccggg cgccggcgga ttgatcgcga ccgacttcgt cgccaacgcg    147540
     cggcccgacg gccgcaccat cacctggtcc gggccgggcg tgctgacgat ctggccgcag    147600
     ttgcgccaga tttcctatga ccccaagaag ctgaccccgg tcaacctgct ggtccagatg    147660
     ggctacatgc tggtgaccaa gccgggagaa agccgctgga acagcgtgca ggacgtgatc    147720
     gacggcagca agagcggcga cgtgacgtat tcgtcggtgg gcgtgggcac ctcgaactcg    147780
     atgaccggcc atttgctcaa tgccatgacc ggcagccggc tgcgcgagat cggctacaaa    147840
     gggggcggcc cggcgctgat gtccaccatg gccggcgaga ccgatatcgg gttcggcgat    147900
     acggccaccc ataagctgat cgccgccggc cggctgcgcg ccatcgccac caccacccgc    147960
     cagcgcgagc cgcgttttcc cgacgtgccg acggtggccg agaccgtgcc gggctacgag    148020
     gtgaccaact ggctgggcgt catcgcgccg ccgggcacgc cgcagcccat cgtggatcgc    148080
     taccagcaga tcttcgccaa gctgatggcc gagccggaga tcgccaagcg cgtcaaggaa    148140
     ctgggcatga cgcccgacgt cggcacgccg caggcattca gcgagctgat cgattcggag    148200
     acgcagctgt ggaagcgcct gatccgcgac cagaacatca aggttgagta aagcatgccg    148260
     acaggagaga agacgatgac tacgatgcaa caacgttacg atgcggtgaa agacgccatg    148320
     gcgcagatcg gccgtctggc tgcgcagctc gacggcgagg cgctgcgcga ggcgatcggc    148380
     ccggtgctgg tcgccctggg cgagcgcgac gagctgtttc cgcgcgatga gttcccgatc    148440
     cgggccggca agcccggcgg gctgtatcag ttgtggcgcg gcgagagcgg cgacctggcc    148500
     ctgtatgcgt cggcgggcaa gaccggcaag aagcagccgc cgcacgatca caccacctgg    148560
     gcggtgatcg ccggcgtgta cggcgaagag cacaacgtgt tcttcgaacg caccgacgat    148620
     ggctcgcgcg ccggtttcgg cacgttgcgc cagatcgacg ccctgaccgt ggtccagggc    148680
     aacgccgcgc gcctgagcgg cgaggtgttc cacacgatcg aagtcgtgtc cgaggaagat    148740
     tcgctgcacc tgcacctgta tggccgcgcg ctcgatacgc tgagcggacg catcaatttc    148800
     gccacggaag aaggcggcgc ctatacccgc ttcatggcgg tgccggaaac ctacgcgccc    148860
     tggatcgcgc cgcgcgatct gtacgagatg ctgaccgacg gcggcgagct ggccatcctg    148920
     gacgtgcgcg agaacggcgt ctatacccag gggcacctgt tccatgccgc gtccatgccg    148980
     ttgtcggtgt tcgagctgcg cgtcgacgac ggactgccgt cgccgcacgt gcgcatcgtg    149040
     gtgatcgacg acgccgacgg cctggccgag caggcggtgc gcctgctgca tcagcgcggc    149100
     taccacaacg tggcggtgct gcagggcgga cagccgggct ggaatgctgc cggcctgccg    149160
     gtatataccg gcgttttcgt gcccagcaag gcttttggcg aagtggccga gcacgtctac    149220
     ggcacgccca gcatcagcgc cgtcgagctc gacgcgctgc ggcgcagcga ggaggtgctg    149280
     gtgctcgaca gccgcaccga acaggaattc aacctgatgt cggtgccggg cgcctattcg    149340
     tgcccgggcg ccgagctggt ggcgcgtgcg ctggaccatg ccggccccat cgtcgtcaac    149400
     tgcgccggcc gtacccgctc catcatcggc gcgcagtcgc tgcgcaacgc cggcaagaca    149460
     gacgtgcggg ccctggaaaa cggcacgatg ggccagcacc tggccggcct gccgctcgaa    149520
     cgcggcaagt ccgccagcta cctggaccgc ccggtcgccg ccggcgccgc gcaggcggcg    149580
     caggcgtggg cgctgggcat gtccatcgcc acgctggacg cgggcgaatt gcacgacatg    149640
     ctgtccaacc cctatcgcac cacgtacctg ttcgacgcac gcgatccgtc ctgctcgtcg    149700
     cgggcgaccc tgccgcgcgc ggtggccgcg cccgggggac agctggtcca gcagacggat    149760
     tactacgcgc cggtgcgcaa tgcgcgcatc gtggtgttcg acaccgacgg cgtgcaggcg    149820
     ccgatgaccg ccggctggct gcaccagatg ggctgggaag tctatctgca ccggcccgag    149880
     gcaacggcgc tggtcgcgcc gccgcgcgtc gagtacgacg acgagcgtgg cgtgccggtc    149940
     gaggccgtcg cggccgacgc cgtgatcatc gacgtggggg attcgcgtac ctatcgggcc    150000
     ggccacctgg ccggcgccgc ctgggcgccg cgctcgcgcc tgccggcctt gctggcgcag    150060
     cgcaagcccg ccgggccgct gctgttcacg tgcgcggacg gtcgggtctc gcggctggcg    150120
     gcggccgacg ccgccgcgca gggctaccag gccgcctacc tgaagggagg caccgcggcg    150180
     ctgggcgcgg accggctgcg cggcgacgcg ccgcagttcc tgaccgaggc gatcgacgtc    150240
     tggtaccgcc cctatgaccg cgagaccggc atcgaggaag ccatgcacca gtacctgagc    150300
     tgggaaaccg gcctgctgga caaggtccgg tccgacccca ccgtggcgtt tcgcatctga    150360
     acgcggcgac ggccccgcgc gcttgcgcgc cggggccgtc gcggccggca ggcgagcccg    150420
     gactgctcag ctgggcgtga tgccggccgc ttccacgaac gatttccagc gctgcttgtc    150480
     ctgctgcacg aaggcgtcga tttcggcggg ggtggccggc gggtaggtca gaaagccctg    150540
     gtccacgtag gtcttctgta ccgaaggctt ggcgatggtc tgccggaact cgtggttcag    150600
     cttctggacg atctccgccg gcgtcttgcg cggcgcgaac accgcatgcc aggtgacgac    150660
     ttcgtagtcg ctgccgatca cgctggcgat cgtcggcagc ttgggggccc agggcagggg    150720
     ctcggcgctg gagacggcca gggcggtcag cttgccggcc ctgaccagcg ggtcgacgac    150780
     cgaccaggca tcgatgtgga aggtattgcg tccggccgcc aggtcggaca tcgccgtcat    150840
     gtccttgtag gggacatgca gcacgcccgg cgcgccgatc ttcttggtga agatcgcgct    150900
     ggcgatgtgg ctggacgtgc cgatgccata cgagctgtag ctgcactgct gctggttctt    150960
     gcgcaggtag tcgatgaagg cctgcggggt cttgatgccc aggccggcgt tgaccactag    151020
     caccaggggc agcttggcgg tgcgcgagac ggccgcgaaa tccttgtcgg gatcgaaggg    151080
     cagggtgcgg tagacgtacg ggttgatgca gaacggcgtg gccgtggaat agagcagggt    151140
     ggtgccgtcg gggcgggaaa tgccgacctg gcgggtgccg atgttgccgg cggcgccggg    151200
     cttgttctcg acgatgaact tgccgcccag gcgttcgctg acgtcattga ccagcaggcg    151260
     ggctatgaca tcggtgctgc cgcccgagcc gtacggcacg acgacggtga ccgggccggc    151320
     ggggtaggcg cccgcctgcg ccagggcaag ccggggcagg gcggcggctc cgcacaggcc    151380
     ggtcagtact ctcaatgcat tgcgacgctg attgttcatg gagcgctcca tagatatttt    151440
     tccggttcgc ttcggcggcc ggggcatcgg gacggtgcga ggccctggcc gggtggatga    151500
     gcgagaaccg gtgtctgcgc ccgctgttca gcgggccctc cagtggtcgt aggcatcccg    151560
     cgcctggtac cagctgccga tcgcgaacag gaaccacggg ttgccgaagt agaaaggatg    151620
     gcctggaatt tcccccatat cgaatgcgtt gatcggttcg cccgactgcg tggcgatctt    151680
     gcggccgacg cagtggccca ggtagctcat catggccacg ccgctgccat tgcagcccag    151740
     cgcgtaatgc aagccgtcgg cgccgccgat gtggggcatc gagtccagcg tcatggcgac    151800
     gttgccgccc cagctgtggg tgatgcgcgt gccggccagt tgcggaaagc gcttgagcat    151860
     ggcgcggtac agcagccggg cggtggtcgc ctcgtcggtg ggcacgaagc gcgcgcgccc    151920
     gccgaacagc agccgccgcc cgtccggcga gagccggtag tggttgacga cgcggcgcga    151980
     ctcggacacg gcccgattgg tcggcagcag gctggcggcg aggtccggcg gcagcgcttc    152040
     ggtggcgatc atgtgggtgc agaccggcac gatgcggcgc ttcaggccgc cgaggttggc    152100
     gcccgtatag ccgatggtgg cgatgaccac ctggccggcc cgcacggtgc cccgcgcggt    152160
     atggacgtca tagccgccgg cgcggcgctc gatgcgttcg accggcgtgc ggccaagcac    152220
     gcgcgcgccc gcgtcgcgtg ccgcccgcag catgccgcca tagagctggg cgggttgcag    152280
     gtggccggcg tgctcgatca gcgcggcgcc gtggtacacg gacgagccga tctcggcggc    152340
     cagctcctcg cgcgggatca tgcgcgcctg cgatccggtg caggcattga gctggtccag    152400
     gcgcgcctgc cagctctggt agtgcgcggg cacccacatg gtggtgagcc gccccgtgcg    152460
     gcgccagccg cactcgatgg cgtaccgttc gatcaatgat tcgacatagg ccatcgaggc    152520
     cgcggcgtcg cgcagccgcg cggccaggcg ctcggcgcgc tggccggcgc tttcgccgac    152580
     cgcggcgagc gccttcttct gcacgttgac gccgcccgac acctgcccgc cggaacgggt    152640
     gctggcgcct tcgccgggac ggccggcctc cagcaccacg gcctcgatgc cggcctcgcg    152700
     cagggccagg gcgcagcaca cgccggtgta gccgccgccc acgatggcca cgtcggcgct    152760
     ggccggcagg gtgtcctcgc cgcattcggg cggctcgtag ccctcccacc agtagggccg    152820
     ccggcgaaaa tccggcgcaa agatgtccct ggacgcggcc atgttcggct cccgcatggc    152880
     tgcgcgctca ggcggccgcg ccgctggccg cggcaatcgc ctgcggcgag ggcaggtccg    152940
     cgtagcgctg gctcaattgc gcatagagcc gctcgatatc ctgcgcgccg ccgtcttgcg    153000
     gcggcgccga gccggccagc gcggcgaaca tctggtgctt gacgaaatgc cgccagctga    153060
     tgggcagcgc cgccatgatg cgcgtcatcg cgtcgtagcg cgccggcgtc cagaccgcct    153120
     cgaagcgcga gcggcccggg ccatggtcga aatgggcctg gccgccccgg tcggcgcggc    153180
     gcagttcgcg ggtggccgcc tcgtccacgc tgaggtccgc gcgcaccgcg acgccatagg    153240
     cctcgcgggc gcgctggcgc gacacgaagc cgcagcgcac gtcttccacc acctgctcga    153300
     tcggccgttc gtagggatgg ccatagccgc cgccggccgg gccctgcagg cggatgacgt    153360
     cgcccggggc gcagttcacc aggtcgctgt tgcgcagctc ctccggcgcg tcggagtcgg    153420
     ggttgcggat gaagcgcgag ttggcgcccg ccttgccgcc catgacgccc caggccgcca    153480
     gctcggagcg gttgcggttg cgcgccgtga ccacgccgtt gggcgccagc agccggaatt    153540
     ccatcgtggc cgcgttgccg ccgcgctggc ggccggcgcc gccggtgtcc ggcaccaggc    153600
     cgtagcggat gatctcgatc ggcacctcgg cctcgttgat ctccaccggc gtgttcttca    153660
     ggaacgcgtt gttggcgccg cagccttcga cgccgtcatg ttccggtccg ccgccggcgc    153720
     cgccgccgca cgggccgatc gacgacagca cctggcggcc ctcgcgcgtg gcggtcttga    153780
     cgttgagcag ggtcgagccg ccggccgggc aggccggcag gcgatcgggc atggcgcggc    153840
     tgaagacgcc gaaggtgcag gcctggatga ccgccgccat caggctgcgc atgcccacgg    153900
     ccgccggcgc ctgcggattg accaccgtgc cttccggcag gacggcacgg cagggccgta    153960
     cgctgccggc gttgagcacg ttgcgcggcg ccagggtatg catgacgtag atcaggccga    154020
     ccgtgatcac cgaatggtgg ccgtcgcctc cggtgggtac gttcagcgac gaggcgacct    154080
     gcgggtcgct gccggtgaaa tccagctcca gttcgtcgcc gcgcacgcgc agcgtgatct    154140
     ggatgcggca cgggtagccg cccacggtat cttcgtcggc gtactcggcg aagcggtact    154200
     cgccgtccgg gatctcgcgg atcagggcgc gggtctgttg ctcggcgtaa tcgaggatgg    154260
     cctcggcgcc ctgcatgaat tcgtccacgc cgaaccggtc gatgatctcg tgcaccttgc    154320
     gctcgccgac attgagcgcg gcgatctggg cgttgaggtc gccgcggttc tgctccggca    154380
     tgcgcacatt gacttccatg atgcgcagca ctttctcgtc gatgacgccg tcgcgcgcca    154440
     gcagcatcgg cgggatgcgc aggccctcct ggtggacttc ggtcagggtg cgcgacagcg    154500
     acgccggcac ggcgccgccc atgtcggtat tgtggatgtg gctgccgacg aagcagacca    154560
     ggcggccgtc gcggaacacc ggcttccaga cgtgcatgtc cggggtatgg gtggccacga    154620
     agccgctgta cggatcgttg gtgagataga tgtcgccttc gcgataatcg tcgaacatgg    154680
     cgatgacccg gccatagtcc agcccggtgt accaggtcgc gccgaaggtc ttgggcgagg    154740
     cgaaggtctt gcccgccggc gtcatcagct gcgccgagaa gtcctcggtt tccttcacga    154800
     aggtcgaata ggcggtgcgc atcaacgtat agcccatcgc ctcggcggcg gcggtgcaat    154860
     ggttggcgag cacttgcagg cggaaattgt ccacggtcac gacgcggctc cttcggtgat    154920
     gcgcagattg gcgtactcgt cgacccggca tgcatagtcg ggcgggatga cggtagtgca    154980
     gtcgtcctgg gtcacgatgg ccgggccggt gaactgctgg cccgccgcca gggcggtgcg    155040
     cgcgtacagc ggcacctcgt gccaggcgcc gtccagccag acgcgtacct tgcgttcggc    155100
     gcgcggcgcg ccggggcgca gcgcatggcg cgggaaggcg ggcttgtcgt tgttgccggc    155160
     gatgaccacg cgcaggctga cgatctgaac cggagcctgt tcgtcggcgt gcccgtacag    155220
     gcgccggtgc atgtcgtgga aggcctggcc caccgcctgc acgtcgccgg cctcgatgtg    155280
     gatcgggtcc agcacggtat cgatctcgta cgactggccg cgatagcgca tttcggccga    155340
     gtacaccagc tcggcctcct cggcgtgtcc ctgttcctgc gccagccatt ggcgcgcgcg    155400
     cccggccagg gtggcgaatt cgtcgcacac gaaggccagc cggtcggcgc tgaggtcggt    155460
     gtacacggtc ttcaggaagt cgctcttgag gtcggcgatc aggccgccca gcgcgctgag    155520
     ggtgccgggc gagggcggca ccacgatctc gcggaccttg agctcgcgcg ccaggaagca    155580
     gcccagcatc gggccggcgc cgccgaaggc cagcacggca tactcgcgcg gatcgatgcc    155640
     gtagcgcgac accaggccgc tgacctccga atacatgccg gagacggcga tctggatgat    155700
     ggcctcggcc gtttcctcga tgccgcggcc cagcctgtcg gccagctcgc ccaccgcctg    155760
     gcgcgaggcg tcggcatcga ccgtgacggc ctggtagccc agttcggaat ggccgaccag    155820
     cccgcagcag acgaaggcgt cggtaatggt ggcgcgcgtg ccgccgcgcc gatagcaggc    155880
     ggggcccgga tgcgagcccg cgctttccgg gcccaccttg agcacgccca gcgggtccac    155940
     ccaggcaatg gagccgccgc cttcgcccac cgaggacacc gagacggacg ggatgtagat    156000
     ctggaaatcg ccgatcagct cgcccacgcc gtattgcggc ttgccgtcga cgatgaccgc    156060
     gatgtcggcg ctggtgccgc cgatgtccag gctcaggcag cgcggcaggc cggccgttgc    156120
     cgcgacgtgg ctggcgccga tgacgccggc ggcggtgccc gacaggatca tctgcacgca    156180
     atcgcgcttg ccctgctcgg cggtcatcac gccgccgttg gatttggtca ggcgcggctc    156240
     gggctgcacg ccggcgttct tcagcgcctg ctgcagcgat gtcaggtaat gggcgacgcg    156300
     cggctgcaca tagccgccga tcacggcggt gatggtgcgc tcgtactcgc ggatgatggg    156360
     ccaggtctcg ctggagcacg acaccggcag gccgggcgcc agcgcttcgg cgatttcacg    156420
     cacgcgcagt tcatgcgccg ggttgcggta ggcgtgcagc agcgagacca cgatgccttc    156480
     ggcgcccgcg tccagcgcct gccggaccgc gcgctccacg ctggcctcgt ccagcggcgc    156540
     gcgcaccgtg ccgtcagggc ccatgcgctc ggcgatgccg aacaccatgc tgcgcttgac    156600
     cagcggcgcg ggccgccgcg acagcaggtg atacatgtcg ggggttttca gccgcgccag    156660
     ctcgagcacg tcgctgaagt tctcggtggt gaacagcgcc agcttcaggc ccttgcgctg    156720
     gatgaccgta ttgatgccga ccgtggtgcc gtgcgtgaaa tacgtgatct gctcgggctg    156780
     gatgccgtag cgctcgccca gcatgcgcac cccggcgatg acttcttcgc cgggttggtc    156840
     gggccgcgaa aagaccttga gacttttgat ttcaccgttg tcttcgtcga atacggcgaa    156900
     atcggtgaat gagccgccga tatcgacgcc taccctgtac cccatggtgc ccccatcgat    156960
     gtcgcgcaaa gccgataaac gcttgcaaag tgcccgcgag ccgtttaaac tttccgctag    157020
     gtgaacaata ttttcatgaa gtggtcaaat gaatgataat cgctcggtcc agaggtgtct    157080
     agcgctgctg cgcagtttcc gcagcggccc ggggcaatcg ctcaccgcct tgtccaaggc    157140
     ggtcgacctg ccgcattcca ccgtgctgcg ctttctgacc acgctcgaga gcgaaggcta    157200
     tgtgcgcaag gaaggcacgt tgtggtcgtt gacgccccaa ctgctggaga tcggctttgc    157260
     cgcgctggcc aacaccgggg tcaacgatgt gatccagtcc gccctgcagg agctggcgga    157320
     ccaatgcgcg ggcacggcca acatcggcga gcgcagcaag aacgacgtca tcatcatcgc    157380
     gcgggccagc tcggaagccg agcggcgcaa gatcctggtg gtcaatctgc gcgtgggcaa    157440
     tgcgctgccg ccggccagcg cgctgtgctc ggcgctggac ctgcccgaag accagtgggc    157500
     gatcgcccgg taccccgagc gcaaggtcac caccgtgggg gttgcgctct tctccagcca    157560
     ggcgcgcggt ctttcattgg gcctgtccgt caacgacgac gactacgaca tgccgcgcat    157620
     cgaggccgag gtgttgccgc gcctgcgtgc gcagcgcgat cacatccggc gcctgatgag    157680
     cctgggcgag atgtaggcct gcgccactat tcccctggtt gcagcatggg ttgcgcggca    157740
     tggcgcgggc cggccgcatt gtttgatggc gcgcaaacgg gcgagccgcg ctcctttccc    157800
     tttgcgcgcg cgggggcgta aagtagggat tgcccgatgc gcggtcgcgc gtcgcacaat    157860
     gtgttgatgg aggacgttat gttcaagcag gtattgggtg gcatggcctt gatggcggcg    157920
     ttcagcgcgc cggttctcgc ggccgaatgc tcggtggaca ttgccggcac ggaccagatg    157980
     caattcgaca agaaggccat cgaggtcagc aagtcgtgca agcaattcac ggtcaacctc    158040
     aagcacaccg gcaagctgcc ccgcaacgtg atggggcaca actgggtgct gaccaagacg    158100
     gccgacatgc aggcggtcga gaaggatggc atagccgcgg gcctggacaa ccagtacctg    158160
     aaggccggcg atacgcgcgt gctggcgcac accaaggtgc tgggcggcgg cgagtcggat    158220
     tcggtgacgt tcgacgtggc caagctggcc gcgggcgatg actatacgtt cttctgctcg    158280
     ttccccggcc atggcgccct catgaagggc accctcaagc tggtcgactg agcgccggcg    158340
     cggaccctgg cgccgccgcc gccggggcgc gctgtcaggc ggcctggcgc agcggccgga    158400
     ccgtataggc gcagcggcgc gcgccggcca ggatgtgctc ggcccgctcg acccgcgcct    158460
     gcgggccgat gatctcgcga aacaggtcca gttcgctgcg gcagaaggcc atgcaggctt    158520
     gcgcggccgc acagatggga cagtgattct ccaccagcag gtagccatcg tcggtggcga    158580
     ccaattcggc catgtagccc tcgcggctgc gcacggctac caggcgctcc aggcgctcgc    158640
     gcaggccgtc ggcgccttgc atggcctcgg cgtagctggc gcgcatgctg gcctcgcgcg    158700
     cgccgatcag cttgtctatc ccgctttcac cgaagacctg gcgcaccgcg cccagcatct    158760
     gcaccgtcat ctcggcgtgc atgtcgggaa agcgcgcatg gccggcctgc gtcagccgcc    158820
     atatctgggt gggccggccg cggccggccg aacgcgtttc ggcgtccacc aggccttcga    158880
     cctgcaggcg cgccatctgc tggcgcaccg cctcggccgt cacgtccagc acctcggcga    158940
     tggccgcgat gccttgcggg ccgcgcgtct tgagcgtcat gagaatgcgc tcggccggtt    159000
     ggtgcggaac ccagtgcgtg ctgacagagg cggattgatc ggacatggcg gttgggcgtc    159060
     tcaggggctg gccggcaggg cggcggtgcg ggcggaacgg gcgggcgcgg cggcgtcggt    159120
     attccagcct ccgcccaggg ccttgtagag cgcgaccagg ctggtatagg actccgactc    159180
     ggattgcgcc acggcatcct gtgcgcgcaa aagagtacgc tgcgcgtcca gcaccgtcaa    159240
     atacggcgcg gccccttcac gatagcgcgt ttgcgccagg tcggcggcgc gctggctctg    159300
     cgtggcgctg tcaagcaggt cgcgcagccg ctgctggttc tgtccatagc gcgtcaacgc    159360
     gccttccact tcctcgatgg cctgcagcgc cacctgttcg tagcgcgccc gcgccgcgtc    159420
     gtgccgggcc tggcccgcgc gcagctgcgc ctggacgctg cccaggtgca acgccggcca    159480
     gctgatcgtc ggcgccagcg cgaaggcctt gctgctggcc tggcccaggt cgccgccgcg    159540
     caaggcaatg aaaccgagga acccgcccag gtcgatgcgc ggatacagtt cggcggtgat    159600
     ggcgccgacg tcggcgttgg tggcggccag caggcgctcg gcggcgcgca cgtcggggcg    159660
     gcgttgcagc agcatggcca cgtcgccgat gggcaattgc gcggccagcg gcgccagcgg    159720
     ctgctcctgc cgcagctcgc ccagctcggc cggccgcatg gccgccagga cggcgatgtg    159780
     gtactgggcc aggcgccgtt gcgtctccag cggcgcgagc agcgcccgcg tgccggccag    159840
     ctcggcccgt gcgctggcca ggtcgccggc atagccgcgg ccggtttcca ccagcgccgc    159900
     ggtgacgcgc agcgtctcct gctgggtggc gaggttggcg cgcgccacgg ccagccgttg    159960
     ctcggcgccg cgcatctcga aatagttgcg tgccagctcg gccaccacca ccaggcgcgt    160020
     ctgggccagg tcggcggcgg cggcctggtc gcgcgcggcc gcggcctcgg cccgtcgctg    160080
     caggcggccg aacaaatcga tttcccaggt cgcgtcgaag cccgcgcggt agctttgcgc    160140
     gaggttgcgc tggtcggggc cggggttgat ctgcgacagg ctgcgcgtgt agccgccggc    160200
     cgcggtcacg gtcggccagc ggtccagttc cttttcgtcg agcgcggcgc gcgcttcgcg    160260
     caggcgcgcc tgcgcctggc ggatatcgag gttgcgcgcc agcgccaggc cgatatcgag    160320
     gttgcgcgcc agcgccaggc cgatcaacgc gtccagccgg gcatcctgca actggcgcca    160380
     ccattcgcgt tgcaaccggt cggccgagaa cagcgcctgt tcggggctgg ccagcttcac    160440
     cggcgcgggc gtgggcgcct ggtactgcgg ccccacggcg cagccggcca gcgccagcgc    160500
     ggcaagcagc gcgccggcgg tacgtgcaaa ggtcgtcggg acgggatgcg tcatgatgcg    160560
     gtctcgtgtg cgggggaggc ggcgcccgcc tgggcgtcca gccgcgccag ttcgcgggcg    160620
     cgcgcggatt ggccggcggc gcggtggtcg cgcgccagca gggtgtacat ggtgggcagc    160680
     acgaacaggg tgaacagggt gcccaccagc atgcccacca cgatcaccag gccgaggctg    160740
     aagcggctgt gcgcgccggc gccgctggcg aacagcagcg gcaccaggcc caccaccatg    160800
     gcggccgtcg tcatcaggat ggggcgcagc cggatacgcg cggcccgctc catggcggcg    160860
     cggcggtcca gtccggcatg cgcctgcatc tcgttggcga actccaccat caggatgccg    160920
     tgcttgctga tcaggccgat cagggtcacc aggccgatct gggtatagat gttgatggtg    160980
     gccatgccga gcgccagcgg aatgagcgcg ccgcagatcg acatcggcac gctgaccagg    161040
     atgatcagcg ggtcgcgcag gctttcgtac tgggcggcca ggaccagata gatgacgatg    161100
     atggcgaaca ggaacgtcac caccagcgcc gagccttcct ggctgtactg gcgcgcatcg    161160
     gactgccagt catggctgaa gccgggcggc agcaggcgcg cctgttcggt aaggaactgc    161220
     atcgcgtcgc ccatggtcac gccgggcatg ggaatggcct ggaacgtggc ggaattcagc    161280
     tggtcgaact gggtcagccg gttgggttcg acgcccatcg agatcttcac cagcgtggcc    161340
     agcggcacct gcgcgccgct ggcgctcttg acatagaact ggcccagcga ctgcggcgtc    161400
     aggcgcatgc cgcgcgggct ttgcggtatc acgtcgtacg agcgtccgtc catgccgaag    161460
     cggttgacgt agttctcgcc caccagcacg gccagcgtat cgccgatggc cttcatggtg    161520
     acgcccaggc tgttggcctt ggcgcggtcg atgtccaccc gtaccaccgg attgttgtag    161580
     tccaggtcgc tgtcgaccac catgaacagg ccgcttgcgc gcgcggcgtg tttcaaggtt    161640
     tccatggcgt cgtagaccac gcggtagtcg gccgcgctca tcagcaccat ctgcaccggc    161700
     aggccgccgg tcgaaccggg cagcgacggc agctggaatg cgaaggtgtt gctgccctcg    161760
     atcgcgttga cgcggttctg cagatcgccc tggatctcgt cggccgagcg tttgcgcgcc    161820
     tgccaggtga ccaggttcac cccgccgatg ctgttggcca cgccgtccga gccgttgatg    161880
     agccagcggc cgttctgctc gggaatctcc tgcatgacgg tgtcccactt ctggccgaac    161940
     ttctcgacgt agtcgatatt ggcgtgctgg ggtgacttga cggcggtcag gatcatggcc    162000
     tggtcttccg cgggcgccag ctcgcgctgc gcgctgccgt acagcaccgg caggttcgcc    162060
     agcaccacga cggcgatcag gccggtcacc cagcggtggc gcagcgagac gtcgagcacg    162120
     cgcccatagg cgtcgcccag gcgctggaag aagtgctcgg ccttgcgcgc catccagcct    162180
     tcggagacac ggctgttcag caggaacgaa ctcatcacgg gcgaaagggt cagggcgatc    162240
     acgcccgaca cgcccacggc cgcggccagc gtgaaggcga actccttgaa cagcgagccg    162300
     gtcagcccgc ccatcaggcc gatgggcgcg tacacggcgg ccagggtgag ggtcatggcg    162360
     atcaccggcc cggccacctc gcgcgcgccg accagggcgg cgtgcaccgg cgacttgcct    162420
     tcctcgatat ggcggtgcac gttctccacc accacgatgg cgtcgtcgac caccagcccg    162480
     atggccagca ccatcgccag cagcgtcaac aggttgatgg agaagcccag ggacagcatg    162540
     atggcagccg cgcccagcat ggacagcgga atcgtcacca ccggaaccag caccgcgcgc    162600
     agcgaaccca ggcacaggaa gatcaccgcc accacgatga ggaccgcctc gagctgcgta    162660
     ttgcgcactt cgtcgatcga ggcgttgatg aagcgcgcca gctcgaacgg aacctgcact    162720
     tcgacgccag gcggcaggtt ctgcttgatg cccggcagca gggcgttgat gcgttcgacg    162780
     atggtcaggg ggttgccgac cggcgtggcg ttcaggccga agtagacggc cttctcgccg    162840
     tccatgcggg cgctggagtc gtacgaggcg gcgcccagct ccaccgtgcc cacgtcgccc    162900
     agccgcacga tggcgccgtc gacctggcgc accaccatgt cgcggaaatc ggtcaggctg    162960
     ttcaggtccg tgttgacctg gatgttggat accacgtaca gccccttggt ctggccgggc    163020
     gcggcctgca cgttgttgtc gcgcagcgcc tgcgcgatct cgcccgccga gatgccgcgc    163080
     gcggccatgc gggccggatc gagccagacg cgcatcgcca gggtctggcc gccgtacagg    163140
     tccacgctgg ccacgccgtc gatggacgag agctgcggca gcaccacgcg ctgcaggtag    163200
     tcggtcagcg cgggaatcgg catggtcttg ctggaaaagc ccacgtaggc caccgacgtg    163260
     gcctcgcccg aggacttggc caataccggg tcgtagatct cctgcggcag ccggtacttg    163320
     acctggttga ccttggccat gatctcggtg agcgccttgt tggaatcggc gttcagcttc    163380
     atgcgcacgg tgatcaggct gcgcccctgg gtggacgagg acgagagata gtcgatgttc    163440
     tcgaccgtcg ccaccgcttg cgcgatgggc tgggtcacga agccttgcat cagctcgggc    163500
     gaggcgcccg ggtactgggt ggtgatggtg atggtggtgt tttcggtcag cgggtattgg    163560
     cgcaccggca gctcgccggt ggcgcgcagg cccagcagca ggatcagggt gctgaccacc    163620
     agggccagca ccgggcggcg cacgaacagg tcggtgaatg tcatggtcgg ccccgatcaa    163680
     tggctggcca gcgccgtgcc gccgccggcg gccagcgtgt cctggccgaa gacctcgacc    163740
     gccgcgccgt tgtgcagccg cagctggccc gaggtcacga cccgctgtcc ggcctgcagc    163800
     ccctcggtca ccacgatgcg gctgtccacc cgctcggcgg tcttgaggaa cacttgccgc    163860
     accgtcgcgg gccggacggt gtcgtccacg acgtagaccg agtcgccgta ggcgctgtag    163920
     ctcaccgcgg tttccggcac ggtgatgacg ccggggcgtt cgggcagcgc cacgcgggca    163980
     ttcacgtaca tcccgggcgc cagcacgccg tcgggattgg gcagggtggc gcacaccagc    164040
     agggtgcggg cctgtgccga cacctgcggt tctatggtgc tgaccacgcc gtcgaatgcc    164100
     cggcccggat acgcatccac gccgacgctg acggcctggc cggtcctgat gtcgcgcagc    164160
     gcctgttccg gcagcgtgat gtccgcgtac atggtgcgcg cgtcggtcag cgacacgacc    164220
     ggttcgccgg cgcgcacgaa ttggcccagg tcgacccggc gcacccccag cacgccgtcg    164280
     aaaggcgcct tgacctgctt ctgctcgacc agggcctgca cccggcgcac ctcgccggca    164340
     gcctggtcgt aggcggcgcg ggcctggtcc agctgctcgg cggtggccgc ctgctgcggc    164400
     accaggcggc gcgtacgttc cagcacgctg cgcgcgttgc gcagttgcgc ctgcaggcgg    164460
     gccaggtcgc cctgttcggg ggcatcgttc aattgcgcca gcacctggcc ggcccgcact    164520
     gcctggcccg actcgaaggc gatccgcgcg atgcgcccgt ccacttcggc gggaatgacc    164580
     acctggcggc tggcctgcag cgtgccgatg ccggccagcg tgaccggcag cggtcccagc    164640
     gccgcggggg cggccgcgac cttgacggga gccatcgtcc aggccggcgc cgagcccgcg    164700
     tcacgcaggt acagccacgc acctcccgct attgccacgg cggccacgat gccggccgcc    164760
     agcgtccctt tcttgctttt catgacgcaa cctaattatc aaagaatatt cttggataat    164820
     tagtcaaagc gagattaccg tcaagaaatt aaagataatc cgacagacct tgtggggtta    164880
     ttgcgggatt gggttttggg ggagattcag tcttgcgcgg cgggttccgg cagcgtgaac    164940
     aagccgagaa agcgcgcaat gcccgcgcgc gggccgctgt agcgtagttg ctcggccgca    165000
     acggcggcat cgaggtcgcc atcgtcgtac accagcgccg ccagcgcgtt gggggaggct    165060
     tcgatggtcg catcgggccg cgccggcggc cggccgcgca gcagggcgat ctggccgttt    165120
     tccacccggg cccagaaatg ctggccgttc agcaccagtt cgtaggtggc ggtcaggcgg    165180
     gcggccgcgc gcgggtcgaa catggcgcga aacgacagca ccagcgagtc cacgctcagc    165240
     ccggcctcgc gcggcagggc cggcgagcga gcgccccatt tgcccagctg gaggatgacc    165300
     ggctccagct cgcggcccca gtccgtcagt tcgtagaccc aggcgcctgc cggcgggtcc    165360
     agcttgcggc ggcgcagcac cgcgacggcc tccagctcgg tcaggcgctg cgtcagtaca    165420
     ttggggctga tgcctggcaa tcccttgcgc aggtcggtaa agcgcttggg gccgagcaac    165480
     agctcgcgca cgaccagcag cgcccagcgc tcgccgacca gatccagcgc atgggcgccc    165540
     gcgcacccat cttcatagct tcgtttgcct gccatgcctg tgccgccggg cttgcctgcc    165600
     cgccagtatg cggttccaaa ataggaccat tgactccgct atcaggagta ttgcgccgat    165660
     attaccagtc cggcgcgcga ggcggcgcca cacctaggtg tgaagattca ataggttgta    165720
     tgcatggttc atccgaaccg gatttgagaa actggaaatc gccaacctcc cagttcactc    165780
     aaggagcccg gccggatgaa cacccataag catgcccgat tgaccttcct acgtcgactc    165840
     gaaatggtcc agcaattgat cgcccatcaa gtttgtgtgc ctgaagcggc ccgcgcctat    165900
     ggggtcaccg cgccgactgt gcgcaaatgg ctgggccgct tcctggctca gggccaggcg    165960
     ggcttggccg atgcgtcctc gcgcccgacg gtctcgcccc gagcgattgc gccggccaag    166020
     gcgctggcta tcgtggagct gcgccgcaag cggctgaccc aagcgcgcat cgcccaggcg    166080
     ctgggcgtgt cagccagcac cgtcagccgc gtcctggccc gcgccggtct gtcgcacctg    166140
     gccgacctgg agccggccga gccggtggtg cgctacgagc atcaggcccc cggcgatctg    166200
     ctgcacatcg acatcaagaa gctgggacgt atccagcgcc ctggccaccg ggtcacgggc    166260
     aaccgacgcg ataccgttga gggggccggc tgggacttcg tcttcgtggc catcgatgac    166320
     cacgcccgcg tggccttcac cgacatccac cccgacgagc gcttccccag cgccgtccag    166380
     ttcctcaagg acgcagtggc ctactaccag cgcctgggcg tgaccatcca gcgcttgctc    166440
     accgacaatg gctcggcctt tcgcagccgc gccttcgccg cgctgtgcca tgagctgggc    166500
