(data stored in SCRATCH zone)

EMBL: BX640416

ID   BX640416; SV 1; linear; genomic DNA; STD; PRO; 349354 BP.
XX
AC   BX640416;
XX
DT   09-AUG-2003 (Rel. 76, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 9)
XX
DE   Bordetella pertussis strain Tohama I, complete genome; segment 6/12
XX
KW   complete genome.
XX
OS   Bordetella pertussis
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Alcaligenaceae; Bordetella.
XX
RN   [2]
RP   1-349354
RA   Sebaihia M.;
RT   ;
RL   Submitted (06-AUG-2003) to the INSDC.
RL   Submitted on behalf of the Pathogen Sequencing Unit, Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA, E-mail:
RL   ms5@sanger.ac.uk
XX
RN   [3]
RA   Parkhill J., Sebaihia M., Preston A., Murphy L.D., Thomson N., Harris D.E.,
RA   Holden M.T.G., Churcher C.M., Bentley S.D., Mungall K.L.,
RA   Cerdeno-Tarraga A.M., Temple L., James K., Harris B., Quail M.A.,
RA   Achtman M., Atkin R., Baker S., Basham D., Bason N., Cherevach I.,
RA   Chillingworth T., Collins M., Cronin A., Davis P., Doggett J., Feltwell T.,
RA   Goble A., Hamlin N., Hauser H., Holroyd S., Jagels K., Leather S.,
RA   Moule S., Norberczak H., O'Neil S., Ormond D., Price C., Rabbinowitsch E.,
RA   Rutter S., Sanders M., Saunders D., Seeger K., Sharp S., Simmonds M.,
RA   Skelton J., Squares R., Squares S., Stevens K., Unwin L., Whitehead S.,
RA   Barrell B.G., Maskell D.J.;
RT   "Comparative analysis of the genome sequences of Bordetella pertussis,
RT   Bordetella parapertussis and Bordetella bronchiseptica";
RL   Nat Genet 35(1):0(2003).
XX
DR   MD5; 85e24c4efce2bf2460d4cc9e357019f3.
DR   ENA-CON; BX470248.
DR   BioSample; SAMEA1705933.
DR   EuropePMC; PMC4504479; 26182210.
DR   EuropePMC; PMC535204; 15574953.
DR   RFAM; RF00005; tRNA.
DR   StrainInfo; 494022; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..349354
FT                   /organism="Bordetella pertussis"
FT                   /strain="Tohama I"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:520"
FT   CDS_pept        189..926
FT                   /transl_table=11
FT                   /locus_tag="BP1646"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa1170 TR:Q9I4G7 (EMBL:AE004547) (244 aa) fasta
FT                   scores: E(): 2.6e-42, 54.27% id in 234 aa, and to Bacillus
FT                   subtilis YjbE protein TR:O31603 (EMBL:Z99110) (218 aa)
FT                   fasta scores: E(): 2.6e-26, 46.66% id in 180 aa. Also
FT                   similar to BP2538 (69.456% identity in 239 aa overlap), and
FT                   to BP2539 (45.982% identity in 224 aa overlap)."
FT                   /db_xref="GOA:Q7VXT7"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXT7"
FT                   /protein_id="CAE41934.1"
FT                   /translation="MVEAIETFHWGAIFQIVLIDILLGGDNAVVIALACRNLPHRQRIK
FT                   GILWGTAGAVLLRVLLIAFALVLLDIPFLKALGCLLLVWIGVKLLAPHEDAHGNITGGT
FT                   SVLAAIRTIILADFAMSLDNVIAIAGAAQNAQADHQLYYVIFGLCVSVPIIVWGSTLVL
FT                   KLIDRFPLVVTLGAGLLGWIAGGMLITDIYVVERWGEPAPMLKLAVEAAGALVVVAAGK
FT                   WLAARRRHARPTHDESASTTPGG"
FT   misc_feature    join(219..287,324..392,609..677,696..764,807..866)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BP1646 by TMHMM2.0 at aa 11-33, 46-68, 141-163, 170-192 and
FT                   207-226"
FT   repeat_region   923..954
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   923..1975
FT   CDS_pept        1025..1975
FT                   /transl_table=11
FT                   /locus_tag="BP1647"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTC0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTC0"
FT                   /protein_id="CAE41935.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHN"
FT   misc_feature    1283..1348
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    1406..1939
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(1944..1975)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        1972..2163
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1648"
FT                   /product="putative branched chain amino acid transport
FT                   permease (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. This CDS is the C-terminal region of
FT                   BP2088. Similar to the C-terminal regions of Escherichia
FT                   coli high-affinity branched-chain amino acid transport
FT                   system permease protein LivM or b3456 SW:LIVM_ECOLI
FT                   (P22729) (425 aa) fasta scores: E(): 0.035, 42.3% id in 52
FT                   aa, and to Streptomyces coelicolor putative branched chain
FT                   amino acid transport permease Sc7h2.24 TR:Q9S2J3
FT                   (EMBL:AL109732) (608 aa) fasta scores: E(): 5.6e-05, 44.82%
FT                   id in 58 aa"
FT   misc_feature    join(1984..2052,2065..2133)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BP1648 by TMHMM2.0 at aa 5-27 and 32-54"
FT   CDS_pept        2160..2942
FT                   /transl_table=11
FT                   /gene="livG"
FT                   /locus_tag="BP1649"
FT                   /product="high-affinity branched-chain amino acid
FT                   transport, ATP-binding protein"
FT                   /note="Similar to Escherichia coli high-affinity
FT                   branched-chain amino acid transport ATP-binding protein
FT                   LivG or B3455 or Z4825 or Ecs4302 SW:LIVG_ECOLI (P22730)
FT                   (255 aa) fasta scores: E(): 3.2e-33, 46.58% id in 249 aa,
FT                   and to Deinococcus radiodurans branched-chain amino acid
FT                   ABC transporter, ATP-binding protein Dr0283 TR:Q9RXM7
FT                   (EMBL:AE001889) (290 aa) fasta scores: E(): 7.8e-35, 47.65%
FT                   id in 256 aa"
FT                   /db_xref="GOA:Q7VXT6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXT6"
FT                   /protein_id="CAE41937.1"
FT                   /translation="MSLLEIHGLGITFGGLRAVHDVAFSVEPGEIVSVIGPNGAGKTTL
FT                   FNMISGIYRPGAGRVVLDRDDVTGMAPFRLARRGMSRTFQNLQIFQNMTVLENAIAGFH
FT                   LQEQGALLSDLFNLRASRARARRAEEGARALLQRVGLERAAEREAASLSYGSLKRLEIA
FT                   RALALQPKVLLLDEPAAGCNAVETEEIDHLIAEVAATGVAILLVEHDMKMVMRISNHIV
FT                   VLDHGEKIAEGPPDAISRDPAVIAAYLGTDSQPGDRPC"
FT   misc_feature    2244..2840
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    2265..2288
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        2936..3637
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="BP1650"
FT                   /product="high-affinity branched-chain amino acid
FT                   transport, ATP-binding protein"
FT                   /note="Similar to Escherichia coli high-affinity
FT                   branched-chain amino acid transport ATP-binding protein
FT                   LivF or B3454 SW:LIVF_ECOLI (P22731) (237 aa) fasta scores:
FT                   E(): 1.9e-34, 46.12% id in 232 aa, and to Streptomyces
FT                   coelicolor putative branched chain amino acid transport
FT                   ATP-binding protein Sc7h2.26 TR:Q9S2J1 (EMBL:AL109732) (238
FT                   aa) fasta scores: E(): 4.3e-42, 55.55% id in 234 aa"
FT                   /db_xref="GOA:Q7VXT5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXT5"
FT                   /protein_id="CAE41938.1"
FT                   /translation="MLTVQGLRSCYGRIEVLHGIDLQVDSGEIVTVVGANGAGKTTLLR
FT                   CLSGVQPVSAGAITFRGEALAAVPAHRRLARGLAHSPEGRQIFTNLSVEENLRLGAYLY
FT                   ADDRVERDMDDAFQMFPILREKRHLAAGGLSGGQQQMLAMARALMGRPSCLLLDEPSMG
FT                   LAPIIVQQIFDVIRGLKALGVTVLLIEQNAYGALQIADRGYVMETGNITMQGAASALIA
FT                   DPRIRAAYLGI"
FT   misc_feature    3014..3562
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    3035..3058
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    3335..3379
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   CDS_pept        3877..4479
FT                   /transl_table=11
FT                   /locus_tag="BP1651"
FT                   /product="putative TetR-family transcriptional regulator"
FT                   /note="Similar to Bacillus halodurans transcriptional
FT                   regulator Bh2958 TR:Q9K8P5 (EMBL:AP001517) (215 aa) fasta
FT                   scores: E(): 8e-09, 28.1% id in 185 aa, and to Pseudomonas
FT                   fluorescens putative transcriptional regulator Pfi2
FT                   TR:Q9RFR4 (EMBL:AF173683) (207 aa) fasta scores: E():
FT                   1.2e-07, 24.06% id in 187 aa"
FT                   /db_xref="GOA:Q7VXT4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXT4"
FT                   /protein_id="CAE41939.1"
FT                   /translation="MARTRSADYENIRDTIIERAAAMFARQGYSETSIGDIARACECSK
FT                   SRLYHYFDSKEAVLRDMLTTHVDSLLERCRQVLYGSNEPKTRFLQIVKLFLEIYATSRD
FT                   RHVVMLTCLDALPEDQRKALIAKQRELIAYVRDALLQLRPDMAANRTLAHVDTMLFFGM
FT                   INWTYTWYKADGSVSPDALAERTVQLFLDGYLNLPSA"
FT   misc_feature    3922..4062
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family"
FT   misc_feature    3970..4035
FT                   /note="Predicted helix-turn-helix motif with score 1762
FT                   (+5.19 SD) at aa 32-53, sequence TSIGDIARACECSKSRLYHYFD"
FT   CDS_pept        complement(4455..5369)
FT                   /transl_table=11
FT                   /locus_tag="BP1652"
FT                   /product="putative oxidoreductase (Partial)"
FT                   /note="Partial CDS, it lacks the N-terminal region. Similar
FT                   to Pseudomonas putida putidaredoxin reductase camA
FT                   SW:CAMA_PSEPU (P16640) (422 aa) fasta scores: E(): 5.1e-34,
FT                   40.98% id in 283 aa, and to Rhizobium meliloti putative
FT                   oxidoreductase protein smc00914 TR:CAC45363 (EMBL:AL591785)
FT                   (405 aa) fasta scores: E(): 6.1e-47, 50.5% id in 299 aa"
FT                   /db_xref="GOA:Q7VXT3"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXT3"
FT                   /protein_id="CAE41940.1"
FT                   /translation="MTTGAAPRPLPAAFAGRSNVFELRNLADVQRLQPAFLAGRRLLVL
FT                   GGGYIGLETAAVAAQAGLSVQVVERASRVLERVACPATAAAIRALHQRHGVLIHEGRTV
FT                   AGTEGDEALTGVELDNGLRIACDLVVAGVGVAPQTALAEAAGIDCDDGILVDAYGRTSA
FT                   PDVWAAGDCARFVLGGEPARLESVQNAIDQAEAVADDMLGQGRPYQPVPWFWSDQYDMK
FT                   LQIVGLNRGYDAVVSHASAKGESHWYFRADRLISVDALNDGRAYMVGKKLLEAGRAVGR
FT                   GEVERPGFEPMQLLRDQAEGRLR"
FT   misc_feature    complement(4854..5363)
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT   misc_feature    complement(5151..5216)
FT                   /note="Predicted helix-turn-helix motif with score 988
FT                   (+2.55 SD) at aa 52-73, sequence LETAAVAAQAGLSVQVVERASR"
FT   variation       complement(5370..5372)
FT                   /note="There is a large deletion in pertussis, relative to
FT                   parapertussis and bronchiseptica, upstream this codon"
FT   repeat_region   5704..5735
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   5704..6756
FT   CDS_pept        5806..6756
FT                   /transl_table=11
FT                   /locus_tag="BP1653"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q79H25"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H25"
FT                   /protein_id="CAE41941.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT"
FT   misc_feature    6064..6129
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    6187..6720
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(6725..6756)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(6753..8309)
FT                   /transl_table=11
FT                   /gene="wcbQ"
FT                   /locus_tag="BP1654"
FT                   /product="putative capsular polysaccharide biosynthesis
FT                   protein"
FT                   /note="Similar to Rhizobium meliloti capsular
FT                   polysaccharide biosynthesis protein RkpI or R00574 or
FT                   smc02270 SW:RKPI_RHIME (Q52938) (538 aa) fasta scores: E():
FT                   1.9e-18, 29.24% id in 489 aa, and to Burkholderia mallei
FT                   WcbQ TR:Q9AI31 (EMBL:AF285636) (511 aa) fasta scores: E():
FT                   6e-45, 39.2% id in 500 aa"
FT                   /db_xref="GOA:Q7VXT2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXT2"
FT                   /protein_id="CAE41942.1"
FT                   /translation="MAETFWLALAPAWAGGLVLSWALEALLRPPVQPPWRRPAWMLLLH
FT                   AGVWTLLFALELALFRRPYFGAINVLAIEAVLVLVSAAKARVLREPFVYSDFEYFTDAL
FT                   RHPRLYLPFLGWPAALLLACGYGLALWAGLALESSATGARTAAWAAHAAPAPFWGATLA
FT                   LAAAGAALAVLAGHRDAGLTYEADQDLRRLGLVATLWLYGRAERQPWTPAMRSGPFGAA
FT                   PAAAGAGPLPHLVSVQSESFFDARRVFGTLKPEVLAGLDALRAEALEHGQLEVAAWGAN
FT                   TVRTEFAFLTGLAASALGVHRYNPYRRLRQPQPSLASHLRQRGYRTVCVHPFHASFYGR
FT                   DRVMPWLGFDEFVHLDAFADAPRAGPYVADAALARYVAERLAGQGSQPLYVHVITMENY
FT                   GPLHWESVDAADAAAVLDGPLAPGCADLVAYARHLRNADAMFTGLAAAMRGLSRPAGLC
FT                   VYGDHVPIMAEVYRRLGEPDGRTDYLIWQAGGQGSAAPGLRRVDELAQVFLRHMGLAPP
FT                   G"
FT   misc_feature    complement(join(7779..7844,7905..7970,8049..8114,
FT                   8130..8195,8241..8294))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BP1654 by TMHMM2.0 at aa 5-23, 38-60, 65-87, 113-135 and
FT                   155-177"
FT   misc_feature    complement(7893..7940)
FT                   /note="ScanRegExp hit to PS00453, FKBP-type peptidyl-prolyl
FT                   cis-trans isomerase signature 1."
FT   misc_feature    complement(8244..8309)
FT                   /note="Signal peptide predicted for BP1654 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.701) with cleavage site
FT                   probability 0.627 between residues 22 and 23"
FT   CDS_pept        complement(8302..9075)
FT                   /transl_table=11
FT                   /gene="wcbP"
FT                   /locus_tag="BP1655"
FT                   /product="putative oxidoreductase"
FT                   /note="Similar to Myxococcus xanthus hypothetical
FT                   oxidoreductase in uraA 5'region SW:YURA_MYXXA (P25970) (258
FT                   aa) fasta scores: E(): 1.4e-15, 39.35% id in 216 aa, and to
FT                   Burkholderia mallei WcbP TR:Q9AI32 (EMBL:AF285636) (262 aa)
FT                   fasta scores: E(): 2.1e-33, 44.26% id in 253 aa"
FT                   /db_xref="GOA:Q7VXT1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXT1"
FT                   /protein_id="CAE41943.1"
FT                   /translation="MRSNWPACVLLTGASGEIGRALALEYAAPGVRLILQGRRLGRLDE
FT                   LVGLCRERGATLSVAAFDIRATERLLAWLEEVNATHPPDLAIINADVNIDIGPDRAGER
FT                   WEDVCMVMDTNLRAAQATVHGLLPAMRARGQGQIALMSSLAAWRGLPDTPSYSASKAAV
FT                   KAYGEALRDWLAPQGVRVNVIMPGYVASPMCAAMPGPKPFLWPPGKAARAIRRGLAANR
FT                   ARISFPFPLNLGCWFLGLAHPAVSSRLLRWLGYGG"
FT   misc_feature    complement(8500..9057)
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase"
FT   misc_feature    complement(8563..8649)
FT                   /note="ScanRegExp hit to PS00061, Short-chain
FT                   dehydrogenases/reductases family signature."
FT   misc_feature    complement(9007..9075)
FT                   /note="Signal peptide predicted for BP1655 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.970) with cleavage site
FT                   probability 0.957 between residues 23 and 24"
FT   CDS_pept        complement(9134..10084)
FT                   /transl_table=11
FT                   /locus_tag="BP1656"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q79H25"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H25"
FT                   /protein_id="CAE41944.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT"
FT   repeat_region   9134..9165
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(9134..10186)
FT   misc_feature    complement(9170..9703)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(9761..9826)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   CDS_pept        10189..11136
FT                   /transl_table=11
FT                   /locus_tag="BP1657"
FT                   /product="putative exported protein (Pseudogene)"
FT                   /note="No significant database matches"
FT                   /protein_id="CAE41945.1"
FT                   /translation="MRPGPWLMALAACAVASSAWGQQGLRLSKDDLQKRANGVLALMSF
FT                   SIVPDITTSALNIAGGGGSTSGSTEFYMTQLGGGDTISKSVPLYLEGVLAASRYDPTFV
FT                   ATQGADSRRIPAKWNSVSATGGIGWDFPLTDELKLRPIFNVALGNVTSDLRAASWYVGR
FT                   QTGQDVDFLDRGSLNAYGLGGSLMLDYEHYRPGYEVDVELRYSDIRLRSFDSSAAVRGQ
FT                   ATAQSANLWARYRAPTGATLLQRPLRYVLELTHSEFLGDQRGVLGFDRLTSVGAGLELD
FT                   SSAYDVFVTRTRLVGRYVFGNNVSGFSVGLAVSF"
FT   CDS_pept        complement(11190..12983)
FT                   /transl_table=11
FT                   /locus_tag="BP1658"
FT                   /product="probable two-component sensor histidine kinase"
FT                   /note="The C-terminal region of this CDS is Similar to
FT                   Deinococcus radiodurans sensor histidine kinase Dr0577
FT                   TR:Q9RWT8 (EMBL:AE001916) (590 aa) fasta scores: E():
FT                   1.4e-05, 31.27% id in 227 aa, and to Pseudomonas aeruginosa
FT                   probable two-component sensor pa1979 TR:Q9I2C8
FT                   (EMBL:AE004624) (216 aa) fasta scores: E(): 1.6e-06, 32.38%
FT                   id in 176 aa"
FT                   /db_xref="GOA:Q7VXS9"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXS9"
FT                   /protein_id="CAE41946.1"
FT                   /translation="MRRAWAVLAWLWLALPAAVLAEPRHVTTAQFLLQDEAAAAAPDLV
FT                   PARGPPGDWQSVALPHAGLQRRVVPDPQAGDAALAWYRLDLDAGGVDDPVLYLPRWQTV
FT                   GRLAVYGDGKLLYRSGGSAQWSGFNRPVWLPLAAGGAPPATLLLLRISSLDGAGAGLST
FT                   VWVGAAGELRWRYELRRWLQQDLPYLASAVFLALGLFALGVWAVRRKESIYGLFFAASV
FT                   VFYLRCLHYHAGPFQLLLDDEWFSWLTITSVGWLAIASYFFAFRLHGRAYPRSERAMLA
FT                   GMGALTAAMLPVWQIHPHLVLLAPLAYLGITVVALFACLLAVWGAWRARSRDGLVLACW
FT                   NLAAIPVAVHDMLLQNYRLSMEHVYLLPYTGIGMFVIFLYVAYRRYVNALAQAAGAQAT
FT                   LQRRLAERERELERSHRRLREIERTRILAGERERLMQDMHDGLGSSLVSALRMVQHGNS
FT                   SEGAVAQVLQECLDDLRLTIDSLEPAQTDLALLLATLRFRLGPRLQAAGLALDWRVGPL
FT                   PPVSWLTPPAALHVLRILQEVFTNILKHARARRLTVSTRLEPAHAVIAVIDDGAGFRGG
FT                   RPAPAAASPGRGLSGMQARIL"
FT   misc_feature    complement(11265..11402)
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, phytochrome-like ATPase"
FT   misc_feature    complement(join(11835..11891,11922..11978,12000..12065,
FT                   12096..12149,12189..12251,12282..12347,12363..12419))
FT                   /note="7 probable transmembrane helices predicted for
FT                   BP1658 by TMHMM2.0 at aa 188-207, 212-234, 244-265,
FT                   278-296, 306-328, 335-354 and 364-383"
FT   misc_feature    complement(12921..12983)
FT                   /note="Signal peptide predicted for BP1658 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.984 between residues 21 and 22"
FT   CDS_pept        complement(12997..13671)
FT                   /transl_table=11
FT                   /locus_tag="BP1659"
FT                   /product="response regulatory protein"
FT                   /note="Similar to Streptomyces reticuli response regulatory
FT                   protein SenR TR:Q9RIM0 (EMBL:Y14336) (217 aa) fasta scores:
FT                   E(): 1.8e-15, 34.52% id in 223 aa, and to Streptomyces
FT                   coelicolor AbsA2 or Sce8.19 TR:Q53894 (EMBL:U51332) (222
FT                   aa) fasta scores: E(): 3.9e-16, 30.88% id in 204 aa"
FT                   /db_xref="GOA:Q7VXS8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXS8"
FT                   /protein_id="CAE41947.1"
FT                   /translation="MQTCTPARPAGSLRIAIVEDDPAFRHAVVAAIAHEPGMSVLAQAQ
FT                   TCADALAMLQGPPADVLLVDLGLPDGSDIDVIWQARRLWRDCGIMVNTMFGDDVHVLRS
FT                   IEAGACGYLLKDSEPAGIVRDICALRDGGSPISPLIARQLLDRLREGLPPAEPPAATAL
FT                   SPRERQVLERITLGYTYDEIASELEVSRHTVQTFVRRIYRKLQVHSKVDAINAAPGLRP
FT                   HE"
FT   misc_feature    complement(13003..13194)
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR family"
FT   misc_feature    complement(13060..13143)
FT                   /note="ScanRegExp hit to PS00622, Bacterial regulatory
FT                   proteins, luxR family signature."