     atcaagcacc gctttacccg accttaccgc ccacagacca atggcaaggc cgaacgcttc    166560
     atccagtcgg ccttgcgtga gtgggcttac gctcacacct accagaactc ccaacaccga    166620
     gccgatgcca tgaaatcctg gctacaccac tacaactggc atcgacccca ccaaggcatc    166680
     gggcgcgctg tacccatctc cagactcaac ctggacgaat acaacctatt gacagttcac    166740
     acctaggcag gtccggtgcc gtgtgttagt aatagggccg gtacggggct gcgagggcag    166800
     ccgatgacca tcgaccagag gcgcgcgcat gcaaaacgaa ctcaagccga ccatcaacaa    166860
     gccggtgttc ctgacctcgg cgctgttcat cctgctgctg gtcgtcttca cgatcgccgc    166920
     tccggccacc gcccaggact tcttcaacgt gatccaggcc tggatcctgg gcaacgccag    166980
     ctggttctac atcctgaccg tggccatcat cctgctggcg gtcatcttcg tggcggtcag    167040
     ccgctacggc aatatcaagc tggggccgga ccacagcgag cccgactacc gcgatatcac    167100
     ctggttcgcc atgctgttct cgaccggcat ggggatcggc ctgatgttct tcggcgtggc    167160
     cgagccggtc atgcacttca tcgatcctcc ggtgggcgag ggcggcaccg cgctggcggc    167220
     gcgcgaggcc atgaagatca ctttcttcca ctggggcctg cacgcctggg ccatctatgc    167280
     cagcgtggcg ctggtcctgg ccttcttctg ttttcgccat ggcctgccgc tgaccctgcg    167340
     ctcggccctc tatcccctga tcggcgagcg catctacggc ccgatcggcc atgccgtcga    167400
     catcttcgcc atcatcggca cggtgttcgg cgtggcgacg tcgctgggcc tgggggtggc    167460
     gcagatcaac agcggcctga accacctgtt cggcgtgccg gtcggcatac cgacgcagat    167520
     cattctcatc gtcatcagct gcgggctggc cacgatttcg gtggccagcg ggctggaccg    167580
     gggcatccgc atcctgtcgg agaccaatct gctgctggcg gtggtgctgc tgctgttcgt    167640
     gctggtgctg gggcccacgg tgttcctgct gcagaccttc gtgcagaata ccggcgcgta    167700
     cctctcggat atcgtcaaca agaccttcaa cctctatgcc tatgagccga ccgactggat    167760
     cggcggctgg accttgttct actggggctg gtggattgcg tggtcgccct tcgtgggcct    167820
     gttcatcgcg cggatctcgc gcgggcgcac catccgccag ttcgtgggcg gggtattgct    167880
     ggttcccgcc ggtttcaccc tgttctggat gacggtgttc ggcgatgccg ccatccacgc    167940
     catcctggtc gaaggcatgg gcagcctcgc cgagaccgtc aaggccgaca gttcgctggc    168000
     cttgttcgcc ttcctggagc acctgccctg gggaagcgtg acgtccgtcg tggcgatcgt    168060
     gatggtggtg gtgttcttcg tgacctcggc cgattcgggc gcgctggtgg tggaccagct    168120
     ggcgtcaggc ggcgccgaga gcacgccggt ctggcagcgc atcttctggt ccaccctgat    168180
     gggcgtggtc gccatcgcgc tgctgctggc cgacggcctg caggcgctgc agacggccac    168240
     catcgccagc gcgctgccgt tttcgatcat tctgctgctg gccttgtggg ggttgttcaa    168300
     ggcgctcagg ctggacgcca ccaagcgcag cctgcttcat cgcaccatca cgcgcaccca    168360
     gccggtgcgc ggccagaact gggagcaccg cctgcgcaac atcgtgatga tgccgcgccg    168420
     cgcgcatgtg ctgcgcttca tttcggacgt ggtgcgtccc gccatggacg acgtggccga    168480
     agccttgcgc aaggaggcct acgaggccca ggtggtcgat ggcgaggagg gcgaggtcag    168540
     gctggaggtg tcgcatggcg tctacctgga cttctcctat gccgtctacc cgcgctccga    168600
     ggtgcgcccc agcctgacgc cccaggaggc caacgacgaa gaggagcgcc gctacttccg    168660
     cgccgaagtg cacttgcgcg aggggggaca ggactacgac atcatgggtt ggacgcgtga    168720
     cgaggtgatc ggcgacatcc tcgaccagta cgagcgccac cgccactatc tgcacgtggt    168780
     gcattgacgc ccgcgcggct cctacaatcg ccgcatgacg ctcaagcaac tcgaagcctt    168840
     ctactgggcc gccacctgcg ccagtttcgc ggtggcggcc gatcgcctgc acctgtcgct    168900
     gtcgtcgctg tccaagcgga tcgccgaact cgagtcggcg ctgggcctgg acctgttcga    168960
     ccgcagcggc catcgcgcgg tcctgacggc cgccggcgaa cggctgctgc cgcaggcgcg    169020
     cgacttgctc gccagcgccg atcgcatccg cgccagcctg cgcgccgagc ccgagctggg    169080
     cgtgcgctgc cgtttcggcg tgggcgaact cagcgcgctc acctggctgc ccaggctgat    169140
     cggacgcgtg cgcggccgct atccggggct ggcgctcgaa ccctatgtgg atgtcggcca    169200
     ggtgctcaag cgcaaggttg ccgaaggcga gctcgatttc gccgtcgtgg ccggcgcctc    169260
     ctcgcacagc gccatcgcgt ccgcgccggt ggggcaggcg catttcgcgt gggtggccgc    169320
     gccgtcggtg gccggggcgg cccaaagcct gacgccgcaa ctgctggccg gcaccgcgct    169380
     ggtttcgctg cccgacgggg cgggcaccac gcgcctgctc gatccctggc tggccggcgg    169440
     tgcgccggcc ggtccgcgcc ttgccggctg ccctgagcgc gccttgcggg gcacgccgcg    169500
     cctgcgctat ctttgatcgc atgacccaac ccctacgcgg cggcctgagc gggcgcgagc    169560
     cccttttcat cgtcttgaac accggctccg gacgcgatga cgcgcccgcc gcgcaggccg    169620
     ccatcgtgca tgtgctgcaa gccgcctcgc gcgcacacgc tgatgccggt cagcgacgcc    169680
     acggcgctgc cgggcgtggc gcgccaggct gtcgaacgcg cgtgcgccga agggggcatc    169740
     gtcgtggccg ccggcggcga cggtacgctc aatgccgtgg cgcgcgccgt actgggctcg    169800
     ggcgtgccgt tcggcatcct gccgcaaggc accttcaatt tcttcgggcg cgcgcacggc    169860
     atcccgcagg atgcgcacgc cgcgacccgc tgcctgttcg acgcccgcat cgagcccgtg    169920
     caggtcggct tgctcaacga ccgcctgttc ctggtgaacg ccagcctcgg cctgtacccg    169980
     caattgctgg aagaccgcga ggcgtacaag cagcgctatg ggcgcagccg catggtggcg    170040
     ctgtggtcgg gcctggtgac cctgctgcgg gcgccgccgc aactgacgct gcaactggag    170100
     catggcggcc aggcgcgcac gctgcgcacg cccacgctgg tggtgggcaa caacgcgctg    170160
     cagctcgagc gcctgggcat cgccgaggcg gcggcgctgc agcaggggca attggtcgcg    170220
     atgtcggtgc gcccggtggg caccctggcg ctttacggcc tgctgctcag cggcttgttc    170280
     agccgcctgg gcgaggccga caaggtcgtc agcttcggct ttgatcgcct gaccgtccgc    170340
     gtgcgcgggc ggcggcgcgt caaggtggcc atggatggcg aaatctcctg gttgccgacg    170400
     ccactgcaat tccaggtctc gcccgagccg ctgcgcctgc tggtgccgtc gcctggccag    170460
     cggctggagg cggcatgatg cgcgtgctgc atatttcgga tacccacttc ggcaccgagc    170520
     gcgagccggt ggtgcatgcc ttgcatgcgc tggccgatac gctgcgcccc gacctggtgg    170580
     tattgggcgg cgacatcaca cagcgggccc ggcgcggcca gttcgccgcg gcgcggcgct    170640
     tcatccaggc cctgcagcgg ccggtgctgg cggtgccggg caaccacgac attccgctgt    170700
     tcaacctggc cgcgcgcctg ttcgatccct atggcaatta ccggcgcgcc ctgggcgcgg    170760
     tgctcgagcc cgtctacgag gacgaccgcc tgctggccat cggcgtcaac agcacgcgcg    170820
     cggcgcgtcg caagaacggc gaggtgtcgc gtacgcaggc gcagcgggtg gcgcagcgcc    170880
     tgcgtgacgc gcgtcccggc cagctgcggg tggtggcgct gcatcacccg gtgcacgcca    170940
     tggtcgagag cgaccagcgc aatctgctca tcgggcgcga gttcgccgtg cctgcctggg    171000
     tcgacgcggg tgtcgacctg atactgggcg ggcatataca tttgccgtac gtggcgccgc    171060
     tgcatggcaa ggccggcgaa gccggccggc gcgcctggac ggtgcaggcg ggcacggcgg    171120
     tttcgcggcg cgtgcggggc agggtgccca actccgtcaa cctgatcgat tacgcggcgc    171180
     aagccgacag cccggcctgt acggtgcagc gctgggattt ccagacggac agcggcgcgt    171240
     tcgtcctctt cgggcagcag gtgctggccc tgaatcgcgc gcgcggatga cgcgcgccgc    171300
     ggcgcgatgc cgctgttcgt gaaccttttg gccgacgttt cgtctattga ccccatggaa    171360
     tcctacgcag tctggattgc tgcccacccc atcatcatct tcgtcgccgc gccggtcctg    171420
     gccgcggcag gcgcgctgtt gctgtggcaa ctggtcgccg gcctgcccgc gggccgccgc    171480
     cgcaccatgg tcttcgccgt gctggcgctg gtggcggtgg gggtgttcgg cgcgctggcc    171540
     gcctcggtcg agcaccaggg cggcatggtc gcgttcgacc aggcgctggc gcgcgcgctg    171600
     gggctgtcca tgccggccgc gttgctgtgg gtgctgtcct ggttcacgca tctgggcgat    171660
     cgaaccttgc tgaccctggt ggcggtgggc atgacgctga cgctgctgtg gcggcggcgc    171720
     tgggtgctgg ccggcgcctg cgtggccgcg acggggggcg cgggcgcgct gaactggctg    171780
     ctcaagcgcg cgttccagcg ggtgcgcccg gaccatctcc acggctacac gctggccgac    171840
     ggctggagct tcccgagcgg gcatgcctcc gcctccatgg ccgtctatgg cattgcctgc    171900
     tacctgatgt tgcgcacctt gccggcgcgc tggcgttcgt ccgcgttggc cggcgtggcg    171960
     gccctgatcg tcgcgatcgg ggtcagccgc gtgctgctgc aggtgcactt cctgagcgat    172020
     gtggtggcgg ggttcgccat taccgccgcc tggctggccc tgtgcgtggc cgtcaccgaa    172080
     tgggcgctgc gcgtcaacgc gcgagcatga gccgcagcag cgcttgcggt ccggcgcgct    172140
     cgccggccac ctcgcgcggg tcggcgtggc ggtagtccgc gcccgcttcc gagaccgcgg    172200
     cgcccagcgc ccggacccag tccggcgggc tcgggcacag gtccagtacc cgcttgccct    172260
     gcaggtccac gcccaccttg ccgtcgctga accgctccag ggtgcggtcg atttcccgtt    172320
     catcggtaag cgccagcacg atcacggccg actcgcgcaa tgcctcggcg gcgctggcgg    172380
     ccagcgtggc ctggccgcga aatggttcgc agcgcagcgg ctggcggtca tagagcgtca    172440
     acgagacatc cggggcggcg tgcagcagcg catgggccgc ctggctgccg gtggccccca    172500
     acccgatgat ggtgatctcg cgcgtcatgg cgccggtacg gcccaggcgc tgacgacatg    172560
     cgcgaccggc tcgtccgcgc catcgcagcg caggatggcc tcggccatgg ccagccggcc    172620
     cgtcttcagg acccgcgcat cggcgatcac ggcggcgccg gacgtcttgc gcaggaagtg    172680
     gatcgtcagg ttggcggtca cggcgccggc ctgcccggtg gcgccgacca cggccgcata    172740
     catcgtcagg tcggccaggc ccatcagcat ggggccggcc acgatgccgc ccaggcgctg    172800
     atgggtatcg cgcgccggca gcacggcccg cgccgtgcca tggccgatat cgaccacgtc    172860
     gatgcccagc acctgggcga agggatgctg gtcggccagc agccggtgga actcggccag    172920
     cgtcatgcgc gcgcggggtt cggcggcggg gatattcatg tcagcgctgc tccagggcgg    172980
     tgatgaaact gtccagcagc gattcggcct gctggcccag cgacttgagc cggcgcgtat    173040
     gaaacagcag cagcagaccc atcagatagg tgaaggtgtt catttcttcc agggcgatgc    173100
     gctcggccgg ccagcggcgg gtgcgctcca ggcccgtgcc cagcagctcc acgcaggtgc    173160
     gcaggcgcgc gttcagcctg tcgtccattt cgcgccccag gccgcgcggc cccaggccgc    173220
     gaaacagata caggcccagc gagaattcgg tctggcgcgt cgtgtagtaa ttgaagaagg    173280
     caacgatcac gctgcgcgcg gcctgggcgt cgacagcgtc ccgcagcgcg tcggccaggc    173340
     tttgccgcag acgctgcagc gacgcctcca gcacggcgcc atagatggct tccttgccgt    173400
     cgaaccatgg atagatcgca ccggtcgtgc agtcggcctc cttggcgatg gcgcggatcg    173460
     tggtgttttc caggccatcg cgcgcgaaca cgcgctcggc ggcttccagg atcaattgcc    173520
     gtcgcagcgc ggctagctgt gaactgtcaa taggttgtat tcgtccaggt tgagtctgga    173580
     gatgggtaca gcgcgcccga tgccttggtg gggtcgatgc cagttgtagt ggtgtagcca    173640
     ggatttcatg gcatcggctc ggtgttggga gttctggtag gtgtgagcgt aagcccactc    173700
     acgcaaggcc gactggatga agcgttcggc cttgccattg gtctgtgggc ggtaaggtcg    173760
     ggtaaagcgg tgcttgatgc ccagctcatg gcacagcgcg gcgaaggcgc ggctgcgaaa    173820
     ggccgagcca ttgtcggtga gcaagcgctg gatggtcacg cccaggcgct ggtagtaggc    173880
     cactgcgtcc ttgaggaact ggacggcgct ggggaagcgc tcgtcggggt ggatgtcggt    173940
     gaaggccacg cgggcgtggt catcgatggc cacgaagacg aagtcccagc cggccccctc    174000
     aacggtatcg cgtcggttgc ccgtgacccg gtggccaggg cgctggatac gtcccagctt    174060
     cttgatgtcg atgtgcagca gatcgccggg ggcctgatgc tcgtagcgca ccaccggctc    174120
     ggccggctcc aggtcggcca ggtgcgacag accggcgcgg gccaggacgc ggctgacggt    174180
     gctggctgac acgcccagcg cctgggcgat gcgcgcttgg gtcagccgct tgcggcgcag    174240
     ctccacgata gccagcgcct tggccggcgc aatcgctcgg ggcgagaccg tcgggcgcga    174300
     ggacgcatcg gccaagcccg cctggccctg agccaggaag cggcccagcc atttgcgcac    174360
     agtcggcgcg gtgaccccat aggcgcgggc cgcttcaggc acacaaactt gatgggcgat    174420
     caattgctgg accatttcga gtcgacgtag gaaggtcaat cgggcatgct tatgggtgtt    174480
     catccggccg ggctccttga gtgaactggg gggtcggcga tttccagttt ctcaaatccg    174540
     gttcggatga accatgcata caacctattg aatcttcaca gttagcccgc gcgcgattcc    174600
     ggattaaggg gacaggatgt tgcaacttac caacaatggg gcgggaaacc ggcttttttc    174660
     tgagcctgac catagccagt cctgccgatt tttgatgcaa tagcgtcaac ttcccttcgc    174720
     ggagttaggg ggggcggcag gccggtatgt gctgcattgc tgctcttgtc actcaaatca    174780
     acggagattt cttaaatgaa aaagactctg ctcgctgccg ccctgctcgc cggtttcgcc    174840
     ggtgccgctc aggcagaaac gtcggtcacc ctgtacggta tcatcgacac gggtatcggc    174900
     tacaacgatg tcgatttcaa ggtgaaaggc gctaacgccg acgacagcga cttcaagtac    174960
     aaccacagcc gcttcggcat gatcaacggc gtgcagaacg gttcgcgctg gggtctgcgt    175020
     ggtacggaag atctgggtga cggcctgcaa gctgtgttcc aactggaatc gggcttcaac    175080
     tcgggcaacg gtaactcggc ccaagacggc cgcctgttcg gtcgccaagc caccatcggt    175140
     ctgcaaagcg aaagctgggg ccgtctggac ttcggtcgcc aaaccaacat cgcctcgaag    175200
     tacttcggct cgatcgatcc gttcggcgct ggcttcggtc aagccaacat cggcatgggc    175260
     atgagcgcga tgaacaccgt tcgctacgac aacatggtca tgtaccagac cccgtcgtac    175320
     agcggcttcc agttcggtat cggctactcg ttcagcgcga acgacaagga tgctgacgcc    175380
     gtcaaccgcg ttggcttcgc caccgccgac aacgttcgtg ccatcacgac cggtctgcgc    175440
     tacgtgaacg gcccgctgaa cgtcgctctg tcgtacgacc agctgaacgc ctcgaacaac    175500
     caagcccaag gcgaagttga cgcgaccccg cgcagctacg gcctcggcgg ttcgtatgac    175560
     ttcgaagtcg tgaagctggc tctggcctac gctcgcacga ccgacggctg gttcggtggc    175620
     caaggctacc cggtcgccgt cacgctgccc tcgggcgaca agttcggcgg cttcggcgtg    175680
     aacaccttcg ctgacggctt caaggccaac tcgtacatgg tcggcctgtc ggcccccatc    175740
     ggcggcgcca gcaacgtgtt cggttcgtgg cagatggttg accccaagct gaccggcggc    175800
     gacgagaaga tgaacgtctt ctcgctgggc tacacctacg acctgtccaa gcgcaccaac    175860
     ctgtacgcct acggttcgta cgccaagaac ttcgcgttcc tggaagatgc caagtcgacc    175920
     gctgtcggcg tcggtatccg tcaccgcttc taatcggctg cggaacgcaa gttccgcttc    175980
     gattccaagc tgacgcgcgg gcctcgtgcc cgcgcgaaaa aagccgccct tcggggcggc    176040
     ttttttcgct tttgaatcat gtttccgagc gcttgggttc agccggaagt aattccgtaa    176100
     atgctacaat ccaaaggttt gcgcatttga cggacgcctg aatgaacctg cacccgtatt    176160
     tccccgtcct gctgtttatc ctggtggcaa ccctgatcgg gtttgccctg cttacagcgg    176220
     gctcgttgct tgggccgcgg cgtccttacg ccgaaaaact gtcgccctat gaatgcggct    176280
     tcgaagcctt cgaagacgcg cggatgaagt tcgatgtgcg ctactacctg gtagccattc    176340
     tcttcatcct gttcgacctg gaaatcgcgt tcctgttccc gtgggccatt gcccagggta    176400
     cggtgggcct cgtcggtttc tggacagtca tggtcttcct ggccgtgctg accgtcgggt    176460
     ttatctacga atggaaaaag ggcgcgctgg actgggaata aatcccggcc tcgatcagca    176520
     cgctatcaga gacgaatatg gctatagacg gcattctcaa gcaaggcttc atcaccacca    176580
     gcgccgacaa gttcctcaac tgggccaaga ccggttcgat gtggcccatg accttcggcc    176640
     tggcctgttg cgcggtcgaa atgatgcacg cgggcgccgc ccgctacgac ctggaccagt    176700
     tcggcatcat tttccgtccc agcccgcgcc agtccgatct gatgatcgtg gccggcacgc    176760
     tgtgcaacaa gatggggccg gcgctgcgca aggtctatga ccagatgccc gaaccgcgtt    176820
     gggtggtgtc catgggctcc tgtgccaatg gcggcggcta ctaccactac tcgtactcgg    176880
     tggtgcgtgg ttgcgaccgc atcgtgcccg tcgacgttta tgtgccgggg tgtccgccca    176940
     cggccgaggc gctggtctat ggcctgctgc agatgcagaa caagatccgc ctgaccaata    177000
     cgattgcgcg ctgaaccacc ggcgcgggcg gcgcggttcg atcgcgccgc cgcccagtga    177060
     agcagtgtcc cggtttacct atgcgtacat gatgatgacc aggctcgaaa ccctgaaaaa    177120
     caacttgcag gccgcttttg gccaggacct cgcgctcacc gagtcgcttg gcgaattgac    177180
     gctggaagtc gccgccgagc agtggttttc ggcgtgcacc aagctgcgca ccgacccggc    177240
     gctgcgcttc gagtcctgta tcgacctttg cggcgtggac tacctgacct ggggcaatgg    177300
     cacgcagccc gaggaaaaga ccggcccggt cacgcgcggc cgctatgccg tcgtcgtgca    177360
     cctgctgtcg atcgagcaca actggcgcct gcgcgtgcgc acctgggccc cggacgacga    177420
     gttcccgatg gtgtcgtccc tgctggaatg ctggcccggc gtgaactggt tcgagcgcga    177480
     agccttcgac ctgtacggca tcgtcttcga aggccacccg gacctgcgtc gcatccttac    177540
     cgactacggc ttcatcggcc acccgttccg caaggatttc ccgctctccg gcacggtcga    177600
     aatgcgttac gaccccgagc agaagcgggt catttaccag ccggtcacga tcgacccgcg    177660
     cgaaatcacg ccgcgcgtcg ttcgtgaaga ctcttacggc atggggcgtt aatcatggca    177720
     gaaatcaaga actacacgct caacttcggc ccgcagcacc cggccgcgca cggcgtgctg    177780
     cgcctggtcc tcgagctcga cggcgaagtc atccagcgcg ccgacccgca tatcggcctg    177840
     ctgcaccgcg ccaccgagaa gctggccgag cacaagacct tcatccaggc gctgccctac    177900
     atggaccgcc tggactacgt gtccatgatg tgcaacgagc acgcctatgt catggccatc    177960
     gagaagctgc tgggcatcga ggcgccgctg cgcgcgcagt acatccgcgt gatgttcgac    178020
     gagatcaccc gcgtcctgaa ccacctgatg tcgctgggct cgcacgccct ggacgtgggc    178080
     gcgatggcgg tgttcctgta cgccttccgc gagcgcgagg acctgatgga ctgctatgaa    178140
     gcggtctcgg gcgcccgcat gcacgcggcg tactaccgtc ccggcggcgt ctaccgcgac    178200
     ctgcccgaca ccatgccgca gtacggcgat tcgagcaaat accgcggcga gaaggaagtg    178260
     cgcgcgatga acgacgcgcg ctcgggctcg ctgctggatt tcatcgagga cttcaccaat    178320
     cgcttcccca gctgcgtcga cgagtacgaa acgttgctca ccgacaaccg catctggaag    178380
     cagcgcctgg tggggatcgg cgtggtcgac ccggatcgcg ccaaggcgct gggctttacc    178440
     ggcccgatgc tgcgcggctc gggcgtggcc tgggacctgc gcaagacgca accttacgaa    178500
     gtctacgatc tgatggactt cgacgtgccg gtcggcgtca atggcgattg ctacgaccgc    178560
     tatctggtgc gcgtggccga gatgcgcgaa agcaaccgca tcatccgcca gtgcgtcgaa    178620
     tggctgcgca acaacccggg tccggtcatg atcgagaacc acaagatcgc gccgcccagc    178680
     cgcaccgcca tgaagtccaa catggaagag ctgatccacc acttcaagct gttctccgaa    178740
     ggtttccacg tgcctcccgg cgaagcctat gccgcggtcg agcacccgaa gggcgagttc    178800
     gggatctacc tggtggccga tggcgccaac aaaccctacc gcctgaagat ccgggcgccc    178860
     ggttttgccc acttgcagtc gctggacgaa atggcgcgcg gccatatgat tgccgacgcc    178920
     gtcaccatca tcggcacgca ggacatcgtt tttggcgaga tcgaccgctg attcttcata    178980
     tcagtccaga gcgcccgcat aacccggatt caaactatgc tgctttccga acaggcctac    179040
     aaaaaaatcg accgtgagct ggccaagttc ccggccgacc aaaggcagtc ggccatcatg    179100
     gcctcgcttg ccatcgcgca agaagagaaa ggctggttgc cggccgaaat tctcgaagac    179160
     gtggccaatt acatcggcgt gccgcccatc gcggtgcagg aagtcgccac gttctacaac    179220
     atgttcgacg tcaagccggt cggcacgcac aagattgccg tgtgcaccaa cctgccctgt    179280
     gccttgcgcg atggcgaaaa ggccgccgac tatctcaagc gcaagctggg cgtcgatttc    179340
     cgtgagacca cggccgacgg ccggttcacg ctgatcgaag gcgaatgcat gggcgcctgc    179400
     ggcgattccc ccgtgctcat cgtcaacaac aagcatatgt gcgtgcgcat gacggaagag    179460
     aaactggacg cgctggtcga tggcctgaag tcgcaaggag agtcggcatg aacgcgcccg    179520
     acctgtacaa gcgcctggcg caggggctgg accccaatcc gctgaacgat ctgtcgatct    179580
     cgatgtgcct gcatggccgg cacatcgcgc cgcagatcat ggccgacgtc gatggcgaga    179640
     actggcgcct gcaggagtac gtcaagcgcg gcggctacga ggcgctgcgc aagatcctca    179700
     ccaccggcat gacgccggaa gacgtgatcg cggaagtcaa ggcctcgggc ctgcgcggcc    179760
     gcggcggagc aggctttccc accggcctga agtggagctt catgccgcgc gcgttcccgg    179820
     gacagaagta cctggtgtgc aactcggacg agggcgagcc cggcacgttc aaggatcgcg    179880
     acatcctgcg cttcaatccc catatcgtga tcgagggcat ggcgatcgcc gcctacgcga    179940
     tggggatcag cgtgggttac aactatatcc acggcgaaat cttcgaggtg tatgaacgct    180000
     tcgaggaagc gctcgaagag gcgcgcgcgg cgggcttttt gggcgacaag ctgctgggct    180060
     cggatttcag cttccagctg cacgcgttcc atggctacgg cgcctacatc tgcggcgagg    180120
     aaaccgcgct gctcgaatcg ctggaaggca agaaaggcca gccgcgcttc aagccgccgt    180180
     tcccggccag cttcggcctg tacggcaagc cgaccacgat caacaacacc gaaaccttcg    180240
     cggcggtccc ctggatcatc cgcaacggcg ggcaggccta cctcgaagtg ggcaagccca    180300
     acaacggcgg caccaagctg ttctcgattt ccggcgacgt cgagcgtccc ggcaactacg    180360
     agatcccgat gggcacgccg ttctcgaagt tgctggaact ggccggcggc atgcgcggcg    180420
     gccgcaagct gaaggcggtg attcccggcg gctcgagcgc gccggtgctg cccgccgaca    180480
     tcatgatgga ctgcacgatg gactatgacg ccatcgccaa ggccggctcg atgctgggtt    180540
     cgggcgcggt gatcgtcatg gacgagacgc gctgcatggt caagtcgctg ctgcggctgt    180600
     cgtatttcta tttcgaggaa agctgcggcc agtgcacgcc gtgccgcgaa ggcaccggct    180660
     ggctctaccg catggtgcac cgtatcgaga atggccaggg ccgccccgag gacctggaca    180720
     tgctcgacag cgtggcgggc aacatcatgg ggcgcaccat ctgcgccctg ggcgatgccg    180780
     ctgccatgcc cgtgcgcagc ttcatcaagc attttcgcga cgaattcgcg caccacatcg    180840
     agcacaagtc ttgtgtggtc ccgcaatatc tgtaggtctc aggaacagca atggttgaac    180900
     taaccgtcga cggcaatcaa gtcgaagtgc ccgaaggcag catggtgatg catgcggccc    180960
     agaagctcgg gctgtacgtg ccgcatttct gctaccacaa gaagctgtcc atcgcggcca    181020
     actgccgcat gtgcctggtg gaagtggaga aggcgcccaa ggcgctaccc gcctgcgcaa    181080
     cgcccgtgac caacggcatg gtggtgcaca cctgctccga gaaggccaag gccgcgcaga    181140
     aatcggtgat ggagtttctg ctcatcaatc acccgctcga ctgccccatc tgtgaccagg    181200
     gcggcgagtg ccagctgcag gatctcgcgg tcggctatgg cggctcgtcg tcgcgctaca    181260
     aggaagaaaa gcgcgtcgtc ttccacaagg acctcggccc gctggtgtcg gccgaggaaa    181320
     tggcccgctg catccactgc acccgctgcg tgcgcttcgg ccaggaaatc gccggcgtga    181380
     tggagctggg catgctcaac cgcggcgagc atgccgagat cacgtcgttc gtcggccgtt    181440
     cgatcgagtc cgagctgtcg ggcaacatga tcgacctgtg tccggtgggc gcgctgacgt    181500
     ccaagccgtt ccgctactcg gcgcgcacct gggaactggc ccgccgccgc agcgtcagcc    181560
     cgcatgacag catgggcgcc aacctggtgg tccaggtcaa gggcgactgc gcgctgcgcg    181620
     tggtgccgtt cgagaacgaa gcgctcaacg agtgctggat cagcgaccgc gaccgcttct    181680
     cctatgaagg cctcaatagc gacgaccgcc tggccgcgcc catgatcaag ggcgccgacg    181740
     gcaagtggca ggaagcctcg tgggccgacg ccctgcaggc ggtggcccag ggcctgtcgc    181800
     gcgtgcgcga aagtttcggc gccggccaga tcggcgcgct ggcttccgag tacgccacca    181860
     ctgaagagtt ctccctgctg ggccgcctgg tgcgcgccct gggttccgag aacatcgact    181920
     tccgcctgcg ccagaccgac gccggcttcg acgcggccct gagcggcgcg ccgtggctgg    181980
     gcatgccggt cgccgaactg gacaacctcg accgcgtcct ggtgattggt tcgttcctgc    182040
     gcaaggatca ccccctgatg gcgcaacgcc tgcgccaggc cgccaagcgc ggcacgcagg    182100
     tgctgctgct cgacgccgcc gccgacgatc ccctgatgcc ggtcgccggc cgcctgacgg    182160
     ttgcgccgtc cgggctggca agcgccctgg ccgaagtggc cgtggcgctg gcgcaggcca    182220
     agggccaggc cgtgccggcc gagttcgccg ccgtggcggc cggagagggc gccaagcaga    182280
     tcgccgccag cctggcctcg ggcagcaatg ctgcggtgct gctgggcaac atggccgtca    182340
     acgcgccgca ggccgccacg ctggcggcca acgcgcaggc cgtggcgcaa ctggccggcg    182400
     cgaagctggg cttcctgacc gccggcggca ataccgtggg cggttacctg gctggcgccg    182460
     tgccgggcaa gggcggcaag aatgccgccg ccatgctggc cgacccgctc aaggcctaca    182520
     tcgtgctgca cgccgagccc tcgctggacg ccgacaacgc gccgcaagcg ctggccgcgc    182580
     tgcgcggcgc gcagttcgcc gtcgcgctga ctccgtatcg ttcggcggcc cagggctggg    182640
     ccgacgtcat gctgccggtc gcgccgttca ccgagacctc gggcaccttt gtcaacgcgc    182700
     aaggccagcc gcagagcttc aagggcacgg tcgcgccgtt cggtcagacg cgtccggcct    182760
     ggaaagtgct gcgcgtgctg ggcaacgtgc tgcacctggc gggctttgac gaggaaacct    182820
     ccgaaaccgt gcgtgacgcg gcgctggcgg gcggcgtgga agcgcgcctg tccaacgcca    182880
     tcagcgcccc gctgggcctg ggccagccgc tcgatgcgct ggagcgcgtg gctgatgtgc    182940
     cgatctatcg caccgacgcc atcgtgcgcc gctccgaacc gctgcaggcc gctccggctt    183000
     cgcgcgcgcc caaggcgcgc atgaatggcc gcaccctggc cagcctgggc gtgagcgcgg    183060
     gcgacaaggt gcgcgtaagc ggcgcggcgg gggccatcga gctcgaagcc gccctggacg    183120
     aggccgtggc cgaccgcgcc gtgcgcgtgg ccgccgcctt tgagcaaacc gccgccctcg    183180
     gcggtgcctt cggtcaaatc agcgtggagc gtgtctgatg gaatggctta atgttctcga    183240
     aagccacggt caggcactgc tgggccccgt ggcgtggatg gtggtctggt cgctcgtcaa    183300
     gatcgtcgtg atcgccgtgc ccatcattct gtgcgtggcg tacctgacgt actgggagcg    183360
     caagatgatc ggcgcgatgc acgtgcgcct ggggccgacc cgggtcggct tcaagggcct    183420
     gctgcagccg ttcgccgacg tgttcaagct gctgaccaag gaagtggtgg tgcccagcgc    183480
     cgccaacaag gtgctgttcg tggtggcgcc cgtggtgacg ctgatgccgg cgctggccgc    183540
     ctgggccgtc gtgccgttcg gccccgaggt ggtgctggcc aacgtcaacg ccggactgct    183600
     gtacatcatg gcgatcacct cgatcggcgt gtatggcgtg atcgtggccg gctgggcctc    183660
     gaactccaag tacgccttcc tgggcgcgct gcgcgcctcg gcgcagatgg tgtcgtacga    183720
     gctggccatc ggcttcgtgc tggtcagcgt gctgctggtg tcgggcagcc tgaacatgag    183780
     cgaaatcgtg ctggggcagg gccgtggctg gttcgccgag cgtggcctga cgttcctgtc    183840
     ctggaactgg ctgccgctgt tgccgctgtt catcatctac gtgatttcgg ccgtggccga    183900
     aaccaaccgc cacccgttcg acgtggtcga gggcgagtcc gaaatcgtgg ccggccacat    183960
     ggtcgagtac tcgggcatgg ccttcgcgct gttcttcctg ggtgaatacg ccaacatgat    184020
     cctgctgtcg tgcatggccg cgatcatgtt cctgggcggc tggatgtcgc cgatcgacat    184080
     cgcgccgctg aactggattc cgggctggat ctggctgggc atcaagacct tctgcgtggt    184140
     ttcgatgttc gtgtggttcc gcgcgtcgtt cccgcgctac cgctacgacc agatcatgcg    184200
     cttgggttgg aagatcttca tcccgctgac cggcgtgtgg ctggtcgtct tggcgatctg    184260
     gatgcagacg ccctggaaca tttggcgctg atgcgtcagg ctgaggctgg aaatggaagc    184320
     gatcaaggat tttttcggta gcctgctgct gaccgagttg ttcaagggct tgcgcctgac    184380
     gggcaagtat tttttcaagc gcaaggtcac cctgcgctac ccgatggaaa agacgccgac    184440
     ctcggcacgc tttcgcgggt tgcatgcgct gcgccgctat cccaacgggg aggagcgctg    184500
     catcgcgtgc aaactgtgcg aggcggtctg cccggcgctg gccatcacca tcgaatcgga    184560
     gcagcgcgac gacggcaccc gccgtaccac gcgctacgac atcgatctca ccaagtgcat    184620
     tttctgcggt ttctgtgaag agagctgccc ggtggactcg atcgtggaaa cccacatcca    184680
     cgagtaccac ggcgagaagc gcggcgatct ttacttcacc aaggacatgc tgcttgccgt    184740
     cggcgaccgc tacgaagccg aaatcgcccg ccgtcgggcc gaagacgcgc cttaccgttg    184800
     atcgccaggg tctgatccat gacatttact accgtcctgt tctacatact ggctttcgtc    184860
     ctggtgatcg ccgctttccg cgtgatcacg gcgcgcagcc ccgtcaccgc cgtcctgcac    184920
     ctgatcctgg cgtttgccaa cgccgccatg atctggatgc tgctgggcgc ggagttcctg    184980
     gcgctgttgc tggtgctggt ctacgtcggc gccgtgatgg tgctgttcct gttcgtcgtg    185040
     atgatgctcg atatccgcat cgacagcctg cgcgacgggc tcaagaccta tctgccgctg    185100
     ggcctggtca tcggcgtggt gctggtgctg gaaatggcct tcgtgctggg ctccacctgg    185160
     tatggcgccg gcccgcaggc ccctgtcgcc ggcgactaca acaacgcccg cgcgctgggc    185220
     gaagtcatgt acacccagta cgtctacgcc atcgaagtgg gcgcggcgct gctgctggta    185280
     ggcatggtgg cggccatcgc gctgaccctg cgccgccgtc gcgacgccaa gtacaacgac    185340
     ccggtcgccg ccgtgcgcgt gcgcgcgaaa gaccgcttcc gcatggtgaa gatgaccgcg    185400
     cagagcgacc gtgcccaggc tcgcgtggcc tcgccgtccg cggatgccca aggagaacaa    185460
     caatgacgct gacgctggcc cactacctga tcctgggggc gattctcttc gccatcggca    185520