FT   misc_feature    complement(13075..13140)
FT                   /note="Predicted helix-turn-helix motif with score 995
FT                   (+2.58 SD) at aa 178-199, sequence YTYDEIASELEVSRHTVQTFVR"
FT   misc_feature    complement(13294..13635)
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain"
FT   CDS_pept        13840..16875
FT                   /transl_table=11
FT                   /gene="sphB2"
FT                   /locus_tag="BP1660"
FT                   /product="autotransporter"
FT                   /note="sequence contains 6 Ns. to be corrected"
FT                   /db_xref="GOA:Q7VXS7"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXS7"
FT                   /protein_id="CAE41948.1"
FT                   /translation="MPARAARAGLLLAGALACSAAAHAELLGVDGGGPSGGAGASGPGL
FT                   AGQPGNGPAPGLGGDRTMPRPGGNGGAGGGAGAASGGSELIHYGGGGGGSDSGGGGGIA
FT                   IIDPMGAAGGNGGGVAQALSAGADLQSSRGGAGDDGGAMSSGSEPGGGGGGGGSGAAVL
FT                   AGGGYRALAVSIVGGRGGAGGAGFESGGGGGGGHGIRIDAADVRIELLATQAAGGQGGD
FT                   GGAGSGSSGGGGDGGHGLAGAANDLRLHVAADSTLRGGDGGASRPVTHRAGAGGPDGTG
FT                   LSLSASRWQVKTAGLIQGGNGGRGEASREFDGGKGGAGGAGLALAGNMGTLHNRGRIQG
FT                   GQGATGGTSVLAAPGAAGAGGVGVRIAGNGNRLVNAGRIAGGASADGQQADAVRIDGAG
FT                   NTFELHAGSVLQGNAVATGSANVLALGGAQPGVFDVSALAAGAPAAWSGVPRYAGFAAY
FT                   EKTGAGTWRLTGGNAAALSWTVRAGRLAVDAEMAGSAMTVAAGGTLGGTGTVGDTTVRA
FT                   GGALAPGNSIGTLRVAGDLVFEPGSRFEVEADPDGTASDRVVVSGTADIRGGAVLHVGP
FT                   EGGFEARQRYVILTAGQRRGQFDAVGSGYAYLAPALSYDATSVALILQRRGAPGSGDLA
FT                   FADLADTANQRATARAVETLPAAHPVYRAIETLPEGAPPAAFDALSGEVHASTRSALLT
FT                   GARQAQRVNLGRLRDHLGLAWQAGAPMAASGGAPGAAALPGAPSPAWAEVVGAWQRLDG
FT                   DGNAAQVRQHVGGLFVGADTALANGWRVGGSLGFTDGRIEVDARASQTDVASYTAALYG
FT                   GRAWDAGAGRLNLLAGAAYTWHDIASERRVDVGDLRQELTADYGASTTQLFTELSYAMP
FT                   LGMTAELEPFAGLAWNQLRVRGFTETGGSAALSGASSRDDMAITTLGARVAAPLGAGAT
FT                   LRAMAGWRHAFGDRTPQSTLAFGQGSAFEVAGAPIARDAALLGVGAGIEVARNAFLDAA
FT                   YAGEFGGGNRQHTASVVLRWRF"
FT   misc_feature    13840..13911
FT                   /note="Signal peptide predicted for BP1660 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.974 between residues 24 and 25"
FT   misc_feature    13861..13893
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    15877..15963
FT                   /note="ScanRegExp hit to PS00402, Binding-protein-dependent
FT                   transport systems inner membrane comp. sign."
FT   CDS_pept        complement(16889..17188)
FT                   /transl_table=11
FT                   /locus_tag="BP1662"
FT                   /product="putative DNA-binding protein"
FT                   /note="Similar to Vibrio cholerae hypothetical protein
FT                   Vca0469 TR:Q9KMA5 (EMBL:AE004379) (104 aa) fasta scores:
FT                   E(): 7.4e-05, 33.69% id in 92 aa, and to Agrobacterium
FT                   tumefaciens Agr_c_3184p TR:AAK87504 (EMBL:AE008095) (95 aa)
FT                   fasta scores: E(): 3.6e-05, 32.94% id in 85 aa"
FT                   /db_xref="GOA:Q7VXS6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXS6"
FT                   /protein_id="CAE41949.1"
FT                   /translation="MKKDNTVFNDLQASLKQAVAIRQGKMPPSRVFKVETVDVKATREK
FT                   THMSQTEFAKAIHVSVRTLQNWEQGHRNPTDPAMALLKIVASAPDIAVRALRTA"
FT   misc_feature    complement(16901..17074)
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix"
FT   misc_feature    complement(16982..17047)
FT                   /note="Predicted helix-turn-helix motif with score 2270
FT                   (+6.92 SD) at aa 48-69, sequence MSQTEFAKAIHVSVRTLQNWEQ"
FT   CDS_pept        complement(17191..>17385)
FT                   /transl_table=11
FT                   /locus_tag="BP1663"
FT                   /product="conserved hypothetical protein (partial)"
FT                   /note="Partial CDS (lacking the N-terminal region). Similar
FT                   to Vibrio cholerae hypothetical protein Vca0468 TR:Q9KMA6
FT                   (EMBL:AE004379) (110 aa) fasta scores: E(): 0.00013, 37.73%
FT                   id in 53 aa, and to Rhizobium meliloti hypothetical protein
FT                   Smc01995 TR:Q92MY0 (EMBL:AL591790) (128 aa) fasta scores:
FT                   E(): 0.0066, 34.92% id in 63 aa"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXS5"
FT                   /protein_id="CAE41950.1"
FT                   /translation="RGGGGIRKMHYGRQGTGKRGGIRVIYYWISQDCQIYMLAAYAKSK
FT                   KINLTPDEIAALRELVKEL"
FT   variation       complement(17383..17385)
FT                   /note="There is a ~100 bp deletion (upstream of this codon)
FT                   in pertussis relative to parapertussis an bronchiseptica"
FT   CDS_pept        complement(17503..18126)
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="BP1664"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="Similar to Escherichia coli glutathione
FT                   S-transferase Gst or B1635 or Z2647 or Ecs2344 SW:GT_ECOLI
FT                   (P39100) (201 aa) fasta scores: E(): 8.3e-17, 34.15% id in
FT                   202 aa, and to Rhizobium meliloti putative glutathione
FT                   S-transferase protein TR:CAC45528 (EMBL:AL591785) (206 aa)
FT                   fasta scores: E(): 3.8e-45, 57.71% id in 201 aa"
FT                   /db_xref="GOA:Q7VXS4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXS4"
FT                   /protein_id="CAE41951.1"
FT                   /translation="MSRWTFYTAPGTCALATHIALHEAGADFDLVKLDFGATQQQSPDY
FT                   LRVNPKGRVPALATEHGVLTENPALLAFIAQSFPQAQLAPLGDPFAFARMQELANYLAS
FT                   TAHVAHAHKRRGARWADDPAAHEAMRAKIPENMTAIAGYLESQIIGPWALGERFSVVDG
FT                   YLYTVGSWMEGDSVDMTRFPKLADYLARVGARPAVQRALAEMNG"
FT   misc_feature    complement(17539..18117)
FT                   /note="HMMPfam hit to PF00043, Glutathione S-transferase,
FT                   C-terminal domain"
FT   CDS_pept        18370..19239
FT                   /transl_table=11
FT                   /gene="tfdA"
FT                   /locus_tag="BP1665"
FT                   /product="alpha-ketoglutarate-dependent
FT                   2,4-dichlorophenoxyacetate dioxygenase"
FT                   /EC_number="1.14.-.-"
FT                   /note="Similar to Alcaligenes eutrophus
FT                   alpha-ketoglutarate-dependent 2,4-dichlorophenoxyacetate
FT                   dioxygenase TfdA SW:TFDA_ALCEU (P10088) (287 aa) fasta
FT                   scores: E(): 3.2e-37, 43.21% id in 280 aa, and to
FT                   Alcaligenes denitrificans 2,4-d dioxygenase TfdA TR:Q9KX47
FT                   (EMBL:U32188) (287 aa) fasta scores: E(): 2.3e-34, 41.28%
FT                   id in 281 aa"
FT                   /db_xref="GOA:Q7VXS3"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXS3"
FT                   /protein_id="CAE41952.1"
FT                   /translation="MTITITPIQGEIAASIGGIDVRRGVTDDQVQAIERALDQYIVVVL
FT                   RGQPLDDDLQQDFIQRFGPAIVTNTIKELTSRRSHRPHLLDITTVDEHGEPLKDRSFMK
FT                   LYMLANQLWHSDGSHIQPPTRLTALSTRMLPSDPPDTEFADMRAAWDALPADQQEQLLD
FT                   LQAEHSIAHSRTLLGMEVDQFSDDSLNRRPPVQHSLVRTNPRTGRRSLYLSGHASHIIG
FT                   WPVEQGRALLQQLTEHATQRQFVYAHAWQMDDLVMWNNAASMHRALPYTGTEPRLLRWS
FT                   GVTELEPV"
FT   misc_feature    18649..18696
FT                   /note="ScanRegExp hit to PS00589, PTS HPR component serine
FT                   phosphorylation site signature."
FT   misc_feature    19171..19188
FT                   /note="ScanRegExp hit to PS00343, Gram-positive cocci
FT                   surface proteins 'anchoring' hexapeptide."
FT   CDS_pept        complement(19217..20161)
FT                   /transl_table=11
FT                   /locus_tag="BP1666"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator Pa2115 TR:Q9I200 (EMBL:AE004639)
FT                   (317 aa) fasta scores: E(): 2.2e-09, 22.48% id in 298 aa,
FT                   and to Rhizobium meliloti LysR family transcriptional
FT                   regulator, probable Sma0557 TR:AAK64948 (EMBL:AE007221)
FT                   (295 aa) fasta scores: E(): 3.3e-07, 26.15% id in 260 aa"
FT                   /db_xref="GOA:Q7VXS2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXS2"
FT                   /protein_id="CAE41953.1"
FT                   /translation="MKLPTPVQIETICTVDRLRTFTAAAAYLHTTQSAISARVREVEEM
FT                   LGVILFKRNGRNVETTLDGRRFVEATAPLQQRLADFMGTFLEPHAISGRIRLAVGNSSM
FT                   GRVSSMLSAIEKVLPNICFDLEVMYAAEILRDLEAGRTDIGVFHTPSRLDSKLFIHTSI
FT                   GTEPTQWLMSGALRADFERRSPGFGLQTLLDHCQIWCVPKPAFYFDQAIESIASHGGKI
FT                   RRLSTSGNMPATVDILLAHGGIGLITDHLSQAHCQNGSLVAAFDGISPPGFDYVLACAR
FT                   SRQSHLLGTVMEIATAAVHAGAAAPALRPVPAR"
FT   misc_feature    complement(19724..20140)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    complement(20012..20104)
FT                   /note="ScanRegExp hit to PS00044, Bacterial regulatory
FT                   proteins, lysR family signature."
FT   misc_feature    complement(20042..20107)
FT                   /note="Predicted helix-turn-helix motif with score 1557
FT                   (+4.49 SD) at aa 19-40, sequence RTFTAAAAYLHTTQSAISARVR"
FT   CDS_pept        complement(20247..21218)
FT                   /transl_table=11
FT                   /locus_tag="BP1667"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Sma1927 TR:Q92Y30 (EMBL:AE007292) (330 aa) fasta scores:
FT                   E(): 4.3e-37, 36.66% id in 300 aa, and to Pseudomonas
FT                   putida hypothetical 34.5 kDa protein in clcB-clcD
FT                   intergenic region precursor SW:YCLC_PSEPU (Q47100) (329 aa)
FT                   fasta scores: E(): 8.6e-37, 37.82% id in 312 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXS1"
FT                   /protein_id="CAE41954.1"
FT                   /translation="MLPRNILLACSGIVGMLAVPAHSDQAYPSQPIRIIVPIAAGGSTD
FT                   VLARSVAQELGKTLGATVVVENKPGAAGAIGAQAVARAAPDGYTLLLTSPDPITVLPNY
FT                   KSNLHYDAAADFAPIQLIAEINYVFATRTDFPAQDLAAFLKMAQQSPGKYTFSSAGTGS
FT                   NTQLVTEMLRQRLGVDMVHVPYQGSGPALIAVASGEVDVQATSMPSMKALYDAGRLKAL
FT                   AVTSEQRFKALPAVPTMQESGVNDFVLSAWFGVFAPAGTPAPIQEKLDNALGKVMSSPE
FT                   IRTRLDSLSMTARPMSLAAFGAYLDTERQRWKTVIDIVGLKD"
FT   misc_feature    complement(21150..21218)
FT                   /note="Signal peptide predicted for BP1667 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.880 between residues 23 and 24"
FT   CDS_pept        complement(21286..22059)
FT                   /transl_table=11
FT                   /locus_tag="BP1668"
FT                   /product="probable short-chain dehydrogenase"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   short-chain dehydrogenase Pa5524 TR:Q9HT49 (EMBL:AE004965)
FT                   (260 aa) fasta scores: E(): 1.6e-22, 38.43% id in 255 aa,
FT                   and to Streptomyces cinnamonensis monensin polyketide
FT                   synthase putative ketoacyl reductase SW:DHKR_STRCM (P41177)
FT                   (261 aa) fasta scores: E(): 7.4e-21, 36.92% id in 260 aa"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXS0"
FT                   /protein_id="CAE41955.1"
FT                   /translation="MNDRLPVAVVSGAAHGIGWAISRRLAEEGHEIVLLDRDEAALEAR
FT                   WQALRATGHAARVCQVDLSDRAQVLALARRLSEPLQRVRVLVNNAGISPKRNGARIGFA
FT                   AVALELDWRPAVETNLTAALILSELVIPAMKSHGRGRIINIGSRVGRSPTGTSALASMP
FT                   YLVTKTAMQGMTRAVARQLAPHGITVNGIAPGRIQTAMGSNVQPALHAAILADIPVGRW
FT                   GAPADVAHVAAFLASEHAGFITGATVDVNGGALML"
FT   misc_feature    complement(21310..21402)
FT                   /note="HMMPfam hit to PF00678,"
FT   misc_feature    complement(21460..22044)
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase"
FT   CDS_pept        complement(22056..23252)
FT                   /transl_table=11
FT                   /gene="lldA"
FT                   /locus_tag="BP1669"
FT                   /product="lactate dehydrogenase"
FT                   /note="Similar to Neisseria meningitidis lactate
FT                   dehydrogenase LldA or Nmb1377 TR:Q51135 (EMBL:U58911) (390
FT                   aa) fasta scores: E(): 3.4e-45, 36.05% id in 380 aa, and to
FT                   Pseudomonas aeruginosa L-lactate dehydrogenase LldA or
FT                   Pa2382 TR:Q9I197 (EMBL:AE004664) (383 aa) fasta scores:
FT                   E(): 4.7e-49, 38.48% id in 382 aa"
FT                   /db_xref="GOA:Q7VXR9"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXR9"
FT                   /protein_id="CAE41956.1"
FT                   /translation="MKTHDALQRRALCIDDLRAWARKALPKGLFEFVDRGTEDEFLLSR
FT                   NRRSLDELRLLPRVMRDVSRRNCSTHYFGQASSMPMIIAPTGAAGLLAYEGEYLMAKAA
FT                   ARAGIPFVLSTASIVSMERVAQAGGDLWFQLYMLPDLGASYRLMDRARNAGYRALMVTL
FT                   DTPVSPNREYNVRNHFTLPMQISSRNALDVMRRPAWIWNVFFRYLLRNGVPMLENYPDE
FT                   YRQRLDASGKGRMSLPKTDSITWESLRALRRHWRGPLIAKGILHPEDARMARDCGVDAI
FT                   VVSNHGGRNFDAAATPIEALPRIVDEIADKAEVFVDSGFRRGVDVAKALALGARGVLLG
FT                   RAPLWGVASAGEPGALHALELMREELLRSMAFLGCESLAALDRGLLAPATLPRNGGWP"
FT   misc_feature    complement(22089..23192)
FT                   /note="HMMPfam hit to PF01070, FMN-dependent dehydrogenase"
FT   CDS_pept        complement(23283..24233)
FT                   /transl_table=11
FT                   /locus_tag="BP1670"
FT                   /product="putative hydrolase"
FT                   /note="Similar to Burkholderia solanacearum conserved
FT                   hypothetical protein Rsc1824 TR:CAD15526 (EMBL:AL646066)
FT                   (319 aa) fasta scores: E(): 1.8e-19, 35.39% id in 308 aa"
FT                   /db_xref="GOA:Q7VXR8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXR8"
FT                   /protein_id="CAE41957.1"
FT                   /translation="MKLGRFSYRHRAAAHVNLAAIVRRDGQECALDLAAVRAARPELAL
FT                   PASMEAVIRLGRAGVDRCNEALAWASREGAASWFTPAADLAWRLPLEVGCCVAAGRNFA
FT                   SHVNEGKAFWDGQASAAGLNQDMPAGFIKIASVMTPHDSAVARPCGVLAFDYEVEVAAV
FT                   LGGPVPLGTPPERALEHVFGYTLFNDLSAREWARAEMKNQMIAMGKNFPGAGPLGPWIV
FT                   TADEVPDPAQLELSLSVNGEPRQHGSCKEMIFTFAQLIAHWSRIGLGAGELIASGTPEG
FT                   GAISRKPDPAPFFLKPGDIVEAHCPQIGTLRTRIV"
FT   misc_feature    complement(23376..23867)
FT                   /note="HMMPfam hit to PF01557, Fumarylacetoacetate (FAA)
FT                   hydrolase family"
FT   CDS_pept        24455..25144
FT                   /transl_table=11
FT                   /locus_tag="BP1671"
FT                   /product="probable short chain dehydrogenase"
FT                   /note="Similar to Escherichia coli 3-oxoacyl-[acyl-carrier
FT                   protein] reductase FabG or B1093 SW:FABG_ECOLI (P25716)
FT                   (244 aa) fasta scores: E(): 1.2e-07, 27.23% id in 246 aa,
FT                   and to Streptomyces coelicolor putative
FT                   dehydrogenase/reductase Scah10.14C TR:Q9RKU3
FT                   (EMBL:AL132824) (258 aa) fasta scores: E(): 9.6e-08, 31.14%
FT                   id in 244 aa"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXR7"
FT                   /protein_id="CAE41958.1"
FT                   /translation="MGRVACIAGSGTERGRAIAARLADEGWKVVQLDGPDGQDARAASP
FT                   ALGIDLGAAADIATIAARLGVDYDEVGAYIHCACAPPAGVATEPSVALALQAWDAALAI
FT                   HLEAPLLISQLLVRPMLAKGWGRVLFVGEHADNIPHGAQETAFACSMSGLIGLARSIAS
FT                   ETGPHGVTANVILPGPLQPEPDPFGLGPRCTYETDGFAATVAFLLSDGARLVNGATIHA
FT                   NGGQAMR"
FT   misc_feature    24461..25003
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase"
FT   misc_feature    25055..25120
FT                   /note="HMMPfam hit to PF00678,"
FT   CDS_pept        25209..25964
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="BP1672"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="Similar to Escherichia coli 3-oxoacyl-[acyl-carrier
FT                   protein] reductase FabG or B1093 SW:FABG_ECOLI (P25716)
FT                   (244 aa) fasta scores: E(): 7.6e-21, 34.69% id in 245 aa,
FT                   and to Agrobacterium tumefaciens Agr_l_2601p agr_l_2601
FT                   TR:AAK89866 (EMBL:AE008330) (246 aa) fasta scores: E():
FT                   7.2e-29, 44.13% id in 247 aa"
FT                   /db_xref="GOA:Q7VXR6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXR6"
FT                   /protein_id="CAE41959.1"
FT                   /translation="MQSVGTALVTGAAAGIGRAIAERLAQDGHDLVLLDVDAPGLEATK
FT                   AVVAGHGRRADVHCIDLGDLQAVRRFAAAHEAAHISILVNNAAISPKRAGRRVTLSETD
FT                   LEQDWLRVLQVNLTTPLVLAQMAAAGMQRARWGRIVNISSLAARCPSGLASLGYTTTKT
FT                   GLLGLTRALAQELAADGITVNSIAPGRFATAMGENLEPEARQRIVAAIPVGRWGEPPEI
FT                   AGLVSYLCGPQTGFITGAVLDINGGAVML"
FT   misc_feature    25221..25790
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase"
FT   misc_feature    25641..25727
FT                   /note="ScanRegExp hit to PS00061, Short-chain
FT                   dehydrogenases/reductases family signature."
FT   misc_feature    25848..25940
FT                   /note="HMMPfam hit to PF00678,"
FT   CDS_pept        26016..27008
FT                   /transl_table=11
FT                   /locus_tag="BP1673"
FT                   /product="putative exported protein"
FT                   /note="Similar to Variovorax paradoxus 2,4-diphenoxyacetic
FT                   acid gene cluster TR:Q9RHQ7 (EMBL:AB028643) (337 aa) fasta
FT                   scores: E(): 1.9e-39, 38.8% id in 317 aa, and to
FT                   Pseudomonas chlororaphis hypothetical 35.8 kDa protein
FT                   TR:Q9L3W5 (EMBL:AJ271325) (336 aa) fasta scores: E():
FT                   2.9e-39, 37.85% id in 317 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXR5"
FT                   /protein_id="CAE41960.1"
FT                   /translation="MTRRIPRRLIAALASFSFLIPGAGSHAADLPESYPNRPIKLLYGF
FT                   STGGPADYVTRLVGRRLAQELGQPVIVESKPGASSTIATNLVAQAPGDGYTIMMGAMNQ
FT                   AVNPSLLPDLPFDQQKDLRAIAIAAFTPNVLVVSADSSIASVDEIVARARRAPGSISYG
FT                   SSGVGTSVHLAGALFGTATGTELIHVPYKGIAPAKLDVVAGRVTMLFDSVVSAKKLIDA
FT                   GRLKAFAVSSANRSALLPDVPTMAELGWQDFDVSPWYAFFAPASTPDAIVERLNAIIVA
FT                   TMSDPQEQANLLAQGVEPRTSTAREADAYVAAEIGKWGELVKRLELKPE"
FT   misc_feature    26016..26096
FT                   /note="Signal peptide predicted for BP1673 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 27 and 28"
FT   CDS_pept        complement(27018..27971)
FT                   /transl_table=11
FT                   /locus_tag="BP1674"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator Pa2206 TR:Q9I1R1 (EMBL:AE004647)
FT                   (315 aa) fasta scores: E(): 5.9e-19, 28.85% id in 305 aa,
FT                   and to Burkholderia solanacearum probable transcriptional
FT                   regulatory DNA-binding transcription regulator protein PcaQ
FT                   TR:CAD15142 (EMBL:AL646064) (319 aa) fasta scores: E():
FT                   2.1e-16, 34.82% id in 313 aa"
FT                   /db_xref="GOA:Q7VXR4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXR4"
FT                   /protein_id="CAE41961.1"
FT                   /translation="MVQRSLAALSHLKFRHIALIQYLLQEGTLRKAARRLSISQPAATA
FT                   MLSDIENLLGVQLFTRSRQGVAPTAQTLALAPRLRILMNDFDELGAMLDRLDTGEHEVL
FT                   RVGVVPQAFTVLLPRAIEGFRQAGGCHLHTVEGSAQDLLARLLAGELDCVLGRLPPDVA
FT                   KLGRDIASLTFVNLYEDDVCVVCGPDHPAARLKKPGYARLAQCDWVLQRISSSVRQALT
FT                   EAFLRQGLLLPHPVVETPTYTQALDIVAATRLLTAAPRHTAMAHARSGRVKVLDIALGV
FT                   APMQVCLILRKSAEAHPQIVRFRSVIEAMPMRFPGA"
FT   misc_feature    complement(27507..27932)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    complement(27798..27890)
FT                   /note="ScanRegExp hit to PS00044, Bacterial regulatory
FT                   proteins, lysR family signature."