     tcttcggcat cttcctcaac cgccgtaacc tgatcattct gctgatgtcc atcgagctgg    185580
     tgctcctggc cgtcaacatg aacttcgtgg cgttctcgag ctggttcggc gacatcgccg    185640
     gccaggtgtt cgtgttcttc atcctgaccg tcgcggccgc cgaggccgcc atcggcctgg    185700
     cgatcctggt actgctgttc cgcaacctga acacgatcaa cgttgacgaa ctcgatcgcc    185760
     tcaagggctg acggggtatt ggaagaaaat gtctagctca cccaatctct acttgctcat    185820
     cgcgctggct ccgctggtcg gcgcgattct cgccggccag ttcggcaccg gattcctggg    185880
     ccgtcccatc ggccgccgcg gctcgcacgt catcaccatc ctgggcgtgc tcatctccac    185940
     catcggctcg ttcgtggtgc tgggcgacgt gctcgacggc catacctacg acggcacggt    186000
     ctatacctgg agcctgatcg gccagaccaa gctggaaatc ggtttcctga tcgatccgct    186060
     gtcggccatg atgatggtcg tggtgacctc ggtctcgctg atggtgcaca tctacaccat    186120
     cggctacatg gccgacgatc cgggctacca gcgcttcttc gcctacatct cgctgttcac    186180
     gttctccatg ctgatgctgg tgatgtcgaa caacatggtg cagctgttct tcggctggga    186240
     agccgtgggc ctggtgtcct atctgctgat cggcttctgg tacacccgcc cgaccgcgat    186300
     cttcgccaac atgaaggcgt tcctgatcaa ccgggtcggc gacttcggct tcgtgctggg    186360
     catcggcctg ctgttcgcgt acgccggcac catgcattac gccgacgtgt tcgcccaggc    186420
     cgacaagctg gccggcgaaa ccctgccggg caccgactgg atgctgctga cggtcgcctg    186480
     catctgcctg ttcatcggcg cgatgggcaa gtcggcccag gtgccgctgc atgcctggct    186540
     gccggattcg atggaaggcc cgacgccgat ttccgccctg atccacgccg ccaccatggt    186600
     gacggcgggc atcttcatgg tggcgcgctt ttcgccgctg ttcgagctgt cggacaccgc    186660
     tctgtcgttc gtcatcgtga tcggcgccat cggcgcgctg ttcctgggca tcctgggcat    186720
     catccagaac gacatcaagc gcgtcgtggc gtactcgacg ctgtcgcaac tgggctacat    186780
     gaccgtcgcg ctgggcgcct cggcctactc ggtggcgatc ttccacctga tgacccacgc    186840
     tttcttcaag gcgctgctgt tcctgggcgc gggctcggtc atcatcggca tgcaccatga    186900
     ccaggacatc cgcaacatgg gcggcctgcg caagtacatg cccattacct ggatcacctt    186960
     cctgctgggc acgctggcgc tggtcggcac gccgttcttc tccggtttct actcgaagga    187020
     acacatcatc gaggccgcgg gcgcggccaa cgtgtggggc gccagcttcg cctattactc    187080
     gacgctgatc ggcgtgttcg tcacctcgct gtactcgttc cgcgtatatt tcctggtgtt    187140
     ccacggcaag gagcgtttcg acgcccatgg ccacggccac catggcgacg cgcaccatga    187200
     cgaccacggc catcacggcg gcacgccgca cgagtcgccg tgggtggtga cgctgccgct    187260
     ggtgctgctg gccatcccgt cggtgctgat cggcgcctgg gtggtcgaac ccatgctgtt    187320
     cggcaagttc ttcgacggcg tgatcaaggt gctgccgcag catccggcca tggccgagct    187380
     gggccacgag tggcacggct gggtggcctt cggcctgcac tccgtgcaga ccgtgccgtt    187440
     ctggctggtg gtcgccggcg ccgtcatcgc ctggtactgc tacctgatca atccgagggt    187500
     gccggccgcg atccagtcca ccttctcggg cgtgtacaag ctgctcgaga acaagtacta    187560
     cgtcgactgg atcaacgagc agatcatcgc ccgtggcgcg cggtgcctgg gctacggcct    187620
     gtggcagacc ggcgaccgcg gcatcatcga cggcgtgctc gtcaacggca gcgcccgcgt    187680
     ggtgggctgg gtggccgcga tcagccgcca tctgcagtcc ggcttcatct atcactacgc    187740
     gttcgcgatg atcatcggca tcatggcgct ggtaactttc tttgtgctga ttccccaatg    187800
     atggcaagcg acatggcatc caacaacttc ccctggctta cgcttgcgat ctttgttccg    187860
     atcgtattcg gtctgctggt gctggcgctg ggccgcgacg accgtcccgg cctgacgcgg    187920
     ggcttgtcgc tgatcggcgc gctggcgggc ttcctggtca cgattcccct ctatacgggt    187980
     ttcgaagccg gtacggcgca gatgcagttc gtcgagaagg cgtcctggat cgaggccttc    188040
     aacgtcaact accatctcgg catcgacggc atctcgctgt ggttcgtgct gctgacggcc    188100
     ttcatcacta tcatcgtggt gggcgccggc tggcaggtga tcaccagccg cgtggcgcag    188160
     tacatggccg ccttcctgat cctgtcgggc ctgatggtgg gcgtgttcgc cgcgctcgac    188220
     ggcatgctgt tctacgtgtt cttcgaagcg accctgatcc cgatgtacat catcatcggc    188280
     gtgtggggcg gacccaaccg cgtgtacgcg gcgttcaagt tcttcctgta cacgctgctg    188340
     ggctcgctgc tgacgctggt ggccttcgtc tacctgtgga acgtgtcggg cggttcgttc    188400
     gacatccaga cctggcacca gaccaagctg ggctacacgc cgcaggtgct gatcttcgtc    188460
     gcgctgctgg ccgccttcgc ggtcaaggtg ccgatgtggc cggtgcatac ctggctgccc    188520
     gacgcgcacg tcgaggcgcc gacgggcggt tcggtcgtgc tggccgccat catgctcaag    188580
     ctgggcgcct acggtttcct gcgcttttcg ctgccgatcg cgcccgacgc ctcgcacggc    188640
     ctggccggcc tgatgatcgc gctgtcgctg atcgcggtca tctacatcgg cctggtcgcc    188700
     atcgtccagg atgacatgaa gaagctggtt gcctattcgt cggtggccca catgggcttc    188760
     gtgacgctgg gctttttcat cttcaacacg gccggcctcg aaggggccat cgtgcagatg    188820
     atttcgcacg ggttcgtttc gggcgccatg ttcctgtgca ttggcgtgct gtacgaccgc    188880
     atgcactcgc gccgcatcgc cgactacggc ggcgtggtca acgtcatgcc ccgcttcgtc    188940
     acgttcttcg tgctgttttc gatggccaac agcggcctgc cggccaccag cggtttcgtg    189000
     ggcgagttcc tggtcatcat gggcgcggtc gagtacaact tctggatcgg cctgctgacc    189060
     gccaccgcgc tgatcctggg cgcgtcgtat tcgctgtgga tgctcaagcg cgttgccttc    189120
     ggcgacatcg gcaacgaccg cgtgcgcgaa atgacggacc tcagcggccg ggaattcctg    189180
     attctcggcg tcatggcgat cgccgtgttg ttcatgggga tctaccccaa gccctttacc    189240
     gacgtgatgc acgtttcggt cgaggccctg ctgcaacacg tggctgtctc gaaactgtaa    189300
     gacctggaca atgatgcaat cccatctcga ttttgccctg gcgaccccgg agatcctgct    189360
     gctggttctc gggctggcca tcctgctcat cgacgcggtc agttcccatc ctgaacgcaa    189420
     gaccacgttc gtcctgacgc tggccacgct ggcggcgctg accgtggtgt ccctgctgca    189480
     atggcgcgac ggcgtcgaag gccagacctt caatggcctg tacgtgaccg acagcctggc    189540
     gcacctgctc aaggtcgcct cgtacatcgc agtcgccgcg accctggtgt atggccgcat    189600
     ctatgcgcag cagcgcgaca tgatgcagcg cggcggcgag ctctacgtgc tgacgctgtt    189660
     cgccttgctc ggccagatgg tcatgatctc ggccggcaac ctgatcagca tctacctcgg    189720
     cctggaactg atgtcgctgg cgctgtacgc gctgatcgcg ctgcgccgcg aagacaaggt    189780
     cgccaccgaa gccgccatga agtacttcgt gctgggcgcg ctggcgtcgg gcttcctgct    189840
     gtacggcatg tcgatggtgt atggcgccac cggccacctc gacctggcga agatcgccga    189900
     ggtcatcgcc tccggccagg ccaagcagct gccgctggtg ttcggcgtgg tgttcctggt    189960
     ttccgggctg gccttcaagc tgggcgccgt gccgttccat atgtggctgc ccgacgtcta    190020
     ccagggttcg cccacggcgg tgacgctgat cctgggcgcc gcgcccaagc tggcggcctt    190080
     cgccatcacg ctgcgcctgc tggtcgacgg cctgcacggg ctggcggccg attggcagcc    190140
     aatgctcatg atcctggccg tgctgtcgct ggcgatcggc aacctgaccg ccatcgtcca    190200
     gaccaacttc aagcgcatgc tggcctattc gaccatctcg cacaccggct tcgtgctgct    190260
     gggcctgatg gccggcgtgg tcgacggcaa gcccgacgcg gcggcctccg cctatggcgc    190320
     ggccctgttc tacatgctga cctacgtgct gaccacgctg ggcaccttcg gcatcatcct    190380
     gctgctggcg cgccaggggt tcgagtgcga gcagatcgac gacctgaagg gcttgaaccg    190440
     gcgcaatccg tggcacgccg ccatcgtctt gctgctgatg ttctcgttgg ccggcatccc    190500
     gccgctggtg ggcttctacg ccaagctggc ggtgctgcag gcgctggtcg aggccggcca    190560
     cgtggcgctg gcggtcgtcg ccgtgatgtt ctcgctgatc ggcgccttct actacctgcg    190620
     cgtggtcaag gtcgtgtact tcgacgatcc ggtcgaccag cccgccgcct tggcggtgac    190680
     ggccggccag cgcagcatcc tgtcgctcaa cggcgcgctg atcctggtgc tgggcattct    190740
     gccgggcggc ctgatggcgc tgtgcgtgca ggtgatccag gcgtcgctgg gctgatggcc    190800
     ggggcaggag cgtgaaccag accgccgccg tatggctgtt gattgcgctg gccctggtca    190860
     gcgccaatct gccgtttctc agcgagcggg tgttcgcgct gctgccgtac aagcgggccg    190920
     gcgttcatgc gcccaagcct ttctggctca gactgtgcga agtgctggtc tggtacgcag    190980
     tggtcgggct gctcggcttc gccttcgagg cgcagctggg caaccgcttt gcgcaggcct    191040
     gggagttcta tgccattacg ttcagcctgt tcctggtcct gggctatccc ggcttcgtgt    191100
     accgctatct ctacaagaag cgccgcccgg cccgggcttg aatccgccgc gccgcttcag    191160
     cgataccgcc tccatgaggc ggtttttttt cgcctacgcc ggccagtgtt ccgaggggca    191220
     ggtgtcgctt ggatttgcca cagatggcgt ggatgctgag agatttgtcc tgtcaccaag    191280
     gaaggatcga gggtggcggc ggatagggac tatctggttt tggggcggcg cggccgatag    191340
     ggggccgcgc cggcggcagt cgtccgtagc atggcgtagc gccgtatccg cttggcgggt    191400
     gggcgtcgca ttccatgttt cgttgacgat agcggattcc catgaagttc tactcttccc    191460
     atccgatgcc cgagtcgctc gcggctgcga tcgcagtgcc tctgttgggc ctgctgccgg    191520
     cggcgcaggc cgcgtccacg gcggtccagc tgccatccgt cacggtcgag ggcgagtact    191580
     cgtcctatca accggaaagc gcccagtcgc ccaagttcac cgcgcccctg gcggacacgc    191640
     cgcgcacggt gcaggtcatc cctgagcggc tcatccagga ccagggggcc agcgacctcg    191700
     aagcggtact gcgcaatgcg ccagggatat cgatgaccgc cggcgaaggc ggccgtccgg    191760
     ccagcgacct gccgttcatc cgcggccaga attcggccag cagccttttt gtcgacggcc    191820
     tgcgcgatcc cagcacgcaa tcgcgcgata ccttcaacct ggaacaggtc gacgtcgtca    191880
     aggggcccga ttcggtattt tccgggcgcg gcggcgccgg cggaagcatc aacctcgtca    191940
     ccaagacgcc caggaaccag gatttcaccg aagtccaggc cggcatcggg acggccgaga    192000
     cctaccgagg caccatagac ggcaactggg tgctgggcga gaacacggcg ctgcgcctca    192060
     acctgctggg caccagggac accgtgccgg gccgcgacaa ggcggtcgag ttcagccgcg    192120
     tgggtatcgc gccatcgctg cgcctgggcc tgagcggccc cacccgcgtg acgctgggcc    192180
     tgtaccacta tcgccaccgg cgggttcccg attattcgat tccgtacgat ccgcgcaccg    192240
     gcacgccgat caccgagacc atcggcgtca gccgccgcaa cttctacggc ctggtgcggc    192300
     gcgactccgg cgataccgag gactacgccg ccaccgtcaa atgggagcac gacctcgcca    192360
     atggcttcaa ggtggagaac ctggcgcgct actcgcgtgc cacggtggag cagatcacca    192420
     ccatgcccga actgaaaacc gccgatctgg ccaaggggct ggtgtaccgc aatctgcgcg    192480
     ccagctacca ggtcaacgac agtttcgcca accgcaccga cctgcgcggt acattcgaca    192540
     cggggcagtg gcgccatacc ttcgatctgg gcggggagtt cgccaccagc cggcgcagtc    192600
     gcgaccgcta caagcaagaa atccccgacg ccgccagtcc ttgctcgccc gtgacggacg    192660
     gcaacaatcc cgccctgtgc gcctcgctcc gggatccgga tccgcacgtg gatttcccgg    192720
     gaacggtgcg gcgcaaccat aacccggccc gctaccacac cgacatcctg tccctgtacg    192780
     gtttcgacac catcgccttc gacgagcagt ggcagctgaa tctcggcctg cgctgggacc    192840
     actacaagac cagcggacgc aacctgccgg tacgaggcgc caagccgccc gtctacgagc    192900
     gtgccgcgcg caccgacaac ctgttcaact accagctcgg cctggtctac aagcctcgtc    192960
     cggacggctc ggtgtatgcg agttacggca cggcgtccac gccgtcggcc gtgtccgact    193020
     acgccccggc ggacagcatc tccggcacaa gccagcagct caagccggag cgcagcgagg    193080
     cgatcgagat cgggaccaag tggcaggtgc tggaccggcg gctgctggtg acgggcgcca    193140
     tgttccgcga gacgcgcaag aacaccagca tcgaagtcgc cgaaggcctg cgcgcaccag    193200
     ccggcaagag ccgcgtcacc ggcatggagc tgggcgtggc gggcagcctg acgccgcgct    193260
     gggacgtcta cggcggctac gcgctgctcg acagcaagct ggtcagggcc agccataaga    193320
     gcggggcgca aggccagccg ctgcccagcg cgccccggca cgcattcagc atctggagca    193380
     cctacaagct gctgccggaa ctgaccgtgg gggccggcgc gttctatcgc agcaaggtct    193440
     atggcaacgc agatgccggc tacaacaagg acggcacgcc caaggcgcgc tgggtgccgg    193500
     cgtactggcg cttcgacgcc atggcggcgt accagcttaa caagcacctt acggcccagt    193560
     tgaacgtcta caacctgctc gacaagacct attacgccaa gacctaccgc agccattacg    193620
     cggcgctggg cccggggcgg tccgccatgc tgacgttcaa gctgagctac tgatccgggc    193680
     tgcaaccccg ccgttccgac ggcctcccgc aagggggccg tttttcattt ccggctggat    193740
     tttccctgtc cgaatggggg ctcggagcgc ggaaagggct gtggcagaaa tgtgacacca    193800
     taggaatatt caggtttggg tcaggtaaac agacgagaat cgcagtcgat ttaaagaaca    193860
     agaatcgttg ttattcagat ttttatggag aagccgttga aatccctgga ctcgtattca    193920
     gcgagcacgc tcgccaactc gctggccgcc gccattgcgg tgccggccct gtgcctgatg    193980
     cccggtgctc aggcacagac cagcgcgggc gttacccaat tggcgccggt gcaggtagag    194040
     ggcgaagcgt ccccctatca ggccaccacc gtccagtcgt ccaagatgac ggcgcccttg    194100
     ctggatacgc ccaggaccgt gcaggtcgtg ccgcagcagg tcatccagga ccaggccgcc    194160
     accaatctgc aggacgtgct gcgcaactcg ccgggcatca ccatgggcgc cggcgagggc    194220
     gggcgcgccg gcggcgacct gcccatcatc cggggccaga atgcggcggg cagcatcttc    194280
     gtcgacggcg tgcgcgaccc cagcacccag atacgcgata cgttcaacct ggagcaggtc    194340
     gagatcatca aggggcctga ttcggtctac tccggccgcg gcggagccgg cggcagcatc    194400
     aacctggtca gcaagacgcc gaaggcgcgc gacttcgccg agggctcggt gcagatcggc    194460
     accgacagca attaccgcgc caccgccgac ggcaactggc tgctgggcga caacgccgcc    194520
     ttccgcctga acctgatggg caacaagggc gacgtgccgg gccgcgacca tgcggtcgat    194580
     ttcagccgct ggggcgtggc gcccaccctg caactgggcg tgggcacgcc cacccgcatc    194640
     accctggggt actaccacta ccaggatgac agcatgcccg attacgcgat cccgtacgat    194700
     ccgaagtcgg ggcagccggt caccgagacc cagggcgtca gccgcaagaa tttctacggg    194760
     ctgaccggcc gcgacttcat gaagtcgcgc gacgacgtgg ccacgctggc catcgatcac    194820
     gatttcagca gcaagctgcg cctgcgcaac gtcacccgct acgggcgctc ggtgaccgac    194880
     tacgccgcca ccaatccgga tgacagcaag ggcaacgtgc ccaacgggct ggtgtaccgg    194940
     gcgctgaagg cgggctacta caccaacaag acgttcacca accagaccga cctgagcggc    195000
     gaattcgaga cgggcagcct gcagcactcg ttcgacgtgg gcttcgagta cagcaacatc    195060
     aagcaggaca aggactcgta tacccagact atcgccaagg gcgcgatgcc ttgcaaggtg    195120
     ggcgccaacg atgccagcaa tccggccttg tgcacctcgc tgtgggatcc ggatccgcat    195180
     gactattatc ccggccacct gtcgcgcaac gacaacccgg cccgctattc caccgacacg    195240
     atcgcgctct acggcttcga cacgatcaag ttcaacgagc aatggcaggc cagcgtcgga    195300
     ctgcgttggg acaattaccg cgtaagcggc agcaatatcg cccgcggccg caacgatccc    195360
     gccagcacgc cggcgttcta cagcaccagc cgcgaagaca atctgttcaa ttaccagctg    195420
     ggcctggcct acaagccggt gcccaacggc acgatctacg cctcgtatgg cacctcgtcg    195480
     acgccgtcgg ccgtcgccgg ctcgaacgtg agcgacgccg tgacggtgag caacgagtcg    195540
     ctggcgccgg agaaaagccg caccgtcgag gtcggcacca agtggcaatt gttcgacgac    195600
     cgcctgaccc tgtcgggcgc gttgttccag gacatccgca agaacaccag cgtggccgtg    195660
     tcggcgaccg aaacggagca gatcggcaag gccaaggtgc gcggcatcga actgggcttc    195720
     tcgggcagca tcacgcccaa gtggaacgtc tacggcggct ataccttcat ggacagcgaa    195780
     ctggtcgagg gcgcctacaa cagcggcgcg gtgggccagg acctgcccaa cacgccgcgc    195840
     aatgccttca gcctgtggac cacctacaag ctggtgcctc agctgaccgt gggcggcggc    195900
     gcctattacg tggacaaggt atatggcaac gcggacaacg gtcgcaatgc cgacggcacg    195960
     ccgaaggcgc gctgggtacc gtcgtactgg cgcttcgacg ccatggccgc gtacgagttc    196020
     aacgaccacc tgaccgcgca gctcaacgtg atgaacatct tcgacaagac gtactacacc    196080
     aaggcctacg cggcgcacta cgcggcgctg ggcacgggcc gcgccgcggt gctgtcgttc    196140
     aatatcaagt attgagcgca gccgcgcagc agggaaaacc ggcgcattgc gccggttttt    196200
     ttttggcatg gcgcggaaat gctctacgat ttcaggtgtt tgccatcgag ccacccgggc    196260
     ggaagacatg acgaatatgc ggcaagtgct gaaaacagac cggctggtgc tggagccgca    196320
     atcgatggcc cgcttcgatc aatggttcgc gatggagcgg cagcgcgatg aagccgggca    196380
     tcgcgatctc accgaggacc aggcatggtt gcgcctttgc gcgcggcagg gaatgtggga    196440
     cgcgtacgct tgcggcttct actacctgct ggatccggtc agcggcgaga tgcgcggcga    196500
     ggccggtttc caattccggc gccgcggctt cgggcccggt ttcgacaacc atccggaggc    196560
     cgcctgggcc gtcgccagcg cccatcaggg caggggactg gcggcggagg caatgcaggc    196620
     gcttctcgcg caccatgatc gatcaagcgg acgccagcgc gtggtggcgt tgatagcgcg    196680
     ttcgaacctt ccctcgctgc gcctggccga gcggcttggc tttcgcgggt attccgacgt    196740
     ggcgttcgat ggtgcagcgc atctgctgct ggaacgggcg ggctgagcgg gcgggtcaca    196800
     gcccccgtcc gccggtcacc ggcaaggttt cgccggtgat gaagccggcc tgctcggaca    196860
     gcaggaacag cacggcgtcg gcgatgtcgg caggctggcc caggcgccgc agcggggtgc    196920
     ttgcgcggat cgtctcgttg aactcgccgc cggccaccga ggccatcgcg gtctcgatgc    196980
     gtcctggggc gacgcagttg atgcggatgc cgaattcggc cacttcgccg gcggcctgcc    197040
     gggtcaggcc gacgactgcg ttcttggcgg tggcgtatga cgcgccggca atcgaggaat    197100
     agcgcaggcc cgccagcgag gcgatgttca cgaccgcccc ggcgcgccgt tcgaccatcc    197160
     ccggcaacac cgcgcgcagc gcgaaaaagt agccgcaaag attgacctgg atgacgcgct    197220
     gccactcctc gggcggggtt tcccagatca tgcgcttgcg gccgtccggc tgcttgggcg    197280
     agatgcccgc gttattgacc agcagatcga aggcgccgaa gccatcctgc atcgatgcga    197340
     tcgacgccac gacggatgcg catcccatgt cgtgcacgat agtcgccgct tccgcgccca    197400
     gctggcgcac catcgccgcc gtttcgtcgg cggccgcatg gtcggcatcc agcacgcaga    197460
     catgggcgcc gtccttggcc agcgccaggg cgatggcgcg gcctatgccg gcacccgcgc    197520
     ccgtcacgag cgcccgcttg ccgcggaacc ggggctgttc gcgcggcgtc atggcgtctc    197580
     gccgccgagg ggccggagct gggattcgaa cgccgatatc ggcggaaagg ccgagggctc    197640
     ggttttcacg tcgatcacga acgggaccgg gctgcgttcg gccgccgcca tggcttgccg    197700
     cagcgaagcg gcgtcgctca cgctggcgcc atcgcagccg catgccttgg cgatcgcgac    197760
     gtgatcgatg gcgccgaagt ggcaaacgtc ggtatgggtg ccgaaacggc tttcttcggc    197820
     gttgatctgg aacccgagca cgccgttgtt gagcaccacg atcgtgaggg gcacctcgtg    197880
     ccggcgagcc gtttccagtt cggcccagca gtgggcgaag ccgccgtcgc cggtcaggca    197940
     aatcacgcgg gcgccgggcc gggcgatctt ggcgccgatc gccatcggga cgccccatcc    198000
     caggccggcg atgccacgcg gcgtgacgaa tcgcgttccc gcctcggtgc aagggatgaa    198060
     ctgggcaagc cagatggacg agtagctggc atcggcgacc cagatgatgt cgccatggct    198120
     tgcacgcaac tccgccatga tccgttccgg ccgcatgggc gaggcgtcgc tctgcgcgta    198180
     gggcgcgagt tcggcgcggt gggcctggcg gcaggcttcg aatgccggcg ccagctcggc    198240
     cattctgcgc gccgcaacgg cctggccgcg cccctgcagg gcatcgccaa gcgcctgcag    198300
     cgtggcggcg gcgtcgccgg caaagcgcat ggccccgtaa ttgcggccga cttcctcgct    198360
     gtcgatgtcg atctgggcat attgcgcctg ctcgggaaac agcgaccacg acgccgtgcc    198420
     gttctcgttg gtgcgggtgc cgacgaacag cacgaagtcg gcgcttcgga cgtaatccat    198480
     gaaatgcttg gccggactgc gcgtgcccat ggcgttgccg atcaccccca gggagagcgg    198540
     atgcgtttcg tcgatcgcgc ccttgcccat attggtggtg gccacgggca ggccggccag    198600
     ggactgcagc cgggccaggg cgtcgcaggc gcccgaaaga tggacgccgc ctccagccac    198660
     gaccaggggc cgcttcgcgt caagcaggcg ctgggcaagc tgcgccaggc ggcctgccac    198720
     cggaaccgtc cggtccagcg ggaagcggcc cagcggctcg tcgctgtcct gcgccaccgg    198780
     ccgcgcctgc gggcaggccg tggtcaggac gtcctgcgat accagcagca ccaccggacc    198840
     gggccggccg gatgtcgcga tacgtatcgc gcgctcggtg tactccgcgg cgcgttcggc    198900
     cacgtcgatc cggcgtaccc atttcgcgca ggacgcgaac agctggacgt ggtcgagctc    198960
     ctggaatgcg ttcttgtccg cgttggcgcg cggcacctcc tgcacgatgg ccaggatggg    199020
     cacggacgcc ttggtcgcct cggagaagcc ggcgaccagc aaggccgcgg ccgggccgtt    199080
     ctgcgccgtg atcacggtca gctggcgtcc gacgcgagcc gcgccgtcgg ccatcgccgc    199140
     gcccgcgttc tccgtccggt agccgatctg gcggataccg atcgcatcgg cggccaggaa    199200
     cagggccgtc ggacagcttt ggccgaagat ctgggcgacg cccgcggcct tcagcacgtc    199260
     ggcgatcgcg ttggcggcct ggtaggcgct cagatcctgg cgcgcccagc tgccggtgct    199320
     ggtgcgcgcg ccgggtggtg attcagtgtg tgcttgcatg gggtttcatc tggtgtggat    199380
     agctgggagg ctggccaggc ggcggcgtgc ggcggctgct acagcttcga tggcggcaga    199440
     ttgatcttct tgacgacctc ggcccacttg gcgatttccg cgcgcatgaa actgtccagc    199500
     gcggcggatg tgccgccggt cggctccagt cccgcggcgg agaactgcgc caatacgtct    199560
     tgggacttca ggcccttgtt ggccgcggcg ttgagcgttt gcacgatcgc ggccggcgtg    199620
     ttcttcggcg cgtacagcgc gacccacgag gccgacgcga acccggggac ggcttcggcc    199680
     acggtaggca gttccggcac cagcgccgaa cgttgcggac ccgtcacggc cagggcgcgc    199740
     aggctgccag ccttgacctg cggcagcgac gagggcatgt tgtcgaacat cagctggaca    199800
     tggccgccga tcaggtcggt cagcgcggga gcgctgacct tgtagggcac atgttggata    199860
     tcggtcccgg tcatcagctt gaagagctcc agcgtcaggt gcagcgagcc gccagtgccg    199920
     gtggacgcat aggattcctt gcccgggttg gctttcaggt gcgcgatcag gccctggacg    199980
     tcccgcaccg gggacgatgg gttgacgacc accagcagcg ggctggatgc cacggcggcg    200040
     atcggttcga aactgccggt cgcgctgtac ggcaggttgg cgtaggtgct ggggttcgtt    200100
     ccatgggtcg cgctggtgcc gatcaacagc gtgtagtcgt cggcgggcgc tcgcgccaca    200160
     taatccgagc cgatgatgcc gcccgcgcct gcgcggttct ccacgatcac cgactgtttc    200220
     agctcctcgc tcatggcgcg cgccaggccg cgcgcggcga tatcggtaat tcctccgggc    200280
     ggatagggca ctaccagcct gatcggcttg gtcggatagg cgtcggcgtg tgcggcgcca    200340
     agcaccccca aagtcagcac gcccgtggcg agggaaatga gtactcggtg caatagcatg    200400
     ttgctgcgtc tccggaaggc gatgttgata cgcctgttat cgatggttgg cctgaaggcg    200460
     acgccattac acccgtaaat gtttgattcg tataatctat tctgtttata gttaattcaa    200520
     tttaagttat gatgccatga acgtgacctt caggcagttg accgccttca tcgaggtcgc    200580
     aagcagccgc agcttctcgc aggcggcgca ggccttgcac gtgacgcagc cggcgctgac    200640
     ggccatgatc cagaagctgg agacccagct tggagtcgtc ctgttcacgc gtacgcgccg    200700
     gggcgccgag ctgaccacca ccgggcgcga actgctgccg gagctgcagc ggatcctggc    200760
     caatctcgag gtcgtgatcg aggatgtgcg tggtgccgcc tcgccgcgcg gcggcaccgt    200820
     cacgctggcg tgcattccgt cgctcagcaa cacctggatc ccatccctga tcgcgcgcgt    200880
     ggagcaggcc tatccgcgca tcaaggtgat cctgaaggac gccatgaccg aaaaccgcag    200940
     cattcacgag atgctgagaa ccggcgatat cgactatggc gtgggcagtc cgtcggtcga    201000
     gcaggatgga ttggagttcg acctgctggc gcacgatgaa ctggtcgcgg tcgtgccgca    201060
     ggatcatccc ctggccaggc gcacactggt ccgctggagc gagttggcgg aatcgccctt    201120
     gataggcatg agttaccaga gccacgtgag gatgctggtc gacgaagcct tcgcggccaa    201180
     cggcatctcg aagcgtccca agcgcgaggt gagccttatc accaccgcca tcggcatggt    201240
     gcgggcaggg ctgggcgttt ccgttctgcc caccaccgcc atcgaggtat gcaacgtcgc    201300
     cgggctgaag gtattgcggc tgcatgcgcc gcgggtgcgc cgtcccctgg ggtttctgca    201360
     cctgccgacg cgcagcctga gcccggccgc gcggctgctt ctgcggttcg tgaaggatgc    201420
     gggccccatt ccgctgggca agcagccgga gtaaggcgcg cgggccggcc gggcggcggg    201480
     aggccgtcgc gaggcgcctg tccccgccgg gacagatacc gtcttggccg tcaagtgttc    201540
     atgggtgcct gtccccgcgg ggacaggcac cctatgtgtg gcttacttct cgaaccagtt    201600
     cagcacgccg tccaggccgc atacgttcag ggcgtagggc gtttgctcgc gcacgatggg    201660
     cttggcgtgg taggcgacgg cgaagccggc gcgggccagc atcttgaggt cgttggcgcc    201720
     gtcgccgatg gcgatgatct gctcgggacg ggccgacagg cactgcgcca gcgcggccag    201780
     gtgcgcggcc ttggcgtcgc cgtcgagaat gtcgcccagc acgcgtccgg tcagcttgcc    201840
     gtcggcgtcg acttccagcg tgttggcatg ggcgtggtcc agccccaggc gttcgcgcag    201900
     ccgctcggtg aagaaggtga accctccgga gaccagcagg gtctggatgc cggccgcccg    201960
     gacgctggcc agcaggcgtt cggcgcccgg gttcaggcgc agcttctcgg cgtacacgcg    202020
     ttcgagcgcg gcggccggcg cgccggccag gagcgccaca cggcggcgca ggctttccga    202080
     gaagtccttg atttcgccgc gcatggcggc ttccgtgatc tgggccacct gggcccccac    202140
     gccggcgacg gtcgcgattt cgtcgatgca ctcgatgttg atcagcgtcg agtccatgtc    202200
     catcgccagg atgcggcagt cggccagcgc caggcccgcg ggcacgaagg cggcgtcgac    202260
     gccgtgcgtt tcggcccaat gccgtacctg ggcgcgcgtg tcgccatcct gctgtacgtc    202320
     gagcaggcgg gccgcggtgg tgctgatgcg cgtcacgccc tgggcctggg ccagcgccgc    202380
     cagctgttcg gcgtgttcgg ccgccagggc gggagactgg atgacgaggt gatggatagt    202440
     catggatcga ggattctggg ccgcgccgag cgcggcggtt atttcagtgc gcgcaggacg    202500
     gcgcgcacgg cgtcggcgcg ggcggcgatc tgaggcgcct tgatctccac ccgcagtttg    202560
     tcctggccgg acagcttgat atggcgctgg cgctgcacca gctcgatgat gcgcaagggg    202620
     tcgaccgtgg tcttggcacc gaactgcagc agggcctgcg tttcgctggc atcgatcttg    202680
     acgatgccca gcggttgcgc ggccaggcgc aggcggtgcg tggccagcaa cgtctgcgcg    202740
     gcttcgggca gtttaccgaa acggtcgatg agttcttcct ggatgcggat caggtcgtct    202800
     tcgccgtcgg catgcgacag gcgcttgtag atggccaggc ggccatgcac gtcgggacag    202860
     tagtccgacg gcagcagcgc cggcgcgtgc aggttgactt cgcaggccag gttgaagggc    202920
     gcgtccaggt cgggctcctc gcccgccttc agcgcccgca ccgcttcgtt gagcatctcg    202980
     ttgtacatcg agaagcccac ctcttggatg ttgcccgatt gcgagtcacc caggatttcg    203040
     ccggtgccgc ggatttccag gtcgtgcatg gccaggtaga agcccgaacc gagctcttcc    203100
     atggcctgga tggcctccag gcgcttcttg gcgttgttcg tgatggcatc ctcgcccggc    203160
     gtcagcagat aggcgtaggc ctggtggtgc gagcgtccga cgcggccgcg cagctggtgc    203220
     agctgcgcca ggccgaagcg gtcggcgcgg tggatgacga tggtgtttgc ggtggggatg    203280
     tcgatgccgg tttcgatgat ggtggtgcac agcagcacgt tgtggcgctg ctggtagaag    203340
     cccttcatga cctgttccag ctcgcgttcg ggcatctggc cgtgggcgac cgcgatgcgg    203400
     gcctcgggca ccagttcttc gaggcgcgcc cgccggttgt ggatggtctc gacctcgttg    203460
     tgcaggaaat acacctggcc gccgcgcttg agctcgcgca gcagcgcttc gcgtatggtg    203520
     ctgccgtcct cgcgccgcac gaaggtcttg atggccagcc gcttctgcgg cgccgtcgcg    203580
     atcacggaga agtcgcggat gccttccagc gacatgccca gcgtgcgcgg gatcggggtg    203640
     gccgtcaggg tcagcacgtc gacctcggcg cgcagcgcct tgagggtttc cttctggcgc    203700
     acgccaaagc ggtgttcctc gtcgatgatg accaggccca gccgcttgaa gcgcacgtcc    203760
     ttggacagga tcttgtgcgt gccgatgacg atgtccacgc ggccgtcgtt gatgccttcg    203820
     acggcggcgg ccacctcctt ggcggagcga aagcgcgaca gctccacgac gcgcaccggc    203880
     cagtcggcga agcggtcgga aaacgtctgg gcatgctgct cggccagcag ggtggtgggg    203940
     cacagcagcg cgacctgctt gccgttggcc acggccagga aggcggcgcg cagcgcgacc    204000
     tcggtcttgc cgaagcccac gtcgccgcat accagccggt ccatggggcg gcccgaggtc    204060
     atgtccatga tgacggcctg gatggcggcc gcctggtcgg gcgtctcctc gaagccgaaa    204120
     ccttcggcga aggcttcgta gtcgctcatg ggcagcttga aggcatagcc ttcgcgggcg    204180
     gcgcgctgcg catacagggc cagcagttcg gccgcggtgt cgcgcacctg cctggccgcc    204240
     ttgcggcgcg ccttgtccca ttggcccgaa ccgagctggt gcaggggggc ggcgtccggg    204300
     tcggcgccgc tgtagcgggc gatgacgtgc agctgcgaca cgggcacgta cagcgtgctg    204360
     ccgctggcgt attcgagatg caggaactcc atctcgcctt cgcccatgtc catgttgacc    204420
     agcccgtggt agcggccgat gccgtgctgg gcgtgcacca ccgggtcgcc ggcgcgcagt    204480
     tcggccaggt cgcgcaccat ggcttcgaca ttgctggtgc gttcctgggt gcgcttgccg    204540
     cgccgggtga cgccggcatg gccggggtag aggtcgttct cggtcaggaa cagcagggcg    204600
     ccgccgggaa cgcagaagcc ggccgacagc ggcgccacgg ccaggccgaa gcgcgcgccg    204660
     tcgtccagga aggcctggat cgaatcggcc tgcgcctcgg gcgccaggcc gtgttcgccc    204720
     agcatttgcg ccagcgtctc gcgccggccg gccgaatcgg cgcacagcag cacgcggtcg    204780
     ccggtctgcg ccagcagcgc gcgcaggcgc gccacggggt cgtcggcgcg gcgcgccacg    204840
     gcgacatcgg gcgcggcggc gaagtccgga tgcggccgct ccgccatcaa ggccaggcgc    204900
     gggaagtctt tcaggcgcgc gaacagcgcc tcgtggtcga ggaacagggt gtccggcggc    204960
     agcaccggcc gttcgcggtc gaccttgaga aagtcgtagc ggctgcgggt gtcatgggcg    205020
     aagcgctgca tggcgtcgtc gatgtcgccc accgtgacgg tgatcgtgtc ggccgccagg    205080
     taatcgaaca gggtggcggt ctgctcgaag aacaggggca ggtaatactc gatgccggcg    205140
     aacgcgatgc cgttgccgat gtccttgtac ggcagggcgc gggaggggtc gccttcgaac    205200
     acttcgcgaa accgcgcccg gaagcggttg cgcgcctctt cgtccatggg aaactcgcgg    205260
     ccgggcagca actgcacttc gcccaccgga tacaggctgc gctgcgtgtc gacgtcgaag    205320
     ctgcggatcg attcgatctc gtcgtcgaac aggtccagcc ggtagggcac caccgaaccc    205380
     atgggaaaca ggtcgatcag gccgccgcgc aggcagaatt cgcccggcgc ggtgacctgg    205440
     gtaacgtggc tgtagttggc cagcgtcagc tgcgcgcgca gggccgcttc gtcgagccgg    205500
     tccttctgct tgaacgaaaa cgtatacgcg gccaggaagg cgggcggcgc caggcggtac    205560
     agggcggtgg tgaccggcac ggtcaggatg tccacgccct ggttcatgag cgcgtgcagc    205620
     gtgcgcaggc gttgcgagat caggtcctgg tggggcgaga acgcgtcgta gggcagggtt    205680
     tcccagtcgg gcaactggcg cacgcgcagt tcgggcgcga attgcgggat ttcatcggcc    205740
     agccgctggg cctccagcgg gtcggccgtc agcaccacca gcggcttgcc ggcctggcgc    205800
     gccaggtccg ccagcagcca tccgtcgccg gatccgggcg ggcggggctg cgtaaagcgc    205860
     gctcccggct tgagggcgga cagggtggtg gcggtggcgg ggatgggcac ggcgggcgga    205920
     gtgagatcag gcatcagggc aaagattata aaatcaccgc aacatgtccg agtccctgat    205980
     cgctatcgtg ccggccgccg gcatcggcgc gcgcgccagc ctgcccggcg aggcggccgt    206040
     tccgaaacaa tatcgcccgc tggccgggca gcccatgctg cgccacgcgg tgcgcgccct    206100
     gctggccgat ccgcgcatcg tccaggtgcg cgtggcggtc agcgccggcg acggctgggt    206160
     cgagcaggcg ctggctggcc tgccgcgtac cgtatggcgc ccatgcggcg gcccgaaccg    206220
     cgccgacacg gtggccgccg ccctggccga cagcggggcg gccgccgacg actggatact    206280
     ggtgcacgac gccgcccggc cgggcttgcc ggccgcggcg ctggcgcgcc tgatcgacgc    206340
     ctgcctggac gatgcggttg ggggcctgct ggccctgccg gtcgccgata ccgtcaaggc    206400
     gggccggcag cgcgtatcgc gcaccgtcga tcgcgacggc ctgtggctgg cccagacgcc    206460
     gcagatgttt cgcgccggct tgctgcgcga cgcgctggcg cgcgcgcggg ccgcgggcct    206520
     ggccgttacc gacgaggcgt cggcggtgga ggcggccggc catgccccgc gcctggtggc    206580
     gggcgcgttg cgcaatttca aggtgacctg gcccgatgat ttcgaactga tggaaaaatg    206640
     gctatgaata tcccgtttcg cgtagggcag ggcttcgatg tgcacgcgct ggtcgaaggc    206700
     cggcccttga tcatcggggg cgtcaccatc gcccacacgc acggcctgct ggggcattcc    206760
     gatgccgatg tcctgttgca tgcggtgacc gatgccctgc tgggcggggc cggcctgggc    206820
     gatatcggcc gccattttcc cgataccgac ccggcctacc gcggcgccga cagccgggtg    206880
     ctgctgcggg cggcgttcga caaggttcgc gcggcgggct gggcgccggt caacgtcgac    206940
     gcgaccatcc atgcgcaggc gcccaagatc ggcccgcacg cggccgccat ggtggccaac    207000
     attgccgccg atctggcgtt ggacgccggc gcggtcaaca tcaaggccaa gaccaacgaa    207060
     ggcctgggct acctgggccg caaggaaggg attgccgcca acgtggtggt gctgctggcg    207120
     cgcgccggct aggtgtgaag attcaatagg ttgtatgcat ggttcatccg aaccggattt    207180
     gagaaactgg aaatcgccac ccccccagtt cactcaagga gcccggccgg atgaacaccc    207240
     ataagcatgc ccgattgacc ttcctacgtc gactcgaaat ggtccagcaa ttgatcgccc    207300
     atcaagtttg tgtgtctgaa gcggcccgcg cctatggggt caccgcgccg actgtgcgca    207360
     aatggctggg ccgcttcctg gctcagggcc aggcgggctt ggccgatgcg tcctcgcgcc    207420
     cgacggtctc gccccgagcg attgcgccgg ccaaggcgct ggctatcgtg gagctgcgcc    207480
     gcaagcggct gacccaagcg cgcatcgccc aggcgctggg cgtgtcagcc agcaccgtca    207540
     gccgcgtcct ggcccgcgcc ggtctgtcgc acctggccga cctggagccg gccgagccgg    207600
     tggtgcgcta cgagcatcag gcccccggcg atctgctgca catcgacatc aagaagctgg    207660
     gacgtatcca gcgccctggc caccgggtca cgggcaaccg acgcgatacc gttgaggggg    207720
     ccggctggga cttcgtcttc gtggccatcg atgaccacgc ccgcgtggcc ttcaccgaca    207780
     tccaccccga cgagcgcttc cccagcgccg tccagttcct caaggacgca gtggcctact    207840
     accagcgcct gggcgtgacc atccagcgct tgctcaccga caatggctcg gcctttcgca    207900
     gccgcgcctt cgccgcgctg tgccatgagc tgggcatcaa gcaccgcttt acccgacctt    207960
     accgcccaca gaccaatggc aaggccgaac gcttcatcca gtcggccttg cgtgagtggg    208020
     cttacgctca cacctaccag aactcccaac accgagccga tgccatgaaa tcctggctac    208080
     accactacaa ctggcatcga ccccaccaag gcatcgggcg cgctgtaccc atctccagac    208140
     tcaacctgga cgaatacaac ctattgacag ttcacagcta gctggcgtgc gcttcggcgt    208200
     ggtagcgccc cacgcgctcc acctcgttct tcgaacccag gatcacggac acgcgctggt    208260
     gcagcttgtc gggctggata tccaggatgc gccccgtgcc gtcgatggcc gcgccgccgg    208320
     cctgctcgac gatcaggccc atcgggttgg cttcgtacat caggcgcagc ttgccggcct    208380
     tgcccggctc gcgggcatcc cagggataca tgaaaatgcc gccgcgggtc aggatgcgat    208440
     gcacgtcggc caccatggag gcgatccagc gcatgttgta gtccttgccc agcgggcccg    208500
     tcttgccggc caggcattca tcgatgtagc gcttgaccgg cggggcccag tggcgcatgt    208560
     tggacatgtt gatggcgaat tccttggtgt cctcggggat gcgcatcgat tcgtgcgtca    208620
     gcacccacga acccatctcg cgatccagcg tgaaccccac cacgccattg ccgatggtca    208680
     gcaccagcat ggtctgcgga ccgtagacgg cgtagccggc cgccacctgc tggctgcccg    208740
     gctgcaggaa gtcctgctcg cagacgtcgg cgccggccac cctgtgcggc gcgcgcagca    208800
     ccgagaaaat ggtgccgatc gacacgttga cgtcgatgtt ggacgagccg tccagcggat    208860
     cgaacagcag caggtactcg cccttgggat aacggttggg gatcagatgg atggtttcca    208920
     tttcctcgga cgccatcgcg gccaggtggc cgccccactc gttggcttcg agcaggattt    208980
     cgttggacag cacgtccagc ttcttctgca cttcgccctg cacgttctcg ctttccaggc    209040
     tgccgagcac gccgcccagc gcgcctttgc tgacagcgtg gctgatggcc ttgcaggcgc    209100
     gcgccaccac ttcgatcagc aggcgcactt ccgggccgag cgcctgggcc gagcgctgct    209160
     gctcgaccag atattgggta agggttttac gtttcaagag tagctcctaa gcagccagat    209220
     ccaaggcttt cgatacgatt tcctgtacgt tgcgcgacag cccggcatgc gcgcgcacat    209280
     gcgccagcgc ggcctgcatg gcgccgcgca gcggctcggc aaagcgcgcc caattatcca    209340
     ggccgcgcgc caggcgggcg gcgatctccg gattgagcgc gtccagggcg agcacctgct    209400
     cggcccagaa gtcatagccg cggccgtctg cgcgatgcat gccgcgggcg ttgttcaggc    209460
     agaactggaa caccagcgcg cgggcgcggt tgggattgcg cagcgtaaag gccgggtgcg    209520
     ccatgagggc gcgtaccgcg tcgatgtcgg tcgagcgcgc ggtggcctgc agcgtgaacc    209580
     atttgtcgac gaccagcggg tcgtcgcgcc agcgttcgta gaacgccgcc agcgccgccg    209640
     cggcgctgtc cggagcgccg aaattcacca gcgccgacag agccgccatg ctgtcggtca    209700
     tgttgtcggc ctggtcgtac tgggcctgcg ccagggcttg cgcgtccgcg ctttcggcgg    209760
     ccatcagatg gctcagcgcc tggttcttca gcgcgcgccg gccagccggg ccggccgccg    209820
     ggctgtaggc gcccggcgtc tggttggcgt cgaacgccgc gcgccagggg gcggccagtt    209880
     ggcggcccac ctcggcgcgc aggaaatcgc gcgccacggc cagggcgggc gggtcgatct    209940
     gctccatgcg ctcggccagg gttttttccg agggcaacgc cagggcgcgg gcccgatagg    210000
     ccgcgtccag cgtcgggtcg gtcagcaggg cgcgccaggc cgcgatgaag gccgggcgca    210060
     cggccagcgg ctggccggcc tgatggctgg ccgtcagcgc gaggatctcg cgcgtggcca    210120
     gttcctggcc tgcttcccag cgggcgaatg gatccgtgtc gtgcgccgac agcagcgcca    210180
     ggtcggcgtc gctccagtcg tattcgacga tgaccggcgc cgagaagccg cgcagcagcg    210240
     acggcaccgg catgtccggc acctgctcga acgtccagct ggcgcgcgcc tcggtcagtt    210300
     cgagcagcac ggtgtcgcgc gccggctggc cgttcaggtg cagcggcagc gcgcggccct    210360
     gcgcgtcgag caggccgatc gcgaaaggaa tgtggaatgc ctgtttggcg aagtcgcgtc    210420
     cggcgcgttt ctccacgccg accggggcgc agcgctgggt cagcgtgacg gtgcaacggc    210480
     cgctttgcgc gtcgtgatcc agcttgacgc tgacgcgcgg cgtgcccgcc tggctgtacc    210540
     agcggcgaaa caccgacagg tcgcggcccg gattgcgcgc ggcgtagacc gattccatgg    210600
     cggcgacgaa atcgtcgcag gtcacggcct gtccgtcgtg gcgccggaag tactcgtcca    210660
     tgccggcgcg gaatcccggc tcgcccagca gggtgtgctg catgcggatc acttcggcgc    210720
     ctttctcgta cacggtggcg gtatagaagt tgccgatctc ctggtagctg tcgggccgga    210780
     tggggtgggc catcgggccg gcatcctcgg ggaactgggc cgcgcgcagc gtgacgacat    210840
     cgtcgatgcg cttgaccgcg cgcgcgctcg cggcggcttg ctcgtccagg ccgcgcgcca    210900
     tcatgtcggc gctgaattcc tggtcgcgga ataccgtcag gccttccttg aggctcaact    210960
     gaaaccagtc gcggcaggtg acgcggttgc cggtccagtt gtggaagtat tcgtggccga    211020
     tgacggattc gatgccttcg tagttggcgt cggtggcggt ggccgggtcg gccagcacat    211080
     aggccgcgtt gaagatgttc aagcccttgt tttccatcgc gcccatgttg aagtcgcgta    211140
     ccgcgaccac catgaagcgg tccaggtcca gctccaggcc gaagcgcgac tcgtcccagc    211200
     gcagcgcgtg gcgcaaggat tccagcgccc attcggtgcg gttctccgaa ccgggatcgc    211260
     tgtagacctg cagcagcaca tcgcggcccg attgggtgcg cacgcgctct tcgcgatgcg    211320
     tcaggcggcc ggccaccagc gcgaacagat agctgggctt gggaaacgga tcttcccatt    211380
     ccgcctgcag gcggccatcg ggcagggtag cggtggccag cagattgcca ttggacaaca    211440
     gcaccggata atcgggcgcc gcgcgcagcg tcacgcgata acgcgacatg acgtcgggcc    211500
     ggtcggcgaa ccaggcaatg cggcgaaagc cctcggcctc gcactgggtg aagaaattgc    211560
     cgccggagac atacagcccc atcagggtgg aattggcggc gggcctgcaa cggctgacaa    211620
     tttcgaccgc cgcgctgggc ggcaggccgc gcaaggtcag ggtggcgtcg tccaggacat    211680
     agccgtcacg cgcccagtcg cggccgtcga cacgaatgga aaccagctcg agcgcttcgc    211740
     cgtccagcac cagcggcgca tcgtcccggg catcggcctt gcgcgccacc tgcatgaggc    211800
     agcgcacggt ggtcgaggcg ggatccaggt cgaattccag cgccacgtcg gcgatggtat    211860
     acggataggg ctgataatcc ttgcggtata cggtgacggg cgtgtctgtg cgcatggcct    211920
     acgaaacaga tgatggacaa tgcgggtatt gtagatgcag cgccgcatgc ccccgcattg    211980
     ctcaggtacc caaatgaaac cttcgcccgg cgcggcggtc gaaggaatat ccggtttgcg    212040
     tccggcctgg agggccgcag tcatgttcag tattcatgcg tattcgcgcc tggcgcggct    212100
     ggccgggctg gccgggctgg ccgggctggc ggccctgctg gcgggcgcgg cgctggtggc    212160
     cgggtgcgcc gcgcccagcg tgtcggcgcg cgtcacctcg ttccagcaat ggccggacgg    212220
     cgttgccgga cagacctacc agttcgcgcc tgaaagcggg cagctcaaca atctcgaata    212280
     tcagtcctat caggacatgg tgcgcgccgg tatcggcgcc accggcctgg ttgaggcgcg    212340
     cgagggccgg aaagcgcggt ttacggtgtc cttccgttat ggctccgcgc agacccaggt    212400
     tatggtgcgg cgcgcctatg atccctattt ctacggcggt tatggcggtt attacgggcc    212460
     gcgctggtgg ggcggtggag tcgggtattg ggggccggaa tgggtcgacg tgcccaccgt    212520
     ggcgtatcgc aatagcctga gcctggaaat ccgcgatacc gcgcgcggcg gcgccgaagt    212580
     ctatcgatcg accgcgtaca ttaccagcgg gcgcgacgac ctgctgggcg ccatgccgta    212640
     tctggtgcag gcaatattcg acaatttccc gggcaataat ggctcggaac gcgagatcga    212700
     gtatccgctg gcccgctagg tgtgaagatt caataggttg tatgcatggt tcatccgaac    212760
     cggatttgag aaactggaaa tcgccacccc cccagttcac tcaaggagcc cggccggatg    212820
     aacacccata agcatgcccg attgaccttc ctacgtcgac tcgaaatggt ccagcaattg    212880
     atcgcccatc aagtttgtgt gcctgaagcg gcccgcgcct atggggtcac cgcgccgact    212940
     gtgcgcaaat ggctgggccg cttcctggct cagggccagg cgggcttggc cgatgcgtcc    213000
     tcgcgcccga cggtctcgcc ccgagcgatt gcgccggcca aggcgctggc tatcgtggag    213060
     ctgcgccgca agcggctgac ccaagcgcgc atcgcccagg cgctgggcgt gtcagccagc    213120
     accgtcagcc gcgtcctggc ccgcgccggt ctgtcgcacc tggccgacct ggagccggcc    213180
     gagccggtgg tgcgctacga gcatcaggcc cccggcgatc tgctgcacat cgacatcaag    213240
     aagctgggac gtatccagcg ccctggccac cgggtcacgg gcaaccgacg cgataccgtt    213300
     gagggggccg gctgggactt cgtcttcgtg gccatcgatg accacgcccg cgtggccttc    213360
     accgacatcc cccccgacga gcgcttcccc agcgccgtcc agttcctcaa ggacgcagtg    213420
     gcctactacc agcgcctggg cgtgaccatc cagcgcttgc tcaccgacaa tggctcggcc    213480
     tttcgcagcc gcgccttcgc cgcgctgtgc catgagctgg gcatcaagca ccgctttacc    213540
     cgaccttacc gcccacagac caatggcaag gccgaacgct tcatccagtc ggccttgcgt    213600
     gagtgggctt acgctcacac ctaccagaac tcccaacacc gagccgatgc catgaaatcc    213660
     tggctacacc actacaactg gcatcgaccc caccaaggca tcgggcgcgc tgtacccatc    213720
     tccagactca acctggacga atacaaccta ttgacagttc acagctagct ggccgccgcg    213780
     ccgcccagct cccattgcga caggccgcgc gtcagctcca gcgcctggcg ttcgaacagg    213840
     cgccggtaca cgccgccgtg caggcggatc agcgcttcgt ggctgccttc ctcgatgacg    213900
     cggccccggt ccatgaccag caggcgatcc agcgcgcgga cggtggacag gcggtgcgcc    213960
     accaccagcg tggtgcggcc ctccatcagg cgctccatgg cccgctggat gagcacctcg    214020
     ctttcgctgt ccaggctgga ggtggcttcg tccaggatga ggatgggcgc atcggccagg    214080
     aaggcgcgcg cgatcgccac gcgctggcgt tccccgcccg acagcttgac gccgcgctcg    214140
     cccaccagcg tgtcgtagcc cttgggcagc gccatgatga agtcgtgcgc gctggccagc    214200
     cgggcggcgc gctcgatctc ggcctgcgtg gccccgggcc gcccgtaggc gatgttctcg    214260
     gccagcgagc ggtggaacag caccgggtcc tgctgcacga tggcgatctg gctgcgcagc    214320
     gacgcctgcc gcaccgcggc gatgtcctgc ccatcgatgg tgatgcgtcc gccgtccacg    214380
     tcgtacaggc gctggatcag cttgatgaac gtggtcttgc ccgagccgga gtggccgacc    214440
     aggccgaccc gttcgcccgg cgcgatgcgc accgagaagt cgcggtacag cggctgctcg    214500
     tgcgggccat agcggaacgt gacgttctcg aagcggatct cgcccgcgcc gatgtcgatc    214560
     ggcccggcgc cgggcaggtc ctcgacatcc agcggctggc gctgcagcga gaccagctcc    214620
     tccatgtcgt tgatcgagcg ctgcaggttg cggatgttca tgcccacgtc gcgcaggtag    214680
     ccctgcagca tgaagaaggt cgtgaaggcg aaggtcacgt cgcccacgct ggcctggccg    214740
     cgctgccaca gcagcagcgc cacgccgagg atggccgcct gcatggccac cagcatcgcg    214800
     ccctgcacgc cgccgttgat ggttccgcgc acccacccgc gccgggtgcg gtggcgccat    214860
     ttgtcggtga cgcgggccag ccgggcttcc tcgcgccatt cggcgccgaa ggccttgacc    214920
     acggcgttgc agctcaccgc gtcggccagc gcgccgccca tgcgggtgtc ccaggcgttg    214980
     cccaggcgcg ccgcgggcgc cacgtagtcc agcgacagcg ccatcgttac cgccacgtac    215040
     agcagcgagc ccagtccgac caccagcccc atgaggggcc agtgccagcc cagcagagcg    215100
     gtggcgccgg ccagcatggc cagcgagggc agcagggcga tcagcagcgt gtcgttgagc    215160
     aggtcgagcg cccacatgcc gcgcgtgatc ttgcgcacgg tcgagccggc gaaggtgttg    215220
     gcgtgccagt cggacgacag ccgctgcacc tggtggaacg ccaggccgac gatgtcgtgc    215280
     atcatcttca gcgtcagcgc gatgatgttc atgaagatgg cctggcgcag caaggtggcg    215340
     cccacgccca gcgcgatcag cagccagaag gcgccgagcg cggcgttgcg cgccaccgtg    215400
     tcggcgggcg cgccgccggc cacggcgtcg atcagccggc cgacgtacag gggcgtgaga    215460
     atgtcggcca gcgccgagag cagcgccagc atggcgatga ggccgatgcg ccagggttgc    215520
     ctggcccagt gcctgaaagt aaagccgaga acggccttga acgcggatcc gcgcaagtcg    215580
     agtttattgc gagccatttg ccagggtccg gccacgcggc gcgcgccagg acgtcagtag    215640
     aaagtgaatg ccagccagcg cgggccgccc atggggggcc ggcaggctac ggattgcgta    215700
     ggggagggcg cgtgggccgc gatgcggccc ggcgcgggct gcgacctaac ggcgcggcgg    215760
     ggtcacgcgc ggagtggcga tgtgcggtac gagcatgggg cgcctccggg tgagtgatcg    215820
     tggatgggaa cgagggcccg tgagcagggc ccgaagtgcg atcctagcag cgggtccgga    215880
     ccgcgcgcaa gattcgccgc cgccggcgtt gcgtaatcga cacggaaggc gcgtgccggg    215940
     ccgggcgcgc cgggtctcta caatatgtcc cgacatgatc gatggaggat gaggcatgga    216000
     cgcggatttc tggctggatc gttggcgcga agggcgcacg cattttcacc agacgcgggt    216060
     gacgccgctg ctgcaaaaat actggccgac gctggacgtg ccggccggcg gccaggtgct    216120
     ggttccgctg gcgggcaagt cgctcgacat ggtgtggctg gccgggcagg gactgcgcgt    216180
     gctgggcgtg gagctgtcgc aactggcggt cgagcagttc ttcgacgaga acgacctgcg    216240
     ccccgagatc caccaatctg cgcagggccg ccactatgtg gcgggcaacc tcgaactgat    216300
     ctgcggcgac gtgttcgcgc tggaagacgc cacgctggcc gcctgcgccg gcgtgtacga    216360
     ccgcgccgcg ctggtggcgc tgcccgagcc catgcgcaag cgctacgcgc gcgaggtcta    216420
     tggccgcctg ggccggggct gccggggcat cctcatcacg ctggactatc cgcaggacca    216480
     gatggaaggt ccgccctttt ccgtggacga cgccgaagtg caggcgctgt atgccggcca    216540
     taccgaagcc cgcctgatcg accggcgcga catcctcgac aaggagccca agttcaacca    216600
     gcgcggcgtg gcgcggctgg acacgctggt ataccggctc gaacgcctgg gctgagcgcg    216660
     gcgatgctgc gccttgttac cgacatccat gcctggtagc gatgggcgag cctacacttg    216720
     cgccgtctcc aacaacagga atatgggcat gaaatcgata ctcgggctgt tgcttgccgc    216780
     ggcgctgctg ggcggctgtg ccgtctatac cccgcacggc gcggccgtgg tggatccgcc    216840
     cgaccgcggc ggcggcttct gtccgcccgg ccaggccaag aagggcaact gctgactgcg    216900
     cacggctgag cgcggcgcgc cgcatgcgcg gcgccgaaat cgctacactg gacgtacggg    216960
     cgcgcgccgg cgcatcggcc gcgcagcgcc caaggaggcg atcatgaaat tctgcatggc    217020
     gacattgatg ctggcggcca gcctggcgct ggccggctgc gcgggcgggc aaggctcgca    217080
     gcccggcccg ccgcatcccg gcgcggtcaa cccctacagc agcggcggtt tccacgacgc    217140
     cggcccggac taccccgata ccggccgttg aaccgcgcgg ccttatttgc tgcgcacgta    217200
     gttgcgtatt tcacgtgcga cgttatcggt ccattcgtcg atcagcggct tgagcgccga    217260
     ggccggcacc gaggcctggc cctgggcgat ggcgcgtacg cgctcgccgg tgcccccgcg    217320
     caccgacgcc cacagcagct ggcccgtctg gctgtcggtg accttgcttt cgatcgcgat    217380
     ggtggcctgc tgcggccggc cgccttccag cacggccctg gcgccggtga cggccagcgc    217440
     cacggggatg tactggtagg ccgccagcgc ctcgctttcg ctgccgaccg ctgtgatcgc    217500
     gatgcgcgcc ttggccacgc ccgggccggg gccgttgacc aggcggatct cgcggccgat    217560
     cttgcggcgc agcgactggt ccaggtagtt ctgcagttcg gtcagcgttt ccatcgacac    217620
     ctgcgccgac ggttgcgggc tggggtagta ctcgaccggc gacagccaca tggcggtgta    217680
     ctggcgcggc ttgagcgcgg cgtcgcggta gatcagccgc gcgccgccgg gcacctgctc    217740
     ctcgcgcaac tgcgagtaat cgccgaggaa gcccgactcc ttcggagcgc gctggttggc    217800
     gcagccggcc agcaacaggg cagcggcgct gagcgctgcg attcgataca gggacgactt    217860
     catagcgggt ttccctacaa aagagacgtt ggcccaggag acgggtggcc cagcatacgc    217920
     ggcgcggcac ccccctgcaa cgcgggcacg cgcgcaacgg cgccgctcat ccgtcgggac    217980
     ggctgccgat ggccgatccc ggccaggccc ggcgccggga ttcgcggcat gatctggtaa    218040
     aataataaag atttcgtaac aaattggcaa ttttcggcgc tgcccggcgc cccgccagct    218100
     tcccggctgc gtgccggcag tcctgccttg ccccgacatt ccttatgccc gatgctcacg    218160
     acccgtacct ggtaagcggc aggttcgaaa tcgccaacct gctgcagacg ctccaggccc    218220
     gccagtgcct gctgctcatg cgcatcccgg gccgcccctt caacagcgtg acctccgtgc    218280
     tgcacgtgga tgcgcaggcg ggccaggtcg tgctggacgc ggcccaggac gacaccctca    218340
     atcagcgcct ggccgatgtc ggcgatgtgg ctttcgacac ctcgctggac aacatcagca    218400
     tttcgtttgc cgccgcgcgc gtggcgcgct gcgagttcga ggcgcggccg gccctgctgg    218460
     tcgatctgcc cgaaaccctg accagggtgc agcggcgcga tacgttccgc atcgccgtgc    218520
     cggtggcgca gcccgcgacc tgggtgcgcg aggcgggcgg ggccgagccg ctggcgctgt    218580
     gcgacatcag cccgggcgga ctggcgctgg ccgatccgct gcagacgctg gacccggcgc    218640
     caggcaagat ctaccgcggc gtgctggcct tgccggagct gggcgcgttc gccgcggcga    218700
     tccgcgtggt ccatcacctg gacgaggtcc tggccaaggg caagaccagc cggcgcatcg    218760
     gctgcgcgtt cgtcgagctc gacaagggca cgggcatccg catccaggcc tacgtcaacg    218820
     ccttgcagcg cgaccagatc gcgcgccagc gcggcctgta gcccgccgcg cccgctcagg    218880
     gcaccagcga caggccgatg cggaactgcg agtcgtggcg ctggttgtag cccagcagcg    218940
     tctcgccgta gccgttgaag tactgcaggt gcaggtagcc gttcatgtcc agccaggtcc    219000
     gcttcagcgg ccaggcgaag tccagctggg tggtgcgccg gctgctggcg ccctggcggt    219060
     acatggccga caccaccgcg ccgccgtcct gcgcccagcg caggttccag tccacatagc    219120
     cggcatagtc ggcgtagtcg aggttttcgc gcgccacgcc gaagtaggtc ttgaccttgg    219180
     gcgcgaaggt cagcgtgctg ccgctgtcga agcggtagtt cagcgccggc tgcacgtagg    219240
     cgtcgttgag cgagcgcgag tcgttgccgc tcttgccgtt ggactggtgt tcgacgccgg    219300
     tgttcaggcc gacgcgccag ttctggctgg ctgacgacca gatattgtcc gatagccaga    219360
     atgcgctggg gttgaaggtg gtgtcgatga agggcttgga gtcgccttcc aggtcccaca    219420
     gcgaagtctg ggtgtagccg aggtagaagt tctcgccgaa ggtggccgga cggtcgccct    219480
     tgggcgagaa cagccggtat ttggcgctga tctggaagcg cgcggtggtc tgctcgcgcg    219540
     tgccgatgtc gaagtacatc ggctggtatt cgctgatggc gctgcggaac acatcgaacg    219600
     cgctggccgg ctggaaggtc tggctgacgg ccacctgcgc cggcgccggg ccggagtcgg    219660
     gcgagacgcc ggccgccgtc acggccgccg gcggcagggg ctgcccggtg cgcgcatcgg    219720
     tcaccggcac atcggccggc gtgctggcca gcgtatcctg ctcgcggccg gtagcgtcca    219780
     gcgccagcat ggtggactcg ccctcgatcg acaccgcctg caggccgcgc gcgtgcaccg    219840
     gcaccacggc gtcccagctc atgcgggcga aattgttgac ggggatgttc agcgccgcct    219900
     cgcccgcggg gcgctgcgcc aggctgcgta tggtctggtc gtcggcgccg cgccactgca    219960
     ataccagctg ctgcggcgcg ttccacgccg cgctggccga accatcgttg aagaacacgg    220020
     cctccaggcg caccgtctcg cccggcgccg ccgcggggcg gtcgagccgg taggaaatgc    220080
     cagcgagagc ggggagcgac attcccgcca gcgccagcgc gagcgcgcca gccagggcgg    220140
     ggcgaatgaa cggggatcgg gggtccggca cttgcatagg aaacgaccag ctatggtgac    220200
     ggcgaactgt agcattcgac gctgtagccg ttgaaacgcc atgtaaggca ggcttgcatg    220260
     ccgctggcga aaaggccgag ccgccgcggg caggcggcgg gctacaagcg gttactcgcc    220320
     gaaccggatg ccttgcgcca ggggcagcgc gcgcgagtaa ttgacggtgt tggtggcgcg    220380
     ccgcatatag tgcttccagg cgtccgagcc ggactcgcgg ccgccgccgg tttccttctc    220440
     gccgccgatc tccgcgcccg aggtgccgat gttcacgttg gcgatgccgc agtccgaccc    220500
     ggcggacgac aggaacgcct cggcttcgcg caggtcgttg gtgaagatgg cggacgacag    220560
     gccttgcggc acgccgttgt gcatggccag cgccgccggg aggtcgccgt agcgcatgac    220620
     atacaggatg ggggcgaagg tctcgtggca gaccacgtcg gtctggcccg gcatttcgac    220680
     gatggccggg cgcacgtacc aggcgtcggg ataccgctcg gccagcaggc gctcgccgcc    220740
     gctgacctgg ccgccctgtt cgcgcgcggc cgtcagcgcg gcctgcatgg cgtcgtacgc    220800
     agcgcggtcg atcagcggcc cgaccagggt gccgggttgc agcgggtcgc ccaccgtcgc    220860
     gctggcgtag gcctgcttca ggcgcgcgac cagggtatcg gcgatatcgg tgtgcgcgat    220920
     caggcggcgc gtggtggtgc agcgctggcc ggccgtgccg atggcgccga acacgatgcc    220980
     gcgcgtggcc atctccaggt cggcgctggg cgccacgatg atggcgttgt tgccgcccag    221040
     ctccagcagg acgcggccga agcgctgcgc cacgcgcggg cccacctgcc ggcccatgcg    221100
     ggtcgagccg gtggccgaga ccagcgccac gtcatgcgaa tcgaccagcg cctagccaag    221160
     ctggcgcccg cctatcagta cttcggccag cccggccggc gcctcgccgt agtcctgcag    221220
     ggcgcgcgcc agcagcgcct ggcaggccag cgcggtcagc ggcgtttttt cggaaggctt    221280
     ccagaccacg gcattgccgc acaccagcgc cagcgcggcg ttccaggacc agaccccgcg    221340
     accgggaagt tgaacgcgct gatcacgccg accacgccca gcggatgcca ggtttccatc    221400
     atgcggtggc cggggcgctc ggacgcgatg gtcagcccgt acaactggcg cgacaggccg    221460
     acggcgaaat cgcagatatc gatcatttcc tgcacttcgc cggcgccttc ggcgaggatc    221520
     ttgccggcct ccagcgagac cagccggccc agcgcctcct tgtgctcgcg cagcacgtcg    221580
     ccgaaccggc gcaccagctc gccgcgccgc ggcgcgggca cgtcgcgcca ttgctggctg    221640
     gcctggcgcg cgcgggtgat cgcggcatgc gcctgcgcca cgctgtgctc gggaacgcgg    221700
     gccagcagcg cgccgtcgat ggggctgcgg gcctgcaggc tgccctgggc cagggcggcg    221760
     gggtccagcc ccagcttgcg caagagatcg gaaggcgtat ccatgattgc tcctgtaagc    221820
     gtggcaacgg cggctttgaa gccggaaaaa cagacactgt actacgtcgc cggcatgccg    221880
     tgggcatcga tcggcggggg cgattgggcc ggcctgcgcc ttccggggta aaatgcgcgc    221940
     ccggccatgc gcccgccggc atcgccgcgc cgcgcgcatt ccgtaccgcc cttagctcag    222000
     ttggatagag cacaggtctt ctaaacctgg ggtcacaagt tcgaatcttg tagggcgggc    222060
     cacagctttc ccgcgcattg cggccagacc ggaaatccca tgcagatcac tgatttgcat    222120
     gggatttttt tcgcttcggc gccgcggtcg ccctgggttg ccctctctgg agataataat    222180
     ggttacttcg ggttttattt aatggcatat tgacgccagt ccttcaggct tgccggaggg    222240
     gccggagggc tgcgccgggg ctacccgcgg cggtccgctt ccccgatcca atcgccgtgc    222300
     ggcggcgcgc agtcctgccg catggctcca gcgagggtgt gcaagatggg aaatggtgct    222360
     cgacgcttgc ggggctggcc ggtgcgcctg ctcatcgcgg gcctggccgt cgccgcgatt    222420
     ttcctggtcg cggccgtcct gatcgcgctg agctggatga actcgcgcaa cctgctgctc    222480
     gacgcggccg cgcgcaccgc caacgatgcg gcgcagatca ccttcgagca cacgcgccgg    222540
     atgatcgagc cggcctcggc caccttgcgc accctgtcgt tcgatcccat cgtgagcgcg    222600
     ccgcgcctgc aggaccgcct ggagcgcatg cggctgctgg ccgaagagct ggctgccaat    222660
     cccttgattt ccgcgctgta cgtcggttat gacaacgggg atttcctgct ggcccgcatg    222720
     ctcgacgacc cgggcatccg ccagcatttc ggcgcgcccg ggcaggcccg cttcctggtg    222780
     cagacggtca cccgcgcggc cgacggcacg gccgagggag atttcctgtt ctacgacggc    222840
     gggctgagcc cgattacgcg ccgcagcgag gccgattacc ggtacgaccc gcgcgagcgg    222900
     ccctggtatg cgaacgccgg cgagggcgcg gccttgacca tctccgcgcc ctatgtgttt    222960
     ttctcgaccc gccaggtggg cgtcagcctg tcgcggcggg ccgagggcgg caaggccatc    223020
     gtgggcctgg acatcgtgct ggacgacctg ggcaggatgc tggacgaact gcgcatcacg    223080
     ccgagcgccg agcttgcgct ggtcgacggc agcggcgcgg tggtcgccta ccgcgacccg    223140
     cgggtcctca cggccagggc cctggccgcg ggagatacgc acctgcggcc gctggacgac    223200
     ctgggggtcg agcccttgtc ggatctgcgc cggatcgccc gcgacggccg acccgtctcg    223260
     tatgacgtcg caggacatga gtggctgggg gtcatgctgc ctttcgacgg cttcgacaat    223320
     gtggacatcc gcctgctgtt gacggcgccc gccgacgaac tgctgggcga cctgcagcac    223380
     gaccgccagc gcatggtcct gatcaccggc ggcctgatcc tgctgttcct gggcctgggg    223440
     tggtggggcg gcagccgcat cgggcgggcg ctggagcgca ccaccgcgca ggccaagcgc    223500