FT   misc_feature    complement(27828..27893)
FT                   /note="Predicted helix-turn-helix motif with score 1335
FT                   (+3.73 SD) at aa 50-71, sequence GTLRKAARRLSISQPAATAMLS"
FT   CDS_pept        28087..29049
FT                   /transl_table=11
FT                   /locus_tag="BP1675"
FT                   /product="putative exported protein"
FT                   /note="Similar to Comamonas testosteroni OrfJ protein
FT                   TR:Q9RHM9 (EMBL:AB029044) (326 aa) fasta scores: E():
FT                   4.8e-32, 34.47% id in 322 aa, and to Alcaligenes eutrophus
FT                   hypothetical 35.7 kDa protein MacB TR:Q9RBG2
FT                   (EMBL:AF130250) (340 aa) fasta scores: E(): 3.3e-30, 35.87%
FT                   id in 315 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXR3"
FT                   /protein_id="CAE41962.1"
FT                   /translation="MKTVLRILLLGAGLLGAAAASAEWPADQPIKIIVPQAAGGTNDTV
FT                   ARLMGVELGKALGQTVVVENRPGASGAIGMQLASRSPADGYTLAIASDTASILSATRKM
FT                   DWRLDHDMAGVAMVGDQPIGVAVSMRAPYASLDELLAAARKEPGTIAFGTSGLGTSQHI
FT                   VGEWLTHLAGVQMIHVPYKGGGQAVTDLVSGTTPAAVLGFAPLLGQARSGGIRIVAVTT
FT                   AERNPAMPEVPTLTELGYPQITRSQWVGVVAPRDTPPAIVKRLSDAMAAIGAQPAIQDK
FT                   LREIGLTPKSMDAAQFDAFIHKDVADWGRLVTELNIKLD"
FT   misc_feature    28087..28152
FT                   /note="Signal peptide predicted for BP1675 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.850 between residues 22 and 23"
FT   CDS_pept        join(29064..29984,29981..30454)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1676"
FT                   /product="probable sulfatase (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 307. The frameshift occurs within
FT                   a dimeric tract of (CGGC)2. The sequence has been checked
FT                   and believed to be correct. Similar to Homo sapiens
FT                   arylsulfatase A precursor ArsA SW:ARSA_HUMAN (P15289) (507
FT                   aa) fasta scores: E(): 2.2e-36, 33.99% id in 453 aa, and to
FT                   Rhizobium meliloti putative arylsulfatase protein
FT                   TR:CAC49614 (EMBL:AL603646) (537 aa) fasta scores: E():
FT                   1.8e-29, 30.27% id in 469 aa"
FT                   /db_xref="PSEUDO:CAE41963.1"
FT   misc_feature    join(29085..29984,29981..30268)
FT                   /note="HMMPfam hit to PF00884, Sulfatase"
FT   variation       29977..29984
FT                   /note="(CGGC)2 in pertussis; (CGGC)3 in parapertussis an
FT                   bronchiseptica"
FT   CDS_pept        30451..30879
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1677"
FT                   /product="hypothetical protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have an internal
FT                   deletion relative to parapertussis and bronchiseptica, and
FT                   it appears to be disrupted by the insertion of IS481
FT                   element."
FT                   /db_xref="PSEUDO:CAE41964.1"
FT   variation       30745..30747
FT                   /note="There is ~100 bp deletion in pertussis and
FT                   parapertussis and bronchiseptica"
FT   CDS_pept        complement(30876..31826)
FT                   /transl_table=11
FT                   /locus_tag="BP1678"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q79H25"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H25"
FT                   /protein_id="CAE41965.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT"
FT   repeat_region   30876..30907
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(30876..31928)
FT   misc_feature    complement(30912..31445)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(31503..31568)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   repeat_region   31897..31928
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        31929..32123
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1679"
FT                   /product="Putative LysR-family transcriptional regulator
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. Similar to the C-terminal region of
FT                   Burkholderia solanacearum conserved hypothetical protein
FT                   Rsp1208 TR:CAD18359 (EMBL:AL646083) (449 aa) fasta scores:
FT                   E(): 2.9, 35% id in 60 aa"
FT   CDS_pept        complement(32120..32842)
FT                   /transl_table=11
FT                   /gene="arsH"
FT                   /locus_tag="BP1680"
FT                   /product="putative NADPH-dependent FMN reductase"
FT                   /note="Similar to Thiobacillus ferrooxidans ArsH-like
FT                   protein TR:Q9L9D0 (EMBL:AF173880) (240 aa) fasta scores:
FT                   E(): 1.2e-60, 69.29% id in 228 aa, and to Pseudomonas
FT                   aeruginosa hypothetical protein Pa2280 TR:Q9I1J5
FT                   (EMBL:AE004653) (230 aa) fasta scores: E(): 2e-61, 69.56%
FT                   id in 230 aa"
FT                   /db_xref="GOA:Q7VXR2"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXR2"
FT                   /protein_id="CAE41967.1"
FT                   /translation="MSEVLADLPNIDPSRFKQPSAAELFPPGRATHAPRFLLLYGSLRE
FT                   RSYSRLVAEEAARLRRALGGETRLFNPSGLPLVDDASEDHPKVRELHELVRWAEGMIWS
FT                   SPERHGAMSGLMKTQIDWIPLSMGAMRPTQGKTLAVMQVSGGSQSFNAVNQMRVLGRWM
FT                   RMLTIPNQSSVAKAYQEFDEAGRMQPSPYYDRVVDVAEELMKFTLLTRDASPYLVDRYS
FT                   ERKEAAETLSRRTAQARI"
FT   CDS_pept        complement(join(32835..33173,33177..33257))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="BP1681"
FT                   /product="arsenate reductase (Pseudogene)"
FT                   /EC_number="1.20.4.1"
FT                   /note="Pseudogene. This CDS contains an in-frame TAG stop
FT                   codon. The sequence has been checked and believed to be
FT                   correct. Similar to Escherichia coli arsenate reductase
FT                   ArsC SW:ARC1_ECOLI (P08692) (141 aa) fasta scores: E():
FT                   5.4e-33, 65% id in 140 aa, and to Serratia marcescens
FT                   arsenate reductase ArsC TR:Q9L337 (EMBL:AJ288983) (141 aa)
FT                   fasta scores: E(): 2.5e-33, 64.28% id in 140 aa. Also
FT                   similar to BP1306, 56.140% identity (57.658% ungapped) in
FT                   114 aa overlap."
FT                   /db_xref="PSEUDO:CAE41968.1"
FT   variation       complement(33174..33176)
FT                   /note="TAG stop in pertussis; GAG in parapertussis and
FT                   bronchiseptica"
FT   CDS_pept        complement(33281..34468)
FT                   /transl_table=11
FT                   /locus_tag="BP1682"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Rhizobium meliloti putative transport
FT                   protein Smb21575 TR:CAC49415 (EMBL:AL603645) (401 aa) fasta
FT                   scores: E(): 1.2e-30, 35.16% id in 401 aa, and to
FT                   Agrobacterium tumefaciens Agr_pat_464p TR:AAK90697
FT                   (EMBL:AE007901) (417 aa) fasta scores: E(): 9.9e-31, 36.17%
FT                   id in 387 aa"
FT                   /db_xref="GOA:Q7VXR1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXR1"
FT                   /protein_id="CAE41969.1"
FT                   /translation="MPGAPVRVVGILGTAQTLAWASSYYLPAMLADPMARDLGVSTPTV
FT                   YAAFSAALVASALIGPWTGLAIDRHGGRMVLAGTSLLFALGLGMLGAAQGLWTMVAAWL
FT                   VMGVAMGAGLYEAAFSSLVRLYGHHARGAITGITLIAGFASTVGWPLSAWMETLFGWRG
FT                   ACLGWAALHLMIGLPLNAWLPKAVAAETPSPDAPAAQEGTLPAARPGPQGLATALLAFV
FT                   FAATWFISTAMATHLPRMLQATGATLAAAVAVGALIGPAQVAGRLLEFGLLRHVHPLLS
FT                   ARLAALTHPAGVAVLLAAGPALAPLFAILHGAGNGILTIAKGTLPLALFGPRGYGARQG
FT                   WLMMPARVAQALAPFLFGLALDAWRANALWLSGGIGLAACAALLVLRARPDPIKP"
FT   misc_feature    complement(join(33311..33376,33461..33526,33548..33613,
FT                   33674..33739,33779..33829,34007..34072,34112..34177,
FT                   34190..34255,34271..34336,34382..34447))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BP1682 by TMHMM2.0 at aa 7-29, 44-66, 71-93, 97-119,
FT                   132-154, 213-230, 243-265, 285-307, 314-336 and 364-386"
FT   CDS_pept        complement(34472..34822)
FT                   /transl_table=11
FT                   /locus_tag="BP1683"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Thiobacillus ferrooxidans ArsR-like
FT                   protein TR:Q9L9D2 (EMBL:AF173880) (118 aa) fasta scores:
FT                   E(): 1.3e-11, 45.09% id in 102 aa, and to Caulobacter
FT                   crescentus transcriptional regulator, ArsR family Cc1505
FT                   TR:Q9A859 (EMBL:AE005825) (109 aa) fasta scores: E():
FT                   2e-11, 42.2% id in 109 aa"
FT                   /db_xref="GOA:Q7VXR0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXR0"
FT                   /protein_id="CAE41970.1"
FT                   /translation="MNAEQAVSSLGALAHAQRLSVFRALVVAGPAGLTPSVMADGLGIA
FT                   RNALSFHLKELAHAGLVSVEQQGRNLIYRADFFRMNALLGYLTKHCCQGATCEVSDSRK
FT                   NTAGCDAGARRA"
FT   misc_feature    complement(34661..34726)
FT                   /note="Predicted helix-turn-helix motif with score 1018
FT                   (+2.65 SD) at aa 33-54, sequence LTPSVMADGLGIARNALSFHLK"
FT   CDS_pept        join(35071..36474,36477..36554)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1684"
FT                   /product="conserved hypothetical protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 468. The frameshift occurs within
FT                   a dimeric tract of (G)6. It also contains a large deletion
FT                   relative to parapertussis and bronchiseptica. The sequence
FT                   has been checked and believed to be correct. Similar to
FT                   Caulobacter crescentus hypothetical protein Cc3460
FT                   TR:Q9A2U6 (EMBL:AE006004) (581 aa) fasta scores: E():
FT                   1.9e-89, 51.82% id in 494 aa"
FT                   /db_xref="PSEUDO:CAE41971.1"
FT   variation       36470..36475
FT                   /note="(G)6 in pertussis; (G)4 in parapertussis and
FT                   bronchiseptica. There is also a large deletion in
FT                   pertussis, relative to parapertussis and bronchiseptica,
FT                   downstream of this position"
FT   CDS_pept        36572..37543
FT                   /transl_table=11
FT                   /locus_tag="BP1685"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Sma1927 TR:AAK65716 (EMBL:AE007292) (330 aa) fasta scores:
FT                   E(): 1.5e-43, 40.37% id in 322 aa, and to Comamonas
FT                   testosteroni OrfJ protein TR:Q9RHM9 (EMBL:AB029044) (326
FT                   aa) fasta scores: E(): 5.1e-39, 39.37% id in 320 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXQ9"
FT                   /protein_id="CAE41972.1"
FT                   /translation="MMKGICAAFAFAALAASWQGPAQAAFPDQPIKLVVPFAPGATIGP
FT                   LAQLVSEQLSSDLGTPVYTEFKTGAGGNIGADIVAKSPGDGYTLLLGTISILTINPSLY
FT                   PDLPFDPVKDFKPVSMLVTTQNILVVNPESKIQSVADLADYARQHPGQATFGSSGTGST
FT                   MHLAGELFSTTAQVKMTHVPYRGGGPARSDLLGGRLTLMFSDLSAVPMVQAGKLRALAV
FT                   TGSQRDGRIPDIPTMQESGMKGFDVEPWYGLVAPAGTPDAVIARLNASVRKVFDKQKVR
FT                   DALQNIGLRPASDLSVAYMAGKIDSDLGKWAPIVKSVDMKTN"
FT   misc_feature    36572..36643
FT                   /note="Signal peptide predicted for BP1685 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.975 between residues 24 and 25"
FT   CDS_pept        37557..38270
FT                   /transl_table=11
FT                   /locus_tag="BP1686"
FT                   /product="probable short-chain dehydrogenase"
FT                   /note="Similar to Pseudomonas abietaniphila DitG TR:Q9X4X1
FT                   (EMBL:AF119621) (244 aa) fasta scores: E(): 1.9e-35, 50.22%
FT                   id in 227 aa, and to Rhizobium loti short-chain
FT                   dehydrogenase/reductase family mlr5208 TR:Q98CC5
FT                   (EMBL:AP003006) (235 aa) fasta scores: E(): 7.2e-19, 37.11%
FT                   id in 229 aa"
FT                   /db_xref="GOA:Q7VXQ8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXQ8"
FT                   /protein_id="CAE41973.1"
FT                   /translation="MKTQATAGDGAAVVAIAGGMGALGRALAQRFKQRGDQVVVLDQAT
FT                   DAAGLPQAGADLALLDVDLNDVASTRHAFDTIARRFGRLDALVSVAGGFHHETLAEGKV
FT                   KAWDHMYALNLRTAVVACQAALPLMLARGAGHVVCIGSDAIGRAHAGLGAYAASKAGVA
FT                   ELVRTLAAETRDQGIAANAVLPGTLDTPGNRRAMPDADFSRWVSLDAAAALILFLASPL
FT                   AAQINGACIPIVNRC"
FT   misc_feature    37557..37640
FT                   /note="Signal peptide predicted for BP1686 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.625) with cleavage site
FT                   probability 0.538 between residues 28 and 29"
FT   misc_feature    37590..38129
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase"
FT   misc_feature    37980..38066
FT                   /note="ScanRegExp hit to PS00061, Short-chain
FT                   dehydrogenases/reductases family signature."
FT   misc_feature    38190..38255
FT                   /note="HMMPfam hit to PF00678,"
FT   CDS_pept        complement(38275..39192)
FT                   /transl_table=11
FT                   /locus_tag="BP1687"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="Similar to Agrobacterium tumefaciens pca operon
FT                   transcriptional activator PcaQ SW:PCAQ_AGRTU (P52668) (311
FT                   aa) fasta scores: E(): 9.2e-13, 27.55% id in 294 aa, and to
FT                   Rhizobium meliloti putative transcriptional regulator
FT                   protein Smb20123 TR:CAC48523 (EMBL:AL603642) (298 aa) fasta
FT                   scores: E(): 1.4e-14, 29.43% id in 248 aa"
FT                   /db_xref="GOA:Q7VXQ7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXQ7"
FT                   /protein_id="CAE41974.1"
FT                   /translation="MGPTDMRVSTRQLQAFLLVAEVRSFTRAAEALHVTQAGLSSMINE
FT                   LETQVGIRLFERSNRATALTQAGTQFLPYARQAVESLNKGMLELSALNRRQQGGICVGV
FT                   SPLIASTVLPAVMREFQQCTGRSCEVVDAELEVLHDMVETGRLDATYGTYMRRASRLKS
FT                   EYIFGMALRLAGPGRLIPPGLEIAGVEDWARQHDIVLWALPDSNAVQQVVDRYLLEVGA
FT                   HALRRQEVCHVATVASLISAGMGMGFVPTFLADFYDRDTVGQIALPQGAPAVDFYCTSD
FT                   ASNPASSSIHVFSRLLAAHCSAAA"
FT   misc_feature    complement(38740..39165)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    complement(39031..39123)
FT                   /note="ScanRegExp hit to PS00044, Bacterial regulatory
FT                   proteins, lysR family signature."
FT   misc_feature    complement(39061..39126)
FT                   /note="Predicted helix-turn-helix motif with score 1525
FT                   (+4.38 SD) at aa 23-44, sequence RSFTRAAEALHVTQAGLSSMIN"
FT   CDS_pept        39299..39595
FT                   /transl_table=11
FT                   /locus_tag="BP1688"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Drosophila melanogaster Cg13065 protein
FT                   TR:Q9VV13 (EMBL:AE003528) (140 aa) fasta scores: E(): 2.2,
FT                   39.53% id in 86 aa, and to Streptomyces coelicolor
FT                   hypothetical 9.1 kDa protein Sch22a.29 TR:Q9L0V4
FT                   (EMBL:AL159178) (89 aa) fasta scores: E(): 8.7, 36.5% id in
FT                   63 aa"
FT                   /db_xref="GOA:Q7VXQ6"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXQ6"
FT                   /protein_id="CAE41975.1"
FT                   /translation="MSLYYRISFVLSVLALAAWAIAVTLYKAPRHGDGYGPDPLGVLLF
FT                   LALWPVGLLLAHSGLLACLVRGQRPASILQGRYGVAIHLALGAGFLAYALYRV"
FT   misc_feature    39299..39358
FT                   /note="Signal peptide predicted for BP1688 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.643 between residues 20 and 21"
FT   misc_feature    join(39317..39376,39413..39481,39518..39586)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BP1688 by TMHMM2.0 at aa 7-26, 39-61 and 74-96"
FT   repeat_region   39592..39623
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   39592..40644
FT   CDS_pept        39694..40644
FT                   /transl_table=11
FT                   /locus_tag="BP1689"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA7"
FT                   /protein_id="CAE41976.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIPPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHR"
FT   misc_feature    39952..40017
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    40075..40608
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(40613..40644)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(40635..41381)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1690"
FT                   /product="putative exported protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. The C-terminal part of this CDS is
FT                   BP2631. Similar to Rhizobium meliloti hypothetical protein
FT                   Sma1927 TR:Q92Y30 (EMBL:AE007292) (330 aa) fasta scores:
FT                   E(): 2.5e-44, 55.23% id in 239 aa, and to Agrobacterium
FT                   tumefaciens Agr_l_312p TR:AAK88723 (EMBL:AE008213) (329 aa)
FT                   fasta scores: E(): 2.4e-43, 53.13% id in 239 aa."