     atgtccgcct tcgatttcag ccggccgccg gatgcgccgg catggctgcg tgagaccagg    223560
     gaactcaatg gcgtcatgga caacgtcagc aacacggtcg aggccttcct ggcgatcagc    223620
     gacgtgctcg gcgccgagcc ccgcatcgaa accatgctgg cgcaggtgct ggagaagttc    223680
     gtccatgcca cgcgttgccg cagcggcgcc atctacctgc tgcagaagga ctcgcaaacc    223740
     atggcccggg cggccgttgc cggcgatgcg cacggcctgg aggaatcgct gccgtgcgcc    223800
     ggcggcggcg atgcggcgcc cgcggcaggc gccgcggacg gcctgcagcg cgtccagttc    223860
     gagctgcgca gccgcgccgg tcgggtggag ggcctgctgg tgctgcgcca cgcccaggac    223920
     caggaccacg ccgcgccggg gttccaggcc tttgcgtttc gcctgaccgg catgttgagc    223980
     gcggcgatcg agacgcggca gttgatcgag tcgcagaagc agttgttcga cgcggtgatc    224040
     cgggtgctcg ccgatgcgat cgacgccaag agcccctata ccggcggcca ctgcgagcgg    224100
     gtgcccgcgc tggcgatcat gatgaccgac cgcatgtgcg ccgataccag cggcccctac    224160
     gccgacttca cgttcaccga ggacgagcgc tacgcgttct acctggccgc ctggctgcac    224220
     gattgcggca agatcaccag cgccgagcac atcgtggaca aggccaccaa gctggaggtc    224280
     atctacaacc gcatccatga aatccgcatg cgtttcgagg tgctgtggcg cgacgcggag    224340
     atcgcgcacc tgcgcgcgtg cctggacggg cagccggccg cggccagcgc ccaggcgcgc    224400
     gacgaacggc aggcgcaact gcaggacgac ttccggttcg tcgccgaatg caacctgggc    224460
     ggcgagtttc tcgccgacga ggcgatcgag cgcctgcgcc ggctggggca ggcaacctgg    224520
     ctgcgccatt tcgacgatgg cctgggcctg gccgcggccg agcggcgccg cctcgagggc    224580
     agccgcgccg gcgcgccggc gcgccggcgc tgccggccat cgaaccgctg ctggccgaca    224640
     agccgcagca ccgggtggag tggggcgaca acaagcccgc cgtcgagcgc gacgatccgc    224700
     gcaacgcgct gggcttcgac atgaagctgc cggcgtaccg gcaggacatg ggcgaactgc    224760
     acaacctgag catcaggcgc ggcaccctga ccgacgagga ccgcttcgcg atcaacgacc    224820
     acatcgtgca gaccctgatc atgctcaagc agctgccgtg gccgcgccac ctggagcggg    224880
     tgccggacat cgccgcgaac catcacgaaa aaatggacgg cacgggctat ccgcgccgcc    224940
     tgccgggcga ggcgctgcac ctgaccgagc gggtgatggc ggtggccgac gtgttcgagg    225000
     cgttgacggc cgcggaccgt ccctacaagc tgcccaaaac gctgtccgaa tccctgcgca    225060
     tcatggcggt catgtgcaag gagcggcacc tcgacaccga gctctatctg tatttcctgc    225120
     gcagccgcat ctggctggct tacgcgcagc agcacatgaa cccgtcgcag atcgacgacg    225180
     tggacatcga agcgctggcg cgcatcgccc agggctgacc cgcctctttc atcccctgtc    225240
     ctgaagccgg ccatccggcc gccgcggcgc aagccgcggg cggccggatg gccgcgccca    225300
     ttccgttctc ctccccctgc gcaagtctcg cgccgctggc gatgcgggaa aacacctagt    225360
     catcttagtt agatatctat cttgtacaac ttatatatag aagtttagaa ttcatcgaaa    225420
     cacactaaca acggagacgt cgtgaacatc acgcaagaaa tcgccaagcg ggtcgtgcag    225480
     acttcgatcc gggatctgcc ggccgatgca gtgggttact ccgaaacctt ggccatgagc    225540
     gcgctgggcg cgatggccgc cggccaccgc agcgcgggcg gccgggaaat cgtcgattac    225600
     gtcaaaagcg ccggcggcgc cgcccaggcc acggtgctcg gccacggcct gaagaccagc    225660
     atggaaatgg ccgggctggc caacggcacc ttcgcgcacg cgaccgaata cgaggacgac    225720
     agcttccccg aggcggtgtc cagctacacg ctgttcccgg ccatcttcgc cgtggccgag    225780
     cacgcccagg caagcggcgc ccgcgtggtg gaggccttcg ccgccggcta cgaagcgcag    225840
     gcgcgcatcg gcctggcgtg ccgccaggcg cgccgcaacg gcttcatggt gctgagcctg    225900
     gccgggtcga tcggctgcgc cgcgtcggcc gccaagctgc tgggcctgga cgagcgccag    225960
     accaccatgg cgctcagcct tgcggcctcg caaggggcgg gtatcggcta ccagaccggc    226020
     tcgatggcgc acatcgtgga aatggggttc gcggcccgca acggcatcgc cgccgccctg    226080
     atggcggccc agggcatgac cgggcagccg gacgtgctgg aggcgccgcg cgggctcatg    226140
     aacatgatca ccggcgacca ggtcgaagcg ccggccgcca tcatcgagca ctggggcagg    226200
     ccgtaccgcc tgatggaaat cggcatcaag tcctatccct gctgctatca cctgcagcgc    226260
     atcatcgaaa ccaccgtgga cctgcgccac gccgaaggcc tggccgccgc cgacatcgag    226320
     gagatttcgg tggaggtcaa cgcgttcttc cccaccgtcg tccagcacat ggaaccgcac    226380
     gacgagatcg aggcgcagtt cagcctgccg cacgtgctgg ccatcgccat gctggaggac    226440
     caggtggtgc cggccggatt ctcccaggcg cgcatcgacg acgcggcgtt ccaggcattc    226500
     cggcgcaagg tcaggcaggt ggtgcgggaa gactggggct ggacccccac gggctggacg    226560
     ccgcggatca cctaccgcct ggccgacggg cgggtgatcg tgcgcgagcc cgagcaggcg    226620
     cgcgggcagc cgccggcgct gctgacgttc gaccagtgcg tgcccaagta cctgggctgc    226680
     gtgcagggca tctaccccga acaacaggtc gagcgctcga tcgcgctgct gcgcgggctg    226740
     gccgggctgg acagcgtcgc cgagctcatg cggtgcctgg ccacgcccgc ctgatccgcc    226800
     gtcttccaat caaagagcaa ggatgcttgt ggtgaaaaca aaattctccg atttgacgca    226860
     cgaagacatt gatcggattc tcgaaatcgt gaaccgggtc gacgacatcg acctgcagat    226920
     ccaggtcgac ggcctgggcc tgcgcgtacg caagggcaat gtcggcgcgc cggtcgcgcc    226980
     gccggccgtg tccgcgccgg ccgccgccga ggcgccggct cccgcgccat ctcccgcgcc    227040
     ggcggcgcag cccgcggccg ccccggcggc cgcgcccgcc gcgcccgccg cggcgcggca    227100
     ggacctgctc agcatcacgg cgcccatgat aggccgcttc tatgccaagc catcgcccaa    227160
     cgatccggcg ttcgtggcgc tgggcagcca ggtcgggccg gacgacagcg tctgcattct    227220
     cgaagtgatg aagctgttca acacggtcaa ggccggcgtg gcgggcgaaa tcgtcgagat    227280
     cctggtgcag gagggcgaca tggtcgaaga gggcgatgtg ctgttccggg tgaagccgca    227340
     atgagccgcc gcataggaat catcgacacg acgctgcgcg acgcccagca atgcctgtgg    227400
     gcgacgcgga tgacggccgg catgatggac ccgatcgccc aggcgctgga cgaggcgggg    227460
     ttcgacatga tcgatttcat ggccccggtg cagttcgatg tgtgcgtgcg ctacctgcgc    227520
     gaggacccgt tcgagaaggc gcgccacttc cgcaagcgct ttcgcaacac gcccatgcgc    227580
     agctattgcc gcagcaagag cctggtcggg ttcagcatgg tgcccgacga catggtcgag    227640
     ctgtggatcg attgcctggc ggccaacggc ttcagcgcgg tcggcacgct cgattcgctg    227700
     ctggacgtcg acaacatgaa ggtcagcgtc cggcgcgcca agaagatcgg catcaagtcg    227760
     atcggcgcgc tggtgttctg cgaaagcccc ctgcataccg acgcgctgta tgccggcacg    227820
     gccgccgagc tggtgcgctg cggcgtggac ggcatcatgc tcaaggactc cggcgccctg    227880
     ctgacgatcg agcgcatccg cacgctcatc ccggcgctgc gcgccgccgt cggcgacatc    227940
     ccgatcgaag tgcacagcca cagcaatacc ggcctggtcc agcgcgtcta cctggacgcg    228000
     gccgacctgg gcatcgacca gctgcatacc tcgatcgcgc cgctggccgg cggcgtggcg    228060
     cagccctcca tacagaacat gacgcgcaac ctcgcgcagc gcggctaccg caccgacgtg    228120
     gacatggcgc gggtcgagga gatcagcgcc tatctgcacc ggctggcggc ccgctacgac    228180
     ttcccgctgg gcaagccgat ggaatacgac gaattccatt atcggcacca gatgccgggc    228240
     ggcatgacgg agaactggcg cttccagttg cgccaggcgg ggctggagaa ccgcttcgag    228300
     gaaatcctcg aagagatcgg ccgcgtgcgc gaggacctgg cctggccgat catggtgacg    228360
     ccgttctcgc agatcatcgg cgtgcaggcc atgctcaacg tggtcaacgg cgagcgctac    228420
     cgcgccgtgc ccgacgaagt gaagatgtac gcgctgggcc acttcggcag gctgctgggg    228480
     ccggtcgagc ccaacgccct ggaccgcatc gtcgccaacg gctcgcccga tgtcggcctg    228540
     acgccgcaac cgaaggatcc cgccttgccg gggctgcgca aggccaatcc cggcatgacc    228600
     gacgaggaac tgctgctgcg ctacatgttc ccggccgacg acgtcgaggc gacgctgggc    228660
     tgcaagccgc tgaagctgac cgttcccgcc ggcgggccga tcgtcaggct gatcgaggaa    228720
     atcctgccgc gcgccggcat acgccatttc gaattgcgca gccagtccga acacatttcg    228780
     ttcacgcgac cctgaaccgg tcccggtttc gttgccacgg agaatccgca tgacacagcc    228840
     cgccgcttct tcccacgccg tcatcgtgat gtacgacgcg cccgccgaac tggacgcctg    228900
     gatgcacggc gaccactacc gcgaggtgct ggccaccccg ggcgtgacgg gcgtgcgccg    228960
     ctacgaggtg ctggacgggc cgcaagcctg ccgcaagtac ctcgccgtga tcgagaccga    229020
     cgacctggac gccacgctgg cgtggcgcga cagcgaagcc ggcgcgcgct cgcagtagga    229080
     cgccaaccag cgcggcgtcg ccaaccgcct cggcctgacc tgcaggcgca tctattgaga    229140
     tgcccgcgac gcgcccaacc cacctgaccc aaggactaca agaatgatca tgcctcccat    229200
     cctcgacatg cggctgcggc cgcccgttcc ggcctggacc aagggttcgt tgttccgcac    229260
     ggccatgcac tatccgcgcc ataacctgac gttcaagggc gcgcgctcgg cctggctcga    229320
     ggacgtcggg ctgctgttcg aggaaatgga ctcggccggc atccgctatg gcgtggccat    229380
     gggccgggct tccagcgggg ccggcaatct gggcggcgtg gccaaccagg acatcgtcga    229440
     cctgctggcc acctaccccg accgctttct cggtttcctg ggcgtggatc tggacaacat    229500
     cgcgggcagc ttggcggaga tccgcgagct ggccggcgct cccggcgtca aggagatttc    229560
     catcgagccc ggctcggccc gggttccgcg ctggtcggac gacaagaccc tggatccggt    229620
     ctacgaactg gcgctggagc tcaagctgcc ggtgtcgatc tcgctgtccg gcctgctgtc    229680
     ggcgctggcc ggccacgaca tcacctggtc cagcccggtg tcgatccagc gggtggccca    229740
     gcgctaccgc gacctgaaga tcgtggtgtc gcacgccgcc tggccctatg ccgacgagat    229800
     ggtcgtggtg gcgctggcct gccccaacat ctacgtatcg ccggacctgt acgcgtcgac    229860
     gcgcggcatg atctgcgccg acagctacgt caagggcgcg aacatgttcc tggaggaccg    229920
     caccctgttc ggcaccgcgt atccggtcaa ggacatccag gattccctgc gcgacttcct    229980
     gcagctgggc tggcgcgagg acatcatcca caaggtgctg tggaccaacg ccgcccgcct    230040
     gctgggcgtg gacaagtaac gcggcggcca ggacggagaa cgacgtgaag aggacagcgc    230100
     tgatcgccgg accgtacggc atcgtgggca acgcgctcgt gcagcatctg gcgcgcgacg    230160
     cggcctggga tgtcgtgacg atttcccggc gccaggaagc cgcgctgcct ggcgtgcggc    230220
     atatcgcggc cgacctgctg gacgcggccc aggccgaggc cgcgctggcc gccttccccg    230280
     gcatcacgca tgtcttctat tgcgcctatg cgccgcgccc caccctgggc gaggaggccg    230340
     cacccaacct ggccatgctg gccaacctgg tgtcggcggt ggacaggcac gcgcgcgggc    230400
     tcgagcgcgt cgtgctggtg cacggaacga aatggtacgg caatcacctg gggccgttcc    230460
     gcaccccggc gcgcgaggac gatgcgcgcc actgcccgcc caatttctat tacgaccagc    230520
     aggactggat cgccgcgcgc cagcgcgagt ccggacgctg gagctggacc gcgttccggc    230580
     cgcacggcat cttcggctat gccctgggca gccccatgaa ccacctcatg gccctgtccc    230640
     tgtatgcctc ggtcatgaag gccgtggcga cgcccttgaa gttccccggc acgccggcgg    230700
     ccttcgcggc gctcaaccag tgcaccgacg cccggctgct ggcgcgcgcc atggcctggt    230760
     cggtggatgt cgcggcctgc gagaacgagg ccttcaattt ccacaacggc gagcccgagc    230820
     gttgggccaa tctctggccg gcggtcgccg aggcgttcgg catgcaggcg gggggcgtgc    230880
     agcagatacg cctggccgcc atgatgccgg ccaacgaggc cgcctggcag gcgatctgcc    230940
     agcggcaggg gctgcgtcat tttcccctgg aggcctatgt caactggtcg tttgccgatt    231000
     gggtctattc caacggcttc gaccaggtct gcagcctgta caagctccgc cgcgcgggat    231060
     ggacggaaat tcttttattt gacgatatgc tcaagtctat gctttcggat ttacggcaac    231120
     ggaagctgct tccagcataa ccaggaccca ccatggctca aatgaaagat aacaacgtct    231180
     cgaatcgcgc gaccctcgtc ctgtatgaga accgctccat cccgctctat cggatgatca    231240
     aggaggagct gatccggttc gtgcagaaga aaggcatcaa atccggcatg gcgctgcccg    231300
     gcgacaacga actggccagc cagttcggcg tcagcgtggg caccgtgcgc cgggccattg    231360
     ccgagctggt ctcggagcgc atcgtcatcc ggcagcaggg gcgcggcacc ttcctggccc    231420
     cctacgacac cagtcgcatg ctcaattcgt tctggcacat cgagcggcgc gatggcgtgg    231480
     tagacgtgcc gctggtgtcg acccacggct tttcccaggc gtcggccacc gaggaggtgg    231540
     cgcagaaact ggcgctgcag ccaggcgacc cggtcttcgt catcaagaac tcgatgacga    231600
     tgcagggcac gccggtgctg ctcgacacga tttatgttcc ggtgcgcacg ttcgagggcc    231660
     tgacccgcga gaagctgagc gcgcgcgacg ccaccatcta tgacttctac cgcgaacagt    231720
     acggcatcaa tatcgtcaag acgatagacc gcgtcagcgc gaccgttgcc gacaaggaca    231780
     cggccaagcg cctgggttgc aagctgggcg cgtccatgct gcgcatcctg cgcgtggcgt    231840
     acagctttgg agatacgccg attgagtatc gctgcagcct gctcgattcg gagaatcacg    231900
     aatacgtcga tgtcaccggc ggagacacca gccgctacgg ttgacatcgg gaacccttca    231960
     ttcaagaggc caatccatga aactgaaaaa ggtattgatt gcgaacaggg gagagatcgc    232020
     cctgcgtatc atccgcgcgt gccgggagat ggacatacgg accgtccagg tctactccag    232080
     cgcggatgag gattcattgc ctgtcaggtt ggccgatgaa gcggccccca tcggcggccc    232140
     cgagccgtcg gcaagctacc tgaacatcgc ggcgctgatc gccgccgcgc gcgagcatgg    232200
     ctgcgacgcc atccatcccg gctacggctt cctgtccgag aacgaagact tcgcccaggc    232260
     ctgcatcgac gccggcatcg tcttcatcgg cccggacccc ggcgcgatcc gcatgatggg    232320
     cgacaaggcg caggcccgca agatcgccaa ggaggcgggt gtgcccatcg taccgggctc    232380
     gcccgagccg gtcagcgacg tcgaggaggc catcagggtg gcccgcgagg tcggctatcc    232440
     gttgctggtc aaggcggcgg cgggcggcgg cgggcgcggc atgcgcgtga tccagggcga    232500
     ggcgcagctg cgcgaggggc tggagcgcgc gtcgatggag gccaagtcgg ccttcggcga    232560
     cggctccgtc tatatcgaac gctatatctc gcccgtgcgc cacgtcgaga tccaggtgtt    232620
     cggcgatggc gaggacgtca tccacctggg cgagcgggaa tgctcgatcc agcgccgcca    232680
     ccagaagctg ctggaggaaa gcccgtcgcc ggtgctgtcc gacgaaacgc ggcagcgcat    232740
     gggcgaggcg gcctgcgcgc tggcgcgcgc ggtcaagtat cgcggcgcgg gcacgctgga    232800
     gttcgtcatg gacggcaaga gcggcgaatt cttcttcatc gaaatgaata cgcgcatcca    232860
     ggtcgagcac cccgtcacgg aaaccgtcac gggcgtggac ctggtcaggc tccagctggc    232920
     ggtggccgcc ggcggcaggc tgggcctgcg ccagcaggac atcgtcatga aggggcacgc    232980
     gatcgaatgc cgcatcaacg cggaggatcc gcagaaggcg ttcatgccca gcccgggcac    233040
     ggtcaacgat atccggctgc cttcggggcc gggcgtgcgc atggattcgc acgtgtaccg    233100
     cggctacaag ctgccgccgt actacgactc gctgctgggc aagctgatcg tctgggacga    233160
     gtcgcgcgag aaagccatcg cccgcatgct gcgcgcgctg ggcgaactgg agatcgtcgg    233220
     cgtgaagacg accaaggaat tccacgaacg gctcatgcga gacgaggatt tcatcgccgg    233280
     caatgtcagc acccagttcg tcaaggaaaa gctgtacgcc gaccacccca tgtgccattt    233340
     gctctgagaa ggtaagcctc acatgtcaca cgaagaactg cttgtcgatt atgccgcccg    233400
     caaggaccat gcgctgggca tgggcggccc ggccaagctg gagaagcgcc gcgccgaagg    233460
     cgtgctgaac gcgcgtgaac ggctcgagct cctgctcgat ccgggcacct tcgaggaaag    233520
     cggcctgttc gcggtgtcgc accgcaagga agtggccgag cgcaccccgg ccgacggcaa    233580
     gatcgccggc tacggcaagg tccaggcgcg caaggtggcg gtggtggcca acgacttcac    233640
     cgtgatgggc gcatccagct cggtggtcaa cggcaagaag atccgccata tgcgcgaagt    233700
     ggccaccaaa aacggtctgc cgctgatctt cctgggcgaa tccaccggcg cgcgcatgcc    233760
     cgaccgcatg ggcgccgagg gccgcgcgat cctggggcag gatccctacg agtaccgccg    233820
     cctgcgcgaa accccctggg tgagcgcgct gctcgggccg tgctacgggt cctccacgtg    233880
     gtacgcctgc ctctcggatt tcgtcgtcat gcgccgcggc gccaccatgg cggtggcgag    233940
     cgggcgggtc acgtccaagg ccatccgcca ggagatcgac tcggaggagc tcggcggctg    234000
     gcgcatgcac acgcagtcca ccggcctggt cgacgcgctg gcggaaaccg acgaggaagc    234060
     gctggagatc gtcaagaagt ggctggccta ttttcccagc aaccagaacg agccgccgcc    234120
     gcgccaggcc gtcacgccgg aaagcgtgcc cgacaccggg gcgatcctgc agcacgtgcc    234180
     gaccgacagc aacaaggtct atgacgtgcg caaggcgatc gactgcatcg tcgaccgcga    234240
     cagcgtgatg gagctcaagg ccaggttcgg ccgttccatc tgcaccatgg tcgcgcgcct    234300
     ggacggccat ccggtcggca tcctggcgag caacccgatg ttcaagggcg gggcgatcga    234360
     cgtggacgcc tgcaataagg ccatctcgtt cctggtgctg tgcgactcgt tcaacatccc    234420
     gctagttgtg aagattcaat aggttgtatg catggttcat ccgaaccgga tttgagaaac    234480
     tggaaatcgc caccccccca gttcactcaa ggagcccggc cggatgaaca cccataagca    234540
     tgcccgattg accttcctac gtcgactcga aatggtccag caattgatcg cccatcaagt    234600
     ttgtgtgcct gaagcggccc gcgcctatgg ggtcaccgcg ccgactgtgc gcaaatggct    234660
     gggccgcttc ctggctcagg gccaggcggg cttggccgat gcgtcctcgc gcccgacggt    234720
     ctcgccccga gcgattgcgc cggccaaggc gctggctatc gtggagctgc gccgcaagcg    234780
     gctgacccaa gcgcgcatcg cccaggcgct gggcgtgtca gccagcaccg tcagccgcgt    234840
     cctggcccgc gccggtctgt cgcacctggc cgacctggag ccggccgagc cggtggtgcg    234900
     ctacgagcat caggcccccg gcgatctgct gcacatcgac atcaagaagc tgggacgtat    234960
     ccagcgccct ggccaccggg tcacgggcaa ccgacgcgat accgttgagg gggccggctg    235020
     ggacttcgtc ttcgtggcca tcgatgacca cgcccgcgtg gccttcaccg acatcccccc    235080
     cgacgagcgc ttccccagcg ccgtccagtt cctcaaggac gcagtggcct actaccagcg    235140
     cctgggcgtg accatccagc gcttgctcac cgacaatggc tcggcctttc gcagccgcgc    235200
     cttcgccgcg ctgtgccatg agctgggcat caagcgccgc tttacccgac cttaccgccc    235260
     acagaccaat ggcaaggccg aacgcttcat ccagtcggcc ttgcgtgagt gggcttacgc    235320
     tcacacctac cagaactccc aacaccgagc cgatgccatg aaatcctggc tacaccacta    235380
     caactggcat cgaccccacc aaggcatcgg gcgcgctgta cccatctcca gactcaacct    235440
     ggacgaatac aacctattga cagttcacag ctagccaacg gctacccacg tgatatcgtt    235500
     cgcgcatcaa ggtaacgtag gcgcaagtgg gtgacgtgat gcagcgaggc gaattggcat    235560
     attggttgaa cgtcgtggtc gagaacggcg agccgggcgc gccgcagata ccagtgccgg    235620
     agcagttcgt gacggcattg accacgctgc gctgcatcga acgcaatgca caaggccaac    235680
     tggttgtaac cgaaaagggg cgcctggcct tgcacatgga ggagcctggg gccctgcatc    235740
     gccaataaca gtttcttttc ccgcgaattg ttgcaggaca cgcatgagtg agatggaact    235800
     tgtgcgtggc agcatagtcc aattaccaga agcgggatta gcaccacccg ccgacgtcgc    235860
     gcgttgcagc cgcacgcgtt ttgcaagtaa cggactggga gggcgccatg cagcatcgtg    235920
     accaggaagt actgatcgac gtttcgacgg ccgccatgga tactggcggg tacggcgtgc    235980
     tgttgacggt gactgccgaa ggcggcaccg aagtcgatgc agcgttttct tatcttggaa    236040
     cctgcgcctc gctggatgag gcgcgcgatc gggcggaggc gttcgcgcag gattggctgc    236100
     gcgagaacat ctaccgctga ccggcgcggg agcgccggca atggcagggc aaaaggcgct    236160
     tgggcggtgg ctgcggcgat ttgggttatc gtcgcggttg cgccacctgg agcgcctttt    236220
     gcatgcgcgt cgtactccca tgtcagccgc ctctttccac actgatctgc ctgctctcgt    236280
     ggcgcagttg cgccagcatt tcaataccgt catcgtgccg ctctggctcg agcgcggctt    236340
     cgacgcaggc ctgggcctgc cttgcgaggc gctcgacgcc catggcgcgc cgctgcccgc    236400
     gcagcgctat cgcgccatgg cgtgcgcgcg ccagctgtat gtgttttccc gtaccgacgg    236460
     cgcggccgcc gcggcgcatg ccgagcggct gttctcgtcg ctgttgcggt atttccagaa    236520
     cgccgcgcac ggcggctggc gccatagcgt cgatgcgcag gggcagccgc ttgacgacac    236580
     gcaggacctc tacacgcatg cctttgtcgt gttcgcctgc gcggcgtatt tcgcccgcac    236640
     gcgcgatgcg cgggcgcgca agaccctgct ggccaccgtc gacgtcatcg agcagcgttt    236700
     ccgtacccgc cagggtctct atgtggcggc cctgtcggcc gattgggcgc aggtcgtgcg    236760
     cggcccggcg cagaatccgg tcatgcacct gaccgaagcc tatctggccg ccgcgggcgt    236820
     ggtcgagccg gcgtggtttg cgcagacgct gggacgcctg acgcaggacg tcgcgtcgac    236880
     gtttctgtac gcgccacggc tgtgcatcgc cgaagagccg ctggaccagc cgccgcggtt    236940
     cgagcccggc caccagttcg agtggtactc gctgctgcat ggcgcgccgg acctgttcgg    237000
     cgacctcgaa ctgggcagcg ccttgcagcg gggttgcgcc tgggtgcggc aacatggcgt    237060
     ggacgcgcac agccatggcg tggcggcggt gctcgacgag tcgggcgccg tgcgcgacgc    237120
     cacccagcgc atctgggccc agacggagta cgcccgctac ctggccctga gcgggcagtg    237180
     gcccgagctg gccacgcaac tacgcgcgtt ccaggcgcgc ttcctgcatc aggacggctg    237240
     gcacgagtgc ctggacgccc agggcaatgt gagccgcgcc gacatgccgt ccaccacgcc    237300
     ttaccacctg gccacgtgtt acgccgcgct ggaggatgcg ctggccgggc agggatgaat    237360
     cttccgcccc ggtagcagtc gcataaagtt acgccagcaa cgtgattcgc cgaaatcctt    237420
     tacaatttgg ctaccaaatg tgtaggagtg gacgatgagc gtcatgtgcc cggcatgcca    237480
     ggccatcaat gcaggctcgt ccggcgtcga accgcatccg cggttgggcc accagggttt    237540
     cacgaatccc agccagaagg ggcgcgaggc caaccgcgaa gaccatttcc gttgcatcga    237600
     gtgtggcgcc aagtggttga gggagaccga tcgctggggc gtggacctcg gattcagact    237660
     ggcgccttga ggggcgcgcg acgggcagcc ggcaggctgc ccgtttgcat ttcgcccggc    237720
     cgccgcgtgc cgtgcggcca gcgcaccggg atcgccgacg gcgctgttcg aggcgcggtt    237780
     gctggcgcgc cggcttaagt tccgggcgta gcctgccgta atgggggtac cgcggcgagc    237840
     gccgccaatc aggccagggc gccatggttc agaaggtcct caacggtttc gccgtcgtgg    237900
     cgttcgccac ccagcccgag cacggcatgc cgccgcgcgc gttcatccag accgcgccca    237960
     tggacggggc cgggcaggcc gagccgcagg tgttcgagat tttcctggcg cggcgctttc    238020
     gcagcgcggt ggaggccatg tcggcggcgc gcaacgcgct ggaccgggtg gtatcggtag    238080
     accaggacgg cgtaccggcg ccgctgccgg actgaagcaa tgcgctagct gtgaagattc    238140
     aataggttgt atgcatggtt catccgaacc ggatttgaga aactggaaat cgccaccccc    238200
     cccagttcac tcaaggagcc cggccggatg aacacccata agcatgcccg attgaccttc    238260
     ctacgtcgac tcgaaatggt ccagcaattg atcgcccatc aagtttgtgt gcctgaagcg    238320
     gcccgcgcct atggggtcac cgcgccgact gtgcgcaaat ggctgggccg cttcctggct    238380
     cagggccagg cgggcttggc cgatgcgtcc tcgcgcccga cggtctcgcc ccgagcgatt    238440
     gcgccggcca aggcgctggc tatcgtggag ctgcgccgca agcggctgac ccaagcgcgc    238500
     atcgcccagg cgctgggcgt gtcagccagc accgtcagcc gcgtcctggc ccgcgccggt    238560
     ctgtcgcacc tggccgacct ggagccggcc gagccggtgg tgcgctacga gcatcaggcc    238620
     cccggcgatc tgctgcacat cgacatcaag aagctgggac gtatccagcg ccctggccac    238680
     cgggtcacgg gcaaccgacg cgataccgtt gagggggccg gctgggactt cgtcttcgtg    238740
     gccatcgatg accacgcccg cgtggccttc accgacatcc accccgacga gcgcttcccc    238800
     agcgccgtcc agttcctcaa ggacgcagtg gcctactacc agcgcctggg cgtgaccatc    238860
     cagcgcttgc tcaccgacaa tggctcggcc tttcgcagcc gcgccttcgc cgcgctgtgc    238920
     catgagctgg gcatcaagca ccgctttacc cgaccttacc gcccacagac caatggcaag    238980
     gccgaacgct tcatccagtc ggccttgcgt gagtggactt acgctcacac ctaccagaac    239040
     tcccaacacc gagccgatgc catgaaatcc tggctacacc actacaactg gcatcgaccc    239100
     caccaaggca tcgggcgcgc tgtacccatc tccagactca acctggacga atacaaccta    239160
     ttgacagttc acagctagcc gcgcggctgg atcttgccgc tgggcagcca gtacaccgcc    239220
     atgccaccgg catccggccg ctcgtcgacc tgcaaggccg tcaggcggcc gttcctgcac    239280
     gggccgccga tacagaggcc ggtgtccggt tcgtaggtgg cgccatggcg cgcgcacatg    239340
     atgagatcgc ccgcgcgcgt gaaaaaactg ttctcccagt ccagctcgac gccgacgtgc    239400
     gcgcagcggt tcagatagcc gtagacctgg ccgcggtagc gcacgaagaa cgcgctggcc    239460
     tggccggcgc catcggtgac cgggactttc acgcccaggc cgccgtcgac caggtcggcg    239520
     gcggcgcaga cgcgtacggc gggcgtggaa tcagtcacgg cgggggcaag gggcggcgaa    239580
     agcgcgcatc ttgggcgtcg cgggggcgct tgtcaatcgt ccagggccac ggcggccgga    239640
     cgggcggctt cctgctggcg cgcccacatg ccggcgtaga tgccgccctg ggccagcagt    239700
     gcctggtggc ggccgcgctc gaccacgcgg ccatcgccca gcacgatgat ttcatcggcg    239760
     tcggcaatgg tggagaggcg atgggcgatg atcagggtgg agcggccctg gctgacctcg    239820
     cgcaggttgg cctggatttc gcgttcggta tgcgtgtcca gggcgctggt cgcttcgtcg    239880
     aacaggaaga tggatgggtt cttgagcagc gtgcgggcga tggccacgcg ctgcttttcg    239940
     ccgcccgaca gtttcaggcc gcgttcgccc accatggtgc ggtagccgtc gggcatggcc    240000
     atgatcaggt catggatgtg ggccagccgc gccgccgcct ggacttcgcc gtcgctcgcg    240060
     ccgggccggc cataggcgat gttgtagtgg atagtgtcgt tgaacaggac ggtgtcctgc    240120
     ggcacgacgc cgatggccgc gcgcaggctg gcctgggtca cgccgcgcac gtcctggccg    240180
     tcgaccagga tggcgccgcg gtcggcatcg tagaagcgaa acagcaggcg cgccagcgtc    240240
     gacttgccgg cccctgaggt gccgaccacg gccacggtct tgccggccgg gatgcggaaa    240300
     ctgacgccct tgagtatggg gcggcgcggg tcgtagccga aatacacttc gcggaattcc    240360
     accgcgccgc cttccagccg cagggcgagc gcgccgggcg ggtcggcgat ctcgcgccct    240420
     tcgccgagca gttcgaacat gcgctccatg tcgatgaggg cctgcttgat ttcgcggtag    240480
     atgaagccga agaagctgag cggatcgtac agctgcagca gataggtatt gaccagcacg    240540
     aaatcgccca gggtgtagcg cccctgcgcg atgccgcggg cggccatcca catgaccagc    240600
     gtcaggccgg ccgagatgat cacggcctgg ccgatgttga gaatggacag gctgacctgg    240660
     ctgcgtaccg cggcgcgttc gtagcggcgc agcgaggcgt cgtagcgttg cgcctcgtgc    240720
     tcttcgttgc cgaaatactt gacggtctcg tagttcagca ggctttcgac cgccttggta    240780
     ttggcctcgg agtcggtctc gttcatctgg cggcgaaagc gcgtgcgcca ttccgtgacc    240840
     accagcgtgt aggccaggta cagggtgacc gtcgcgccgg tggccagggc aagccagccg    240900
     tcgaacattt tccacagcac cgcacagacc aggccgattt cgaacagcgt gggcagcacg    240960
     ttgaacagca ggaaggtcag cagggtctgg atgcccttgg tgccgcgctc gatggcgcgc    241020
     gtcaggccgc cggtctggcg cgccaggtga aagcgcagcg ccagcgcgtg caggtgcagg    241080
     aagatctgca ggcccaccgc gcggatggcg tgctggccga cgcgggcgaa cacggcgtcg    241140
     cgcagctcgg aaaacagcag cgacagcacc cgtgcggcgc cgtaggccag gatcagcccc    241200
     agcggcaccg tgacggcgcc gggcgcgccg ccgccgagct ggtcgaccgc cgacttgtaa    241260
     agaataggta catagacgac ggccgccttg gccgccaaca ggcacagaat ggcgatgacg    241320
     acccgggcct tcaggccggg gcggtcggcg ggccagagaa agggcgccag cgtgcgcagg    241380
     gtgtccaggc tgttacgccc ggcaggcgtc ggagaggggg agggcatcaa gggcaggggc    241440
     gccggtctgg gaaaccgggc cggaaacagg ctttcacatt ggcattatgg gccacggggt    241500
     tatcatccgc gagaatgtcc tgcaagagtg tcagattttt catcccgtca gattcgtcaa    241560
     caccagggag ggttttatgg cgcaagtacc ggtactgaag ctgaacgacg gtaatgcaat    241620
     gccccagctg ggcctggggg tgtggcaggt tcccaacgac caggcggccg ccagcgtcaa    241680
     ggccgcattg gcggccggct accgctcgat cgacacggct gccatctatg gcaacgaggc    241740
     cggcgtgggc gaggggctgc gcgctgcggg ggtagcccgc aaggatttgt tcgtcaccac    241800
     caagctgtgg aacgaccggc atggctacga cgaggcgcag cgcgccatgg acgagagcct    241860
     gcgcaagctg ggcctggcct atgtcgacct gttcctgatc cactggccgg tggccggcag    241920
     cgacaagttc gtcgatgcct ggcgcgccat ggtggcgatg aaggaggacg ggcgcgcccg    241980
     ctcgatcggc gtgtccaatt tcacgatcgc caatctgcgg cgcctggtcg acgagaccgg    242040
     cgtggtgccg gcggtcaacc aggtcgaact gcatccgggg ttcgcccagc gcgagctgcg    242100
     cgccttccat gccgaacagg gcatcgccac cgaatcctgg agcccgctgg gccagggcgc    242160
     cgtcatgcac gacgcgacgc tggccgggat cgccgcgcgc cacggcaagt cggcggcgca    242220
     ggtgacgctg cgctggcatc tgcagaatgg cctgatcgtg attcccaagt cggtgacgcc    242280
     ggcgcgcatc caggccaaca tcgacgtatt cgacttcgaa ttgtcggccg acgagatggc    242340
     cgatatcgac gccttgccgg aaggcccgcg gctcggaccc gaccccgcca ccttcaccgg    242400
     ctgatacccg cggcgccgcc ccagggggcg gccaaggagc ttggagacca tggaatacgt    242460
     acgactgggc agcaccggac tgaaggtgtc gcgcctgtgc ctgggatgca tgacctacgg    242520
     cgagccggcg cgcggcaacc acgcctggac gctggacgag acgcagagcc ggccgttctt    242580
     tcggcaggcg ctggatgccg gcatcaattt cttcgatacc gccaacagct actcggacgg    242640
     caccagcgag gaattcctgg gacgcgcctt gcgcgagtac gtgccgcgcg acgaggtggt    242700
     ggtggcgacc aaggtgttct tccccttgcg caaggaaccc aacagcggcg ggttgtcgcg    242760
     caaggccatc atgcgcgaga tcgacgccag cctgcggcgg ctcggtaccg actacgtgga    242820
     cctgtaccag attcaccgct gggactacga cacgcccatt gaggagacgc tgcaggcgct    242880
     gcatgatgtg gtcaaggccg gcaaggcgcg ctacatcggc gcttcctcga tgcatgcctg    242940
     gcagttcgcc aaggcgctgt acctggccga ccggcatggc tggacgcgtt tttccaccat    243000
     gcagaaccac tacaacctgc tgtaccgcga ggaagagcgc gagatgctca agctgtgctg    243060
     cgccgagggc gtgggcgtgc tgccgtggag tccgctggcg cgcgggcgcc tgacgcgcga    243120
     ctgggccgag ggcagcgcgc gcgccgacac cgacgatgtg ctcaagcggc tgtacagcgc    243180
     caccgagcag gccgatcgcg gcgtcatcga cgcggtgggc gaggtggcgg cgcagcgcgg    243240
     cgtctcgcgc gcgcaggtgg ccatggcctg gctgctgcgt cagccggcgg tgaccgcgcc    243300
     catcgtgggg gcgagcaagc cgcgccacct ggaggacgcg gtggcggcgc tggccctgcg    243360
     cctgaccgac gaggaggccg cgcgcctgga agcggcctat gcgccgcatc cggtggccgg    243420
     attcgcttag ccgccgcggc gcgggccggg cgcgggacgg cgttcgcgcg ggacgatcca    243480
     gaagcgcgcg atcaccacca gcagccaggc cagcgccagc cacgaggccc agtgccacac    243540
     gccggtgccc agcagggcgg cgagcagccc gaacacgctg agcgcgccca gcacgatggg    243600
     catgccccag acgaaataga aatgctggcg cggcgtcatg cgggcgtcct ttgcggttcg    243660
     gctgcctgct ggtggcggcg caccagctcg gccacgcgtg cgtcggtggc cttgcggcgc    243720
     gccagccaca ggtagaggcc gctgcccagc accacgatgg tgatcaggtc gagcagggcc    243780
     cagatgattt tcagcggcat gccgccgtaa tcgccgaaat gcagcgggcg cgacagttcc    243840
     aggacggtga ggtaccacgg cattctggcg acggcggcca gctcgccggt cttgccgtcg    243900
     accagcaccg gcgtgttcag cttggaggtc agcggcgtat tgcccttgag ccagacgatg    243960
     tagtgctgcg ggctgccgaa ggcattgccg ggatacgaga tgccggtcag ggcgcggtcg    244020
     ggcacggccg ccaaggccgt gtcggcggcg cgctgcggcg ccgacagctc ggccggccgc    244080
     gggacgggct tgccttggta aggagccgtc atggcctgca gttcggtctg ctgccagagg    244140
     cggaacagcg gcgtggacaa ctcgttgatg acgccggtca ggccgacgac gaaggcccag    244200
     accagggtga cgatgcccag caggttgtgc aggtccagcc acttcaggcg gttggaacgc    244260
     gaggcgcgca ccgtgccgaa atccagcttc ttcatgaacg gaccgtacag caccacgccc    244320
     gagacgatgg cgatgacgaa cagcaggccc atcaggccga gaaacagttc gccggccagc    244380
     ccggcgtaga ggtccacgtg cagcgccagc atgatgccca tgaagctgaa gcggtcggcc    244440
     gaatacttgg ggccgtcgtg caggatgtcg ccggtgcggg cgtccacgcg caccgcgtgg    244500
     ccggcctcga ccgcctggcc cagcttgggc gtgaagccga catagacctg gggttcctcg    244560
     tcatccagga aaacgtagtc gatgtattcg tcggggtaga gcgcatgggc gcgggcgacg    244620
     atggtgtcga ggctggcgtc gggcgtgccc tcggccacct gcgccacggg cttgccctcg    244680
     tcgagcaggt gctcgatctc gtggtggaag accaggggca ggccggtgat gcagatgatc    244740
     agcaggaaaa gcgtacagac caggctggtc catttatgga ccaggtacca agtcttgatg    244800
     gtcgacgctg tactcatgga atagtggaag taggtctaaa agcggaaaag tatcacgaat    244860
     aatatttatt ctcatcagtt ttttgtaagc tgggcatgcg cgcccgcgcc ggccggcccg    244920
     ccgccatccg ggttacagtg accgtaccgc ttttttccag ggatccggcc ctggcttgcg    244980
     atggccccga acctgcagta ccccgctttc ctgcgcctgc cgcgcaaccc cgccggacgc    245040
     gacttcgccg tgggcgatat ccatggccat ttctcccgcc tcgagcaggc gctggacgaa    245100
     tgcggcttcg atccgcggcg cgaccgcctg ttctcggtgg gagacctgat agaccggggg    245160
     ccggacagcg aggccgcggt gcaatggctg gcgcatccgt ggttctacgc cgtgcagggc    245220
     aaccacgagg actatgccat ccgccatgtg cgcaccggcc tggtcgacca ggacaattgg    245280
     cgcagctatg gcggcggctg gtttctcgat gccgcgcccg agcgccagcg cgcctgggcc    245340
     ggcgcgttcg cggccttgcc ggtggtgatc gaggtggcga cgcaggccgg cccggtgggc    245400
     ttgctgcacg ccgattgccc ggtgcgggac tggagccggc tcgagtattt cctgcaggcg    245460
     cggcccaagc gggcgcgctc ggtctgccag tggtcgcgcg agcggctggc cagcggcgac    245520
     gcgcgcggcg tggacggcat ccgcgccgtg gtggcgggcc atacgccggt cagcgagccc    245580
     gtggtgctgg gcaatgtcta tcacatcgac acccagggct ggcgtccgca tggctatttc    245640
     accttgttcg acctctgtac gctgagcgcc tggccgcgcc cggcgcaggc cggcgcgccg    245700
     gccgcgcgcg gctgagctag agcggcgtgg cgccgaccct gcccggcagg gtgacgggct    245760
     gggccgaggc gccgccgtgc gcgggcgcgg caggcggtgc ggaggcggcc gcgggcggcg    245820
     cgcccagcgg caggctggcc ggcgtggcct gcccgtcggg caggtcggcg cggggcaccg    245880
     gaatcggtgg aatgggaggt tgcccgcccg acgaggagcc ggcgggcggc tgcccgggct    245940
     gctgcacgcg cgcgggcgcg ccgtcgctgg ggcgcatgtt gttcaggaag tcggtcagct    246000
     cgtcgccgct ggacagatcc agcgcggcca cggcctgccc gggcgggaat tcgctgaagt    246060
     agtactcgcc gttgtcgacg atcaggccct ggggccgcgg cgcgcgcggc gcctggggcg    246120
     tgcccttgag cgtgggctgt tcgtagtcga gccaggtgga cagcgccagc ccgctgccga    246180
     attcgttggt gcccagcgag cggggctggt cgaaccccat ccagaccgtg gtggtctgct    246240
     gcgcggtgta gccggagaac cagacatcga ccgcgtcgtt ggtggtgccg gtcttgcccg    246300
     cgatgtcgtt gcgcttgagc gtgcggtaga cgcgcgcggc cgtgcccttg gtggtggtgt    246360
     cgtgcatgat gtcgtcgatc acccaggccg tgcgcgggtc gatggcgcgc gcggtttcgt    246420
     cgccggcctt gaccggcgtg gtctgcatca ggaccttgcc ggaacggtcg gtgacgcggt    246480
     cgatcaggta gggggtgacg cgatagccgc cgttggcgaa cacgctgtag gcgttggcga    246540
     cctgcagcgg ggtggcgccg ccggcgccca gcgccagcgg cagcatggcg ggccagcgcg    246600
     cctgctcgaa gccgaagcgg gtgaggtagt cgcgcgcgta ctcggggccg atggcctgca    246660
     ggatgcggat cgacaccatg ttcttggacc ggtacagccc ttcgcgcaag gtgagcatgg    246720
     gctcgtagcg gttgccgtcg ttcttgggct cccaggcgcg cgagccggtc tgctcggcgg    246780
     tcagcatgaa gggctggtcg ttgacctggg tggccggggt catgccgcgc tcgagcgcgg    246840
     cggcatagac gaacggcttg atggtggagc cgggctggcg ccacgcctgg gtgacgcggt    246900
     tgaacgagcc gcggtggaag tcgaagccgc ctatcatggc gctgatcgcg ccgtcggccg    246960
     gcgacatcga taccagggcc gcctgcagcg cgggcatgtt gatgatttcc caggtgtcgc    247020
     cgttcttgtg caggtacacc accgagccgc gccggatgcg cagcgcatcc ttggcgttgg    247080
     gggccagcgc gcgggccacg atggccagcg ctttcttgtc gtcgacggtg acgatgtcgg    247140
     tggcggtgcg ggccacggtc accgaggtgg ggctggtcga cagcaccacg ccggccagca    247200
     ggtcgtcgct gtcgggcgcc tgatcctgca cgctgtcgag gatttcgtcg aaggcctggg    247260
     cgtcttgttc gatgccgtcg ggcaggtcga tctgcgcctg cgggccggga tagggcgcgc    247320
     gccgggtgta gtcgagcacg cccgcgcgca ccgcgcgata ggcggcctgc tgggccttgg    247380
     aatcgatagt ggtgtagacg tcgatgccgt gcgtataggc gccgtcctgg tagatgctgt    247440
     acatcagctg gcgcaccagc tcggcgggat actcgccgtg gatggcgaag ccatgcgccg    247500
     ggccgccctc gctgccgcgc aggacgatgg tctgcgcgcg cgcctcttgc acctgctcgg    247560
     gcgtcaggta gcccagcgtc tgcatgcggc ccagcacata ttgctggcgc gcggtggcgc    247620
     gcggcaggct ggccagcggg ttggcgcgcg agggcgcctt gggaatgccg gccagcatgg    247680
     cggcctcggc cggggtgacc tccgacagcg gcttgccgaa ataggtgcgc gacgcggcgg    247740
     caaagccgta tgagcggtgg cccaggtaga tctggttcat gtagagctcg aggatctggt    247800
     ccttggtgag ctcggcttct atcttgtagg tgagcagcag ttcatagaac ttgcgcgagt    247860
     acgtcttttc ggaggacagg tagaagttgc gcgccacctg catggtgatg gtgctgccgc    247920
     cctggctctt ggacagcttg accatgttgg tcagcacggc gcgcgccacg cccatccagt    247980
     ccaccccgcc atgctggtag aagcggtcat cctcggcggc cagcacggcc tgcttcatga    248040
     cctgcgggat ttcgtcggcg cgcaacacgt tgcggtgttc ttcgccgaac tcgccgatca    248100
     gcacgccatc ggcggtatag acgcgcaagg gcacgcgcgg ccggtagtcg gtcatggcgt    248160
     gcagctcggg caggctgggc caggccagcg ccagggccag ccccagcgcc agcgcgcccg    248220
     cggcgcccag gccggccacg gccacgcccg ctttgatcaa cagggatttg cgaaacagcc    248280
     gcggcccgcc gggcgggggc ggcttggtgg attgcgaaga cgtattcatc ggtgccgatt    248340
     ctagggcaga acaccataga ccggcatctg ggggaattgg tttccgtaac caaacgtgca    248400
     cggcgctgcg ccagcgtaat gcgggacgga tcggaccgat cccccgccgg ggcgggggcc    248460
     ggactcaggg cttgaggtgc tcggtgaaga atttttccat ggcggcgtag aactcgaact    248520
     tgttctcgtc gttgtggaag ccatggcctt cgttgtcctt gaccatgtac tcgacctcga    248580
     cgccgcgctg gcgcagcgcc tggacgacct ggtcgctctc ggccttgttg acgcgcgggt    248640
     ccttggcgcc ctgggcgatg aacagcggcg tcttgatgcg gtcgacgtgc agcgcgggcg    248700
     aggtggcttc caggcgcgcc ttgtcgcgca ccgggtcgcc caccatgtcc tgcatcttgg    248760
     ccagcagcgg cttccagtag ggcggtatgg tgttcatgaa ggtgaagagg ttggataccc    248820
     ccacgtagtc gaccgccgcc gcgtacaggt cgggcgtgaa ggcgacgccg gccagcgtgg    248880
     cgtagccgcc atagctgccg ccgtagatgc cgatgcgccg cgggtcggcg atgccctggt    248940
     cgatcagcca ttgcaccccg tcggtgatgt cgtcctgcat cttcaggccc cattggccga    249000
     agccggcttc ccagaacttg cggccgtagc cggtcgagcc gcggaagttc atctgcagta    249060
     cgcagaagcc gcggttggcc aggaactgca cttccgggtt gtagccccag ccgtcgcgcg    249120
     cccagggccc gccgtgcggg ttgacgatgc aggccaggtt cctgggcgcg cgtccggccg    249180
     gcagggtgag atagccgtgg atggtcaggc cgtcgcggct ctggtagctg acgggccgca    249240
     ccggcgccat gtcggcctcg ggaatggcgg gattgatgtc ggccagcttg tgcaggctgt    249300
     cgcgccgcgc gtcgtacaga tagcgcgacc ccggcgtgcg gtcgttgtag gcggccacga    249360
     tgaaggtgtc ctcgtcgcgg ttccagccct gcagcgcgaa gtcgtagccg ggcagggcgc    249420
     gcgccagccg ggcgtacagg gcttcggtct cggcgtcgaa aaaccggtgg cgcggcttgt    249480
     cggtctggta ggaggcgacg gtcagcacct tgcgcttgcg cgaatagccg gccgcgtcga    249540
     ggtccacctc gtccggttcg aatacgggtt gctccacgtc gggcgtggcc gggtcgatga    249600
     ccaccagggc cagcttgtcg cggccgcggt tgctcagggc gtacagcttc ctgtcgtcga    249660
     aggtgaagaa ggccgggctg acgctcacgc ggtagtcggt ggtgatgagc gggcgaaacg    249720
     gcgcggcctc gtcgtcgcgg tagagcaggg tggtgttcag gccgtcgctg gtgatggcgg    249780
     cgcgcacctt gccggcatgg tcggtctgcc agcccaccac gttgcccggg ttctgcgcga    249840
     ccagttcggc cgccccggtg cgcacattga cgcggtagac gtcgaacacc tgcgggtcgc    249900
     gccggttgtg gctgatcagc acgtggtcgg ggtcgtcggg caggtcgtcc tcgatcgagg    249960
     cgcgcacccc ctcgtagggg gtgaggtcgg cgacctggcc ggtgcgcgcg ttgacggcca    250020
     ggacgtggaa attctcgtcg ccgccgaagt ctttctggta gagcacggtg tcgtcgccct    250080
     tccagaagaa attgctgata tcgcgcgcgg tttcgctggt cagcttgcgc ggctcgccgg    250140
     ccggcacgcc gtcggccagc gcctgtacgt agatgttcat gcgcggcggc tggccgtcga    250200
     tgctgaccgg ctgcatgaag cccagcgtct tgccgtcgtc ggccaggcgg aagtagccgc    250260
     gctcggggtt gcggaagaag tccttgagcg gataggcgcg cgggggctgg gcggccgcgc    250320
     ccagcgtggt gccgatcagg ccggcggcca ggacggtgcg cttgatgagg gtgagcaagg    250380
     ggaacctccg gagaatgcgg gcgcggcgcg gccgcgcgat acggcgttgg gcgtgccgcc    250440
     ggcgccggcg accgtgtcga tcatgccaca ggcgcgccgg cagtgtcgaa cggccccgat    250500
     atgcgggata atcgcgccca tgtcatcggg agaaatcatg cgcattgcac ggattgccgc    250560
     ggttgcgggg gtggtggggc tggctggctg ctcggtgggc accgcgccag gggccggcgc    250620
     cgtgtcgggc aactacaagc tgcagaccaa ctatcaggac gcctatcgct acgcgacggt    250680
     gcaggccgag cgctgcctgg tgggccaggg ctgctaccgg gtggtgggcg aactcgacga    250740
     caacgcgcgc accggcctgg tgcgggtcgt ggcgccgttc ttcgacggcg agatggcgcg    250800
     cgtggagatc ggcaccatcg atgcgcacag ctccaacgtc tatatcggca tgtggggcaa    250860
     gagtatctgg aataccgacg cgctgcgcgc catgcgcgaa gcggtcgtgt acggagtgcc    250920
     gtcctgcgtg gcctatatgc cggcgatccg gcgccgaccg aggaagtctc tggcgcctgc    250980
     ccaaccgcta ggctcagtcg ccgccggggc ggcgctggat gatcttgaac gtggcggtgg    251040
     ccttggccac cagttcaccg gcgctgtcgc ggatctctcc tttgcagaag gcgatcgacg    251100
     cgccgcggcg caggcagcgc gtttcgatga ccaggtcgcc gcgccccggg gacatgaagc    251160
     tggtgttcat gtcgatggtg gccacgccga cttcgggggt gtcgccgcgg atggcggcgc    251220
     ccagggtgaa atccagcacg ctcatcagcg tgccgccgtg gatgtcgccg cggctgttga    251280
     ccaggtcggc gcgcgccggc agccgggtgc gggcggtgcc gttgcccgag tgctcgggaa    251340
     ccaccccgag caactgcatg aagggaatgg tcaggccgaa aaagtcggtg tgtggtgtcg    251400
     acatgatggg tagctgttgc gtgacagatc tgtggtgaag gtaagaggcg agccataata    251460
     tcgctttttc cggccgcggc aggcggcgac gcttttcagt catgtcccag ctccagcgca    251520
     aaatcgtgca catcgacatg gatgcgttct atgcgtcggt cgagcagcgc gacaatccgg    251580
     cattgcgcgg ccttccggtc gtggtggcct ggaccgggcc gcgctcggtc gtgtgcgcgg    251640
     cctcgtacga ggcgcggcgc tatggcgtgc attcggcgat ggcggcggcg cgcgctcagc    251700
     ggctctgtcc ggacgcggtc tacgttcccc ccgatttcaa tcgctaccgc gaggtgtcgc    251760
     gccaggtgcg cgccattttc gcgcgccaca ccgacctgat cgagccgctc tcgctggacg    251820
     aggcctatct ggacgtgacg tgcaacaagc tgggcctggc ctcggccacc gaggtggcgc    251880
     agatcatccg gcgccagata cgcgaggaga ccggcctgac cgcctcggcg ggcgtggcgc    251940
     ccaacaaatt cctggccaag atcgcctccg actggaacaa gcccgacggc ctgttcgtga    252000
     tcaagccctc gcgcgtgctg gacttcctgc aacccttgcc ggtgcgcaag gtgccgggcg    252060
     tgggcaaggt catgcaggcg cgcctggagc aactgggcat ccagacggtg ggcgacctga    252120
     gccgccattc ggtggccgag ctggagcagc gtttcgggcg ctatggcgtg cgcctgtacg    252180
     agctggcgcg cggcatcgac gagcgcgcgg tgcaggcgga ccagccggcg cagcaggttt    252240
     cggccgagac gacgttcgac accgacctgg cgctggaggc gctgggcgag gcgctggagc    252300
     ggctggcggc caaggtatgg gagcagggcg cgaagaaagg gcgcatcggg cgcaccacgg    252360
     tgttgaagct gaagaccgac cgcttccgca tcctgacgcg cagcctgacg ctgatgcagc    252420
     cgccgggctc ggcggcggag ctggcggcga tcgcgcgcca gctttgtacc cgcgtggacc    252480
     tgccggcgca cacgcgctac cggctggtcg gggtggggat gagcaatttc cccgacgcgc    252540
     aggccgaggc gccgcgccag gcggagctgt tcggcgacgc cttctagttg tgaagattca    252600
     ataggttgta tgcatggttc atccgaaccg gatttgagaa actggaaatc gccacccccc    252660
     cagttcactc aaggagcccg gccggatgaa cacccataag catgcccgat tgaccttcct    252720
     acgtcgactc gaaatggtcc agcaattgat cgcccatcaa gtttgtgtgc ctgaagcggc    252780
     ccgcgcctat ggggtcaccg cgccgactgt gcgcaaatgg ctgggccgct tcctggctca    252840
     gggccaggcg ggcttggccg atgcgtcctc gcgcccgacg gtctcgcccc gagcgattgc    252900
     gccggccaag gcgctggcta tcgtggagct gcgccgcaag cggctgaccc aagcgcgcat    252960
     cgcccaggcg ctgggcgtgt cagccagcac cgtcagccgc gtcctggccc gcgccggtct    253020
     gtcgcacctg gccgacctgg agccggccga gccggtggtg cgctacgagc atcaggcccc    253080
     cggcgatctg ctgcacatcg acatcaagaa gctgggacgt atccagcgcc ctggccaccg    253140
     ggtcacgggc aaccgacgcg ataccgttga gggggccggc tgggacttcg tcttcgtggc    253200
     catcgatgac cacgcccgcg tggccttcac cgacatccac cccgacgagc gcttccccag    253260
     cgccgtccag ttcctcaagg acgcagtggc ctactaccag cgcctgggcg tgaccatcca    253320
     gcgcttgctc accgacaatg gctcggcctt tcgcagccgc gccttcgccg cgctgtgcca    253380
     tgagctgggc atcaagcacc gctttacccg accttaccgc ccacagacca atggcaaggc    253440
     cgaacgcttc atccagtcgg ccttgcgtga gtgggcttac gctcacacct accagaactc    253500
     ccaacaccga gccgatgcca tgaaatcctg gctacaccac tacaactggc atcgacccca    253560
     ccaaggcatc gggcgcgctg tacccatctc cagactcaac ctggacgaat acaacctatt    253620
     gacagttcac aactagccgg gtggtgaggt cgtagcggct catgaccgcg gcgctgtcgc    253680
     gggtgaccgc ggaattgctg gcgggatgca tcgtcggatc tcctcagtcg ctggatttct    253740
     tggtcaattt gggggaaaga atgagcgcgg cgggcgagcg cgtcgcgaag gcctgcctga    253800
     tggcttcctc ggccacgaac tcgaccgcgt cggcgcgcgt gagggtgtga tgcggaatgc    253860
     ccagggagtc gaggatcggg cgcatggtct gccatacccg tacctggacc aattggcggt    253920
     cgcccagcgc gccgcgctcc gatatcacca tcaccaccgg gatttcgtaa ggcacgggca    253980
     gcgacgccag cacattggcc agggtggcaa agccgctggt ctgggtgagc agaatgctgc    254040
     gcatgcccgc catctgcgcg ccgcagacga tacccagggc ctcttcttcg cgagcgggac    254100
     agacgacctg gaaatggtcg tcggcctcga cccggtcgat cagcggcttg agcaccttgt    254160
     cgggcacgta ggtcaccagc cggatgtcct ctttcttgag gatgcgccag acggtttcgt    254220
     cccatgtcgc ggtggccgcg gtgtcgccgg tttcatgcgc tgcgattgcc cccatgcctg    254280
     ctctcctgtg tgtggcgccg cgcgtgcccg gcagggcatg ttgcggacgt gatcggtgct    254340
     ggagtcgcca tactaggaat gccggttaat tgatacaaac aaatatttcg aatagattat    254400
     tcggcacaac cgataaatca ctcgccaagt gtctgagggg aaagaggtat ggaccgtcgc    254460
     gtttcgctgc ggcacttgcg ctgcttcctg gcagtggtgg aaacccgttc gttcaccctc    254520
     gcggcctcgc gcatgttcct gtcgcagtcg tcgctgaccg ccgcgatcca gcagttcgag    254580
     gaagcggtgg ggctgaagct gttcgagcgc acgacgcggc atgtggagct gaccgacgcc    254640
     ggccgctact tcaaggcgga agccgagcgg gtcgtccatg gcttcgacgc ctccatccgc    254700
     gatctcaagg cgttcggcca gggaggccac atgcacgtcc atgtggccag cgccccgtcc    254760
     gtggtgcagg cgctgctggt gccggccatc ccgcacctga aggcaagttt tccccatatc    254820
     acctttacgg ttcgcgacgc cgacgcgacg cgcatcgaac gcatggtgct caacggggaa    254880
     atcgactttg ccctgaccag caggcatatc gcgttcgacg agctcgaata cgttccgctg    254940
     ctgcgcgacc agtacggcgt ggtgtatcgc tcgtccgcct ttcgcctgga gggcgagggg    255000
     ccggtgcgct ggagcagcct cgcggccgaa ggctatgtgc agttcacgcc ggacaccgcg    255060
     ctgggcgcga tgctggcggc cttgcccgcc gccgcgcctg tacgacgagc agcgcgacgc    255120
     ggtatccagc agcaccacgc tctacgccat gctggagctg cccggcacgt attccatcgt    255180
     cggcgcgttg tcggccggga ccggcccgtt tcccgagttc gatttccgcg cgctggtcga    255240
     tcccgtgctg acgcgcgaga tctgcctggt gacacggcgc ctgcgctaca tgtccacgag    255300
     cgcgcggcgc atcctgcagg cgctgctgga ggtgttcgac cgcatcgcct tgccgcaagg    255360
     ggtggagctg ctgcggcgcg acgcccgggt cgacccgggc agccaggccg cggcagacgg    255420
     cgccggcccg tcctctccca ctttgtaacg accgcttgct gcgcgctgga aacttcgcta    255480
     gactgctttc acaaaggtag tatcaattga tactgctaaa ggcggatcga taacaagcca    255540
     aggagactga ccatgaagtc acgcatttgc cgccggctgg ccggcgcgtt gctcggtgtg    255600
     gttgcggctt gcgccagcca ggcgcaggac accatacgcc tggggttgca ggcggtcccc    255660
     accgacgagc tgtaccaggc ccgggactgg gcccagccct acgggctgaa aacggaaatc    255720
     tcgacctaca gttcggccgg cgactctctc aaggcgttcc tggccggccg cgtggacgtg    255780
     gtgtccggcg gcgcggcgcg gctggtcacc atggcggcca agcagcccga ggtgttctac    255840
     atcgtggccg ccaaccagta cggcggcgac cgttacggca tcatcgtcgg gcccgaggcc    255900
     ccgtacaaat cgatcgccga tctcaaaggc aagaagatcg gggtggtcag cggttcgggc    255960
     gcgcacggca ccttgatgct gtacctcgag aagaaccagc tcagtcccaa ggatttccgc    256020
     ttcgtcaaca tgaaggtcga ggatatcgcg gcggcggtga accgcggcgt ggtcgatgcc    256080
     ggcctggcct gggagccgca cgtcgccctg gcggaagtca acggcgcggt caagcgcatc    256140
     cagtcgatga agggcgtcaa cgaaagcccc aacttcatcc tcgtcaatcg cgagtatgcc    256200
     ggcaagcacc ccgaagcggt cgccaagtac atcgcgtcca tgatcgacat gtcgcagctg    256260
     accgcgaacg atcccaagaa ggccggcgag atgatcgcgg cccagctggg caagtccggc    256320
     gtcagcatcc cgcccaaggc gatggagctg gccgtctcgc gcatcgtggt ggatccgcgg    256380
     atcgaggatc gcctgctcga agagctgccc gccatcgccg agcccatgat cgctgccggg    256440
     cgcatcaacg ccatgccgga gttcggcaag ctggttcaga agtcgtacta cgagcgggct    256500
     gccgcgcttg ccaaggccag gcagtgagcc ggatcacgga gaccccatga agccgcttgc    256560
     cgcaaccaca gcccacacgg tcatgatcag gcctgccgcg cggcgtactc ccggcgcttg    256620
     cgccgcgtac gccgagttcg gccggttcat gctgcccatc gtcaccctgc tcgtgttctg    256680
     ggagttcgcc gtcagggcgg ggtggatcgc ctcgaacatc tttccctcgc cgtcgatgat    256740
     cttcgctcgc gccagcgagc agctcttttc caccgggccg gagcagggca tgctgttcaa    256800
     gcacatcggc gccagcctgt atcgcgccat cagcgccttc ttgctgagcg tgctcatcgg    256860
     gataccgctg ggcttctgcc tgggcctgat gccgtcggtc cacaaatgga ccagcccgat    256920
     cctgagcgtc atgctgccat tgcccgccgt cgcgtggacc cccatcctgc tggtcgcgtt    256980
     cggccagggc gaccggacca tcatcaccgt atgcttcctg ggcgcgttct tccctgtgct    257040
     ctacagcacg atccaaggcg tcaaggcagt gagcaaacag tcgatctggg tggtgcgcag    257100
     catgggcggc aagcgccggc acgtcctgct gaacgtcctg ctgccctcct gcctgccggc    257160
     gctgatatcc ggcctgaagc tgggcatggc ccactcgtgg cgcacgctgg tcgccgccga    257220
     gatgctggcg gccatcagca cgggcctggg ctacatgatc ttcgccgccc gcagctatat    257280
     ggacgtctcg accatgttcg tgggcatcgc gctgctggcc ttgatcggca tggcgatcga    257340
     atacgggata ttcggcatgc tggagcagcg caccatcagg aaatggcatg gcgcctcgcg    257400
     cataggagga tcgaaatgag cagcgcaatg gcttcctcca tgcctggcgg cgacggggcc    257460
     agggttttcg accggcttct cgtgcccctg gtctcgctgg gcgtgccgct gttgatctgg    257520
     gaattcctgg cgcgctccgg cctggtcagc gacttcctgt tccccccgcc cagcagtatt    257580
     ttctccacgc tttggtcgga ctccggagcc gacgtccacg gcggacagct ataccgccat    257640
     gtgtactaca gcatgatgcg cctgctggcc ggccttgcgc tggcggcggc cgtcggcacc    257700
     ctgatcggca tcctgatcgg cctgacccgc tgggggcggt tcgtcttcaa gcccttgctg    257760
     agcctgttca tgccggtgcc cacgctggcc tggacgccga tcctgctgtt gctgatcggc    257820
     gtcgacaaca agaccacgat cctgatcgtg ttcatcgcgg ccagcttcga ggtgatcctc    257880
     aacgtagtgg ccggcatcga gaacatgaac gtcaaggtgt tctgggtcgc gcgctcgatg    257940
     ggggccagcc gcctgcagat cttcttcaag gtgatcgttc ccggcatcct gccgtacctg    258000
     atcaccgggg tgcggctggg cagcggctat gcgtggcggg ccttgatcgc cgcggaaatg    258060
     ctggccgcca gctcctacgg gctgggcttc atgatctacg aggcctccga gttcatggac    258120
     atgaccacca tctacggcgg gctgatcatg attgcgctgc tcggctatct gatcgagaac    258180
     gtgctgatgg gcgcgttcga ggagcgtacg gtcggcaaat ggggcgtcca ggtcgaacgc    258240
     tgaaaacaac gaaacgggag acggagatgg caagggacaa gatcgtggcc aggaacgtga    258300
     gcatgcggtt cggcgacgta ctggcgatca aggatgcgac ctgcagcatc ggggaacggg    258360
     agtttgtcgc aatcatcggc cccagcggct gcggcaaatc cacctttctg tatgtgatcg    258420
     cgggtttcga agggatttca ggcggcgccg tcgaactgga cggcgaaccg atacgcggcc    258480
     cgggcccgga ccgcggcatc gtctttcagg agttcgtcct gtacccctgg cgcaccgtca    258540
     tggagaacgt cacgctgggc ctggacatca agaagacgcc gccgcaggaa gcgcggcggc    258600
     gcgcccagaa gtggatcacc ctggcggggc tggacggttt cgaggatgcg tatccgtcca    258660
     cgctgtcctg aggcatgaag caacgggtgg cgatcgcccg ggcgctgacc tacgacccgg    258720
     aggtgatcct gctggacgaa ccattcggcg cgctggatgt gcagaccaag aactacatga    258780
     tccatgacct gcaaagcctc tggacagagg cgaacaagac catcgtcatg gtgacgcaca    258840
     gtgtgtcgga ggcggtgctg ctggccgacc gcgtgctgat cttcagcgcg cggccgtcct    258900
     ccatcattgc cgacatcaag atcgacctgc cccatcccag gggcgccggc gacgagggcg    258960
     tgaaggcgta cgaggacgag gtgacgcgca tcctgtcggc cgaagtcgac aaatccatga    259020
     gcatggagcg gcgcgtggcg gcgtgacgcg cggcgggccg gcgatgccgg ccgcattcca    259080
     tattggcgcg cctgatttaa agtagtatca ttagatactc ccaatttgca gtcaaccata    259140
     ccgaggtgag agaaatgagc atgaacgagg aaaccgccgc caaactccag ggcctgaccc    259200
     ggcgtttcgc caaactggtg cacgacctga agttcgagga cttgcccgag gaggtgctgc    259260
     acaaggccaa gctgatcatt cgcgatggac tgggcaacca gatcgcggct tcggccatca    259320
     gcgagccggc gcggcgcgtg gtcgagatcg tgcgcgaatg gggaggcaag cccgaggcca    259380
     ccgtcatcgg ctacgggttc aaggtgcccg cgccgctggc ggccatgtgc aatgccatgc    259440
     tgggccacgg cgtggagctg gatgacgcgc atgggtcggg cctgatcaag ggcggttcgg    259500
     tcatgattcc ctcgatcatg gcgctggccg aggccaacgg caaaagcggc cgcgacgtca    259560
     tcacggccat cgtcgcaggc tatgaagtgg cggtccgcat cgccaaggcg atcaacctcg    259620
     gacatcgcca gcgcggcttt cacaccaccg gcacggtatc cctgttcggc gcggccgccg    259680
     ggggcgccaa gctgcttggt tgcgacgaag aaggcatcgc ggcggcgatc ggcctggccg    259740
     ccatgcagtc ggcgggcatc cagtcatacc tggacgatcc gtgcatggcc aagccgttca    259800
     gtcccggcaa atcggccttc aacggcacca tggcggccgt catggccagc cgcggcttcg    259860
     ccggcccgcg caaggccctg gaatgcaagg agggcttctt caacgcctac tgcgaagata    259920
     tccgcgtcga cgacctgctc gacggactgg gcgagcgctt cgtcatcatg gaggtcggct    259980
     tcaagccgca tgccgcctgc cgctatgcgc acggccccat cgatctggct cagcagttct    260040
     tcgaggaggg ggtgcgcctg gaggacgtcg agaagatcga cgtgcgcatg tgcgagttgt    260100
     cgatccgcca ggcgtccaag cccaaggcgc ccaacctgaa cgccgccatg ggcagcaccg    260160
     agttcggtgt cgcgctggca ttggcgggcg ggcgcaacgg cctgcgggag tactgggacg    260220
     gtttcaacga ccagcgcgtc cacgaggccg cggcggaccg cacgcgtctc atcatggagc    260280
     ctgcgtacgg cgtcaccggc cgccaggcgg ccatggcggt cacgctgaag gacgggcggg    260340
     tgctgcagcg cgaccaggcc gagcccaagg gcgagcccag caacccgctg accgaccagg    260400
     agctgaccga caagttcacc ggcctggtgg acatggtcga aacgtccagc caggtcagcg    260460
     gcgagttttc gcagcgcctg atgcgcctgg aggacgagaa ggcgatcgcg gacctgatcg    260520
     gaccgctgaa ggcggctggc cagactcccg cgctgcgcgc cgcttgacgc cgccgcgccg    260580
     ggatgcgcga caatgaaccg cgggggcgcc ggccgccccc gcggcatcag gcccgagggc    260640
     gcgggtgttg cgcccatacg aggattaagc gatgaacgtg acggacggga ttgcgcaacg    260700
     gtcgatggct gagtacacag gcatcctgat caacggcgtc tggcaggcgg gagagggcag    260760
     ctttccggtg ctggacaaat acaccctggt gcccgcagcc gaggtcttcc gcgccagccg    260820
     ccggcaggtc gcgcaggcgg tggcgcagtg caaggcggcg gccgaccggg gagcgccggc    260880
     ggcgcgcgaa cgcgcggccg tcctgcgccg cgcggccggc ttgctggaca cctatcgtca    260940
     ggacttcgag gccgtcatga tggtggaagg cggctttacc gttcacgaca tttccgccga    261000
     gttcacgcgg gccaaggtga cgctggaact gtcggccgac gaagcgctgc gtctgaccgg    261060
     cagcatggtg ccgttccagg ccagcccggg cgcggagcac aagctggggt tcacggtgcg    261120
     cgtcccggtg ggcgtggtgg cggcgatcac gccgttcaac gcgcccttga acacggtgct    261180
     gcacaaggtt gcgccggcct tcgcggcggg caatgccgtg gtgctcaagc cgtcggcctt    261240
     cacgccgctg accagcgcgc tgctggcgcg ggtgctgctc gaggccggca tgccgcccga    261300
     gttcctggcc gtggtccagg gcgagggcga tgacgtcggc acgtggctgc tggaagagca    261360
     ggatgtggcg ttctatacat tcacgggcag tacccgggtc gggcgcatca tccagcgtgc    261420
     cgccgggttg cggcgcacgc agatggaact gggcagcatc gccagcacca ttgtctgcgc    261480