FT                   /db_xref="PSEUDO:CAE41977.1"
FT   misc_feature    complement(41301..41381)
FT                   /note="Signal peptide predicted for BP1690 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.910 between residues 27 and 28"
FT   misc_feature    complement(41325..41357)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        41803..44736
FT                   /transl_table=11
FT                   /gene="phaA"
FT                   /locus_tag="BP1691"
FT                   /product="putative pH adaptation potassium efflux protein"
FT                   /note="Similar to Rhizobium meliloti PhaA protein TR:Q52978
FT                   (EMBL:X93358) (725 aa) fasta scores: E(): 1.4e-160, 62.5%
FT                   id in 688 aa, and to Rhodobacter capsulatus NADH-quinone
FT                   oxidoreductase chain 5 TR:O68034 (EMBL:AF010496) (961 aa)
FT                   fasta scores: E(): 1.8e-159, 53.16% id in 963 aa"
FT                   /db_xref="GOA:Q7VXQ5"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXQ5"
FT                   /protein_id="CAE41978.1"
FT                   /translation="MSLLLVLALPFLGSLCAALLPANARNAEAWLAGLIALACTLLVAS
FT                   LYPQIAAGGVIRADLPWAPALGLQFTLRMDGYAWLFALIVSGMGALVVLYARYYMSPED
FT                   PVPRFFSFFQAFMAAMLGVVMSGNLIQLVMFWEMTSLASFMLIAYWHHRLDARRGARMA
FT                   LTVTGAGGLSLLAGVLMLGHIVGSYDMDQVLAAGDIVRADPWYPAVLVLIALGALTKSA
FT                   QFPFQFWLPNAMAAPTPVSAYLHSATMVKAGVFLLARFWPMLAGTDEWFWIIGGAGLCS
FT                   LVLGAYAAIFQQDMKGVLAYSTISHLGLITLMLGLNSSLGLVAAIFHMVNHATFKASLF
FT                   MAAGIVDHETGTRDVGRLSGLYGAMPITATLAMVAAASMAGVPLLNGFISKEMFFAETT
FT                   FVSGDVLVRWGLPLMATLAGAFSVTYSLRFILQVFFGPPAEDLPRAPHEPPRWMLLPSA
FT                   LLVMVCLVVGVLPGVTLGPILHLAASSILGEHMPQYSLSVWHGFNLPLAMSFVALTAGV
FT                   LLYLALRARQRAHPGLVPFIYRFDGRRTFEYLLDASSVAAAWLLRYLASSRMQVQMLVI
FT                   VLGTLWVAWLPLRAGGWLAGQARLTPADPAFAILWVVGAACALGAAYQAKYHRLASLTL
FT                   SGGAGLITCLTFVWFSAPDLALTQLAVEVVTVVLLLLGLRWLPRRIQTGGDEDRPDLRA
FT                   RVRRLRDLGLAGVAGACMAALAYAVLTRPVGDTISSFFTERALPDGGGTNVVNVILVDF
FT                   RGFDTLGEITVLGIVALTVYALLRRFRPAPESVELPHQQREQDGMPTVDETGERPAPDT
FT                   KSPLPAGPMMIPAVLVRLLLPVAVLVSVYLLLRGHNLPGGGFVGGLVMATAIILQYMVG
FT                   GVYWVESRSRLNPQHWVGLGLLAAGGAAVSAWLALRPFLSALAWDVALPVVGHVHLSSV
FT                   LLFDLGVYMLVVGATVLVLVALAHQSLRAQRQAAVEAQAVAQTGSPA"
FT   misc_feature    41803..41874
FT                   /note="Signal peptide predicted for BP1691 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.409 between residues 24 and 25"
FT   misc_feature    join(41806..41874,41902..41970,42031..42099,42142..42210,
FT                   42289..42357,42424..42492,42529..42597,42607..42675,
FT                   42712..42780,42901..42969,43177..43245,43303..43371,
FT                   43522..43590,43618..43671,43690..43758,43768..43836,
FT                   43897..43965,44077..44130,44275..44334,44362..44430,
FT                   44464..44532,44590..44658)
FT                   /note="22 probable transmembrane helices predicted for
FT                   BP1691 by TMHMM2.0 at aa 2-24, 34-56, 77-99, 114-136,
FT                   163-185, 208-230, 243-265, 269-291, 304-326, 367-389,
FT                   459-481, 501-523, 574-596, 606-623, 630-652, 656-678,
FT                   699-721, 759-776, 825-844, 854-876, 888-910 and 930-952"
FT   misc_feature    42004..42147
FT                   /note="HMMPfam hit to PF00662, NADH-Ubiquinone
FT                   oxidoreductase (complex I), chain 5 N-terminus"
FT   misc_feature    42178..42981
FT                   /note="HMMPfam hit to PF00361,
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains"
FT   CDS_pept        44736..45080
FT                   /transl_table=11
FT                   /gene="phaC"
FT                   /locus_tag="BP1692"
FT                   /product="putative pH adaptation potassium efflux protein"
FT                   /note="Similar to Rhizobium meliloti pH adaptation
FT                   potassium efflux system C transmembrane protein PhaC
FT                   TR:CAC47490 (EMBL:X93358) (115 aa) fasta scores: E():
FT                   3e-27, 72.97% id in 111 aa, and to Rhodobacter capsulatus
FT                   potential poly(3-hydroxyalkanoate) polymerase TR:O68035
FT                   (EMBL:AF010496) (114 aa) fasta scores: E(): 8.7e-31, 76.31%
FT                   id in 114 aa"
FT                   /db_xref="GOA:Q7VXQ4"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXQ4"
FT                   /protein_id="CAE41979.1"
FT                   /translation="MEVVYALAIGVLAGSGVWLLLRPRTFQVIMGLSLLSYAVNLFIFG
FT                   MGRLTVGRPPVVSASAPVDAAAYADPLPQALVLTAIVIGFATTALFLVVLLASRGLTGT
FT                   DHVDGREPES"
FT   misc_feature    44736..45071
FT                   /note="HMMPfam hit to PF01898, Protein of unknown function
FT                   DUF67"
FT   misc_feature    join(44745..44798,44817..44885,44958..45026)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BP1692 by TMHMM2.0 at aa 4-21, 28-50 and 75-97"
FT   CDS_pept        45077..46705
FT                   /transl_table=11
FT                   /gene="phaD"
FT                   /locus_tag="BP1693"
FT                   /product="putative pH adaptation potassium efflux protein"
FT                   /note="Similar to Rhizobium meliloti PhaD protein TR:Q52981
FT                   (EMBL:X93358) (547 aa) fasta scores: E(): 6e-96, 52.33% id
FT                   in 535 aa, and to Agrobacterium tumefaciens Agr_c_899p
FT                   TR:AAK86324 (EMBL:AE007986) (548 aa) fasta scores: E():
FT                   5.1e-94, 50.28% id in 533 aa"
FT                   /db_xref="GOA:Q7VXQ3"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXQ3"
FT                   /protein_id="CAE41980.1"
FT                   /translation="MIDWLQHLPIYPITVPLIAGALMLLLPDTQRKTRAGIGLLSSLLQ
FT                   LASAIALLSLAAGAGGIWPDGIGVYLPGDWPAPFGIVLVVDRLAAVMLALTAVLGLAAL
FT                   IYSLARWDRAGVHFHSLYQFLLMGLNGAFLTGDLFNLFVFFEVLLAASYGLMLHGSGIA
FT                   RVTAGLQYIAVNLVASFLLLISIALIYGVTGTLNLADLALRAGTLTGGERSLFEAGAAI
FT                   LGVAFLVKAGAWPLNFWLVKGYGSAAAPVAALFSIMTKVGIYALLRIGSLLLPTGAPAA
FT                   FSLDWMFAAGLATLVFGGLGLLANQQLEKLTGYCVIVSAGTLLTALGMPGVTLTGPALF
FT                   YLISSVLATGALFMLVELIERTRSFGANVLAVTMDLFDLDDPSTPNRSDDVVGVAIPAA
FT                   MAFLGLAFVSCALLVTGLPPLSGFVAKFSLLSAAVTAANTPSVALDAWVLVALVLLSGL
FT                   AGLIALGRVGIRIFWSSDDRVTPRLRLMEAGPVAVLLLLCVVLAAGAGPVSAYLDAAAQ
FT                   SLDRPASYVNAVLAKQPARALSEGL"
FT   misc_feature    join(45086..45154,45191..45259,45335..45403,45416..45484,
FT                   45497..45565,45602..45670,45728..45796,45809..45877,
FT                   45920..45988,46007..46075,46085..46153,46253..46321,
FT                   46415..46483,46544..46612)
FT                   /note="14 probable transmembrane helices predicted for
FT                   BP1693 by TMHMM2.0 at aa 4-26, 39-61, 87-109, 114-136,
FT                   141-163, 176-198, 218-240, 245-267, 282-304, 311-333,
FT                   337-359, 393-415, 447-469 and 490-512"
FT   misc_feature    45479..45979
FT                   /note="HMMPfam hit to PF00361,
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains"
FT   misc_feature    46274..46456
FT                   /note="HMMPfam hit to PF00361,
FT                   NADH-Ubiquinone/plastoquinone (complex I), various chains"
FT   CDS_pept        46702..47181
FT                   /transl_table=11
FT                   /gene="phaE"
FT                   /locus_tag="BP1694"
FT                   /product="putative pH adaptation potassium efflux protein"
FT                   /note="Similar to Rhizobium meliloti PhaE protein TR:Q52982
FT                   (EMBL:X93358) (161 aa) fasta scores: E(): 1.9e-18, 39.26%
FT                   id in 163 aa, and to Agrobacterium tumefaciens Agr_c_898p
FT                   TR:AAK86323 (EMBL:AE007986) (162 aa) fasta scores: E():
FT                   4.3e-21, 45.45% id in 154 aa"
FT                   /db_xref="GOA:Q7VXQ2"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXQ2"
FT                   /protein_id="CAE41981.1"
FT                   /translation="MMRRYYLALLPLAMLALWLMLNQSASIGQLALGAALALWLGWASS
FT                   RLRPLRGKPRSLWLLPGLAARVFADIVRSNVAVARLVWQRRPDFSPGFIAIPLDLHDPH
FT                   GLAILACIVTYTPGTVWVDIIDGKLVLHVLDLQNEEAWIALVKQRYERTLIEVFE"
FT   misc_feature    46702..46776
FT                   /note="Signal peptide predicted for BP1694 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.427 between residues 25 and 26"
FT   misc_feature    join(46714..46767,46777..46830)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BP1694 by TMHMM2.0 at aa 5-22 and 26-43"
FT   CDS_pept        47178..47462
FT                   /transl_table=11
FT                   /gene="phaF"
FT                   /gene_synonym="phaF1"
FT                   /locus_tag="BP1695"
FT                   /product="pH adaptation potassium efflux system protein F"
FT                   /note="Similar to Rhizobium meliloti pH adaptation
FT                   potassium efflux system protein F PhaF or PhaF1 or R02914
FT                   or Smc03183 SW:PHAF_RHIME (Q52983) (92 aa) fasta scores:
FT                   E(): 4.3e-16, 54.34% id in 92 aa, and to Agrobacterium
FT                   tumefaciens Agr_c_896p TR:AAK86322 (EMBL:AE007986) (93 aa)
FT                   fasta scores: E(): 7.8e-17, 52.68% id in 93 aa"
FT                   /db_xref="GOA:Q7VXQ1"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXQ1"
FT                   /protein_id="CAE41982.1"
FT                   /translation="MMNIVLYWSASFALLCFALAMACAAIRLLRGPTAQDRVLALDSLY
FT                   VSGMLTMLVFGIRAGTPVYFDIALLIALFGFVGSTAMAKFLLRGEVIEP"
FT   misc_feature    47178..47243
FT                   /note="Signal peptide predicted for BP1695 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.746 between residues 22 and 23"
FT   misc_feature    join(47187..47255,47289..47357,47370..47438)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BP1695 by TMHMM2.0 at aa 4-26, 38-60 and 65-87"
FT   CDS_pept        47459..47785
FT                   /transl_table=11
FT                   /gene="phaG"
FT                   /locus_tag="BP1696"
FT                   /product="putative pH adaptation potassium efflux protein"
FT                   /note="Similar to Rhizobium meliloti PhaG protein
FT                   TR:CAC47494 (EMBL:X93358) (121 aa) fasta scores: E():
FT                   6.7e-11, 44.89% id in 98 aa, and to Rhodobacter capsulatus
FT                   hypothetical 12.6 kDa protein TR:O68039 (EMBL:AF010496)
FT                   (116 aa) fasta scores: E(): 9.4e-14, 48.98% id in 98 aa"
FT                   /db_xref="GOA:Q7VXQ0"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXQ0"
FT                   /protein_id="CAE41983.1"
FT                   /translation="MSDVDIPLWAGIPAAILLVLGGLLTLAGALGMLRFGHFYARIHAP
FT                   TLGNTMGACSVLTASILVFSSLSMRPVVHEFVIGMLLVLTSPVTGMLLMRAAVYRARRA
FT                   DDSA"
FT   misc_feature    join(47486..47554,47591..47659,47687..47755)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BP1696 by TMHMM2.0 at aa 10-32, 45-67 and 77-99"
FT   repeat_region   47839..47870
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   47839..48891
FT   CDS_pept        47941..48891
FT                   /transl_table=11
FT                   /locus_tag="BP1697"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q79H25"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H25"
FT                   /protein_id="CAE41984.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT"
FT   misc_feature    48199..48264
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    48322..48855
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(48860..48891)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        48968..49477
FT                   /transl_table=11
FT                   /locus_tag="BP1698"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXP9"
FT                   /protein_id="CAE41985.1"
FT                   /translation="MSKIRIQRWCGALALGAGSLMAFGAHAAGTGSGQSQYQMDVQRCN
FT                   SGDTSQDRATCLREAGAARQESQRNRLDDKQEGRYQDNAMMRCKNLPASQQQDCITQMT
FT                   SGNTTTRGSVGGGGVLRETVIQVPAGTPGRPMPGSQMPSGQMPGAAPGGLQPPPAGTVA
FT                   PPPVMR"
FT   misc_feature    48968..49048
FT                   /note="Signal peptide predicted for BP1698 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 27 and 28"
FT   CDS_pept        49575..50423
FT                   /transl_table=11
FT                   /locus_tag="BP1699"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Borrelia burgdorferi hypothetical protein
FT                   Bb0007 SW:Y007_BORBU (O51040) (285 aa) fasta scores: E():
FT                   7.4e-16, 26.31% id in 285 aa"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXP8"
FT                   /protein_id="CAE41986.1"
FT                   /translation="MSDVIALVFDFDDTLASDSTTGFLESIGVDTASFWKDQVDPLLSQ
FT                   QDWDPVPAYLYQMIQLSRQGSHGLITRERLREWGVRLALHDGVQTLFGRLRAAVRAEHP
FT                   KVQLEFYLISSGIGDVVRATPIAHEFTEIWASEFVYGEDGGISFPRRIVSFTDKTRYLF
FT                   HIQKGLIGREYRNKPFEVNRKVPEDRLRVPFDQMVFVGDGYTDIPCFSLIRSAGGFAFG
FT                   VWDPKHRDKRSRAWGFIEEGRVSNLNQARYDEQAELYQWLEEAVTSLAGRIALKSRVYR
FT                   G"
FT   CDS_pept        50473..50922
FT                   /transl_table=11
FT                   /gene="cumB"
FT                   /locus_tag="BP1700"
FT                   /product="putative zinc-binding hydrolase"
FT                   /note="Similar to Pseudomonas putida CumB TR:Q9X3V3
FT                   (EMBL:AF086638) (145 aa) fasta scores: E(): 5.4e-31, 59.31%
FT                   id in 145 aa, and to Burkholderia solanacearum putative
FT                   hydrolase protein rsc1451 TR:CAD15153 (EMBL:AL646064) (183
FT                   aa) fasta scores: E(): 6.3e-32, 63.69% id in 146 aa"
FT                   /db_xref="GOA:Q7VXP7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXP7"
FT                   /protein_id="CAE41987.1"
FT                   /translation="MALALEQAQEAARLGEVPVGAVVVDAQGEVLGTGYNRTIIDRDPT
FT                   AHAEIVALRAAARRLDNYRLPGVSLYVTLEPCVMCIGAMLHARLARVVYGARDPKTGAC
FT                   GSVLDVGAVGQLNHHTTITGGVLAEPCGELLRGFFRARRAKESPV"
FT   misc_feature    50506..50748
FT                   /note="HMMPfam hit to PF00383, Cytidine and deoxycytidylate
FT                   deaminase zinc-binding region"
FT   misc_feature    50611..50724
FT                   /note="ScanRegExp hit to PS00903, Cytidine and
FT                   deoxycytidylate deaminases zinc-binding region signature."
FT   CDS_pept        50919..51920
FT                   /transl_table=11
FT                   /gene="ldcA"
FT                   /locus_tag="BP1701"
FT                   /product="muramoyltetrapeptide carboxypeptidase"
FT                   /EC_number="3.4.17.13"
FT                   /note="Similar to Escherichia coli muramoyltetrapeptide
FT                   carboxypeptidase LdcA or B1192 SW:LDCA_ECOLI (P76008) (304
FT                   aa) fasta scores: E(): 2.6e-36, 40% id in 300 aa, and to
FT                   Neisseria meningitidis hypothetical protein Nma1819 or MccF
FT                   TR:Q9JR41 (EMBL:AL162757) (394 aa) fasta scores: E():
FT                   9.9e-35, 41.28% id in 281 aa"
FT                   /db_xref="GOA:Q7VXP6"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXP6"
FT                   /protein_id="CAE41988.1"
FT                   /translation="MTKKKNPPASHGHDHHEHHGHEPGHVCDAGCAHAPAQASGIYLVS
FT                   PSSAVRDAAELELACQRLAAEGFQTKVDRAALAVHQRFAGTDKQRAAGLQRAIKQKHPI
FT                   VMATRGGYGLIRLLPMIDWRAMADSGKRFVGMSDFTAFNLALLAQTGAVSYSGATAVRD
FT                   FGLAKTDELTVALFGEIMRGELEILSFETRDADAFDGRGVLWGGNLATLVSLLGTPYMP
FT                   KVRGGILFLEDVAEHPYRVERMLAQLWQAGVLERQKAIVLGSFSDYRLAAHDNGYDMHA
FT                   VVGWLRKTVKVPVVTGLPYGHTDTKATLPIGKKVGLATERGMAHLVIDEHTH"
FT   misc_feature    51237..51461
FT                   /note="HMMPfam hit to PF02016, Uncharacterized protein
FT                   family UPF0094"
FT   misc_feature    51519..51899
FT                   /note="HMMPfam hit to PF02016, Uncharacterized protein
FT                   family UPF0094"
FT   CDS_pept        complement(51933..52727)
FT                   /transl_table=11
FT                   /locus_tag="BP1702"
FT                   /product="probable enoyl-CoA hydratase/isomerase"
FT                   /note="Similar to Pseudomonas aeruginosa probable enoyl-CoA
FT                   hydratase/isomerase Pa2013 TR:Q9I298 (EMBL:AE004627) (265
FT                   aa) fasta scores: E(): 2.1e-37, 41.06% id in 263 aa, and to
FT                   Caulobacter crescentus enoyl-CoA hydratase/isomerase family
FT                   protein Cc2169 TR:Q9A6C5 (EMBL:AE005888) (262 aa) fasta
FT                   scores: E(): 3.4e-38, 44.22% id in 251 aa"
FT                   /db_xref="GOA:Q7VXP5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXP5"
FT                   /protein_id="CAE41989.1"
FT                   /translation="MLQTLEVAYGPQTAVVWLNRPDVRNALDPRMIAELTETFMALGAD
FT                   NEVRAIVLAGRGKAFCAGADLNWMRRSAQAGDAENRADAQTLATMLHTIYTCPKPTIAR
FT                   IHGPCMAGGMGLAAACDIAVASHEARFALTETRLGLIASMISPYVLRAMGARTASRWFL
FT                   SAEVFEATEAWRIGLVHELCEADRLDGQINELLGSFMLTSPHAVAQAKRLIRDVAGAPI
FT                   DAALLEETAARIAEQRASADGREGLASFLEKRQPAWVPRQDT"
FT   misc_feature    complement(52176..52688)
FT                   /note="HMMPfam hit to PF00378, Enoyl-CoA
FT                   hydratase/isomerase family"
FT   CDS_pept        complement(52776..54677)
FT                   /transl_table=11
FT                   /locus_tag="BP1703"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Rhizobium meliloti putative transmembrane
FT                   protein Smc04283 TR:CAC46625 (EMBL:AL591789) (579 aa) fasta
FT                   scores: E(): 3.8e-49, 49.83% id in 610 aa"
FT                   /db_xref="GOA:Q7VXP4"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXP4"
FT                   /protein_id="CAE41990.1"
FT                   /translation="MKIHKALWFGLSCIGLVLLMIAFLTPWDHLATGHIGLLMLALIVV
FT                   AIMLGFPTAFTLMGMGVLFTFLAYFMQHEDGARAVRQTLDLMVQRTYATMTNDSLISVP
FT                   LFVFMGYLVERANLIERLFRSMHLALARLPGALGVATLITCAIFATATGIVGAVVTLMG
FT                   LLAMPAMLKAGYSVRLTAGSITAGGCLGILIPPSVMLIVYGATTGVSVVQLYAGAFFPG
FT                   IMLAGLYVLYVMVVAKLRPDMAPPLSKEERHIPLQPGAEVLRQQGHRHAVPGLLAGLFK
FT                   RRDPQVTGSFLARNLMLVVAPLAAFVLITGATYDTLTEPPVVYEIPDELRLGSGDSFDS
FT                   GLAEPPSEDGGLAEPPGAAAAPETAAAQVEAAEAAEDAAAERLPAPYGFWIFFAVCVAL
FT                   LAVFYALLNWSRLEVFRLLMSSFFPLALMIVAVLGSIVFGLATPSEAAAMGALGGALLA
FT                   LAYRRLTMPVLRESVYLTAKTSAMVCWLFVGSSIFSAAFALLGGQGIVEQWVLSLGLTP
FT                   IQFMLLAQIIIFLLGWPLEWTEIIVIFMPIFVPLLKAFGIDPLFFGLLVALNLQTAFLS
FT                   PPVAMSAFYLKGVAPPHVTLNQIFLGMMPFMGIQLLAIFLLYMFPGIGLWLPTVLYR"
FT   misc_feature    complement(join(52794..52859,52992..53057,53079..53144,
FT                   53160..53225,53286..53339,53370..53435,53457..53522,
FT                   53739..53804,53979..54044,54075..54140,54180..54278,
FT                   54339..54404,54468..54560,54606..54656))
FT                   /note="14 probable transmembrane helices predicted for
FT                   BP1703 by TMHMM2.0 at aa 7-24, 39-70, 91-113, 133-166,
FT                   179-201, 211-233, 291-313, 385-407, 414-436, 446-464,
FT                   484-506, 511-533, 540-562 and 606-628"
FT   misc_feature    complement(54606..54677)
FT                   /note="Signal peptide predicted for BP1703 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.904) with cleavage site
FT                   probability 0.407 between residues 24 and 25"
FT   CDS_pept        complement(54674..55297)
FT                   /transl_table=11
FT                   /locus_tag="BP1704"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical
FT                   transmembrane protein Smc04287 TR:CAC46626 (EMBL:AL591789)
FT                   (233 aa) fasta scores: E(): 5e-40, 52.63% id in 209 aa, and
FT                   to Rhizobium loti Mll5171 protein TR:Q98CF5 (EMBL:AP003005)
FT                   (194 aa) fasta scores: E(): 4.3e-14, 40.24% id in 164 aa"
FT                   /db_xref="GOA:Q7VXP3"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXP3"
FT                   /protein_id="CAE41991.1"
FT                   /translation="MLRLIRLVDRLSTFVGQAFAWLIVVLTLHICWEVSARYILNTPSA
FT                   WAFDLQLMYYGILFMMAGAYTLAKNGHVRGDILYGFLPPRVQAGLDLLLYILFFIPGVV
FT                   AMVWAGWYYAGESIAIREHSSLMANGPPIYPFKAFIPIAGAFLLLQGLAEIARCLLCLR
FT                   KGQWPSRAEDVEEVDVDKLKEMVHVKDEDIAELDQYVEKGEQTR"
FT   misc_feature    complement(join(54818..54883,54956..55021,55085..55141,