     ggatgccgat ctcgaggccg ccgtgccgcg gatcgccaac gcggcgttcc gcaaggccgg    261540
     ccaggtgtgc acatcgattc aacggctgta cgtcgaggac gcgctcaaga acgagctgat    261600
     cgaacgcttg tcccgctacc tggacgacat gcctgccggc gatccgcgcg ccgtcgcgac    261660
     gcgggtgggc cccatgatca gcgaggcggc cgcgacgcgg gcgcaagcct ggatcgccga    261720
     ggccgtcgag gcgggcgcgc gcctggtgcg cggcggcgag cgccagggag cggtggtgca    261780
     gccggccgtc ctggccgacg tgcccgagtc ctgctcggcc tggagcaccg aggtgttctc    261840
     gcccatggtg tcggtcgggg gctttgcccg cttcgatgac gtcctggcca gcgcgaacga    261900
     cacgccctat ggcctggccg ccggtatctt caccaatgat cacgcccgta tcatgagcgc    261960
     cgttcgttcg ctgcgcttcg gtacggtgca tatcaacgag acctccagcg cgcggtgcga    262020
     cgtcatgccg ttcggcggcg tcaaggacag cggtttcggc aaggaggggc ccggttatgc    262080
     ggcccgcgag atgaccgaag agcgcctgat cgtcttcaac cagtagttct cgatccggtc    262140
     cgaaaagcgg cccgccgtca ggcgggccgt tgcgttcagg cggcctggcg gcgcccggcc    262200
     agggcgtgct gcgccgcgcc ggcgccggcg atccggccga aggcggtgcc gatggccatg    262260
     ccgatgtccc cggtgtagcc cttgccgagg atattgcccg ccatcatttc gcccgccacg    262320
     aacaggttcg gactgggccg gtcattgaag cggaccgcgg ccgtgtcgtc ggtcttcagg    262380
     cccaggtagg tgaaggtgat gcccggcttg agcggaaagc cctggaaggg cggctcgacg    262440
     atggggctgg cccagtgggt cttggccgga gtcagcccct gcgtgcggca gtcgtccagc    262500
     acggtgtggt cgaacgtgcc ggatatgcac gtggcgttgt attcggcgat ggtccggctg    262560
     gtctgctcca cgggcaggcc cagtttgcgc gccaacgcct cgatgctgtc ggcctgcgtg    262620
     cctgggaaca cgggcggcat gaagcggccg atcgatttgc ggtcgatgat ggaccaggcg    262680
     atctggccgg gttgctgggc caccagccgg ccccatatgg cgtaccgctt gggccagaag    262740
     tcttcgcctt cgtcatagaa gcgctggccg gcgcggttga ccacgatgcc cagcggtacg    262800
     cagtcgatgc gggtgcagat gccgccgtcg tacaacgggg agcgcgcgtc gatggccacc    262860
     atatgggcct gggtggggtc gccgatggcg tcggccccgc tgtcgagcat gtgccgcaac    262920
     agcacgcccc ggttgtaccg ggtgccgcgg atgaggaatt gcagcgcggg cctttcgccg    262980
     ttctcgttgg tgccccaggc ctggtcgagc caatccaggt tggactcgaa gccgccggcc    263040
     gctagtacgc agctgccggc ctcgatgcgg gcgccgtctt ccaggacggc ggccacgaag    263100
     cgctcgccgt cgcgctcgat ggccgccacc ggcgtgtcgt agcgcacctg tatcccgagg    263160
     gcggcggcgc tgcgatagta cgcgttgacc agggccttgc cgccgcccat gaagaatgcg    263220
     ttggtacggg ccaggtgcaa ggttccggac agcgagttct gaaaccgtac gccatggctg    263280
     cgcatccacg gccggcaatt ggaggagcgg cggatgacga gcctggccag gtgctcgttg    263340
     gtgatgccgc cggtgacctt caacaggtcc tgccagtatt cttcttccgg gtagctctcc    263400
     accagcacgt cctgcggtgc gtcgtgcatg cagcgcagat tgcgcgtgtg ctgcgagttt    263460
     ccgccgcgcc attcgcgcgg cgcggcttcg agcagcagaa cgctcgcgcc cgcttcgcgc    263520
     gccgacaggg cggcgcacag cgcggcgttg ccgccaccaa tcaccagtac gtctatcatc    263580
     cgttcctcca ggggttggtt cagtcagcgc ctacattgag cgtgccgggc gtgcgtttct    263640
     cgacggcgtt cttgagcagt gcggcgctgc gataaatgcc gtgggcgaac ttgccatacg    263700
     gcatggtgag gaaaaaggcc atgacgaagc ccaggtgcac cgccagcagc accgccatcc    263760
     atgacgtgtc gcgcagcgcc agcaacagca ggccggtcag gctcacgaag aacagcaggg    263820
     ccatgaatcc gcggtccatc gcatgctggg cggggtcgcc atggtcggcg tggcgcttgc    263880
     ggttgagcag gtagagtccg gcgggcccga tcagcaggcc gatgccgccg gccgtgccca    263940
     gcagtacggg caggctgagt acggggtagg gcgcctgcca gcccagcgcg tagtgataga    264000
     ccgtggctac gccggtggcc gcgaagcaca gcatgaagcc gtagaacgtc aggtgatgaa    264060
     agcggcgccg ccacagggtg aagcgcgcgc tttcttcgtt gcagccttcc ccgtgtccgc    264120
     cacccaggta gcgcagcgtc aggacgtcga acgaagcctc cgcggccgcg ccgctggccg    264180
     aggacggcgg cgcggcgtcc tggcgggtgc cgcgccagaa acgggttgcg ccgattccca    264240
     gcgccagtgc cgcatacagg aagaccaggc cgaacatggc caccagcagg ttgtgcggga    264300
     atatggcgta gaaattgccc tgcaacgggg cgtgccacag ggcgccgttg agccagaaca    264360
     gcagcgccag aaagagcgag agccccacgg ccgtcgccag cgacagcgtc aggccgttac    264420
     ggtcgtagag ctgccccagc gccctcggcc acgcatactc ggaataggtt ttcaggcgca    264480
     ccttggccag ggtgcgaggg atgttgacgt cgaattcgtg cggcgccgcg tactgacagg    264540
     catgcaggca ggctccgcag ttatggcaaa gattggcgag atagtgcaca tcctctttca    264600
     cgaagtcgag gcgccgcgtc atcgccggga acaccgcgca gaatccctcg cagtaccggc    264660
     acgcattgca gatcgtcagg atgcgccgcg cctgcgcttc gtcgtgctcg atgccggtgt    264720
     cttccaccgc gatcggtatc gttgcgcggg ccatgacctg gctttcggta tagggtgtgc    264780
     tcatctgtct cctctccttc gctgaatgtc cgcgcacggc gcggccttac cgcatccgtt    264840
     gcatgagttg gcggatcttc tctcgcgcga tgaacagctg gcccgccatg atgaggcgcg    264900
     ccgtgcggtt cagggcggcc ttgcggaccc gcggcccggc tggtgtctgg tccacttgcg    264960
     aatcgaccga aagcgcgccg gatggatggc caagccggat ctcgctgccg gtatcgccgc    265020
     gcaattgctc ctgcaccacc gaacctggga tgcggcaggc gatggcggtg cacaccgcgc    265080
     cagtcaccgc cagggccttg tgcggtttct gcatcgccag ctggcgcacg cacaggttga    265140
     tgtcggcggc cttgatgggc gtgtcgcccg ccacgtagtc gcgcggcgcc gatatcatca    265200
     tcacgcgcgg cacgttggga ctggtctcgc gcgccttgcg ggcgtcgtcg accaggccga    265260
     gcgtcacggc ggcccagccg cgcgcctgct ccaggcggtc catgagcgca ctgtcgttct    265320
     ggatgtcctg cggggtggcg gtggcgtcgc cgcctatgtc ctcggccacc acgtagacga    265380
     acggcgtggc cgcatcgacc agcgagacgc ggacggggcg cccgtcgatc tcgatggcgt    265440
     cggcggcccg gccggtgggc agcaaggttc cggacacgga acccgcgcag tcgccgaagt    265500
     cgatggccac cgtcgcgccg ctgcctggca ccccgggcac caccgtgggc ccctcgacgc    265560
     aaggcacgcc ggcccgcacc gcgaagctgg cctccaccac ctgcttggtg ttggtggtgt    265620
     agatgcgcac gcgattctgt ccctcccggg ccgggatcag gccgcgcagg accgcgtagg    265680
     ggccgaccgc ggcaagcatg ttgccgcagt tgccgccggt cgagacctgg gcgcgcgtga    265740
     ggtcgacctg gcagaaggtg tactcgacgt ccgcgtcggg gcgcccggat cgcgcgacga    265800
     tggccgcctt gctggtcagg ggatcggcgc cgccgatgcc atcgatctgc cgggcatccg    265860
     gcgagccgta cgccgccagc agcgtcgcgt cccgctccaa ggggtcggcc ggaaggtcgg    265920
     ccgcgagaaa aaagccgccc ttgctggagc cgccccgcat gtacaggcaa ggcaggctga    265980
     gttgttccgg atcggccgtc acgcaaagcg gtgagggagg ggcctgcgtg cgcggcggtt    266040
     cttgggcggg tgcatccatg ggcggtctcc ttgcggatcc tggcgggacg gcggccggtg    266100
     cctgcgtctt tacaggatat tggaagtagt gaataatact actaccgtca aaaccgttgt    266160
     caaggctcga tcatggacaa gccgcgtacc gcacctgttg cctcgttgtc gccgttgagt    266220
     ttcgatcacg accatcgttc gaagaagccg cgggccgtcg ggctcacgtc ggtcatcgat    266280
     ttcggtccgg acggtttcgg ctgggcgggg cccgccagcc tgcgcgatta cctgcgttgc    266340
     gtggccgact acatcgatta cgccaagatc tacgccttga acgccctgat cctgcccgaa    266400
     gagatcgtgc gcgagaccgt gcggatctac cgggatgcgg acatcaagcc atacgccggc    266460
     ggcatactgt tcgagtatgc gtacctgaag aacgagctgg acggctacat ccggcacctg    266520
     aagaaactgg gcatgcccag gatcgaggtc tcggagaatt atctcgactt cggcgatgac    266580
     gaacgcatgc gccatataga gacgatgcaa aagcatggct tcgaggtgat atacgagttc    266640
     ggcaggaaga acccgaccga gccgttcagc ctggcgcaac tcgagcgtgt catccgcagc    266700
     aatgtggcca tgggtgtgca tcacaccatc atcgagcagt ccgagatcga ctgcgtcagc    266760
     gccagcaatc cggctatact caaggacatt gccgcccggg actggtttcg caatatattc    266820
     atcgaggcgg acccgtacgc cttcccgaag ggccacgcga cgctgctcga gaaattcggc    266880
     gatggcgtca atctcgccaa cattaccgcg gaccaggtgc tgcgcctgca aggattccgc    266940
     tacggcgtgg gccgtgcggt caactactcc atcttgtccc gcatctgagg caggccccgg    267000
     cacggtcacg acagcaaggc agtttccaga tgaacaatac gagatcggcg tacgagaaga    267060
     taatcaagga cctgcagggc gtgggcttca gcgattacga agccaagacc tatatcgcgc    267120
     ttctgctcac gcccaatgca accgcctacg aaatcagcaa ggaagccggc attcccaagg    267180
     ccaactgcta ctccgtgctc gaggcgctgc gcaagaatgg cgccgtgcag gcggtttcgg    267240
     agaatccggt caagtatgtc gccgtcgatc ccaaccgcta tttcaaccag atggtcgagc    267300
     tcacccagct gcgctgcgaa gacctgaagg aaagcctgaa gaacatcggc cacctgccgc    267360
     aggaagacct ggtatggtcg cttaacgacg cggcggcggt cggcctgcat atcgagaaga    267420
     tgatcggctc ggcgcgcgac acgattcgca tcaaggccgc ggacaccacg ctggagccgc    267480
     atttgcccag cttgaagaag gccgcccggc gcggcgtcaa ggtgttgatc atcctgttcg    267540
     gcgaggatgt ccggccgttc gagctgggca agaattgcaa ggtctatctg cacgaaggca    267600
     acggcatacg cgtcggcatc tcgcacaagc tgatcaccgt cacgcgcgac tacaaagagg    267660
     ccctggtcgc cgaggtcggc cgggatgcct acggctccta tacggaaaac aagcccatcg    267720
     tcaccctggc cgactcgctg ctgcgccatg agatctactt tgccgagatc ttcagctgct    267780
     tcggcgacga gatccaggag aagttcggac cggcgctggt caagttgcgc gagagctacc    267840
     tgcccgcgga tcaggcggat gcattgaagg tattcctgga aacggccgac cctgcccggc    267900
     tggccggcaa ggccacggcg gcctgagccg gcgggcccaa acaacgggca aggcgtgcct    267960
     tgcccgggcc gcgcaccgca tcagggctcg gccaggacgg ggttgcacag ccggccgacg    268020
     cgctcgatct ccacttcgac cgtgtcttgc ggcttgagcc agagcggggg agtccgcgcc    268080
     atgccgacgc cggcgggcgt tcccattacc agaacgtcgc cgggttccag ggtcatgcat    268140
     tcggtaacga tgccgatcgc ctccgcgacg tcgaaaatca tgtcgtccgt gttggcttcc    268200
     tgcaccgtcc gcccattcac ccggcatgtg atgccaaggc cgcgtccgcc cggcggaagg    268260
     tcgccggcca ggacgagcgc cgggccgaag ccgccggtac ggtcgaaatt cttgcccacg    268320
     gtccattgcg gtgttttctt ctggtagtcg cgcacggaca tgtcgttgaa gcaggcgtag    268380
     cccagcacca tgtccagggc ctgttccggc atgacgtgcc tggcccgctt gccgatgacg    268440
     acggccagct ccgcttcgta atagaaatga cccgagaccc ggggcagcca tgcggcttgc    268500
     ccgtgggcca ccagcgagct gggagcgcgc aggaagaacc atggatacgt cggcttgtcg    268560
     cggccgccct ccctggcgtg atcgtagtag ttcaggccca ggcagatgat cttgccgggc    268620
     cgggtcagca ggggggcgag cacggcggcc gagccggcga caagcggcgt gccggcggcg    268680
     agcgcctgcg cgccgagcgc gggcaggtct tcttcccggc gtatgcgctc gcccagctcg    268740
     ggcgagtcgc cgttttccgg gccgggcagc aggacatagc catgagggtg cgccacggcg    268800
     gccatcgcgc gcccggcgtg gtctaggttc acgaattgca tgttttctcg acggtggtgt    268860
     gggcggagcg tgcgtgctcc gcggttcggt ggtgcggacg gggcttgggc ccgcgcccct    268920
     attggggcac gaggggcgcg ttgggcttga cgccggggac ctcgatgccg ttgggccggc    268980
     cgttgctggc caggccattg cgccgcagca gcggttccgg gatgggcggg ccgccctcgc    269040
     aggccagcca caggcgcagc agatgccggc gccgctcggt ttcgggccag tcttcatacg    269100
     ccgtgcgaga gtggaagatg gtgaagttgg acaggagctg cacgtcgccg ggcttgaagt    269160
     ccatgtcgag gtagagcgcc ggatcgcatg tcagtgcgtc caggcagtcg agcgcctcgt    269220
     tctgttgggc gctcaggcgt ggcacggacg gcagcgcctg cgccttgcgg atggcgctgc    269280
     gtacgtagtt ggcgtacatg cgcccctggt agggcgcgaa gacggggctc gacgagtagg    269340
     gcttctgtcc ttccgggatc tcgccccagc gcgtgcgatg aaaactgtcc agcagcgtgc    269400
     gcgcgtgttc ggggtgacgg gcggccagtt cgttccagac ggtcgtggag ctgacgaccg    269460
     aagacagccc gccggccttc gccggcctga cgcacagcag gcccacgatg tccgatgaat    269520
     ccgtgtgata cggaagccgg ttggaggtct ggtagccgcg cacggcggcg tccgcataat    269580
     ccagccccag attggcgaca tggcccagta cgtgcccctt gccattttgc gagacgggca    269640
     ggccgaggtt cgttccgagc gcccagaacg caatggcgga ctgccgcatg gtgtactgtt    269700
     cgaccggcac gccgcggatc aggtacaggc cgcgcccgtg cagcacttca tgcttgacgt    269760
     gttgcaggcg ttggccgagt tcgcccagtt cgaagtcgtc ctggctcaat tccgtgatgt    269820
     ccttgccgcc ggcgtcggcg cgccgcaccg cccggtccag ctgctccagc tcggggccgg    269880
     tcaggtgatg cacccagtat tccgggtgtt tgtccagctg cggcccgtac caggcctgtg    269940
     cattccggta tgagtccagc gacgcttcgg tcggcgtgca tgcttcgttc atggcattct    270000
     ccctgcggga tggcccgtcg gctgcgaaac cggcggacga gtttgcccct gccacgcgtg    270060
     cgtggcggga ttgcggttca gaaagggcgc tgcgcccagg ccggcgctgc ggctgtctca    270120
     gatgggctgc agattcaggc ggtcgatcag gtcgccccac ttggccattt ccgactggag    270180
     cgacgcggat gcctcggcgg gcgtattgcc gatcgggacc gcgccttctt cggccagctt    270240
     gcggatgaag tccgcgtcct gcatcgccga cttcagatcg tggttgatct tgtcgacgat    270300
     gcgatcgggg gtgttcttcg gcaccatgac ggtgaaccag gcgccgctct cgaatccggt    270360
     gacgcccgcc tcggacacgg ttggcacgtc gggcaggacc tgggtgcggg tcgtgccgga    270420
     gacggccagc gcgcgcagct tgccggcctg gatctgcggc agtacgagcg gaatcggcgc    270480
     gaaggcgaag tcgatgcggc cggccaccac gtcgttgagg gcgggcccca ttcccttgta    270540
     ggcgacgtgc gtgaacttga cgcgcttcat cagggccagc aactcgccgg aaagatgatt    270600
     ggccgatccg atgccggccg agccgaaggt gatctgctcg ggccgctggc cggcgtccgc    270660
     gaccaggctg gcgacatcct ggtacctgga ttgctcggcc gtgatcagga caaagggtgg    270720
     ggtggcgacc accgagacgg ctttcaggtc ctcgacgggg tcgtacggca ggcccttgat    270780
     cagcttgttc gcgacgacca ggttgcccgc cgcgcccagg accagggtgt gcccgtccgg    270840
     ttcggccttg gcgacggtgt tgaccgcgat ggtgccggac gcgccgggct tgttctcgac    270900
     cacgaccggc ttgtcccaat actcggtcag cttgagcgac aacagccgca cgagcatatc    270960
     ggcattgccg ccgggggtgt agggcaccag aaaacggacc gttcgctccg gataggccgg    271020
     ggtaggggtc tgcgcgcagg cggctgcatg cgtcgaggcg gccagcaata ctgcgaaaag    271080
     ccgttgcaac attattctgt ctccaggttt tcggtcgacc ggtgtgcccc ggcgcaagtg    271140
     gtgacgtatt ccgtttggtg gaaagcagtc tatccgggtc agtgataaat taataatagg    271200
     agtaacttat caaatgatcg gaaaaacaaa atgcagaaat cggcggccag ggggctgggg    271260
     catatccgga tcaagcactt gcgcttgctc gaactggtgg tgcagtacgg gtccctgcgc    271320
     aaggcggccg agggcctgca cctgagcgag ccggccgcca gccagatgct gcgcgaagtc    271380
     gagtccacgt tcggggtgac gctgttcgag cgaggcaggc ggggcatgcg gccgaatccg    271440
     tttgccgatg tgctggtcgg ccgcgtgtgg gtcatcctgc gcgagctgca cgagatgcag    271500
     gccgacgtgg ctgagctgga gcatcgccag ggtgtgtcga gcgacctcgg cgcgctgccg    271560
     cgttgcctgc atacccttgt gcccacgacg ctggtgcgcc tgttcggcgc cggcttcagg    271620
     tcgcgcgtac ggattgccga aggcacgtcg cggcagctgc tcgacgcgct ggaccagggc    271680
     gccatcgata tcgcggtcac ccgtttgctg gaaagccacg cgggcctggc cggcgcgcgc    271740
     aatttcgaca gcgcggtcct ctatgaggaa gccattgcca tcgtatgcag cacggaccat    271800
     ccgctgagcg cggtggacac ggtcaccctg gacatgctga cgcagtacga ctgggtgctg    271860
     ccgccgtcga cctccatcac cggcaaattg atcgaagagg agttcgtcag cgcagggctg    271920
     cggccgcccg tgccgaaagt ggaatggctt acctcggcct cgcgcctgac cctggtgcag    271980
     aaaagcaatt tcctcggcat atgtcctgcc tcggtggcgg ccgaattgca gcagggcggc    272040
     cgcctgcatg tgctgcccgt caatccgcgg gttccgctac cgccgatttc ggtggtgtgg    272100
     cggcgcacca agggcgacat cgcggaaatc atggacatga agaacgcgct gatcgagtgc    272160
     gcggccgcca tgccgggcgc catggaaacc ggggcggctg tccgcgccgg cgaattctga    272220
     tccggcccgc gttcgagcgg cgcgctatgt cgacagctgc ggcaacaggc gcgtcaattc    272280
     ggcctcggcc atgaactgga tctggttggc cttcgcatac gccagcgccg gcgcgctgat    272340
     ctcgccgatg gtgacgtaga tggcgtcgtg cgcgccatgg gtctcacgga cggcgttcag    272400
     ctcctgcagc gcctgcacgc cgacgcgcga ggctttccac cgctttgcgc cgaccacggc    272460
     cagccgattc ttgcgccgca acacataatc ggccggcccg ccctgcagca cggtgacctc    272520
     gcagccgtcc tggcgcaagc cctcctgcag cactttcgag aatgtttccc aggacatggc    272580
     gcgcgccgcg ttggtggcgc gttcgacgcg ggcggccgaa gggacgttgc gctgcttcca    272640
     ggccgccatg gccgcaatga cgagaaaggg cagggcggcg aagaacagga ccgcggtgaa    272700
     cgtcggccgt gtggatgcga gcgcgctggc gatcaggacg agcgcgatgg cggcgctgat    272760
     ccaccacgaa gagcgcagga ggatggcgaa tatcgagttg ggggctggct tgagtttcac    272820
     gccggagctg tcgggtctgg taggcaggcg ccagtatagg gcaggcgggc cggcccccgc    272880
     ccggcccgtg cggcgacttc cggctcctgc gccttacggc ccgggccgcg cgcccggcgt    272940
     gcgttcgcgg tcccagagcc gtgagcgatc cgcctgcgcg cgctccttta tcttgtattt    273000
     ctctatcttg ttggtgggcg tcagcggcat cgcgtccacg aattcgacga agcgcggcac    273060
     catgtgcgcc gccatctgct gctggcagaa ggcgaccagt tcgtccggat ccagggcctg    273120
     gccgtccttg agcatgatcg tgacggccac ttcgtcctcg ctgtgctccg actgcagcgg    273180
     gtataccgcc acctgcagca cggcgggatg cagggcgatc acggattcga cttcgtacga    273240
     cgagatgttc tcgccgcggc ggcggatcat gtccttcttg cgatcggtca ggtagagata    273300
     gccgtcggcg tcgaagtagc cgcggtcccc ggtatggaac cagaggttgc gccaggccgc    273360
     cagcgtggct tccggcatct tgtagtagcc cagcggcgcg gcgcccggct gttcgatgcg    273420
     catcacgatc tcgccgacct ggcctgccgg cagggtcagg tcgtcctcgt cgaccacgcg    273480
     tatcgcgacg ccttcgcagg tcctgcccag gctgagcgac ttctcgggcg gcgcatcggg    273540
     cgagagcgac gcgccgaaac cgtagtcgct cagggcgtag cccgcgatca cgcgcaggcc    273600
     gaagcggcgc tcgaaatcgt gcacgaaggg cggcgggggc gccagcgagc aaatacgcac    273660
     cttgtgctcg agatcgaccg gcgaggccgg ctgcgaccag aggaaattgc cgatggcgcc    273720
     gatggcgttg aagcgtgtca cgccgaaggc gcgtacgcgc tcccagaagc gcgaggcgga    273780
     gaagcgttcg tccagcacca ccgaggtgcc ggccacgatc gcggtcgtgc agctgagcag    273840
     cagcgcattg gcgtggaaca gcggcatgca gacgtagtcg acgtcttcgg gcaggaagta    273900
     gcggtagtgc acgctgtgct tgccccagtg ccaggccgcc ccgtgcggaa tcatgatggc    273960
     cttcgatggc cccgtggtgc ccgaggtgaa catgagatag gccaggtcgg tgaagcgcac    274020
     gtcattgtcc accgcctcgt cgctcgcggc gtccgcggga aagggctcga ccgccagcgg    274080
     caggcctgcg agcatccggc gagcgttcgc ggcatcgccg atgaccagca ctcgccgcag    274140
     ttgcgccagg cgcggggcca ccgccgcaaa cgcttccatg caggcgtcgg ccacgatcgc    274200
     ggtcacgcaa tccgcatgcg tgaggtagta ctccagcagc gacgccttgg cattggtgtt    274260
     gatcggcacc gatacggcgc ccaccttgcc gagcgccaga ttgccgagca ggcattccgg    274320
     gcagttcggc gacagcatgg cgacgtgctc gccctgggcg atgccgtagc cgatcatcgc    274380
     ctgggcgata ccattggtgc ggcggtgcag gtccgcgaag gtatagctgc ggccgtccgg    274440
     cgcaaagcgc aggaaaaccc ggtccgggca gcgctcggcg cggcgcgcca gtaccgcgcc    274500
     ggtcgtccac tgccggatgt caccgatttc ggcttcggcg tcgatggccg gccagatgtt    274560
     tgctgcttgc atgaatgccg ttctcacttt gccgccagca ggccgctttg gcgcagcagc    274620
     ccgttcaaat agctacgttc ggccggcaag gtcttgagcc acgcctggcc gtcctcgaat    274680
     gccggctcca ggccctgggc gcggcagaat tcgatgaagt ccggactcag cgtcgccttg    274740
     tggatggcct gggcgatggc atccacggcc gcgtccgggg taccggtgcg cacgaatgcg    274800
     ctgttccacg agaccaccga gaaatccttt gcgccggcct ccatggcggt gggaacctcg    274860
     ggcgcgatga tcgatcgctg cggcccgctg accgccaggg ccttcagcga gccgttgtgc    274920
     gtcagcgtgt tcagcgaccc cagcgcggac aggaccatgg gaacgtgccc ggcgatgctg    274980
     tcgctgatca attgcgccgt ggtcttgtag ttgatgatgt tgatgtcgac gccggccgcc    275040
     ctggccatcc ccgcggccgt ggcggtgccg tgcgcgccga cggtgccgac atccagctgg    275100
     ctgccggtgc gctttgccgt ttccaccatc tcccggaagg tgctgtaggg cgcgctcttg    275160
     gtcgccgcca gcatgtagac cggcgcggtc acgcgcgcga ccggccgaaa atccttcagc    275220
     gggtcgtagt ccgcctgcgg gttgagatcc ggcacgaaga gaaagggcgg accggtgtac    275280
     aggatggtgt ggccatcagc cggcgccatc ttggcggcca ccgtgccgat cagcccatcg    275340
     gcgcccacgc ggttttccac gtagaccgac tggttccact gctgcgtgaa ccgcgtcgcc    275400
     aggaaacggg ccacgacgtc cacggccgtt ccggccggga agggcacgat catcgcgaca    275460
     gggcgctgcg ggaacgcggc cgcctgggcg gcgcccgcga gggccaggcc cagggccccc    275520
     gcggccagca tgaaactgcg acgggtgatg cgatttccgg aatgcatgtc tctaatcctt    275580
     ttcgtgatcg tgcgtcgggg cgaacactgg cagcagccgg ccttgctgcg tcgggcggaa    275640
     gcgggcgctg acgcgctggc cgatgcgcac gctgtcgggg tcgcagtcga cgatattggt    275700
     cagcatcaac gggccctcgg ccagcctgac gtaggccacg acataggggg tcgcggtacg    275760
     cgccacgctg aagctgaaga tctcgccctg gccgctcgat gcggtccagc gagggtccgg    275820
     ggccttgcag aaagggcaga acgcgcgggg atgccaatgg aagcattcgc accggacgca    275880
     ctggggcaac agcagcgtgc cggtttcggc cgcctgccag aacggcgccg attccggata    275940
     tgcaagggcg taggggtcgg cctgccagcc gcacgcctgt tcgctgttct gcatctgtca    276000
     gtcctcccgc tcgaaaatga cggtggtgtg cgaatggccg atgccataga ccccgccggg    276060
     gccggccgcc agggccaggt cgcagttctt cacctgtacg gccggatgcg cctcgccgcg    276120
     cagctggcgc acggcctcga tcgccttggt catgccgccc cgattggccg gatggttgtt    276180
     gcacagacag tccgccgccg tcggtattga aaggcagccg tcccacgccg gatatcaggt    276240
     tgccgtcggc cacgaagcgt cccccttcgc ctttggggca gaagccgagg tcttccagtt    276300
     gcatgatgac catgatggtg aagttgtcgt agatggacgc atatttgata tccgccggtg    276360
     tcacgccagc ctgggcgaac gccgcgggcg ccgagcgggc ggcgcccgtc accagcaggt    276420
     cttcatggtg gccgccgttg ttggtgcgga tggtctcgcc gtggcccacc accttgatgc    276480
     gcggccgatt caggctgcgc gccacttcgg gcgccacgat caccaatgcg ccgccgccgt    276540
     cggtgatgac gcagcagtcc agccgatgca gcgggtcggc caccatcggc gagcccagca    276600
     cgtcgtccac cgtatagacc ttgcgcagca gcgcgtcggg gttgtgctgc gcgtgatgcg    276660
     aggcggcgac cttgacccat gccagttgct cgctggtcgt gccgtactcg tgcatgtggc    276720
     ggcgcgcgaa attcccgtag atggtgccta tcgtccagcg gtatgccgag tcccatggcg    276780
     ccgagggccg gtccgggccc gggatgcgcg gctcggtacc cgtggcctgg ccctcgctgc    276840
     gcgggcgtcc ggccagggtg atcagggcca ccgagcactt gcctgcggcg atggcatggg    276900
     cggcgtggcc gatctgcgca agataggagc cgcccccgat ctcggtgccg tccacgtgcc    276960
     gcagcgtcag gttcagataa tccaccatat aggcgggccc caggccggcg tcgccggcgc    277020
     agaaataccc gtccacgtcg gcgaaactca ggccggcgtc gtccagcgcg ccgcgcgcgc    277080
     tctccgcatg caattgcgcc acggacttgt ccggcgcatg gcgcagggga tgttcatagg    277140
     cgcccgccac ataggccaga gcgtgtctcg tcatgtctgt ctccatcctc cggctggtcc    277200
     ccgcgccgcg cgatgcgggt cggggctggg ccggaacctg ttatttcggc tgctgtccgt    277260
     gcggcgtcgc ctgcaccttg ggcgtcacgg ccttgtaggc gtaggcaatc cgatgttccg    277320
     cgatagaggg ggacatgggc atcaaagggg tattgacgcg gctgatcagg gtgtcgaatg    277380
     tgtggcgcaa gtcatcggtc tcgatgtcga acaccgtcat gaagcgccat ggatgcgggc    277440
     cggccttcag ctgttcctgc tccagctcga agcgctgccc cgccttgaac cccggcacgg    277500
     ccagcacgtc gggaagatgc tggttcacat accattcatc gaactgatct tccatgccct    277560
     gcgtagggtt ggtaaacacc accaatcgat attcctgcat gctgttgccc ctcctgttgt    277620
     atatggtccc gccgctagat ccggatgccg gagcgccgca ccacctcgcc ccaccggcgg    277680
     tactcggccg cgagaaagtc tttcgcttcc tgcggactcg tcggcatggc gtcgatggcg    277740
     aaattggcca gcgccttgcg cacctcgtcc gtggcgaggg aggcgtgcag cgcggcggcc    277800
     agcctgtcga tgacgtccgc cggcgttccc gctgggacgt aggcagccat ccatccgaga    277860
     acctcgaatc ccggcagcgt ttcggctatg gccggaacgt cgggcagcgc cggcgagcgc    277920
     ttgcggctcg tgacggccag cgcgcgcagg tcgccgttcc tgatcagcgg cagggacggc    277980
     ccgatgttgt tgcaaaggaa ctcgaactgc ccgcccttgg catcggtgaa caactgctgc    278040
     gttcccttgt atggaacgtc cacgatgtcg atgccggctt cctgcttcag cgcctcgagc    278100
     accaggtgcg gagaggtgcc gatgcccgta tggccgaatg cgggcttgcg tcccttcccg    278160
     cggccggctt cgagcagttg cgccagtgtc cgggcgtccg acgcgtgcgt tgccatcacc    278220
     accgaggcga ccccgcccag catggaaatg ggctcgaagt ccgtcagggg ttgataggga    278280
     atgtcggcga tcagatgcgg gttgaccgcc agcgcgcccg acgtggcgag caggatggtg    278340
     tatccgtccg gggccgcctt ggcgacgtaa ttcgtcgcga tggtctggtt gccgcccgtg    278400
     cggttttcga tcaccaccgg ctggcccagg atcttgctca tctcctggcc cagcaggcgc    278460
     ggcaggaagt ccgtcacgcc gccgggcggg ctgggcgaaa tgaaccggat gggcttttgc    278520
     ggaaactcgc cagccatggc gctcatcggc cagcccagag cgggcagggc tgccgcgccc    278580
     aggaccttca gtgcatgtct acgattcatg tctccccctg tcgttatcga tatcggatcc    278640
     ggagcgggcc ggttcggtgg atcaacgaga gcttagatac gcagccataa tgagtaaaat    278700
     actattttta gtcactttga taataaaaac gatatggctg atttcgtggc aagcatgaac    278760
     ctgaagagcc tgcgccactt ctgcgttgtc gccaccgaac tgaacctgcg ccgcgccgcc    278820
     gagcagctcc atatcgcgca gccggcgctg tcggtctcca tcgcgcagct ggagtcgagg    278880
     ctgggcgcca ggctgttcgt gcgcggacgg cgcggcgtca cgctgaccga ggccggcgcg    278940
     ctgctgctgc ccgaagccat gcagatcctg cggcacgccg aaaggctgcc gttcctcgcc    279000
     cgggacgccg caagcggcga cgtcggcacc ctgcggctgg ccttcgtcgg cagcgcaccc    279060
     tatcgcctgc tgccgcaggc attgccgcaa ctgcagcgcg cccacccggg cgtccacgtg    279120
     gagctgtacg aggccaccac cgatcgcatt gtcgaaggcc tgcacaatcg gacgttcgac    279180
     ctgggcatcg tgcgctatcc gctggatgcg tttccgggcc tggagctcga actcgtggac    279240
     gaggacggtt tctgcgtggc gctgccgcac gaccatgcct tggtcgcggc cggggaaatc    279300
     tcgctgcgcg acctggccga cgagccgctg ttgctgccgc cgcgcgaaca ttcgccgccc    279360
     ttgcgcgcgc tcatgctcga gggcttccag gcccagggca tcatgcctcg catcgccaat    279420
     cacatggcca cgcagaccgc gaccgtgctg gcgctggtgg aaatgggcgc cggcatcgcg    279480
     ctggttccgc aatccatcgt gggccgtgtc ggctaccgcg tggcgttccg tccgcttgcc    279540
     ccaggctcgc gattccgtac gggcctggcg ctgctgagca gtccggacca ccacactacg    279600
     ctggcagacc acttccggcg cgcgatccgc cagagcatag gctagggcag gagccgcgga    279660
     tggccgctcg ccggttcgcg gcgcaggaac tcgtccaggc cgggggcggg cgctgtccgg    279720
     aaagaaaagt agccgtgcga agtgaaactc atgccacgta cgtcgagttt tgatagtggt    279780
     acaggcatgt ggatgctagg ccgccagact cgcaaggtgt gcaagcagca ttgacttcgt    279840
     gctacccacg caaacgagag ccccgatacg gattgtccag tcggggctct ctgctgggtg    279900
     cgtcggacgc aatatgcgtc atcaggcagt catggcgaga tgtgcgatgt agctgctccg    279960
     gctttcgccg gcggcgcggg cgcgatcatc caggcgcttg agaatgcggc gcgggatcgt    280020
     gatgttcacg cgctcaacag tttcatccaa gactgcagga tcgacatcag cgatcgccca    280080
     aatccagttg gcaaactctg gattggcctg atgattggcg atgctggtcg ccggaggaat    280140
     gggggcgccg gagtcgatgg ccgtttcaat ccacaactca atggcttcct tggcgttctc    280200
     gattgcttga tcaatccctt cgtccgctgc tgaaaagcag ccgggcagat caggaacaac    280260
     gaccccccag gcgcgcgtgt cgctgccggg ttcaatggca atgggatatt tcacttttct    280320
     gtgctccttg tgtggcatgg actagctgtg aagattcaat aggttgtatg catggttcat    280380
     ccgaaccgga tttgagaaac tggaaatcgc caacctccca gttcactcaa ggagcccggc    280440
     cggatgaaca cccataagca tgcccgattg accttcctac gtcgactcga aatggtccag    280500