FT                   55202..55258))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BP1704 by TMHMM2.0 at aa 13-32, 52-71, 92-114 and 138-160"
FT   CDS_pept        complement(55424..56548)
FT                   /transl_table=11
FT                   /locus_tag="BP1705"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Smc04289 TR:CAC46627 (EMBL:AL591789) (339 aa) fasta scores:
FT                   E(): 1.1e-92, 69.27% id in 332 aa, and to Rhizobium loti
FT                   periplasmic mannitol-binding protein, SmoM Mlr5166
FT                   TR:Q98CF9 (EMBL:AP003005) (369 aa) fasta scores: E():
FT                   3.4e-29, 30.98% id in 355 aa"
FT                   /db_xref="GOA:Q7VXP2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXP2"
FT                   /protein_id="CAE41992.1"
FT                   /translation="MQHVTQSRRKFISGAGAVAGTAVLGFPAVTRAQGSPVSMRFQSTW
FT                   PANDIFHEFAQDYARKVNDMAEGQLKIEVLPAGAVVKAFDLLDAVSAGTLDGGHGVVAY
FT                   WYGKNTAVALWGSGPSFGMDANMLLAWHEYGGGKELLTEIQKAMGVNVTSLMYGPMPTQ
FT                   PFGWFKKPITKADDVKGAKFRTVGLAIDMYSAMGAAVNALPGGEIVPALDRGLLDGAEF
FT                   NNASSDLALGFQDVSKICMLQSFHQSAEQFEILFNKNKYDALPKHLKHILAYAAQAASA
FT                   DMSWKAADRYSKDYIKLQKDHNVKFYKTPDAILQQQLKIWDEMIAKRSAENPLFKKVLD
FT                   SQRQFAERAGRWSNDTNVNFRMAFNHYFARKQPA"
FT   misc_feature    complement(56453..56548)
FT                   /note="Signal peptide predicted for BP1705 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.996) with cleavage site
FT                   probability 0.768 between residues 32 and 33"
FT   CDS_pept        56929..58533
FT                   /transl_table=11
FT                   /locus_tag="BP1706"
FT                   /product="probable ATP-binding ABC transporter protein"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   ATP-binding ABC transporter protein Rsc1453 TR:CAD15155
FT                   (EMBL:AL646064) (540 aa) fasta scores: E(): 1.2e-125, 72.5%
FT                   id in 542 aa, and to Escherichia coli hypothetical ABC
FT                   transporter ATP-binding protein YbiT or B0820 or Z1042 or
FT                   Ecs0897 SW:YBIT_ECOLI (P75790) (530 aa) fasta scores: E():
FT                   5e-116, 67.41% id in 534 aa"
FT                   /db_xref="GOA:Q7VXP1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXP1"
FT                   /protein_id="CAE41993.1"
FT                   /translation="MISTANLTIQFGPKPLFENVSVKFGEGNRYGLIGANGSGKSTFMK
FT                   IIGGDLEPSAGNVSLEPGVRLGKLRQDQFAFEEVRVLDVVMMGHTEMWAAMSERDAIYA
FT                   NPEATEDDYMRAADLEAKFAEYDGYTAEARAGELLLGLEIAVDQHNLLMREIAPGWKLR
FT                   VLLAQALFSNPDVLLLDEPTNNLDINTIRWLENVLNGYQSTMIIISHDRHFLNQVCTHM
FT                   ADVDYGEIRVYPGNYDDYMLASTQARERLTANNAKAKERIVELQDFVRRFAANKSKSRQ
FT                   ATSRLKQIDRIKADQVEVKPSSRQNPYIRFEQNKVMHRLAVTIEKLSKSYDQPVIRDFS
FT                   AMVDAGEKVAIIGANGVGKTTLLRMLATDLAPDSGTVKWSENADIGYMAQDVSDQFQQG
FT                   DINLFDWMAEHRQPGDDDQSIRSALGRLLFSGDDLPKAPKVLSGGEKNRMTFGRLMLGR
FT                   HNVMLLDEPTNHLDMESIESLQFALEKYEGALIFVSHDREFVSGLATRIIEILPDGELV
FT                   DYRGGYEDYLASRGIEA"
FT   misc_feature    57007..57612
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    57028..57051
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    57964..58467
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    57985..58008
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    58249..58293
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   CDS_pept        58689..59465
FT                   /transl_table=11
FT                   /locus_tag="BP1707"
FT                   /product="putative ABC-transport protein, ATP-binding
FT                   component"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   ABC-transport protein, ATP-binding component Sc8g12.21
FT                   TR:Q9KYY4 (EMBL:AL355753) (270 aa) fasta scores: E():
FT                   4.4e-32, 49.52% id in 212 aa, and to Pseudomonas aeruginosa
FT                   probable ATP-binding component of ABC transporter Pa2294
FT                   TR:Q9I1I1 (EMBL:AE004655) (284 aa) fasta scores: E():
FT                   2.7e-30, 45.65% id in 230 aa"
FT                   /db_xref="GOA:Q7VXP0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXP0"
FT                   /protein_id="CAE41994.1"
FT                   /translation="MNLTFDHVHKSFGSLNVVEGFSSEFKTGELVALVGPSGCGKSTLL
FT                   HLAAGLEQASQGRVLADGKPVQGPHPSRTLVFQEHALYPWLTLRDNVALALEFQNAPKA
FT                   QARQQAVHWLERVGLGGFDAYYPHQVSGGMRQRAALARAFIAQPQTLLMDEPFGALDAL
FT                   TRLSLQDVLRQLIEQEKPSVVLVTHDVDEALFLADRIVVFSQRPARVLREFNLAHRAKS
FT                   HDLSDLASEKREILRLLGIEVDSHGHGHGPKVALAA"
FT   misc_feature    58770..59306
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    58791..58814
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    59076..59120
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   CDS_pept        59550..60548
FT                   /transl_table=11
FT                   /locus_tag="BP1708"
FT                   /product="putative exported protein"
FT                   /note="Similar to Methanobacterium bryantii copper response
FT                   extracellular protein TR:Q48929 (EMBL:U40213) (353 aa)
FT                   fasta scores: E(): 1.3e-14, 29.32% id in 266 aa, and to
FT                   Deinococcus radiodurans ABC transporter, periplasmic
FT                   substrate-binding protein, putative dr1277 TR:Q9RUV4
FT                   (EMBL:AE001975) (325 aa) fasta scores: E(): 6.4e-14, 29.76%
FT                   id in 299 aa"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXN9"
FT                   /protein_id="CAE41995.1"
FT                   /translation="MKLKQWLSLPLAAALLAAAPAMAAEKFRVGYLRVMDDAQAIVAQE
FT                   GGYYKKAGLDSELIEFKSGTDLIKAIVGGQLDIGVLGFTNAVAWASKGADLKVVGGAQQ
FT                   GYHSLLVRDDSDIKDIAGLKGKTLASQAEGSTADVVLKGVVLKEGKLGADDVNVMGGSP
FT                   AVAVQSLVGKRVDAAFLFEPYDRIAQLVAPVKQIYEVGQAWPFPCMVVITSGDVLAKRK
FT                   DDVWKALDAQKEAIDLLQNKPADASRLIASYFIAEPTLKTLTRGELPRETVISEAISTQ
FT                   VFTPKLTDKDTNRLQEIADILQAQGSLKTRDGKPYDVSSIVDLSWQEARKL"
FT   misc_feature    59550..59618
FT                   /note="Signal peptide predicted for BP1708 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 23 and 24"
FT   CDS_pept        60545..61318
FT                   /transl_table=11
FT                   /locus_tag="BP1709"
FT                   /product="putative permease of ABC transporter"
FT                   /note="Similar to Pseudomonas aeruginosa probable permease
FT                   of ABC transporter Pa3448 TR:Q9HYF8 (EMBL:AE004765) (274
FT                   aa) fasta scores: E(): 2.7e-18, 35.4% id in 257 aa, and to
FT                   Streptomyces coelicolor putative ABC-transport protein,
FT                   membrane component sc8g12.20 TR:Q9KYY5 (EMBL:AL355753) (267
FT                   aa) fasta scores: E(): 4e-18, 29.96% id in 257 aa"
FT                   /db_xref="GOA:Q7VXN8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXN8"
FT                   /protein_id="CAE41996.1"
FT                   /translation="MSSSTRVTGARKHLAGVLGVLFILALWQAAAWVLPDFLMPGVPTV
FT                   AQRLVEDLGQASFHQSLLGTLGRLGAGYGLALAAGIGFGLVAAVLFFFREVLRSAIVIL
FT                   QSIPSIAWVPLFLIVMGFGNTPIIVVVALSAFFPAALSVMNATESVQRVHVSAARVMGA
FT                   TRWGLIKRVYLPAVMPELITGAQLAFGNAWRALISAEMLIGFGKGLGRSLAYSGEIADM
FT                   TGVMTNILVIAVLAALIDQFVLENLKHRLLRYQYV"
FT   misc_feature    60545..60637
FT                   /note="Signal peptide predicted for BP1709 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.960) with cleavage site
FT                   probability 0.551 between residues 31 and 32"
FT   misc_feature    join(60581..60649,60755..60823,60842..60910,60923..60982,
FT                   61043..61111,61208..61276)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP1709 by TMHMM2.0 at aa 13-35, 71-93, 100-122, 127-146,
FT                   167-189 and 222-244"
FT   misc_feature    60980..61216
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   CDS_pept        join(61355..62062,62064..62204)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1710"
FT                   /product="putative substrate-binding protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 236. The frameshift occurs within
FT                   a dimeric tract of (C)2. The sequence has been checked and
FT                   believed to be correct. Similar to Escherichia coli
FT                   cystine-binding periplasmic protein precursor FliY or B1920
FT                   SW:FLIY_ECOLI (P39174) (266 aa) fasta scores: E(): 0.44,
FT                   24.72% id in 275 aa, and to Pseudomonas glumae lipase
FT                   chaperone lipB SW:LICH_PSEGL (Q05490) (353 aa) fasta
FT                   scores: E(): 0.25, 32.44% id in 262 aa"
FT                   /db_xref="PSEUDO:CAE41997.1"
FT   variation       62061..62062
FT                   /note="(C)2 in pertussis; (C)1 in parapertussis and
FT                   bronchiseptica"
FT   repeat_region   62201..62232
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   62201..63253
FT   CDS_pept        62303..63253
FT                   /transl_table=11
FT                   /locus_tag="BP1711"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TT88"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TT88"
FT                   /protein_id="CAE41998.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEATRAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   misc_feature    62561..62626
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    62684..63217
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(63222..63253)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        63291..63878
FT                   /transl_table=11
FT                   /locus_tag="BP1712"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Smc01701 TR:CAC41902 (EMBL:AL591783) (194 aa) fasta scores:
FT                   E(): 1.3e-36, 54.01% id in 187 aa, and to Pseudomonas
FT                   aeruginosa hypothetical protein Pa0168 TR:Q9I6W4
FT                   (EMBL:AE004454) (196 aa) fasta scores: E(): 4.1e-35, 52.66%
FT                   id in 188 aa"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXN7"
FT                   /protein_id="CAE41999.1"
FT                   /translation="MMHTLAAACRHQEEIKKSRFAAYAAPVGTIAEAMAHFAAHSDPAA
FT                   THNCWAYRIGNEYRFNDDGEPGGTAGRPILQAIDGQGLDRVAVLVVRWFGGIKLGAGGL
FT                   VRAYGGCAANCLRAGERLPVIALATVRCRCGFAELPLLQARLAQAGASVRSETFDADGA
FT                   QLEFDVSRAALEELARTFANITRGRGDWDVQA"
FT   misc_feature    63501..63590
FT                   /note="ScanRegExp hit to PS00910, Uncharacterized protein
FT                   family UPF0029 signature. Confirmed by InterPro eMOTIF
FT                   pattern match."
FT   CDS_pept        complement(63896..64279)
FT                   /transl_table=11
FT                   /gene="trxC"
FT                   /locus_tag="BP1713"
FT                   /product="thioredoxin 2"
FT                   /note="Similar to Escherichia coli thioredoxin 2 TrxC or
FT                   B2582 or Z3867 or Ecs3448 SW:THI2_ECOLI (P33636) (139 aa)
FT                   fasta scores: E(): 2.2e-13, 51.28% id in 78 aa, and to
FT                   Streptomyces coelicolor thioredoxin TrxA2 TR:Q9RD25
FT                   (EMBL:AL133422) (134 aa) fasta scores: E(): 7.1e-23, 49.23%
FT                   id in 130 aa. Also similar to BP1263, 39.000% identity in
FT                   100 aa overlap."
FT                   /db_xref="GOA:Q7VXN6"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXN6"
FT                   /protein_id="CAE42000.1"
FT                   /translation="MSIVELTKDTFQDAITPDGTLIIDFWAPWCGPCRGFAPVFEQAAE
FT                   QHPDVTFAKVNTDVEQELAGALGIRSIPTLMVFREKVLLFSQPGALSAGQLGELLTKVK
FT                   EVDMAEVHRDIAQARENGEGEQA"
FT   misc_feature    complement(64043..64276)
FT                   /note="HMMPfam hit to PF00085, Thioredoxin"
FT   misc_feature    complement(64160..64216)
FT                   /note="ScanRegExp hit to PS00194, Thioredoxin family active
FT                   site. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        complement(join(64415..65005,65005..65433))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1714"
FT                   /product="conserved hypothetical protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 143. The frameshift occurs within
FT                   a dimeric tract of (GC)2. The sequence has been checked and
FT                   believed to be correct. Similar to Bacillus subtilis
FT                   hypothetical 37.1 kDa protein in ara-lacA intergenic region
FT                   YvbT SW:YVBT_BACSU (O32254) (336 aa) fasta scores: E():
FT                   6.3e-72, 59.69% id in 325 aa, and to Pseudomonas aeruginosa
FT                   hypothetical protein Pa2483 TR:Q9I0Z9 (EMBL:AE004676) (333
FT                   aa) fasta scores: E(): 6.9e-70, 58.91% id in 331 aa"
FT                   /db_xref="PSEUDO:CAE42001.1"
FT   variation       complement(65005..65008)
FT                   /note="(GC)2 in pertussis; (GC)3(G) in parapertussis and
FT                   bronchiseptica"
FT   CDS_pept        complement(65639..66931)
FT                   /transl_table=11
FT                   /locus_tag="BP1715"
FT                   /product="permease"
FT                   /note="Similar to Pseudomonas fluorescens OrfX protein
FT                   TR:Q9RHS8 (EMBL:AB023289) (431 aa) fasta scores: E():
FT                   4.7e-101, 64.33% id in 429 aa, and to Rhizobium meliloti
FT                   putative integral membrane transporter protein,
FT                   xanthineuracil permeases family smb21281 TR:CAC49185
FT                   (EMBL:AL603644) (457 aa) fasta scores: E(): 1.3e-125,
FT                   78.37% id in 430 aa"
FT                   /db_xref="GOA:Q7VXN5"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXN5"
FT                   /protein_id="CAE42002.1"
FT                   /translation="MLEKLFQLRDHATTVRTEIVAGLTTFLTMSYIIFLNPDILSSTGM
FT                   DRNAVFVATCLAAALGSLIMALVANWPIGMAPGMGLNAFFAFTVVKTMGYTWEQALGAV
FT                   FISGVIFLFLTISGIRAWLIRGIPHSLRSAIAAGIGLFLAIIALSNANIVVAHPATKVT
FT                   LGDLREPGPLFAILGFFIIAALDALRVRGAILIGILSVTVLSMLLGYNQFNGIFSSPPS
FT                   LAPTFMQLDILGALHTGFVHVILVFVLVEVFDATGTLMGIAKRAGLVPEDRPNRLGRAL
FT                   FADSTAIVAGSMLGTSSTTAYVESASGVQAGGRTGLTALVVALLFLAALFIAPLAGSVP
FT                   AYATAPALLYVAGLMMRELIDIDWNDVSEATPAALTALVMPFTYSIANGLAFGFISYVV
FT                   LKTCTGRIREVHPATWLVAILFIVRYAFFPE"
FT   misc_feature    complement(join(65648..65698,65735..65800,65906..65971,
FT                   66173..66238,66284..66349,66371..66421,66467..66532,
FT                   66560..66625,66641..66697,66719..66784,66830..66895))
FT                   /note="11 probable transmembrane helices predicted for
FT                   BP1715 by TMHMM2.0 at aa 12-34, 49-71, 78-97, 102-124,
FT                   133-155, 170-187, 194-216, 231-253, 320-342, 377-399 and
FT                   411-428"
FT   misc_feature    complement(65756..66886)
FT                   /note="HMMPfam hit to PF00860, Xanthine/uracil permeases
FT                   family"
FT   CDS_pept        67066..68106
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="BP1716"
FT                   /product="probable glycoprotease"
FT                   /EC_number="3.4.24.57"
FT                   /note="Similar to Escherichia coli probable
FT                   O-sialoglycoprotein endopeptidase Gcp or B3064 SW:GCP_ECOLI
FT                   (P05852) (337 aa) fasta scores: E(): 2.5e-68, 57.8% id in
FT                   346 aa, and to Ralstonia solanacearum probable
FT                   O-sialoglycoprotein endopeptidase gcP TR:CAD15926
FT                   (EMBL:AL646068) (347 aa) fasta scores: E(): 2.1e-81, 65.69%
FT                   id in 344 aa"
FT                   /db_xref="GOA:Q7VXN4"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXN4"
FT                   /protein_id="CAE42003.1"
FT                   /translation="MIILGFESSCDETGVAAVCTERGLLAHALHTQIAMHQEYGGVVPE
FT                   LASRDHIRRVVPLTRQVLAEAGLTLADVGAVAYTAGPGLAGALLVGASVAQALAWSRAL
FT                   PAIGIHHLEGHLLSPLLAEPRPEFPFVALLVSGGHTQLMLVDGVGRYELLGETLDDAAG
FT                   EAFDKSAKLMGLGYPGGPALARLAEQGDASRYDLPRPMLHSGDLDFSFSGLKTAVLTRV
FT                   KAATRDGGELGEQDRADLAAATQAAIVEVLAAKAIRALKQTGLRRLVVAGGVGANALLR
FT                   AHLARALKPLRAEAYFPPLSLCTDNGAMIAFAAAERVKAGLADLREGDHAFTVRPRWDL
FT                   ADIQAG"
FT   misc_feature    67066..68022
FT                   /note="HMMPfam hit to PF00814, Glycoprotease family"
FT   repeat_region   complement(68175..69405)
FT                   /note="Insertion sequence"
FT   CDS_pept        complement(68204..69220)
FT                   /transl_table=11
FT                   /locus_tag="BP1717"
FT                   /product="transposase for IS1663"
FT                   /note="Similar to Neisseria meningitidis putative
FT                   invertase/transposase Nma1800 TR:Q9JTF3 (EMBL:AL162757)
FT                   (318 aa) fasta scores: E(): 2e-17, 28.48% id in 316 aa and
FT                   Acinetobacter spSE19. pilin inverting protein ChnY
FT                   TR:Q9F7E1 (EMBL:AF282240) (324 aa) fasta scores: E():
FT                   8.2e-50, 47.516% id in 322 aa"
FT                   /db_xref="GOA:Q7TTM7"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTM7"
FT                   /protein_id="CAE42004.1"
FT                   /translation="MADSSLLSAGGQVHVFIGIDVSKAKLDCTLLTAEADKRKTKVVVN
FT                   TAAGVQALLAWCAKHGAQPAQLHAILEPTGLYHEQAATALPQVRVSLVNPAQARDFAKA
FT                   LALRSKNDALDSYVLARYGQTLSPALWHPAPLHARQLRALLTRREALSKDLLRELNRKE
FT                   KSQFSPSAPLVDGSIDKAIAFLREQIKQIERAIDQHIDNHPDLKQDCELLNSIPAIGPQ
FT                   AGNAILAVMHNRHIDSAQSLAAYLGVVPVQRQSGSSLNSCARLSKAGPSQVRATLYMAA
FT                   LVGTRHNPHIRALYQRLLKAGKSKKAALGAAMRKLVHLCFGVLKNRIPYQPNYAMNG"
FT   misc_feature    complement(68336..68668)
FT                   /note="HMMPfam hit to PF02371, Transposase
FT                   IS116/IS110/IS902 family"
FT   misc_feature    complement(68681..68968)
FT                   /note="HMMPfam hit to PF01548, Transposase"
FT   CDS_pept        complement(69488..70135)
FT                   /transl_table=11
FT                   /locus_tag="BP1718"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Neisseria meningitidis putative integral
FT                   membrane protein Nma1261 TR:Q9JUL4 (EMBL:AL162755) (200 aa)
FT                   fasta scores: E(): 1.5e-32, 54% id in 200 aa, and to
FT                   Caulobacter crescentus hypothetical protein Cc2446
FT                   TR:Q9A5K1 (EMBL:AE005913) (218 aa) fasta scores: E():
FT                   9.4e-29, 50.7% id in 213 aa"
FT                   /db_xref="GOA:Q7VXN3"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXN3"
FT                   /protein_id="CAE42005.1"
FT                   /translation="MPATMVLTAPSLLSSSALIVLAYLIGSIPFAVVVSKLMGLQDPRS
FT                   YGSGNPGATNVLRTGNKTAAALTLLGDAAKGWFALWLARALVPELSWGAYALVALAVFL
FT                   GHLYPLFLRFKGGKGVATALGVLMAIEPWLAVATIATWLIVAVFSRYSSLAALVAAFFA
FT                   PVYYVFGSGAAWHARLEVGLAIAVISALLFYRHRANIARLLKGTESRIGKKK"
FT   misc_feature    complement(69518..70081)
FT                   /note="HMMPfam hit to PF02660, Domain of unknown function
FT                   DUF"
FT   misc_feature    complement(join(69548..69613,69626..69682,69704..69769,
FT                   69800..69865,69887..69943,70034..70099))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP1718 by TMHMM2.0 at aa 12-34, 64-83, 90-112, 122-144,
FT                   151-170 and 174-196"
FT   misc_feature    complement(70070..70135)
FT                   /note="Signal peptide predicted for BP1718 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.978) with cleavage site
FT                   probability 0.879 between residues 22 and 23"
FT   CDS_pept        70261..71019
FT                   /transl_table=11
FT                   /gene="surE"
FT                   /locus_tag="BP1719"
FT                   /product="stationary-phase survival protein"
FT                   /note="Similar to Escherichia coli stationary-phase
FT                   survival protein SurE or B2744 or Z4052 or Ecs3598
FT                   SW:SURE_ECOLI (P36664) (253 aa) fasta scores: E(): 5.4e-43,
FT                   49.79% id in 245 aa, and to Ralstonia solanacearum probable
FT                   stationary-phase survival protein SurE TR:CAD14906
FT                   (EMBL:AL646063) (251 aa) fasta scores: E(): 1.9e-61, 64.14%
FT                   id in 251 aa"
FT                   /db_xref="GOA:Q7VXN2"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXN2"
FT                   /protein_id="CAE42006.1"
FT                   /translation="MRILVSNDDGYNAPGLEALVEALSGLGELTVVAPETNHSGASNSL
FT                   TLNRPLTVRTAANGFIYVNGTPSDCVHVALTGLMDARPDLVVSGINNGANMGDDTLYSG
FT                   TVAAASEGYLFGIPSIAFSLIEKGWQHIESAARAARQVVERQIAQPLAAPVLLNVNIPN
FT                   RRYEDMKGYAVTRLGKRHPSEPVVRTTTPYGDTVYWVGPVGLAADATPGTDFHATAQGQ
FT                   VSVTPLRLDLTQHSQLDDVRNWAEPLCVNA"
FT   misc_feature    70261..70818
FT                   /note="HMMPfam hit to PF01975, Survival protein SurE"
FT   CDS_pept        71145..71783
FT                   /transl_table=11
FT                   /gene="pcm"
FT                   /locus_tag="BP1720"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="Similar to Escherichia coli protein-L-isoaspartate
FT                   O-methyltransferase Pcm or B2743 or Z4051 or Ecs3597
FT                   SW:PIMT_ECOLI (P24206) (207 aa) fasta scores: E(): 2.6e-31,
FT                   51.7% id in 205 aa, and to Rhodocyclus gelatinosus Pcm
FT                   protein TR:Q9JP91 (EMBL:AB034704) (270 aa) fasta scores:
FT                   E(): 5.7e-33, 52.75% id in 218 aa"
FT                   /db_xref="GOA:Q7VXN1"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXN1"
FT                   /protein_id="CAE42007.1"
FT                   /translation="MNSDRLRQAMVQRLRAQGIADERVLNAMAAVPRHLFVDEALASRA
FT                   YEDAALPIGHSQTISQPWVVARMIAAVCEDRAPARVLEVGAGCGYQAAVLAQIVREVHA
FT                   IERIRGLYELARGHLRALRLATRVRLIHGDGMLGVPGVAPFDAIVVAAAGLAIPQALLD
FT                   QLAPGGRLIAPEGSTHQRLVLIERTGATAWSRKELEAVRFVPLRAGIQS"
FT   misc_feature    71160..71777
FT                   /note="HMMPfam hit to PF01135,
FT                   Protein-L-isoaspartate(D-aspartate) O-methyltransferase
FT                   (PCMT)"
FT   misc_feature    71541..71588
FT                   /note="ScanRegExp hit to PS01279,
FT                   Protein-L-isoaspartate(D-aspartate) O-methyltransferase
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        71801..72685
FT                   /transl_table=11
FT                   /locus_tag="BP1721"
FT                   /product="putative peptidase"
FT                   /note="Similar to Escherichia coli lipoprotein NlpD
FT                   precursor NlpD or B2742 SW:NLPD_ECOLI (P33648) (379 aa)
FT                   fasta scores: E(): 2.2e-18, 39.39% id in 264 aa, and to
FT                   Rhodocyclus gelatinosus NlpD protein nlpD TR:Q9JP90
FT                   (EMBL:AB034704) (314 aa) fasta scores: E(): 2.5e-29, 43.77%
FT                   id in 297 aa"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXN0"
FT                   /protein_id="CAE42008.1"
FT                   /translation="MLNGQLQLTESQSVAGASAAAASRPVLWAGVLAIALLAGCASKGP
FT                   RAPVVDLTGQPGASGPTDGSYVVKPGDTLYKIARANNVDIENLKRWNNLTDPNQISVGQ
FT                   VLRLSSSGAGGAQTTPVTSSKPQPKPLDQGSAETPAGGMEAGAGGETGGATTPPAATVP
FT                   DPKPARAADAAVINWGWPANGAILQTFNSNTKGIDLAGSLGDPVIAAADGKVMYSGNGV
FT                   RGLGNLIIINHQNGFITAYAHNRALLVKTGQNVKRGAKIAEIGETDTTSPRLHFEIRRQ
FT                   GTPVDPMQYLPPR"
FT   misc_feature    71996..72127
FT                   /note="HMMPfam hit to PF01476, LysM domain"
FT   misc_feature    72014..72079
FT                   /note="Predicted helix-turn-helix motif with score 1132
FT                   (+3.04 SD) at aa 79-100, sequence DTLYKIARANNVDIENLKRWNN"
FT   misc_feature    72422..72670
FT                   /note="HMMPfam hit to PF01551, Peptidase family M23/M37"
FT   CDS_pept        72682..73461
FT                   /transl_table=11
FT                   /locus_tag="BP1722"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Neisseria meningitidis hypothetical
FT                   protein Nma1628 TR:Q9JTU6 (EMBL:AL162756) (264 aa) fasta
FT                   scores: E(): 6.4e-60, 55.89% id in 263 aa, and to
FT                   Campylobacter jejuni hypothetical protein Cj1132C TR:Q9PNG2
FT                   (EMBL:AL139077) (264 aa) fasta scores: E(): 2.1e-26, 35.56%
FT                   id in 239 aa"
FT                   /db_xref="GOA:Q7VXM9"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019288"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXM9"
FT                   /protein_id="CAE42009.1"
FT                   /translation="MTPTLVFDLETIPDVAGLRRLNDWGGEVSDLEVVERAFAARREAV
FT                   GHDFLPLHLHQVAVVGCVFRDDQGFRVKTLGQPDDPEAALLSGFFKTIERYTPRLVSWN
FT                   GSGFDLPVLHYRSLIHGVPAPRYWDTGDEDRDFKFNNYISRYHNRHIDLMDLLAKYNGR
FT                   ANAPLDELAKLCGFPGKLGMDGSKVWEAWNQGKADEVRAYCETDVVNTWLVYCRFRFLR
FT                   GELDRVAYDAEVALVRDTLAASDAPHWKEYLAAWDAA"
FT   CDS_pept        73566..74165
FT                   /transl_table=11
FT                   /locus_tag="BP1723"
FT                   /product="putative exported protein"
FT                   /note="Weakly similar to Epiphyas postvittana
FT                   apolipophorin-iii-like protein TR:Q9GPN5 (EMBL:AF314181)
FT                   (186 aa) fasta scores: E(): 5.3, 22.89% id in 166 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXM8"
FT                   /protein_id="CAE42010.1"
FT                   /translation="MSRHAIRSTLAGLTLALSAGVVAAPALAATQEGPAAGHMKEQGRH
FT                   HHKKMMRDGVWLPGVGPLSKAQIESLKLDAKQQGLVDQARQAQRDVHKSRRDAGATGRD
FT                   ALKAQLDSGKLDPRALLAESDKRHEQFRAQATQVRDKWLAVWDSLNEAQRGQVTEIAKA
FT                   NQARMSERHARMQERMQKRHAEGGQSAAPAGAATAN"
FT   misc_feature    73566..73649
FT                   /note="Signal peptide predicted for BP1723 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.981 between residues 28 and 29"
FT   CDS_pept        74454..75206
FT                   /transl_table=11
FT                   /locus_tag="BP1724"
FT                   /product="putative exported protein"
FT                   /note="Similar to Ralstonia solanacearum probable signal
FT                   peptide protein Rsc0341 TR:CAD13869 (EMBL:AL646058) (268
FT                   aa) fasta scores: E(): 3.5e-18, 37.9% id in 277 aa, and to
FT                   Caulobacter crescentus hypothetical protein Cc2658
FT                   TR:Q9A513 (EMBL:AE005933) (230 aa) fasta scores: E():
FT                   2.5e-11, 34.65% id in 202 aa"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXM7"
FT                   /protein_id="CAE42011.1"
FT                   /translation="MKKPLFALPLVLAVCAAAGARAEPTDLGAGFSLSGNAAMVSDYLF
FT                   RGYSQTDFRPAIQLGFDLTHTSGLYLGNWNSNVSDFVFTDGNLEMDFYGGWKGEAGGGV
FT                   GLDVGVLHYYYPGSSSPKGGNYNNTDLYLGVSYANYSLKYSYTPGDFFSTPDTKGTWYL
FT                   DGTATFDLGDGWGLVGHLGYQKLKKAQDMDGDALGHYVDYKLGVTKDLSGWVLGLAAVG
FT                   ATRDNWLPTKNGHPSGRLGAVLSVARTF"
FT   misc_feature    74454..74519
FT                   /note="Signal peptide predicted for BP1723 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.948 between residues 22 and 23"
FT   misc_feature    75322..75483
FT                   /note="HMMPfam hit to PF01938, TRAM domain"
FT   CDS_pept        75325..76725
FT                   /transl_table=11
FT                   /locus_tag="BP1725"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhodocyclus gelatinosus YgcA protein
FT                   TR:Q9JP88 (EMBL:AB034704) (473 aa) fasta scores: E():
FT                   1.1e-106, 61.96% id in 447 aa, and to Ralstonia
FT                   solanacearum probable RNA methyltransferase protein rsc1209
FT                   TR:CAD14911 (EMBL:AL646063) (450 aa) fasta scores: E():
FT                   1.2e-104, 62.1% id in 446 aa"
FT                   /db_xref="GOA:Q7VXM6"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXM6"
FT                   /protein_id="CAE42012.1"
FT                   /translation="MVDVLNIESLDLEARGIAHRDGKVLFVEGALPGERVTVQTVRRKP
FT                   SYEIAKVEEVLRPSSQRVAPRCPHFGVCGGCAMQHLAPAAQVAIKQRALEDTFWHVGKL
FT                   KPARILPPLYGPTWGYRYRARLSVRVVPKKGGVLVGFHERKSSYVADMRECHVLPPAVS
FT                   RLLLPLRAMIAAMSAPDRMPQIEVALGDETIVLVLRHLLPLTDGDIAVLRAFAAEHGVQ
FT                   WWLQSKGPDTVHPLEREHADALAYTLPEFGLRMPYRPTDFTQVNHAINRAMVSRALKLL
FT                   DVQPQDRVADLFCGLGNFTLPLATQGREAVGVEGSKALTDRAHEAAARHGLGERTRFAT
FT                   LNLFEVDVQWLRGLGYFDRMLIDPPREGAQAVAQALSLLAPGERPRRIVYVSCSPGTLA
FT                   RDAAIMVHEGGYALRSAGVINMFPHTGHVESIAVFESLDEATVLQAQAQARQKAREEAE
FT                   RLAEAAAA"
FT   CDS_pept        complement(76749..77147)
FT                   /transl_table=11
FT                   /locus_tag="BP1726"
FT                   /product="MerR-family transcriptional regulator"
FT                   /note="Similar to Rhizobium meliloti heavy metal dependent
FT                   transcription regulator HmrR SW:HMRR_RHIME (Q9X5X4) (147
FT                   aa) fasta scores: E(): 1.2e-35, 71.53% id in 130 aa, and to
FT                   Agrobacterium tumefaciens strC58 Agr_c_1709p TR:AAK86743
FT                   (EMBL:AE008024) (140 aa) fasta scores: E(): 3.7e-29, 60.3%
FT                   id in 131 aa. Also similar to BP3173, 58.333% identity in
FT                   84 aa overlap."
FT                   /db_xref="GOA:Q7VXM5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXM5"
FT                   /protein_id="CAE42013.1"
FT                   /translation="MNIGDAAQASGISAKMIRYYESIGLIGPAARTESGYRVYGDAELH
FT                   TLRFVRRARDLGFSVEQMNELLALWRDRSRASADVKRIALEHVATLERKADELRQMADT
FT                   LKHLAHHCHGDTRPDCPIIEELSNTGRR"
FT   misc_feature    complement(77031..77138)
FT                   /note="HMMPfam hit to PF00376, Bacterial regulatory
FT                   proteins, merR family"
FT   misc_feature    complement(77070..77138)
FT                   /note="ScanRegExp hit to PS00552, Bacterial regulatory
FT                   proteins, merR family signature."
FT   misc_feature    complement(77082..77147)
FT                   /note="Predicted helix-turn-helix motif with score 1364
FT                   (+3.83 SD) at aa 1-22, sequence MNIGDAAQASGISAKMIRYYES"
FT   CDS_pept        77323..77523
FT                   /transl_table=11
FT                   /locus_tag="BP1727"
FT                   /product="putative exported protein"
FT                   /note="Similar to Pseudomonas syringae OrfH protein
FT                   TR:Q9KWM7 (EMBL:AB033420) (65 aa) fasta scores: E():
FT                   2.9e-05, 43.54% id in 62 aa, and to Agrobacterium
FT                   tumefaciens strC58 Agr_c_2220p TR:AAK87005 (EMBL:AE008049)
FT                   (84 aa) fasta scores: E(): 2.5e-07, 47.61% id in 63 aa"
FT                   /db_xref="GOA:Q7VXM4"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXM4"
FT                   /protein_id="CAE42014.1"
FT                   /translation="MTIAFHVPDMTCGHCVKSITQAVQQAVPQALVQIDLAARRVTVEG
FT                   AAAAEPVAQAIRAAGYAVQAA"
FT   misc_feature    77329..77517
FT                   /note="HMMPfam hit to PF00403, Heavy-metal-associated
FT                   domain"
FT   misc_feature    77341..77430
FT                   /note="ScanRegExp hit to PS01047, Heavy-metal-associated
FT                   domain."
FT   CDS_pept        77662..78390
FT                   /transl_table=11
FT                   /locus_tag="BP1728"
FT                   /product="putative glutaredoxin"
FT                   /note="Similar to Vibrio cholerae peroxiredoxin family
FT                   protein/glutaredoxin Vc2637 TR:Q9KNU3 (EMBL:AE004330) (247
FT                   aa) fasta scores: E(): 3.4e-61, 65.14% id in 241 aa, and to
FT                   Neisseria meningitidis putative redoxin Nma1141 or Nmb0946
FT                   TR:Q9JQS4 (EMBL:AL162755) (245 aa) fasta scores: E():
FT                   4e-59, 64.31% id in 241 aa"
FT                   /db_xref="GOA:Q7VXM3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011906"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXM3"
FT                   /protein_id="CAE42015.1"
FT                   /translation="MLQNREGQRVPSVTFPVRENNAWKQVTTDDVFKNKTVVVFSLPGA
FT                   FTPTCSSTHLPRYNELAPTFFAAGVDSIVCVSVNDTFVMNERAKDQESANVTLLPDGNG
FT                   EFTDGMGMLVDKKDLGFGKRSWRYAMLVKDGVVEKMFIEPEKEGDPFEVSDADTMLAYV
FT                   APQARKPDQVVVFSKPGCPFCVDAKALLKGKGFDPIEIPLDNKVRGRVIGAVSGGDTAP
FT                   QVFINGKLIGGFDALKAYLA"
FT   misc_feature    77677..78144
FT                   /note="HMMPfam hit to PF00578, AhpC/TSA family"
FT   misc_feature    78175..78345
FT                   /note="HMMPfam hit to PF00462, Glutaredoxin"
FT   misc_feature    78184..78234
FT                   /note="ScanRegExp hit to PS00195, Glutaredoxin active site.
FT                   Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        78524..79939
FT                   /transl_table=11
FT                   /locus_tag="BP1729"
FT                   /product="putative pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="Similar to Halobacterium volcanii dihydrolipoamide
FT                   dehydrogenase Lpd SW:DLDH_HALVO (Q04829) (474 aa) fasta
FT                   scores: E(): 1.4e-30, 32.27% id in 471 aa, and to Vibrio
FT                   cholerae pyridine nucleotide-disulfide oxidoreductase,
FT                   class I Vc2638 TR:Q9KNU2 (EMBL:AE004330) (484 aa) fasta
FT                   scores: E(): 1e-102, 60.17% id in 467 aa"
FT                   /db_xref="GOA:Q7VXM2"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXM2"
FT                   /protein_id="CAE42016.1"
FT                   /translation="MKTLHTDVAIIGAGTAGLAAHRAARAAGKRALLIEGGQYGTTCAR
FT                   VGCMPSKLLIAAAEAAHAAAHGGPFGVHIDGAVRIDGAQVMARVKSERDRFVGFVLEGV
FT                   ENIPAEDKLRGMARFVEDTVLRVDGHTEVRAGSVVIASGSRPAVPPPFLALGDRLVVND
FT                   DVFAWDTLPARVAVFGPGVIGLELGQALARLGVQVRVFGVSGSLGGITDPRVRQSARKA
FT                   FQQEFYLDPDARVLETKRVGDEVEVRYVALDNTERTERFDYALVATGRRPNVDGLDLHN
FT                   TSLALDARGVPHFDRHTMQAGQAPVFIAGDANADAPLLHEAADEGRIAGENAARYPDVA
FT                   PGLRRAALGVVFSDPQIALVGTPFARLESGTFVAGEVDFGDQGRSRVMLRNRGMLRVYA
FT                   DIESGRFVGAEMVGPSAEHIGHLLAWAAQQSLTVAQMLEMPFYHPVVEEGLRTALRDAA
FT                   ARLAQARPQRLAA"
FT   misc_feature    78524..78601
FT                   /note="Signal peptide predicted for BP1729 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.900) with cleavage site
FT                   probability 0.633 between residues 26 and 27"
FT   misc_feature    78545..79393
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT   CDS_pept        complement(79943..80806)
FT                   /transl_table=11
FT                   /locus_tag="BP1730"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Neisseria meningitidis hypothetical
FT                   protein Nmb1061 TR:Q9JZH0 (EMBL:AE002456) (281 aa) fasta
FT                   scores: E(): 9.7e-50, 45.77% id in 284 aa, and to
FT                   Escherichia coli O157:H7 hypothetical 32.0 kDa protein
FT                   Ecs4371 TR:BAB37794 (EMBL:AP002565) (280 aa) fasta scores:
FT                   E(): 1.4e-45, 42.8% id in 271 aa"
FT                   /db_xref="GOA:Q7VXM1"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXM1"
FT                   /protein_id="CAE42017.1"
FT                   /translation="MFSYRHAFHAGNHADVLKHAILVHVLDYMNRKEAPYWVVDTHAGA
FT                   GLYALGSDWASKNAEHADGVARLWELSGLPPLLADYVARIRDYNTDGVLRHYPGSPWLT
FT                   LDVLRERDRLRLFEMHPSESDVLVRNLERRNERTALRQTTVFAADGFEGVKALLPPPTR
FT                   RGLVLIDPSYEDKQDYRRTLTAVREGVKRFATGTFVVWYPLVQRREASEMARQLERLPV
FT                   KSWLHATLTVRKPAADGFGLHGSGMFLVNPPWTLHDALKPAMPLLARELAQDDRAGFTL
FT                   QYRENP"
FT   CDS_pept        complement(80819..81568)
FT                   /transl_table=11
FT                   /gene="ugpQ"
FT                   /locus_tag="BP1731"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /note="Similar to Escherichia coli glycerophosphoryl
FT                   diester phosphodiesterase UgpQ or B3449 SW:UGPQ_ECOLI
FT                   (P10908) (247 aa) fasta scores: E(): 4.5e-40, 47.73% id in
FT                   243 aa, and to Alcaligenes eutrophus Orf1 protein TR:Q44028
FT                   (EMBL:X91877) (248 aa) fasta scores: E(): 2e-53, 58.5% id
FT                   in 241 aa"
FT                   /db_xref="GOA:Q7VXM0"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXM0"
FT                   /protein_id="CAE42018.1"
FT                   /translation="MTAPLPAWPYSPYIAHRGGGRLAPENTLAAMRVGAAHGFTMFEFD
FT                   VKLSRDNVEVLLHDDDVDRTSNGHGPAASKTYAELAQLDAGSWYAPQYAGEPVPTFSAV
FT                   ARYALANGIACNVEIKPCPGREAETGAAVARAAAALWQDALPAPLLSSFAEPALHAARG
FT                   AAPQLPRALLVDRVPADWLERLRKYDCIALNINQRDASRELVDAVHQAGYRIAAWTVND
FT                   PARARLLLDWGMDAIFTDELATIRPAV"
FT   CDS_pept        81811..83766
FT                   /transl_table=11
FT                   /gene="ppiD"
FT                   /locus_tag="BP1732"
FT                   /product="peptidyl-prolyl cis-trans isomerase D"
FT                   /EC_number="5.2.1.8"
FT                   /note="Similar to Escherichia coli peptidyl-prolyl
FT                   cis-trans isomerase D PpiD or B0441 SW:PPID_ECOLI (P77241)
FT                   (623 aa) fasta scores: E(): 2.9e-17, 26.07% id in 652 aa,
FT                   and to Pseudomonas aeruginosa peptidyl-prolyl cis-trans
FT                   isomerase D PpiD or Pa1805 TR:Q9I2T8 (EMBL:AE004606) (621
FT                   aa) fasta scores: E(): 6.5e-30, 31.49% id in 651 aa"
FT                   /db_xref="GOA:Q7VXL9"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXL9"
FT                   /protein_id="CAE42019.1"
FT                   /translation="MFEIIRTHRRWMQLILLLLIVPSFMLVGVQGYDSFINREPELATV
FT                   AGQPVTRSEFDQAHRNQLEQLRQRLGSQFDPAMIDTPAMREQLLNQLIDQRLLAVVAAD
FT                   NGFSVSDGTLRNTIAAIPQVQDNGRFSPERYRQVLAAQGMSPTSFEAGLRRDLAVARVL
FT                   DPISQSASVPAEVARSVEAALTQRRTVQLRQFAASDFRAKVTVSPQDIQAWYDANQEQL
FT                   RVPEQVQAQYLVLDEAAATEGVQVKDEDIASYYEQNKSRFGQPERRRVSHIMISIPPGA
FT                   SEEARKAAAAKAQEIAAQAAADPAGFAELARKNSQDTGSAGQGGDLGWAPLPAPLQQAA
FT                   QALAKDQVSGVVDTPTAFHILKVTDFQPGSVKPLAEVKDEVVGEIRKQLASARFADMAT
FT                   DMTRLVYDQRDSLQPTADKLGLKLRTAGGITRTGLLPAEQAGAGSAAGGDDAQLLDNPR
FT                   VRQVLFSPDVLREKLNSGVIELTPDTMLAVRVAAVEPSHIPPLEQVRASIEDRLFGERA
FT                   AQAARQAGEAALKSVQADASATPEGFAPAIVVSRQDAQNLPRRVLDAVMRQAPSPLPAY
FT                   TGVELGADYVVARIEKVEAGQSTEQDLDLLKTQLSGAWGQAEDAAVLRQLRDQYKVQIL
FT                   PEAAEAIKGDAQSAAG"
FT   misc_feature    81811..81903
FT                   /note="Signal peptide predicted for BP1732 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.959) with cleavage site
FT                   probability 0.562 between residues 31 and 32"
FT   misc_feature    82603..82905
FT                   /note="HMMPfam hit to PF00639, PPIC-type PPIASE domain."
FT   misc_feature    82729..82794
FT                   /note="ScanRegExp hit to PS01096, PpiC-type peptidyl-prolyl
FT                   cis-trans isomerase signature. Confirmed by InterPro eMOTIF
FT                   pattern match."
FT   CDS_pept        complement(83748..84356)
FT                   /transl_table=11
FT                   /gene="tesA"
FT                   /gene_synonym="apeA"
FT                   /gene_synonym="pldC"
FT                   /locus_tag="BP1733"
FT                   /product="acyl-CoA thioesterase I precursor"
FT                   /EC_number="3.1.2.-"
FT                   /note="Similar to Escherichia coli acyl-CoA thioesterase I
FT                   precursor TesA or ApeA or PldC or B0494 SW:TESA_ECOLI
FT                   (P29679) (208 aa) fasta scores: E(): 9.7e-24, 42.07% id in
FT                   183 aa, and to Pseudomonas aeruginosa acyl-CoA thioesterase
FT                   I precursor TesA or Pa2856 TR:Q9HZY8 (EMBL:AE004712) (201
FT                   aa) fasta scores: E(): 2.1e-36, 56.28% id in 183 aa"
FT                   /db_xref="GOA:Q7VXL8"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXL8"
FT                   /protein_id="CAE42020.1"
FT                   /translation="MPAQAQTASAPTGSAPHAVLVVGDSLSAEYGLRRGSGWVPMLAQR
FT                   VSQQSPNYRVVNASISGDTTSGGLARLPALLRQHAPAVVVLELGSNDALRGLALDMTER
FT                   NLRAMAQASRQAGASVLVVGMQIPPNYGRDYTQRFAQVFPAVAEQEKARLVPFLMEGIA
FT                   TNRAMFQADGIHPNENAQPALLDNVWPLLEPMLAQPAAD"
FT   misc_feature    complement(84060..84305)
FT                   /note="HMMPfam hit to PF00657, Lipase/Acylhydrolase with
FT                   GDSL-like motif"
FT   misc_feature    complement(84282..84314)
FT                   /note="ScanRegExp hit to PS00639, Eukaryotic thiol
FT                   (cysteine) proteases histidine active site."
FT   CDS_pept        84415..85092
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1734"
FT                   /product="probable ATP-binding ABC transporter protein
FT                   (Pseudogene)"
FT                   /note="This CDS is possibly a pseudogene. This CDS appears
FT                   to have a large deletion, relative to B. parapertussis and
FT                   B. bronchiseptica, following codon 169. This deletion may
FT                   have resulted from an insertion of IS481 downstream.