     caattgatcg cccatcaagt ttgtgtgcct gaagcggccc gcgcctatgg ggtcaccgcg    280560
     ccgactgtgc gcaaatggct gggccgcttc ctggctcagg gccaggcggg cttggccgat    280620
     gcgtcctcgc gcccgacggt ctcgccccga gcgattgcgc cggccaaggc gctggctatc    280680
     gtggagctgc gccgcaagcg gctgacccaa gcgcgcatcg cccaggcgct gggcgtgtca    280740
     gccagcaccg tcagccgcgt cctggcccgc gccggtctgt cgcacctggc cgacctggag    280800
     ccggccgagc cggtggtgcg ctacgagcat caggcccccg gcgatctgct gcacatcgac    280860
     atcaagaagc tgggacgtat ccagcgccct ggccaccggg tcacgggcaa ccgacgcgat    280920
     accgttgagg gggccggctg ggacttcgtc ttcgtggcca tcgatgacca cgcccgcgtg    280980
     gccttcaccg acatccaccc cgacgagcgc ttccccagcg ccgtccagtt cctcaaggac    281040
     gcagtggcct actaccagcg cctgggcgtg accatccagc gcttgctcac cgacaatggc    281100
     tcggcctttc gcagccgcgc cttcgccgcg ctgtgccatg agctgggcat caagcaccgc    281160
     tttacccgac cttaccgccc acagaccaat ggcaaggccg aacgcttcat ccagtcggcc    281220
     ttgcgtgagt gggcttacgc tcacacctac cagaactccc aacaccgagc cgatgccatg    281280
     aaatcctggc tacaccacta caactggcat cgaccccacc aaggcatcgg gcgcgctgta    281340
     cccatctcca gactcaacct ggacgaatac aacctattga cagttcacaa ctagcaggcc    281400
     ccgattgctt cggggcttgt gtctcacttc aaaccagctg ctttgaggat gctgtttagt    281460
     agtccgatgc cgagatcctt tttagggtga gggacgctga tatgtccggg gcggtctggg    281520
     tgggtgaaaa cgtggtggga tcccttaacg ccccgcagtg tccacccgga ccgctcaagc    281580
     tgcttgatca gttctttgct gtccatgtgt gtactataca cacttttaat gtgtatagta    281640
     cacattaaca aactattttg ccccgcgcga ggtgttgcgc ggggcttttc atttcccctc    281700
     ccgctaccga ggggccgcgc gctgggccgc gtgcgggggg caatctctgg ggcgatggcc    281760
     gccaggacca cccacttgac caaatcaagc cccaccgccc ggcggcggct ttccgttccg    281820
     gtactgcctc gtcgcccgag ccccacctgc gggctgggaa aagctgacca agcaactcaa    281880
     aacagccaaa aaaaatagcc aacttttgaa gttggctatt aggtaaatac ttgatactta    281940
     acggaaattt ggtggagccg gggggaattg aacccccgtc cgcaagccct ccgcaaccag    282000
     ttctacatgc ttagtcgatc tatttggatt taaccctgga cttagccgat cgacgggccg    282060
     gaccagggcg attcacgtaa tttaaaccaa cgccgtgtga ccccagcggt ggccgattcc    282120
     ttgtgaatgt cgctgctgcg gttcggggtt gccccctggg aagttgcctt cccccgcctg    282180
     acccaaggac agatcagtgc agcggctcac cgcttaagcg gcgagagcga aacgctcgtc    282240
     gttggcgttt gtagtgttcc agtggattaa cgagcttact ggtgctcggc atgccctgag    282300
     ctgtttcatg acccacgtcg aatccggatc ggccccaagg ttgacagcca ttgtaccgtt    282360
     aattcggccc gcgcgtcttc atggttcgat gcccggcgcg ggcgccgccg ggcggggcgt    282420
     ggacgggcgc cgcgacagca ccagcgcgat ggccaggccc accgccgcga ggacgatgac    282480
     ggcggcgacc gtgcccaggg acgccaggcc gcggctgtcg atgaagtggc cgcccacggc    282540
     tgcgcccagg ccgatgccga tgttggcgcc cgagatgttc aacgacgcgg cgaaggccgg    282600
     cgcctgcggg gcggccttga tgacgcgcac gtggcagacc gtcagcagcg cggcctgggc    282660
     gacgccccac agcgccagcg cgagcgccag ccagtacggc gcctgcatga cctgggcgac    282720
     gaacagcagg ccggcggtca tgatcaggct gaacaggatg gtggcgccca gcgggctgcg    282780
     gtcgaccagg cgtccgccga gccagttgcc caatatgccg gcgccgccga aggccatcat    282840
     ggtccagccc acgaccttgc cgtcgaagcc ggccaggtgc tcgagcatgt cggccaggta    282900
     ggtgtaggcg gtgaacatgc cggtgaagac aagcagggac agcatcacat ggcccagcag    282960
     cctggggtcg cgcaggatgc gcagttgggt gctcaggcgc tggttctggc gccccgtcct    283020
     cggtttggga aagtaggcca gcagcagggc cttggcccag gccacggcgg tcagcaccgc    283080
     gaaggcggcg cgccagccga aggcgtcgga aaccagcacg ccgatgggaa tgcccaggac    283140
     ggtggcggcg acgatgccga agccgatgat ggatatggcg cgcccggcat aggcggggcc    283200
     gaccagctcg acggcggtgg cgctggccag cgaccagaac acgggcagcg ccagggcggg    283260
     cacgaagcgg gcgaacgcca tgacccagat gttgggcgag acggcggcca gggcattggc    283320
     caggccgaac agcaccagca cccagacgaa caggcgcttg cgttcgagat tggccagcag    283380
     ggcggtcagc accgggccgg cggcggccac cgtgaaggcg aacagcgaca ccagcaggcc    283440
     ggcctgcgac acggtgacct gcaggtcgcg cgccaggggc ggcagcaggc cgacgatcag    283500
     gaattccgtg gtcagaatgg taaagcctgc cgcggacagc agaatgatgg gcaacaacat    283560
     aggattctcc gcgcaccggc gaggcgggcg cgttgggggg aacggttgga cgcgccggcg    283620
     gctgggcggc gccggcgcag gaacgttacg ctagaggaat gcggtgacgg gataaagacg    283680
     gaaatctcgg catgactgtt cgcgtgggtg gagcaatcag tggccgggtg tggcgccggc    283740
     acgggcatgg ggcccgcgcc ggccgtcgcc gaaggtcagg ccgtggcgcg cgtgggcagc    283800
     aagggttcga tggcggacca cagttcgcgc ggcgaagcgg cgcacgcctc ggcctgccag    283860
     gttgtgacgt cttcttccat gccaacgtag ccgtaggccg ccgccaccgc cggcatgccg    283920
     gccgcatggg ccgcctggat gtcgcgcagg tcgtcgccca cgtagacgca tcgcccggcc    283980
     tcgaagccgg cctgctcggc cgcgtgcagc aggggcaggg gatgcggctt ggcgtgggcg    284040
     gtggtgtcgc cgcagaccag caccgcgctg tcgcgcgtca ggcccaggtg ttcgacgatg    284100
     ggcagcgtca ggtaggtgac cttgttggtg acgatgcccc aggacaggcc gcgctgggcg    284160
     atatcctcga gcaggtcggc gatgcccggg aacaggcggc tgtgcacggt ggattcggcc    284220
     gcatagtctt ccaggaactg cagccgcgtc ggctcgtagt cgggatggtc gggcaacagg    284280
     cccagcgcgg cgcgcagcag gccgcgcgcg ccctgggaag ccatcggctg cagcgcttcg    284340
     tagggcatgg gctccaggcc cttgcgagtg cgttgccggt tggcggcggc ggccaggtcg    284400
     ggggccgtat cggccagggt gccgtcgaaa tcgaacagga tgagggcgct catttgcggg    284460
     tggacatcag gtagttgacc gaggtgttgg ccgacagcga atagacctgg gtaatggggt    284520
     tgtactccat gccgcgcatg cccgtgggtt ccaggccggc ctggcgcgcg ctggtggcca    284580
     gttcgctggg cttgatgaag ctgtcgtagc tgtgggtgcc gcgcggcagc aggcgcagaa    284640
     cgtattcggc gccgacgatg gcgaacagga acgacttggg gttgcggttc agggtggaga    284700
     agaacaccca tccgccgggc ttggccagcg cggcgcaggc ccgcacgacg gaggccggat    284760
     ccggcacgtg ttcgagcatt tccatgcagg tcaccacgtc gtactggccc ggctgctcgg    284820
     cggccagttc ctcgacgggc acggcgcggt aatcgacctt cacgccggac tccagcccgt    284880
     gcaggcgggc gatcttgagc gatttctcgg ccaggtcgat gccggtgacc tgcgcgccgg    284940
     ccacggccat gctctccgac aggatgccgc cgccgcagcc catgtccagc acgcgcttgc    285000
     cgctcaggct gccggcggtc tcctggatcc agcccaggcg cagcgggttg atggcatgca    285060
     gcggcttgaa ttcgctttcc gggtcccacc agcgggcggc cagcgcgctg aatttctcga    285120
     cctcggcttg gtcgacgttg acgccggggg cgctggattg ggtggctgtc gtcatgggcg    285180
     cgggggtcgg cgggccgacc ggctctatac aagggtacgg catgccgcgc cgggagggcg    285240
     cggcaagaaa aaagggcctc gctatgcgag gccccctcat tgtagcggct agcgctgcaa    285300
     ttagttcttg cggctaccga cgatttcgat ttccacgcga cggttctggg cacggccttc    285360
     acgcgtcttg ttcgaagcga tcggttgcag ttcgcccttg ccttccgtgt agatacggtt    285420
     ggggtcgata cccttgctga ccaggtaggt cttgaccgca gcggcacggc gctcggacag    285480
     cttctggttg taggcttcgg tgccgatcga gtccgtgtgg ccaacggcga tgatcgtttc    285540
     cagatcgatc gtgccggctt gctgggcgac ttgatccagc agctggcggc cttccggctt    285600
     cagcgtcgac ttgtcgaagt cgaagaaggt gtcagcattg aacacgacct tggcggccat    285660
     gggagcggac ttttccttct gagcgaccgg aacgccgtcg caaccgggga tgccggtagc    285720
     cggggtccag aacgcatcgc gccagcacag ttcattggtg ccgttcttcc aaacgtcgcc    285780
     aaacggattg cgccagttgt ccacggtttg cgcggaagct gcaccagagg ccgtaacagc    285840
     ggcgaaggcg agcgccagag cgaatttgga gggtttgttc atgtttctcc tcgttgagct    285900
     tgaagctgga taagtgactc gcagcgaacc cccgccgcat atcaggaaaa cggggccagt    285960
     atagcaacgc caagaacagg ttcaaaggat cgctactggg tctcctgcgt gctggaaaca    286020
     atcttaaggc atttgggtgg ctttggctgc cctagaccgt tgcattgacc gtggatattg    286080
     agcatttcag ggctcgccgc cttgatcatg ttggtttttg gcaacaaggc ggggaagcgc    286140
     gcaagcaagc ccgccggggc ggccccaaag gaggcaaaaa ggatcgaatg atagaatttc    286200
     ctgtttaccc ggctcgggtt catccttaca tacgattctg tcgcctatat atatggattc    286260
     cttcgccaag gagacgcttc cggtatcgct ggaagaagag atgcgccgta gctatcttga    286320
     ttacgcgatg agcgtgatcg tggggcgcgc gctgccagac gtgcgtgacg gtctcaagcc    286380
     tgtgcatcgc cgcgtgctgt acgcgatgca cgaactgaac aacgattgga accgtgccta    286440
     taagaagtcc gcgcgtatcg tcggggacgt catcggtaag taccacccgc acggcgacca    286500
     gtcggtatac gacaccatcg tccgcatggc gcaggacttc tccatgcgct acatgctggt    286560
     cgacggccag ggcaacttcg gctccatcga cggcgacaac gccgcggcga tgcgctacac    286620
     cgaaatccgc ctggccaaga tcgcgcacga gttgctggcc gatatcgacc aggaaacggt    286680
     cgacttcggg cccaactacg acggcagcga acaggagccc ctgctgctgc cttcgcgcct    286740
     gcccaacctg ctggtcaacg gcagctcggg tatcgccgtg ggcatggcca ccaacattcc    286800
     cccgcacaac ctgcaggaag tggtcgacgg ctgcctgtat tgcctgcgca atccggaatg    286860
     ctcgatcgac gagctgatcg aactgatccc ggcgccggac tttcccacgg gcggggtgat    286920
     ctacggcatc acgggcgttc gcgaggggta ccgcaccggg cgcggccgcg tcatcatgcg    286980
     cgccaagacc cacttcgagg acatggagaa gggcaaccgc caggccatcg tggtcgacgc    287040
     gattccctac caggtcaaca agaagaccct gcaggagcgc atcgccgagc tggtcaacga    287100
     caagaagatc gagggcattt cggacatccg cgacgagtcg gacaaggacg gcatgcgcct    287160
     ggtcatcgag ctcaagcgcg gcgaagtgcc cgaggtggtg ctgaacaacc tgtacaagaa    287220
     tacgcagctg caggacacct tcggcatgaa cctggtggcg ctggtcgacg gccagccgcg    287280
     cctgctgaac ctcaagcagc tgatcgagta cttcctgcag catcgccgcg aagtggtgac    287340
     gcgccgcacc gtgttccagc tgcgcaaggc gcgcgaacgc ggccacgtgc tggaaggcct    287400
     ggcggtggcg ctggccaaca tcgacgactt catcgccatc atcaaggcgg cgcccacccc    287460
     gccggtggcg cgccaggaat tgatggcgcg ttcctgggat tcgtcgctgg tgcgtgaaat    287520
     gctggcccgc gtcgacggcg acgccgccgg cggcgtcgcg gcgttccgcc ccgacgacct    287580
     ggcgcccgag tacggcctgc agggcgatgg caactaccgg ctgagcgaga cccaggcgca    287640
     ggaaatcctc aacatgcgcc tgcaacgcct gaccggcctg gagcaggaca agatcatcgg    287700
     cgagtacaag gacgtgatgg ccaccatcgc cgacctgctc gacatcctgg cccgtccgga    287760
     tcgcatcacc acgatcatca gcgaagagct gcaggccatc aaggccgagt tctcgacctc    287820
     ggccaaggat acgcgccgcg ccgaaatcga agtcaacgcc accgagctgg ataccgaaga    287880
     cctgatcacg ccgatggaca tggtggtcac cctgtcgcat ggcggataca tcaagagcca    287940
     gccgctgtcc gagtaccgtt cgcaaaagcg cggcggacgc ggcaagcagg ctaccgccat    288000
     gaaggagaac gactgggtcg accagctgtt catcgccaat acgcacgact acctgctgtg    288060
     cttctccaac cggggccggg tgtactggct gaaggtgtgg gaggtgccgc agggcacgcg    288120
     caactcgcgc ggcaagccca tcgtcaacat gttcccgctg gccgacggcg agaaggtgac    288180
     cgtggtgctg ccggtcaagg aattcagcga agaccactac gtcttcatgg cgacgtcgcg    288240
     cggcacggtc aagaagaccc cgctgtccga cttctcgaac ccgcgcaagg ccggcatcat    288300
     cgccgtcgac ctggatgacg gcgattacct gatcggcgca gacctgaccg acggcaagca    288360
     cgatgtgatg ttgttctccg acgccggcaa ggcggtgcgc ttcgacgaga acgacgtgcg    288420
     tccgatgggc cgcaatgcgc gcggcgtgcg cggcatgatg ctcgaagagg gccagaccgt    288480
     catcgcgctg ctggtggccg gcgacgagac ccagagcgtg ctgaccgcca ccgagaacgg    288540
     ctacggcaag cgcaccccga tcaccgagta cacccgccat ggccgcggca ccaagggcat    288600
     gatcgccatc cagaccagct cgcgcaacgg ccgcgtggtc ggcgccgtgc tggtgatgcc    288660
     gtccgacgag atcatgctga tcaccaccgg cggcgtgctg gtgcgcaccc gcgtggccga    288720
     gatccgcgag atgggtcgcg ccacgcaggg cgtcacgctg atcagcgtcg atgacggcag    288780
     cagcctgtcc ggcgtgcggc gcgtggtcga aagcgatgcc gacgccgatg acgaggatgg    288840
     cggcgaagag ggcggcgaag agggcggcga ccaaggcggc gacgataccg gcgcccaggg    288900
     caaggattct gaaccgactg aacctacgga gtaatgatgg ctcgcccctg gaatttctcg    288960
     gcaggcccct cggccttgcc cgaggcggtg ctgcagcaag ccgccgccga aatgctggac    289020
     tggcacggca gcggcatgtc cgtgatggaa atgagccacc gcggcaagca cttcgtgcag    289080
     atctgcgacg aggccgaggc cgacctgcgc gaactgctgg gacttccggc cgactacgcc    289140
     gtgatgttca tgcagggcgg cgggctgggc gaaaacgcca tcgtgcccat gaacctgatg    289200
     ggccggcgca gcacgccggc ggccgatttc gtggtgaccg gccactggtc gacccgttcg    289260
     cacaaggaag cgggccgcta cggcgacgcg cagatcgcgg ccagcgccgc cgaggccacc    289320
     gagatcgacg gccaggccca gtcctcctgg acctggctgc cgccggtcga tacctggcgc    289380
     gtgcgcaagg attcggccta tctgcacctg tgcagcaacg aaaccatagg cggcgtcgag    289440
     ttcaccgaat ggcccgatcc ggccagcctg ggcgcgcccg acgtgccgct ggtggtcgac    289500
     gtgtcctcgc atttcctgtc gcgtccgctg gacatcgcgc gcgcggggct ggtgttcgcc    289560
     ggcgcccaga agaacgccgg cccggccggc gtgaccgtgg tcatcgcgcg ccgcgacctg    289620
     ctgggccatg cgctgccgat ctgcccgtcg gcgttcgact atgccaacgt ggcggccgat    289680
     cactcgcgct acaacacgcc gcccactttc gccatctacg tgatgggcct ggtgttcaag    289740
     tggatcaagg cgcacggggg cgtgcgcggc atggaagaag ccaaccgcgc caaggccgag    289800
     ttgctgtatg gctacctgga cggctccgcg ttctaccgca acccggtgca ggcatcggtg    289860
     cgctcgcgca tgaacgtgcc gttcgtgctg cgcgacgaat cgctcaacga tgccttcctg    289920
     caaggcgcgg aagcggccgg cctgatgcag ctcaagggcc acaagagcgt cggcggcatg    289980
     cgggcctcga tttacaacgc catgccgctg gcaggcgtgc aggccctgat cgattacctc    290040
     aaggagttcg agcgccgcca tggatgattc cctgcaggac aagctgcggc cgctgcgcga    290100
     ccgcatcgac gccatcgacg cccagatcct cgacctgctg tcgcagcgcg cgcgcaccgc    290160
     gcaggaagtg ggctcggtca agcacgccgc gcacgcggat ggcccggtgc tgcgccccga    290220
     gcgcgaagcc gaagtgatcc gccgcttgca gtacagcaac ccggggccgt ttcccaaggc    290280
     cgccgtggcc gccgtctgga ccgagatcat gtcggcctgc cgcggcctgg agcgcggcat    290340
     gaccgtggcc tatctggggc cgcagggctc gttctccgaa caggccgcgc tcgagcattt    290400
     cggccattcg gtgcagcagc tgccgtgccc ctcgttcgat gaggtgttcc gcgccgtcga    290460
     ggccgggcag gccgacgtcg gcatggtgcc ggtggaaaac tccaccgagg gcgcggtcaa    290520
     ccgcagcctg gacctgctgc tgaacacgcc gctgacaatc ctgggcgagc gctcgctggt    290580
     gatccgccac tgcctgatga gccagtccgg cacgatggac ggcatcaaga cgatctcggc    290640
     gcatccccag gcgctggcac agtgccaggg atggctgacg cgccattacc cggacctcaa    290700
     tcgcgtggcg gcggccagca attccgaggc tgcccgcgtg gccgccgagg atccgacggt    290760
     cgcggccatc gctggcgaag tcgccgcgcc ggcctggaac ctgcgcgtcg tggccgccgg    290820
     catccaggac gatccgcaga accgcacgcg cttcctggct gtcggccata tcgagccatt    290880
     gagcagcggc aaggacaaga ccagcctgat cctggccgtg cccaaccgcg ccggcgccgt    290940
     ctatgacatg ctggcgccga tggcggccaa cggcgtttcc atgacgcgct tcgaatcgcg    291000
     cccggcgcgc acgggccagt gggaatacta tttctacgtc gacgtgctgg gccatcgcga    291060
     tgacgcgaac gtggcccgcg cactggcggc attgcaggcg caggtggcct tcttcaaggt    291120
     gctgggttcg tatccggcgc aatagggcca cggcgtggtt gacgcacacc aggcggccgc    291180
     cgtgacggag cgtgtgtccg tccggcgctg ccatattgtt tttctgcagg tatgagcgcg    291240
     aacaattcgg caaacgggca ggggcccctg gtccccgtgc tggctgtggc cggcgtaggc    291300
     ttgatcggtg gctcgttcgc cgccgcgttg cgccacgccg ggcaggtcgg caccattctc    291360
     ggcgtgggcc gcaacccggc gtcgctggcg cgtgcgcgcg agctgggcct gatcgacgag    291420
     gccgtctcgc ccgaggaagc ggcggcgcgc gccgacctgg tgctgctgtc caccccggtg    291480
     ggcgggctgg gcgcgatgct ggcgcggatg cgcgaccatc tgcggccggg ctgcctgctg    291540
     accgatgccg gcagcaccaa atcgcaggtc gtcatggcgg cgcgccaggc gctgggcgag    291600
     caggtttcct gtttcgtgcc ggggcatccg atcgccggcg gcgagcgcac cgggcccgag    291660
     gcggccgacg cggggctgta cgtacggcgt gcggtggtgc ttacgcccct gccggagaac    291720
     gcggccgcat cggtggcgcg cgtgcgcgcc tgctggcacg cttgcggggc gcacgtggtc    291780
     gagatggacg acgcggcgca cgaccggctg ctggcctcgg tcagccacat gccgcacttc    291840
     ctggccgccg tctacatggc ccaagtggcc ggctccgatg acgcccaggc gcgcatggat    291900
     ctggccggca gcggttttcg ggatttcacg cgcatcgcgg ccggttcgcc ggaaatgtgg    291960
     cgcgatatct ttttgtccaa ccaggccgcc atgcagtccg agctggcggc cctgcgacgg    292020
     gtgctcgacg aggccgagca ggcattgggc gccggcgacg gcgcgcgcct gcaggccttg    292080
     ctggagcgcg cggcgcacgc gcggcgcaat tggcgcaagg attccaaatg agcggattgg    292140
     catatctcga cctgcccgcg gcgcgcctgg cgcgcggcga ggtggccctg ccgggctcca    292200
     agagcatctc caacagggta ttgctgctgg ccgcgctggc cgaaggcagc accgaaatca    292260
     cgggcctgct cgattccgat gacacccgcg tcatgctggc cgcgttgcgc cagctgggcg    292320
     tatcggtggg cgaggtggcc gacggctgcg tgaccatcga aggcgtggcg cgctttccga    292380
     ccgaacaggc cgagctgttc ctgggcaacg ccggcaccgc gttccggccg ctgaccgcgg    292440
     cgctggcgtt gatgggcggc gattaccgcc tgtccggcgt gccgcgcatg cacgagcggc    292500
     ccatcggcga cctggtcgac gccctgcgcc agttcggcgc cgggatcgaa tacctggggc    292560
     aggcggggta tccgccgctg cgcatcggcg gcggcagcat tcgcgtcgac gggccggtgc    292620
     gcgtggaggg ctcggtgtcc agccagttcc tgaccgcctt gctgatggcc gcccccgtgc    292680
     tggcgcggcg cagcggccag gacatcacca tcgaggtggt gggcgagctg atttccaaac    292740
     cctatatcga gatcacgctc aatctgatgg cgcgctttgg cgtgtcggtg cggcgcgacg    292800
     gctggcgcgc cttcacgatc gcgcgcgatg cggtctaccg cggcccgggc cgcatggcga    292860
     tcgagggcga tgcgtcgacg gcgtcgtact tcctggccct gggcgccatc ggcggcgggc    292920
     cggtgcgcgt caccggcgtg ggcgaggaca gcatccaggg cgacgtggcg ttcgccgcga    292980
     cgctggcggc gatgggcgcc gacgtgcgct atggcccggg ctggatcgag acgcgcggcg    293040
     tgcgggtggc cgagggcgga cgcctgaagg cgttcgacgc tgacttcaac ctgattcccg    293100
     acgccgccat gacggccgcg acgctggcgc tgtacgccga cggcccatgc cgcctgcgca    293160
     acatcggcag ctggcgcgtc aaggagaccg accgcatcca cgccatgcac accgagctgg    293220
     agaagctggg ggcgggcgtg caaagcgggg cggactggct ggaggtggcg ccgcccgagc    293280
     ccggcggctg gcgcgacgcc catatcggca cctgggacga ccaccgcatg gccatgtgct    293340
     tctcgctggc cgcgttcggt ccggcggcgg tgcgcatcct ggatccgggc tgcgtcagca    293400
     agactttccc cgattatttc gacgtgtacg cgggcctgct ggccgcgcgg gactgaacgg    293460
     cgcctgcccc atggctattt tcgcatccgc cggcgccgcg ccggtcatca ccatcgacgg    293520
     ccccacggct tccggcaagg gcaccatcgc gcaccgggta gccaagcagc tgggctggga    293580
     cgtgctcgac agcggcgccc tgtaccggct gaccgccctg gccgcgttgc ggcgcggcct    293640
     gccggccacc gacgagccgg cggtggccgc cgtggcccag gctctggacg tacggttcga    293700
     cgggccgcat gtctacctgg aagggcggga cgccgggcat gaaatccgcc aggaagaggt    293760
     cggaaactac gcttcgcgca tcgccgccta cccgggcgtc cgtcaggcct tgctggagcg    293820
     ccagcgggct ttccggcagc cgccgggcct ggtcgccgac ggccgcgaca tgggggcggt    293880
     cgtgtttcct gatgcgtccc tgaaaatatt tctggtggcc gatgtcgagg cgcgcgcgca    293940
     aagacgctgt aagcagttga tcgaaaaggg aatttctgct aatctagatg acctgctacg    294000
     cgatatgcgt gaacgcgatg cgcgtgacac gcagcgtgcg gtggcaccgc tagccccggc    294060
     tgccgatgcg catgtgctgg attcatctgg cctgaccatc gaacagaccg tgcaggccgt    294120
     gctggatttc tggtgcgcct agccacggcg cgtgttgttt cggcagtatc tgtcagtacc    294180
     tgtttgaggc cctgacggcc aatctccagc ccccacggga caccccgcaa gggcaggcga    294240
     agccggcagg ttctaccact ccactgctgc gggcaatccg ttgcggtgtg ttttgaacgg    294300
     ccaatcccgg ccaaatggat tccaacctaa tgtcttccgt ttccacctcc gccatccttg    294360
     gcggcgaaaa cttcgccgac ctgttcgcag aaagcctcaa gagccaggac atgaagtccg    294420
     gcgaggtcat cagcgcagaa gtcgtgcgcg tcgaccacaa cttcgtggtc gtcaacgccg    294480
     gcctgaagtc cgaagcgctg attcccctgg aagagttcct caacgaccag ggcgaactcg    294540
     aagttcaacc cggcgacttc gtctcggtgg cgatcgattc gctggagaac ggctacggcg    294600
     acaccatcct gtcgcgcgac cgcgccaagc gtctgtcggc ctggctgcaa ctggagcagg    294660
     ccctcgagaa cggcgagctg gtcaccggca cgatcaccgg caaggtcaag ggcggcctga    294720
     ccgtcatgac caacggcatc cgcgcgttcc tgcccggttc gctggtcgac ctgcgtccgg    294780
     tcaaggacac cacgccgtac gaaggcaaga ccctcgaatt caaggtcatc aagctggacc    294840
     gcaagcgcaa caacgtcgtg ctgtcgcgcc gccaggtgct ggaagccagc atgggcgaag    294900
     agcgccagaa gctgctcgag acgctgcacg aaggcgcggt ggtcaagggc gtggtcaaga    294960
     acatcaccga ctacggcgcg ttcgtcgacc tgggcggcat cgatggcctg ctgcacatca    295020
     ccgacatggc ctggcgccgt gtgcgtcacc cgtccgaagt cctgcaagtg ggtcaggaag    295080
     tcgaagccaa ggtgctcaag ttcgaccagg aaaagagccg cgtctccctg ggcgtcaagc    295140
     agctgggcga agatccgtgg gtgggcctgg ctcgccgcta cccgcagggc acccgcctgt    295200
     tcggcaaggt caccaacctg accgactacg gcgcgttcgt cgaagtcgaa gccggcatcg    295260
     aaggcctggt gcacgtgtcc gaaatggact ggaccaacaa gaacgtcgat ccgcgcaagg    295320
     tcgtgaccct gggcgaagaa gtcgaagtca tggtcctgga aatcgacgaa gaccgtcgcc    295380
     gcatttcgct gggcatgaag cagtgccgcc agaacccgtg ggaagagttc gccaccaact    295440
     tcaagcgtgg tgacaaggtc cgcggcgcca tcaagtcgat caccgacttc ggcgtgttcg    295500
     tcggcctgcc cggcggcatc gacggcctgg tccatctgtc cgacctgtcg tggacggaat    295560
     cgggcgagga agccgtgcgc aacttcaaga agggcgacga gctggaagcc gtggtgctgg    295620
     gcatcgatac cgagaaagag cgcatctcgc tgggtatcaa gcagctcgaa ggcgacccgt    295680
     tcaacaactt cgttgccacg cacgacaagg gcgccgttgt tccgggcacc atcaagtcgg    295740
     tcgagcccaa gggcgccgtg atcaccctgt cggtggatgt ggaaggctac ctgcgcgcct    295800
     ccgagatctc ctcgggccgc gtcgaagacg ctaccaccgt gctgaaggct ggcgagaaca    295860
     tcgaagccat gatcgtcaac atcgaccgca aggcgcgttc gatccagctg tcgatcaagg    295920
     cccgcgataa cgccgagacg gccgagacca tccagcgcat gtccgaggcg agcgcttcgt    295980
     cgggtacgac gaacttgggc gcgctgctca aggccaagct ggaccaacag cgcaacgacg    296040
     gttgacgtga ccaagtcgga gctgatcgcc gcgctggcgg cccgctatcc tcagctggcc    296100
     gctcgcgaca ccgattacgc tgtcaagacc atgctcgatg caatgaccca ggccctggcc    296160
     tcgggtcagc gcatcgaaat ccgcgggttt ggcagctttt cgctgtcgca gcgctctccc    296220
     cgtatcgggc gcaatccgaa gtcgggcgaa caagtgctgg tgcctggcaa gcaggtgccg    296280
     cacttcaagg ccggcaagga gctgcgcgag tgggtcgatc tggttggcaa cgatcagggc    296340
     gacgactcgt ccaacgggtc gtccgacccg ctgcaatcgg tcatggatat gcatgccatg    296400
     cactgatgtg ccgcgtacgg cgtcccgcgt ggttggtgtt ctaccggcaa agccccttgc    296460
     ttgttcaagg ggctttgttt tttcgggccg gcgccgcgcc gcggcgaaaa agacggccgg    296520
     cgcatgtgcc gccggccgcg gcaatggcgc cgcttccgct tacaattact cgtcttgaat    296580
     tctttggagc atgcgtcatg cgctacctgg tctgggccct gcgattgctc gtgtttgtgg    296640
     cggttctgat gttcgcgctc aagaacacca atcccgtcgc cgtgactttc tatgccgatt    296700
     acgtggtgca cgacgtaccg ctgatcgtcg tcatgctggt cgtgttcgtc gtcggcgcgc    296760
     tgttcgggct gctgctgacc gtacccgccg ccatgcgccg ccgccgcgag gccctgcgcc    296820
     tgcgccgcga agtcgagcgc ctgcaggcgg ccgccagcgg cacgccgccg gccgtcacgc    296880
     cggaggccgt cgcgccgatg tcgccgctgt aacccggggc gccgtgtccc tacttcctac    296940
     cgagagcccg cgctgtggac tttgaaccct ggtggctgat attcgtgccg gtgctgtttg    297000
     cgctgggctg gctggcggcg cgctttgact tccggcagat gctgcgcgag acgcgcacgt    297060
     tgcccgattc gtacttccgc ggcctgaact tcctgctcaa cgagcaaccc gaccgggcga    297120
     tcgacgcgtt cgtcgaggtc gccaagctgg atcccgaaac caccgagctg cacttcgccc    297180
     tgggcagtct gtttcgccgg cgcggcgaaa tggagcgcgc catccgcgtg caccagagcc    297240
     tactgagccg ctccgacctg ccggtggccg agcgcgagca cgcacagcac gaactggcgc    297300
     aggatttcct gaaggccggc atgctggacc gcgccgaagg ggcgttcgag cagctcaagg    297360
     acacccgcta tgcgctgccc gcgctgcgtt cgctgatccg tatctacgaa tccgagcacg    297420
     actggccgcg cgccatcgag gcggtcaaga ccttgcacgg gctggtcgac gagcccgtgc    297480
     cgcagatcgt gcactactac tgcgagcagg cgcaggccgc gctgacggcc aagccggtgg    297540
     atttcgacgc cgcccatgcc gcgctggacg cggccgacca cgccgccggc atggtcgagc    297600
     gcggcaacgc gccggccaag gcgtcgctgg tgcgcaccgc catgttgcgc gcgcgcctgg    297660
     ccgccctcga gaacgatccc aagcgcgaac gcctgtatct cgaatccatc ctcacgcagg    297720
     cgcccgaatt cgccggactg gtggccgagg ccctgctgac caactaccgg caggccgacc    297780
     aggccgccgc cgggttggcg atgctgcagc agcagtacca gcggcacgcc tcgctggacc    297840
     tcttcaacgt ggtgttccgc gagctgcgcg tgcagcaggg ctcggcgccc gcgtgggcat    297900
     tcgcgcgcga ggcgctgcgc catcatccgt ccctgctggg cctggaccgc ctgctcgagg    297960
     ccgaattggc ctcgcccggc gcgcccgccg acgccgggcc cgtgaccggg gccgacctga    298020
     ccctgctgcg cagcctcatc cataaacata cccagcgcct ggatcgctat gcctgccgca    298080
     gttgcggctt ccaggcgcgc cgcttttact ggcagtgccc cggttgcaat tcctgggaaa    298140
     cctacgcgcc gcgccgcctg gaagaactcg aatgaatcaa taccccgctg aacgcatcgc    298200
     ccgcgcccgc gtgctggtcg tgggcgacgt catgctcgac cgctactggt tcggcgaagt    298260
     cgaccggatt tcgccggaag ctccggtgcc cgtggtgcgc gtggcgcgcc gcgaagaccg    298320
     cctgggcggc gccgccaacg tggcgcgcaa cgtggccgcg ctgggcgccc aggtgacgct    298380
     gatcggggtg gtcggcgccg atgaggtcgg cctccgcatc gagcgcatgg cagccgaaga    298440
     gggcgtgcgc accgacctgg tatccgacac cgaacacccg accacgctga agatgcgcgt    298500
     gctcggccgc cagcagcagc tgctgcgggt ggatttcgag cagcatcccg agccggccgc    298560
     actcgacggc atcagcgccg ccgtggcgcg gcagctggcg cagcacgata tcgtggtgct    298620
     gtccgattac gccaagggcg tgctggaccg ggtcgaatcc atcatcgccg ccgccgtcgg    298680
     ccacagcctg ccggtgctgg tcgaccccaa gggcgaccac tacgagcgct atcgcggcgc    298740
     cacgctggtc acgcccaacc gggccgaaat gcgcgaggcg gtcgggcgct ggaaaaccga    298800
     ggacgaactg gccgagcgcg cccagcggct gcgcctcgac ctggacctgg aggccttgct    298860
     cgtgacgcgg tccgagcagg gcatgaccct ctttaccgac gcggggcgcg accatgccga    298920
     cgccgccgcg cacgaagtct atgatgtatc gggcgccggc gataccgtgc tggcgaccct    298980
     ggccgtcatg cgcgcggtgg gactgtcctg gggcgacgcg atgcgctggg ccaaccgggc    299040
     cggcggcatc gtggtcggca agctgggcac gtcggtggtg accgccgcag aacttgcagg    299100
     agaatcaaca tgatcgtggt gaccggcgcg gccggcttta tcggcagcaa tctggtgcgc    299160
     ggcctgaacc ggcgcggcat ccaggacatc atcgccgtcg acgacctgac cgacggcgac    299220
     aaattccgca acctcgtcga ttgcagcatc gccgactatc tcgacaagga cgagttccgc    299280
     gaacgcgtgc gcggcggcaa cctgccggcc ttgcgtgccg tgctgcacca gggcgcctgc    299340
     tcggacacca ccgagcgcaa cggccgctac atgctggaca acaactaccg cgtcacgctg    299400
     gaactgttcg agtactgcca ggccgagcgc gtgccgttcc tgtacgcctc gtcggccgca    299460
     gtctacggcg gttcgtc