FT                   Similar to Ralstonia solanacearum probable ATP-binding ABC
FT                   transporter protein Rsc1718 TR:CAD15420 (EMBL:AL646066)
FT                   (236 aa) fasta scores: E(): 2.1e-33, 70.06% id in 167 aa,
FT                   and to Pseudomonas aeruginosa probable ATP-binding
FT                   component of ABC transporter Pa2857 TR:Q9HZY7
FT                   (EMBL:AE004712) (227 aa) fasta scores: E(): 1.3e-29, 64.63%
FT                   id in 164 aa"
FT                   /db_xref="PSEUDO:CAE42021.1"
FT   misc_feature    84520..85074
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    84541..84564
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    84844..84888
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   variation       84919..84921
FT                   /note="There is a large deletion in pertussis, relative to
FT                   parapertussis and bronchiseptica, following this codon"
FT   repeat_region   85089..85120
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   85089..86141
FT   CDS_pept        85191..86141
FT                   /transl_table=11
FT                   /locus_tag="BP1735"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA3"
FT                   /protein_id="CAE42022.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   misc_feature    85449..85514
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    85572..86105
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(86110..86141)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(86290..86628)
FT                   /transl_table=11
FT                   /locus_tag="BP1736"
FT                   /product="putative exported protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa4739 TR:Q9HV60 (EMBL:AE004887) (114 aa) fasta
FT                   scores: E(): 2.6e-06, 40.18% id in 107 aa, and to the
FT                   N-terminal region of Escherichia coli osmotically inducible
FT                   protein Y precursor OsmY or B4376 SW:OSMY_ECOLI (P27291)
FT                   (201 aa) fasta scores: E(): 5.6e-06, 33.33% id in 120 aa"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXL7"
FT                   /protein_id="CAE42023.1"
FT                   /translation="MQVRKLFVATLIGATAAIGSLAHAAGEDKPKQSVGEYASDATVTT
FT                   KVKAAFVADKSLSALDIAVETNNGVVTLTGTVGTATEADQAATVARDVEGVKQVMNNIK
FT                   VDPAKAAK"
FT   misc_feature    complement(86557..86628)
FT                   /note="Signal peptide predicted for BP1736 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 24 and 25"
FT   CDS_pept        complement(86686..86847)
FT                   /transl_table=11
FT                   /locus_tag="BP1737"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Rhizobium loti Msr3702 protein TR:Q98FM7
FT                   (EMBL:AP003002) (54 aa) fasta scores: E(): 1.3e-08, 60.37%
FT                   id in 53 aa, and to Pseudomonas aeruginosa hypothetical
FT                   protein Pa5482 TR:Q9HT88 (EMBL:AE004961) (53 aa) fasta
FT                   scores: E(): 4.5e-07, 63.46% id in 52 aa"
FT                   /db_xref="GOA:Q7VXL6"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXL6"
FT                   /protein_id="CAE42024.1"
FT                   /translation="MLHYAVVFFVIAIIAAVLGFGGIAAGAAGIAKILFFVFLVLALLS
FT                   ILGGVFRK"
FT   misc_feature    complement(join(86695..86748,86761..86826))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BP1737 by TMHMM2.0 at aa 7-29 and 33-51"
FT   misc_feature    complement(86770..86847)
FT                   /note="Signal peptide predicted for BP1737 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.990) with cleavage site
FT                   probability 0.435 between residues 26 and 27"
FT   CDS_pept        complement(86879..87079)
FT                   /transl_table=11
FT                   /locus_tag="BP1738"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa4738 TR:Q9HV61 (EMBL:AE004887) (65 aa) fasta
FT                   scores: E(): 1.5e-13, 60.93% id in 64 aa, and to
FT                   Escherichia coli protein YjbJ or B4045 or Z5644 or ecs5028
FT                   SW:YJBJ_ECOLI (P32691) (69 aa) fasta scores: E(): 2.7e-10,
FT                   52.3% id in 65 aa"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR026042"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXL5"
FT                   /protein_id="CAE42025.1"
FT                   /translation="MNNDIVAGKWKQLTGKAKAAWGELTDDELTRTEGNAERLAGLIQE
FT                   RYGKTKEQAQREVREFFDRNP"
FT   CDS_pept        complement(87345..89918)
FT                   /transl_table=11
FT                   /gene="cphA"
FT                   /locus_tag="BP1739"
FT                   /product="cyanphycin synthetase"
FT                   /note="Similar to Synechococcus elongatus cyanphycin
FT                   synthetase CphA TR:Q9F2I7 (EMBL:AJ288949) (896 aa) fasta
FT                   scores: E(): 5.9e-113, 41.6% id in 870 aa, and to
FT                   Cyanothece cyanophycin synthetase CphA TR:Q9KGY4
FT                   (EMBL:AF279247) (872 aa) fasta scores: E(): 4.1e-110,
FT                   40.25% id in 872 aa. Also similar to the adjacent CDS,
FT                   BP1740, 44.509% identity (46.921% ungapped) in 856 aa
FT                   overlap."
FT                   /db_xref="GOA:Q7VXL4"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011810"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXL4"
FT                   /protein_id="CAE42026.1"
FT                   /translation="MEVSRIRALRGPNLWSRNTAIEAIAACSDAECAINGMPDFEARLR
FT                   ARFPQLGVLQPEGQRDAISMAHVLQATALGLQAHAGCPVTFGRTSPTIEPGVFQVVVEY
FT                   SEEDVGRLAFELAEALIRSAQDDTPFDLPQALQRLRDLDEDTRLGPSTGSIVNAAVARS
FT                   IPYHRLTQGSMVQFGWGSKQRRIQAAETDMTSAISESIAQDKDLTKMLLDAAGVPVPMG
FT                   SSVDSAAAAWQAAQALGGSVVVKPRDGSQGRGVAVNIETRDRIESAFEAAAEISSEAIV
FT                   ERYIPGHDFRLLVVGDTLVAAARRDPPQVTGDGTHTIAELVAQVNADPLRGDGHATSLT
FT                   KIRFDDIAIATLRKQGYEADSVAAAGALVVLRNNANLSTGGAATDVTDEVHPELAARAV
FT                   TAARMIGLDICGVDVVAETVHLPLEDQHGGVVEVNAAPGLRMHLNPSFGKGRAVGEAII
FT                   SHMFAERDDGRIPVVAVAGTNGKTTTVRLTAHILDCAGHRVGMTNSDGVYVGKQRIDTG
FT                   DCSGPRSARRLLLHPDVDAAVLETARGGVLREGLAFDRCNVAIVTNIGMGDHFGLGYIS
FT                   TVEDLAVVKRVIVQYVQPDGMAVLNAADPMVAEMASACPGSITYFAEDRNHPVMATHRA
FT                   QGHRVVYRDGDSLVAAQGGAEVAFALADIPLTRGGAIAFQVENTMAALAAAWALGIDWD
FT                   TIRHALAIFVNDAQTAPGRFNVFDFRGATLIADYGHNPDAIQALVRAIDTMPARRRSVV
FT                   ISGAGDRRDEDLRQQTEILGGAFDDVILYQDQCQRGRADGEVVALLRQGLQQAPRTRHI
FT                   DEIQGEFVAIDAALERLAPGDLCLILVDQVEEALAHIASRVTGQP"
FT   misc_feature    complement(87723..88505)
FT                   /note="HMMPfam hit to PF01225, Mur ligase family, catalytic
FT                   domain"
FT   misc_feature    complement(88431..88502)
FT                   /note="ScanRegExp hit to PS01011, Folylpolyglutamate
FT                   synthase signature 1."
FT   CDS_pept        complement(89989..92562)
FT                   /transl_table=11
FT                   /gene="cphA"
FT                   /locus_tag="BP1740"
FT                   /product="cyanophycin synthetase"
FT                   /EC_number="6.-.-.-"
FT                   /note="Similar to Cyanothece cyanophycin synthetase CphA
FT                   TR:Q9KGY4 (EMBL:AF279247) (872 aa) fasta scores: E():
FT                   1.9e-49, 37.54% id in 863 aa, and to Synechocystis sp
FT                   cyanophycin synthetase CphA or Slr2002 SW:CPHA_SYNY3
FT                   (P73833) (873 aa) fasta scores: E(): 2.4e-49, 37.98% id in
FT                   874 aa. Also similar to the adjacent CDS, BP1739, 44.509%
FT                   identity (46.921% ungapped) in 856 aa overlap."
FT                   /db_xref="GOA:Q7VXL3"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011810"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXL3"
FT                   /protein_id="CAE42027.1"
FT                   /translation="MRNHSSITMKKKDIEFLDVVTLRGPNIWTYRPVLEAWVDIGELED
FT                   FPSNTIPGFYERLSGWLPTLIEHRCSPGVRGGFLQRLREGTWPGHILEHVTLELQNLAG
FT                   LPGGFGKARETSRRGVYKVVVRAWHEQVTRAALQEGRDLVMAAIEDRPFNVPAAVARLR
FT                   ALVDSLCLGPSTACIVDAADDRDIPYIRLFEGNLVQFGYGSRQRRIWTAETDRTSAIAE
FT                   GISRDKDLTKELLSTCGVPVPEGRLVQSAADAWEAAQDIGLPVVVKPYDGNHGRGVFTN
FT                   LLTRDEIESAYAVAVDEGSGVIVERFITGNEHRLLVVGDRMVAAAAGEPAWVTGDGVST
FT                   IEDLIGSQINTDPRRGRTENHPLNPVRLDSAARLEIARQGMTATSVPAAGRNVLIQRSG
FT                   SVAFDVTDRVHPSVAATVALAARVVGLDVAGVDLVTDDISRPLDQTRGAIVEVNAGPGL
FT                   LMHLKPADCPPRPVGRSIVDHLFPADDDGRIPIVGVTGTNGKTVVARLVARLVQKGDCA
FT                   NWAAGRRVLMNRSVDAAVIENDSGVILGQGLAYDRCLVGVVTNIDDGDHLGDFDINETD
FT                   RLVDVFRTQIDVVLPGGAAVLNARDPRVVRMAELCDGEVLYFGLDPALPTLAAHLAEGK
FT                   RAVYLRAGRIVLARGRDEEALADIAAVPLTHGGRVAFQIENVLAAVAAAWALDIPVELI
FT                   RAGIETFDIDQADAPWQFTLFERNGACVVVDDVHNPSALRALLAAIEQFPARRRAAVYS
FT                   AGADRNDDALVEQGRLLGTTFDQVVLYDDATVASKRPAGQARSLLRQGLEQSARATAIA
FT                   DEADHARAIARVLDDLREGDFALLQSDEAFSGPTIDLVRRWIQQG"
FT   misc_feature    complement(90373..91092)
FT                   /note="HMMPfam hit to PF01225, Mur ligase family, catalytic
FT                   domain"
FT   misc_feature    complement(91633..91884)
FT                   /note="HMMPfam hit to PF00289, Carbamoyl-phosphate synthase
FT                   L chain, N-terminal domain"
FT   CDS_pept        join(92953..93015,93019..93063,93065..95092)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1741"
FT                   /product="putative ABC transporter (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a an in-frame
FT                   TGA stop codon and a frameshift mutation following codon
FT                   36. The frameshift occurs within a polymeric tract of (G)3.
FT                   The sequence has been checked and believed to be correct.
FT                   Similar to Deinococcus radiodurans ABC transporter,
FT                   ATP-binding protein Dra0349 TR:Q9RYG8 (EMBL:AE001863) (602
FT                   aa) fasta scores: E(): 1.2e-66, 38.66% id in 613 aa, and to
FT                   Bacillus subtilis YknV protein TR:O31708 (EMBL:Z99111) (604
FT                   aa) fasta scores: E(): 5.6e-64, 36.19% id in 594 aa"
FT                   /db_xref="PSEUDO:CAE42028.1"
FT   variation       93016..93018
FT                   /note="in-frame TGA stop codon in pertussis; TGG in
FT                   parapertussis and bronchiseptica"
FT   variation       93061..93063
FT                   /note="(G)3 in pertussis; (G)2 in parapertussis and
FT                   bronchiseptica"
FT   misc_feature    join(93353..93421,93479..93547,93707..93775,93785..93853,
FT                   94037..94105,94133..94186)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP1742 by TMHMM2.0 at aa 12-34, 54-76, 130-152, 156-178,
FT                   240-262 and 272-289"
FT   misc_feature    93359..94192
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region."
FT   misc_feature    94403..94957
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    94424..94447
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    94736..94780
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        95089..95577
FT                   /transl_table=11
FT                   /locus_tag="BP1743"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="InterPro:IPR015005"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXL2"
FT                   /protein_id="CAE42029.1"
FT                   /translation="MRAQPAMNDSAFQLHRNQAGRLVFTGADGRAHEGVVPVRAFPISA
FT                   PASGLSLVSADGHELAWLDDVAQLPPAQRPLVEAELASREFMPEIRRIVSVSTFATPSS
FT                   WQVETDRGNATFVLRGEEDIRRLAGHTLLITDMHGIFFLIRDALALDRHSRKLLDRFL"
FT   CDS_pept        complement(95669..96799)
FT                   /transl_table=11
FT                   /locus_tag="BP1744"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa3230 TR:Q9HZ10 (EMBL:AE004746) (374 aa) fasta
FT                   scores: E(): 1e-64, 46.88% id in 369 aa, and to Ralstonia
FT                   solanacearum conserved hypothetical protein TR:CAD16055
FT                   (EMBL:AL646069) (408 aa) fasta scores: E(): 1.8e-74, 51.44%
FT                   id in 381 aa"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXL1"
FT                   /protein_id="CAE42030.1"
FT                   /translation="MPSSVELSVQAGLEHFDAAQWDALAGPQPFVRHAFLRALHDTGCA
FT                   SPGTGWTPCFLALRRAGLLAGAVPLYAKSHSRGEYVFDYAWADAYARNGLPYYPKLLSA
FT                   VPFTPVGGARLLAHTHADRLLLARGLIQLARQFEVSSLHVLFPSDDDLLALREAGYLIR
FT                   AGVQFHWRNAGYAGFDDFLAAFSHDKRKKIRQDRKKVAAERVSFRWLRGADIDAAALDF
FT                   FYQCYRHTYLAHGNPPYLNLEFFRQLHAEMPDALVLILAEQDGQPVAAALNLQADGVLY
FT                   GRYWGARRYIPGLHFETCYLQSIEYCIAHGQASFEGGAQGEHKMARGLLPTPTWSAHWI
FT                   ADTRFAAAIDDFLGHETHAIDEYRDELATHSPFRKT"
FT   CDS_pept        96874..97695
FT                   /transl_table=11
FT                   /locus_tag="BP1745"
FT                   /product="putative exported protein"
FT                   /note="Similar to Neisseria meningitidis hypothetical
FT                   protein Nmb0621 TR:Q9K0H9 (EMBL:AE002417) (275 aa) fasta
FT                   scores: E(): 6.4e-40, 53.94% id in 241 aa, and to
FT                   Pasteurella multocida hypothetical protein Pm0569 TR:Q9CN70
FT                   (EMBL:AE006092) (287 aa) fasta scores: E(): 7.4e-37, 52.83%
FT                   id in 229 aa"
FT                   /db_xref="InterPro:IPR007402"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011197"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXL0"
FT                   /protein_id="CAE42031.1"
FT                   /translation="MEAASIAVPGAGAGASLRAQALDALMTPAWADKLAAVAAIDAGAP
FT                   VGAQQDLAEPAGLPGRPPAPQLVPPSQVRQRSVQSPEGRAALLHALAHIEFNAINLALD
FT                   AVWRYGGLPDAYYLDWLKVAREEAYHFDLLNRHLSGLGHAYGDFPAHNGLWEMAEKTRA
FT                   DLLARLALVPRTLEARGLDASPLIRDKLAAAGDADGAAILEIILRDEIGHVAIGNHWYK
FT                   ALCAQRGLDPVAQYAQLASRYGAPRLRGPFNLEARRAAGFDEDELRALLQA"
FT   misc_feature    96874..96936
FT                   /note="Signal peptide predicted for BP1745 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.947) with cleavage site
FT                   probability 0.901 between residues 21 and 22"
FT   CDS_pept        97734..98963
FT                   /transl_table=11
FT                   /locus_tag="BP1746"
FT                   /product="putative peptidoglycan-binding protein"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transglycolase Pa1171 TR:Q9I4G6 (EMBL:AE004547) (398 aa)
FT                   fasta scores: E(): 2.8e-92, 62.46% id in 389 aa, and to
FT                   Caulobacter crescentus peptidoglycan-binding protein,
FT                   putative Cc3322 TR:Q9A382 (EMBL:AE005994) (433 aa) fasta
FT                   scores: E(): 1.6e-49, 41.23% id in 388 aa"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXK9"
FT                   /protein_id="CAE42032.1"
FT                   /translation="MVHMNKAYLRLLCATAFAAAAIPALAAPAAATPADLDAYRACLKQ
FT                   LRGDAIKSGVQAATYDAQTASLAPDMDVLGFLDVQPEFKTPIWDYMAGLVDEERIEDGR
FT                   QALARHADVLARAQAEYGVDPATVVAVWGVESNFGKNLGGRPLLTSLSTLSCFGRRQSY
FT                   FRGEFFATLKIIQDEHMQPERLAGSWAGAFGQTQFMPSTYLRLAVDFDGDGRRDLVDSV
FT                   PDALGSTANFLRRAGWQTGQPWGFEVKLPAGMDLAGTGRRNKQPMSAWQARGIKRVDGG
FT                   ALPAGDTPAALLAPAGAQGPVFLVLRNFDALYSYNAAESYALAIAHLSDRLRGDLPFAR
FT                   AWPTDDPGLSRAERRELQELLLARGFDIGKPDGVIGVRTRQALQTVQGQLGLPADGRAG
FT                   QKTLKALRTP"
FT   misc_feature    97734..97811
FT                   /note="Signal peptide predicted for BP1746 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.651 between residues 26 and 27"
FT   misc_feature    98781..98957
FT                   /note="HMMPfam hit to PF01471, Putative peptidoglycan
FT                   binding domain"
FT   CDS_pept        99092..99532
FT                   /transl_table=11
FT                   /locus_tag="BP1747"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa3796 TR:Q9HXK1 (EMBL:AE004798) (195 aa) fasta
FT                   scores: E(): 9.9e-12, 41.61% id in 149 aa, and to
FT                   Escherichia coli hypothetical protein YidB or B3698
FT                   SW:YIDB_ECOLI (P09996) (132 aa) fasta scores: E(): 5.3e-05,
FT                   31.72% id in 145 aa"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="InterPro:IPR027405"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXK8"
FT                   /protein_id="CAE42033.1"
FT                   /translation="MGLLDSLTSIAGGALGGGDERSANGGMAALLPVLVAQLNNYPGGL
FT                   TALIQRFQEGGLGEVIASWVSAGPNQPVTPAQLDSVLEPGMVDQMAQQSGQDRGDVLAN
FT                   LSRLLPGLVDTATPGGQAESGQSFDAGSLLASLSGLLDGKRG"
FT   repeat_region   99541..99572
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   99541..100593
FT   CDS_pept        99643..100593
FT                   /transl_table=11
FT                   /locus_tag="BP1748"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTC0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTC0"
FT                   /protein_id="CAE42034.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHN"
FT   misc_feature    99901..99966
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    100024..100557
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(100562..100593)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(100590..101063)
FT                   /transl_table=11
FT                   /locus_tag="BP1749"
FT                   /product="putative AsnC-family transcriptional regulator"
FT                   /note="Similar to Rhizobium loti transcriptional regulator
FT                   Mll7935 TR:Q984M5 (EMBL:AP003013) (159 aa) fasta scores:
FT                   E(): 1.9e-15, 36.42% id in 151 aa, and to Agrobacterium
FT                   tumefaciens StrC58 Agr_c_1339p TR:AAK86548 (EMBL:AE008008)
FT                   (150 aa) fasta scores: E(): 8e-23, 45.27% id in 148 aa"
FT                   /db_xref="GOA:Q7VXK7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXK7"
FT                   /protein_id="CAE42035.1"
FT                   /translation="MQLDAIDHRIIGILQRDADISNAVLAERVGLSASACLRRVARLKE
FT                   NGVIRRIVAVLDPARVERPLSAIVTLEFARHGSEYRRTFMEQVALEPAVTQCYMVTGEV
FT                   SCVLIVHMRDMDEYLAFADRLFDQDDNVQAFYTHIVMQTVKDEPVVAVPAAPR"
FT   misc_feature    complement(100674..100985)
FT                   /note="HMMPfam hit to PF01037, AsnC family"
FT   misc_feature    complement(100941..101006)
FT                   /note="Predicted helix-turn-helix motif with score 1034
FT                   (+2.71 SD) at aa 20-41, sequence ISNAVLAERVGLSASACLRRVA"
FT   CDS_pept        101204..102163
FT                   /transl_table=11
FT                   /locus_tag="BP1750"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Agrobacterium tumefaciens strC58
FT                   Agr_c_1338p TR:AAK86547 (EMBL:AE008008) (320 aa) fasta
FT                   scores: E(): 1.6e-32, 33.44% id in 296 aa, and to Bacillus
FT                   halodurans Bh3588 protein TR:Q9K6Y6 (EMBL:AP001519) (317
FT                   aa) fasta scores: E(): 1.1e-14, 26.35% id in 296 aa"
FT                   /db_xref="GOA:Q7VXK6"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXK6"
FT                   /protein_id="CAE42036.1"
FT                   /translation="MPYLSGLMRRSGRLFLTLVKVMLPVMIAVQAAQAWGWIDILGQAF
FT                   APAMGLLNLPAEAGMVWMTGAFVGIYGAIAALISLAPALELTGGQFSALCSMLLFAHAL
FT                   PVEQAIVRRAGASFWATAALRVGAALGYGAAVSWFCHATGWLDEPVSLQWLQSTALAGE
FT                   QAGGIWAWVRGTAVSLSFTYLIILALLVALDVMERTGITRAITVALTPVLRVSGLDPRV
FT                   TPVTILGVLLGLSYGGALIIEEAEKQQLEARPRFLALAWLSLSHSLIEDTVLLMALGAN
FT                   GWIVLVGRLLVTLVVVAILARMLGGGGAARRPLGAPAG"
FT   misc_feature    101204..101296
FT                   /note="Signal peptide predicted for BP1750 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.808) with cleavage site
FT                   probability 0.570 between residues 31 and 32"
FT   misc_feature    join(101237..101305,101378..101446,101570..101638,
FT                   101714..101782,102050..102118)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BP1750 by TMHMM2.0 at aa 12-34, 59-81, 123-145, 171-193 and
FT                   283-305"
FT   CDS_pept        complement(102165..103373)
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="BP1751"
FT                   /product="DNA/pantothenate metabolism flavoprotein"
FT                   /note="Similar to Escherichia coli DNA/pantothenate
FT                   metabolism flavoprotein Dfp or B3639 SW:DFP_ECOLI (P24285)
FT                   (406 aa) fasta scores: E(): 1.7e-56, 43.95% id in 405 aa,
FT                   and to Neisseria meningitidis DNA/pantothenate metabolism
FT                   flavoprotein Nmb1658 TR:Q9JYB7 (EMBL:AE002516) (394 aa)
FT                   fasta scores: E(): 3.2e-65, 48.72% id in 392 aa"
FT                   /db_xref="GOA:Q7VXK5"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXK5"
FT                   /protein_id="CAE42037.1"
FT                   /translation="MLDLARKRIVLGLTGGIACYKIAELVRRMTEQGAVVDVVMTEAAT
FT                   HFITPVTMQALSGRPVFVDAWDARVDNNMAHIDLTRGADAVLIAPASADFMAKLAHGLA
FT                   DDLLSTLCLARACPLLVAPAMNREMWANPATQRNAAQLRADGITVLGPAAGEQACGETG
FT                   TGRMLEAHELLADLIASFQPKVLADRHMLLTAGPTSEPVDPVRVLSNRSSGKTGYALAR
FT                   AAHEAGARVTLITGATALAIPRGVTALHVTTARQMHDAVMANANDADIFVAVAAVADWR
FT                   VKNVSEQKLKKTTEGGGAPALEFEPNPDILAEVAKLASGPWCVGFAAETEKLAEHAEAK
FT                   RLRKGIPLLVGNLAHKVMDADTTELVLFDEHGVHPLPAAAKLDAARRLIAEIAARLPAP
FT                   ARP"
FT   misc_feature    complement(103002..103355)
FT                   /note="HMMPfam hit to PF02441, Flavoprotein"
FT   misc_feature    complement(103317..103349)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(103478..103984)
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="BP1752"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /note="Similar to Escherichia coli lipoprotein signal
FT                   peptidase LspA or B0027 SW:LSPA_ECOLI (P00804) (164 aa)
FT                   fasta scores: E(): 5.5e-22, 41.17% id in 153 aa, and to
FT                   Pseudomonas aeruginosa lipoprotein signal peptidase LspA or
FT                   Ls or Pa4559 TR:Q9HVM5 (EMBL:AE004869) (169 aa) fasta
FT                   scores: E(): 3.8e-28, 49.36% id in 158 aa"
FT                   /db_xref="GOA:Q7VXK4"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXK4"
FT                   /protein_id="CAE42038.1"
FT                   /translation="MTQARAAAPRLAPWLAAAALIIVLDQATKLYFDGAFQYGERLNVL
FT                   PFFDFTLLYNRGAVFSFLASEEGWQRWFFTALGVGASIVIVWLLRRTAGQPRFSLALTL
FT                   IMGGALGNVIDRVAYGHVVDFLLFYWRDWHYPAFNLADVAITCGAVLLVVDELLRARKR
FT                   PTAQD"
FT   misc_feature    complement(103490..103951)
FT                   /note="HMMPfam hit to PF01252, Signal peptidase (SPase) II"
FT   misc_feature    complement(join(103523..103579,103625..103690,
FT                   103718..103768,103913..103963))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BP1752 by TMHMM2.0 at aa 7-24, 72-89, 98-120 and 135-154"
FT   misc_feature    complement(103634..103672)
FT                   /note="ScanRegExp hit to PS00855, Signal peptidases II
FT                   signature."
FT   CDS_pept        complement(103987..106848)
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /gene_synonym="ilvS"
FT                   /locus_tag="BP1753"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="Similar to Escherichia coli isoleucyl-tRNA
FT                   synthetase IleS or IlvS or B0026 SW:SYI_ECOLI (P00956) (937
FT                   aa) fasta scores: E(): 1.3e-99, 51.64% id in 972 aa, and to
FT                   Aquifex aeolicus isoleucyl-tRNA synthetase IleS or Aq_305
FT                   SW:SYI_AQUAE (O66651) (956 aa) fasta scores: E(): 2.3e-130,
FT                   40.53% id in 982 aa"
FT                   /db_xref="GOA:Q7VXK3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXK3"
FT                   /protein_id="CAE42039.1"
FT                   /translation="MDYKKSLNLPDTPFPMRGDLAKREPGWVAEWEETQVYQAIRAASR
FT                   GRPRFVLHDGPPYANGDIHIGHAVNKILKDIIVKSRNMAGYDAHYVPGWDCHGMPIEIQ
FT                   IEKKYGKHLPVTEVQSKARAYALEQIDRQRKDFKRLGVLGDWHNPYLTMNFSNEADEIR
FT                   VLGRILEKGYVFRGLKPVNWCFDCGSALAEAEVEYADRVDPAIDVAFPFTDRGALARAF
FT                   GLDEVDAGAIVIWTTTPWTIPSNQALNVHPEIDYALVRVTPAPVHGPLLLLAQERVEPS
FT                   LKAWGLEGEIIATAKGEALEGLRFRHPLAAAAQGYDRTSPIYLGDYVTLDTGTGVVHSA
FT                   PAYGIEDFVSCKAHGLADSDILGPVMGDGKFVDSLPLFGGLSIWDANPRIVEALKLADS
FT                   LMLVQKLSHSYMHCWRHKTPVIYRATSQWFAGMDVKPRDGGPSLRESALAGIDATAFYP
FT                   AWGRARLHAMIANRPDWTLSRQRQWGVPMAFFVHKETGELHPRTVELLEQIAQRVEKGG
FT                   IEAWQSLDPRELLGDEAELYEKNRDTLDVWFDSGSTHATVLGGKDGVLGGSHGAELAWP
FT                   ADLYLEGSDQHRGWFHSSLLTGCMLYGHPPYKGLLTHGFVVDGQGRKMSKSVGNVIAPQ
FT                   KVSDSLGAEILRLWVASTDYSGELSISDEILKRVVESYRRIRNTLRFLLANVADFDAVG
FT                   QAVPYGELFEIDRYALAMTAQMQAEVQGHYERYDFHPAVSRLQTFCSEDLGAFYLDILK
FT                   DRLYTTAAGSAARRSAQTALLDITQTLLKLMAPILSFTAEEAWKILAGSALAKQADAPR
FT                   VTIFTEVYHALPPFADGEALTAKWTRLRAIRAEVQRKLEEVRSAGAIGSSLQAEVDLYA
FT                   NAADHDILASLGDDLRFVLIVSRATVHADADDLRIEIAASGHKKCERCWHWRPDVGQDA
FT                   DHPEICGRCVSNLFGAGEPRTRA"
FT   misc_feature    complement(104686..106773)
FT                   /note="HMMPfam hit to PF00133, tRNA synthetases class I (I,
FT                   L, M and V)"
FT   misc_feature    complement(106645..106680)
FT                   /note="ScanRegExp hit to PS00178, Aminoacyl-transfer RNA
FT                   synthetases class-I signature. Confirmed by InterPro eMOTIF
FT                   pattern match."
FT   CDS_pept        complement(106838..107803)
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="BP1754"
FT                   /product="riboflavin biosynthesis protein"
FT                   /EC_number="2.7.1.26"
FT                   /note="Similar to Escherichia coli riboflavin biosynthesis
FT                   protein RibF or B0025 or Z0029 or Ecs0028 SW:RIBF_ECOLI
FT                   (P08391) (313 aa) fasta scores: E(): 4e-48, 47.49% id in
FT                   299 aa, and to Pseudomonas aeruginosa riboflavin kinase/FAD
FT                   synthase RibF or pa4561 TR:Q9HVM3 (EMBL:AE004869) (312 aa)
FT                   fasta scores: E(): 2.6e-47, 48.48% id in 297 aa"
FT                   /db_xref="GOA:Q7VXK2"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXK2"
FT                   /protein_id="CAE42040.1"
FT                   /translation="MKPSLRIYRYPPPPSQRTPCALTIGNFDGVHLGHQAILARVRQEA
FT                   RARGLVPAVMTFEPHPREYFATLNRRPELAPTRISGLRDKLQALAAAGIEQVVVERFDA
FT                   RLAEMSANAFIEDLLVAGLQTRWLLVGEDFRYGHKRSGDIDLLREAGLTHGFEVCTLAD
FT                   ITDRQGHRISSSEVRTALAVGDLDRAAQLLGQPFHISGHVIHGQKLGRELGFPTMNLRV
FT                   APRCATRSGIYVVRVLGLQDRPLPAVASLGVRPTVEDRGRVLLEAHLLDESLDAYGKLV
FT                   RVEFLHKLRDEEKFADLPSLTAAIAQDAQNARAYFAVHGL"
FT   misc_feature    complement(106853..107230)
FT                   /note="HMMPfam hit to PF01687, Riboflavin kinase / FAD
FT                   synthetase"
FT   CDS_pept        107854..108477
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="BP1755"
FT                   /product="phosphoribosylglycinamide formyltransferase
FT                   (Pseudogene)"
FT                   /EC_number="2.1.2.2"
FT                   /note="Pseudogene. A deletion removed the C-terminal region
FT                   of this CDS. Similar to Escherichia coli
FT                   phosphoribosylglycinamide formyltransferase 1 PurN
FT                   SWALL:Q9F6I6 (EMBL:AF293163) (212 aa) fasta scores: E():
FT                   1.8e-36, 54.4% id in 193 aa, and to Ralstonia solanacearum
FT                   probable phosphoribosylglycinamide formyltransferase
FT                   protein PurN or rsc2454 or rs01151 SWALL:Q8XWM0
FT                   (EMBL:AL646070) (216 aa) fasta scores: E(): 2.4e-45, 63.07%
FT                   id in 195 aa"
FT   misc_feature    107878..108432
FT                   /note="HMMPfam hit to PF00551, Formyl transferase"
FT   misc_feature    107908..107940
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   variation       108475..108477
FT                   /note="There is a ~140 bp deletion in pertussis, relative
FT                   to parapertussis and bronchiseptica, following this codon"
FT   CDS_pept        108556..109857
FT                   /transl_table=11
FT                   /locus_tag="BP1756"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein Rsc2453 or Rs01153 SWALL:Q8XWM1 (EMBL:AL646070)
FT                   (417 aa) fasta scores: E(): 2.2e-77, 54.41% id in 419 aa,
FT                   and to Neisseria meningitidis fmu and fmv protein, putative
FT                   nmb1351 SWALL:Q9JZ03 (EMBL:AE002483) (418 aa) fasta scores:
FT                   E(): 1e-67, 48.81% id in 420 aa"
FT                   /db_xref="GOA:Q7VXK1"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXK1"
FT                   /protein_id="CAE42042.1"
FT                   /translation="MLGEVLQWTYPADAVLSHWLRAYPGMGGRDRAELAQAVYDVLRHL
FT                   RRYRQFAESGVGPATRRLAILGLAATMNPDVLAEGLGADQAAWLQRIRHIDVATLPRAV
FT                   RASVPDWLDERLAQLDDSEALLDALNRPANLDIRVNPLKAERDPMLTVLRAGPAGRFDP
FT                   QPMPYSPWGIRLAGHPSVNRWPQFEDGSIEVQDEGSQLLALLMGPRRGEMIIDFCAGAG
FT                   GKTLLLGALMRSTGRLYAFDVSAARLARAKPRFARSGLSNVVPVAIDSENDTRVKRLAG
FT                   KAQRVLVDAPCSGIGTLRRNPDLKWRQHPQSIAEMCELQHRILKSAARCVAPGGRLVYA
FT                   TCSLLAEENAEQAERFLAEHPDFERLDAAQLLANRCANLTLSGPYVQLRPDVHGTDGFF
FT                   AAVFERRKPSAAATQEPADVAAETGPGEPEDAAG"
FT   misc_feature    108928..109767
FT                   /note="HMMPfam hit to PF01189, NOL1/NOP2/sun family"
FT   repeat_region   109854..109885
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   109854..110906
FT   CDS_pept        109956..110906
FT                   /transl_table=11
FT                   /locus_tag="BP1757"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA3"
FT                   /protein_id="CAE42043.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   misc_feature    110214..110279
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    110337..110870
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(110875..110906)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(110903..111277)
FT                   /transl_table=11
FT                   /locus_tag="BP1757A"
FT                   /product="putative exported protein"
FT                   /note="Similar to the N-terminal region of Escherichia coli
FT                   PilL TR:AAL05516 (EMBL:AF399919) (357 aa) fasta scores:
FT                   E(): 3.8, 33.01% id in 106 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXK0"
FT                   /protein_id="CAE42044.1"
FT                   /translation="MLRLLPALLALAVPAAWAAGPTVQVGDNVTLASYYQIRGADCASL
FT                   RPPLVRIVQPPRLGTATVVQSQGNSGPGGRCAHTAVPVTQIVYRGTQPGQDTVVWEVTH
FT                   QPRQPASRRDSAAIVVVPRN"
FT   misc_feature    complement(111224..111277)
FT                   /note="Signal peptide predicted for BP1757A by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.997 between residues 18 and 19"
FT   CDS_pept        111539..112747
FT                   /transl_table=11
FT                   /locus_tag="BP1758"
FT                   /product="probable fatty acid desaturase"
FT                   /note="Similar to Azotobacter vinelandii stearoyl-CoA
FT                   desaturase TR:Q59162 (EMBL:U37517) (367 aa) fasta scores:
FT                   E(): 7.8e-68, 47.7% id in 348 aa, and to Pseudomonas
FT                   aeruginosa probable fatty acid desaturase pa0286 TR:Q9I6K4
FT                   (EMBL:AE004466) (392 aa) fasta scores: E(): 2.5e-79, 49.23%
FT                   id in 392 aa"
FT                   /db_xref="GOA:Q7VXJ9"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXJ9"
FT                   /protein_id="CAE42045.1"
FT                   /translation="MDSILSFISGGLTQATWWQIVLFTLVVTHITIVSVTVFLHRSQAH
FT                   RGLDLHPAVMHFFRFWLWMTTGMVTKEWVAIHRKHHAKCEKEGDPHSPMLFGIWKVLFR
FT                   GAELYREESANKETMAKFGHGTPDDWLERNIYSKHSLAGVLTMLAIDLALFGAVGLTVW
FT                   AVQMAWIPFWAAGVVNGIGHYWGYRNYNSPDTSTNVFPWGIIIGGEELHNNHHAHGTSA
FT                   KFSAKWYELDIGWGYISILKFFGLAKVKKVAPKLKLESGSKGIDLSTLQGVITHRYEVM
FT                   ARYGDLVKRAAREELSKLKSSRQQDAANCRWTTLRRVRRWLHRNEEVLQPEQRAEVDQA
FT                   IAQNQSLSTLVQMRRELGRLWESSSASSEQLLHDLQAWCQRAQQSGIAGLEQFALHLRR
FT                   YAA"
FT   misc_feature    111545..112243
FT                   /note="HMMPfam hit to PF01069, Fatty acid desaturase"
FT   misc_feature    join(111581..111649,111959..112027,112040..112099)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BP1758 by TMHMM2.0 at aa 15-37, 141-163 and 168-187"
FT   misc_feature    112442..112507
FT                   /note="Predicted helix-turn-helix motif with score 1213
FT                   (+3.32 SD) at aa 302-323, sequence SRQQDAANCRWTTLRRVRRWLH"
FT   CDS_pept        112744..115044
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /gene_synonym="mutU"
FT                   /gene_synonym="pdeB"
FT                   /gene_synonym="rad"
FT                   /gene_synonym="recL"
FT                   /locus_tag="BP1759"
FT                   /product="DNA helicase II"
FT                   /EC_number="3.6.1.-"
FT                   /note="Similar to Escherichia coli DNA helicase II UvrD or
FT                   MutU or PdeB or Rad or RecL or B3813 SW:UVRD_ECOLI (P03018)
FT                   (720 aa) fasta scores: E(): 1.3e-94, 46.5% id in 772 aa,
FT                   and to Neisseria meningitidis DNA helicase II Nmb0232
FT                   TR:Q9K1D0 (EMBL:AE002380) (735 aa) fasta scores: E():
FT                   1.2e-108, 53.78% id in 766 aa"
FT                   /db_xref="GOA:Q7VRY2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VRY2"
FT                   /protein_id="CAE42046.1"
FT                   /translation="MMLEKLNPEQRAAVTLEPQHALVLAGAGSGKTRVLTTRMAWLIQT
FT                   GQASPFALLAVTFTNKAAREMLTRMSTLLPIDTRGLWIGTFHGLCNRMLRAHHRDAGLP
FT                   QAFQILDTTDQLAAIKRLLKAGNIDDEKYPPRDVQRFINGAKEEGLRPGDVEAYDPHRR
FT                   KLIEIYQLYEAQCQREGVVDFAELLLRAYELLSRNAPVREHYQRRFRHILVDEFQDTNT
FT                   LQYKWLRLLAGTGAAIFAVGDDDQSIYAFRGANVGNMADFERDYAHGRVIRLEQNYRSY
FT                   GHILDSANALIGHNTGRLGKNLWTEQGEGEPVRVIEQPSDGMEAQWLVDEIRALINDGR
FT                   MRSEIAVLYRSNAQSRVLEHALFSVGIPYKVYGGLRFFERQEIKHALAYLRLIANPNDD
FT                   TSWMRVVNFPTRGIGARTLEQLSDAARAHDTSLFGAVARVGGKGGSNLAQFAQLIGQMA
FT                   HDTRELPLPELVDHVIEASGLKAHYQTEREGAERLENLNELITAATVFAAEENFEGLPA
FT                   GVVPDHDVSGALMPGVVDAPQPDTLGGLTPLAAFLSHAALEAGDNQAQVGQDAVQLMTV
FT                   HAAKGLEFDAVFITGLEEGLFPHENSIMEPAGLEEERRLMYVAITRARERLYLSLAQSR
FT                   MLHGQTRYAMRSRFLEEIPEQHLKWLSPRAGLHQGGGFGGAAPAWSSRGDAFGRKPTGT
FT                   AAPRQPRGMASGVTVGEQQFRVGQGVRHARFGDGTIIGLSGSGQDAQAQIQFRDVGAKT
FT                   LALGIAKLDIITA"
FT   misc_feature    112759..114180
FT                   /note="HMMPfam hit to PF00580, UvrD/REP helicase"
FT   misc_feature    112816..112839
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        complement(115097..117709)
FT                   /transl_table=11
FT                   /locus_tag="BP1760"
FT                   /product="putative exported protein"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   siderophore receptor Pa1365 TR:Q9I3X9 (EMBL:AE004565) (813
FT                   aa) fasta scores: E(): 1.1e-08, 23.6% id in 771 aa, and to
FT                   Escherichia coli hypothetical protein Yddb or B1495
FT                   SW:YDDB_ECOLI (P31827) (790 aa) fasta scores: E(): 3.1e-72,
FT                   32.65% id in 781 aa"
FT                   /db_xref="GOA:Q7VXJ8"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXJ8"
FT                   /protein_id="CAE42047.1"
FT                   /translation="MSKPILKKRQRTTLAALLLCTAAATHAATQSPALAFDLPAQPLDA
FT                   ALRAYARQAGVALSFDAREAARKQAPALRATMTAQAALQHLLRGSGLTWRAAGANRYAV
FT                   VRAADAAAAWPLEPVRVYGDATRERVYTEQEIAATPASNRDLSALIATHPAIRESGTAE
FT                   DGANRGTLNVEDISIHGASPYQNLFLIDGVGATSRVDPANKSRNFTDVPSNPQAYFLDT
FT                   ALLGEVRVFDNSIPVEYGAFNGGVVDARLRRPSGENHVKLDYRWNGSNLTRQKIAPGNA
FT                   EDWLQGTPDFTPSWRKRFHTASADIALGERAGLVLGLSRRISRIERWRLGAVGHLDRPE
FT                   RDDSLDRVDNLLGKFSLRLDADTITDLSLKYADRREHLVSNFFRDTDWRNRHGAQGAVW
FT                   NIEHTLRGGKLSAQLGWDRFDSHRNSAHTEFVQHDFVDGRPGFASGGYGKDEKGQRNLT
FT                   LATRLDLAPIQTGPVSHASYVGLQVEHTGARFKRYNQSYSYRAVHREDGTEKHFSKVRH
FT                   LPGSVTLDYTRLGLYASDELTWRRWTLNAGLRYDRDNFLHHRTLAPRARLDWDVLGSDD
FT                   TVLSAGWSRYYGGHVLKIAMQEEFSRLSEQVLDHHGDPVPNGRKITRVNYDGLRSPYDD
FT                   EWAFSLAQRAYGIRGVLTFVHRNGRDQVTRRGDSRVGYRYTNEGNSRTDGWNLTLANEE
FT                   AWRLGETLWHAQASWGYQRNKRNLNLAEGYESSPVERADYVYYNGKRIPAANLPPSNFN
FT                   LPHKVSLDLTGHWPRHGLTWSNTVNWHGRRKEIAFVDTGPAPEYLDMYESLSAPSYWSW
FT                   DTRLIWQPPFARQVTLALDVLNVLNRIAALTTNPRDSLIDARRYRTGREIWLQVGYRY"
FT   misc_feature    complement(117629..117709)
FT                   /note="Signal peptide predicted for BP1760 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.967 between residues 27 and 28"
FT   CDS_pept        complement(118069..119994)
FT                   /transl_table=11
FT                   /locus_tag="BP1761"
FT                   /product="probable ABC transporter ATP-binding protein"
FT                   /note="Similar to Escherichia coli hypothetical ABC
FT                   transporter ATP-binding protein YheS or B3352 or Z4713 or
FT                   Ecs4203 SW:YHES_ECOLI (P45535) (637 aa) fasta scores: E():
FT                   2.4e-90, 50.31% id in 632 aa, and to Pasteurella multocida
FT                   hypothetical protein Pm1582 TR:Q9CKM9 (EMBL:AE006195) (640
FT                   aa) fasta scores: E(): 1.6e-89, 49.68% id in 638 aa"
FT                   /db_xref="GOA:Q7VXJ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXJ7"
FT                   /protein_id="CAE42048.1"
FT                   /translation="MIRASGLTLRRGTKVLLDGADFVVHPGERVGIVGKNGAGKSSLFA
FT                   LLTGALDPDAGNLDLPAGWRIASVQQEIAADAQAAREFVIDGDTHLRALQAQRAALTDD
FT                   QGTQIAETEAALIEAGAWSAASRAEQLLAGLGFKPSEWMQPVRSFSGGWRMRLVLARAL
FT                   MAPSELLLLDEPTNHLDLDAMLWLEKWLTAYPGTVLLISHDTEFLDAVARAILHFDQAK
FT                   LQRYRGGYQDFLLQRAERLRQANIAYERQTREAARLQGFIDRFKAKASKAKQAQSRVKA
FT                   LARMEALAPIHAESGIDIRIPSPDHMPDPLLAMEHMDAGYGGAEPILRDVTLMVRAGSR
FT                   IGVLGANGAGKSTLIKTLADELAPHAGTRRASRGLAIGYFHQHQLDMLDLDSTPLAHLA
FT                   RLAPEVREQELRNYLGGFGFSGDTVLSKVGPMSGGEKARLALSLIVWQKPNLLLLDEPS
FT                   NHLDVETREALATALAEFSGSMLLVSHDRHLLRTTVDSFWIVADGGVREFDGDLEDYRD
FT                   WLAARNAGERAAAREAAAGEPGVAVDRKAQRRLEAEQRQRLATLRKPLAAKLAKVEADM
FT                   ERARARLQELDAVIADADLYSDARRTERQQVMTEHGESGKRLNDLEEQWLEIQQALEEI
FT                   EQDNAA"
FT   misc_feature    complement(118486..118983)
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    complement(118660..118704)
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   misc_feature    complement(118939..118962)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    complement(119332..119916)
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    complement(119506..119550)
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   misc_feature    complement(119872..119895)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        complement(119991..120887)
FT                   /transl_table=11
FT                   /locus_tag="BP1762"
FT                   /product="putative adenine-specific methylase"
FT                   /note="Similar to Neisseria meningitidis hypothetical
FT                   adenine-specific methylase Nmb1655 SW:YG55_NEIMB (Q9JYC0)
FT                   (303 aa) fasta scores: E(): 1.9e-60, 55.4% id in 296 aa,
FT                   and to Escherichia coli hypothetical adenine-specific
FT                   methylase YfcB or B2330 SW:YFCB_ECOLI (P39199) (310 aa)
FT                   fasta scores: E(): 9.6e-56, 50.51% id in 289 aa"
FT                   /db_xref="GOA:Q7VXJ6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017127"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXJ6"
FT                   /protein_id="CAE42049.1"
FT                   /translation="MQNNNRQELQTLRDLIRYAVSRLNAARVALGHGSDNAWDEAVYLV
FT                   LHGLHLPPDTLDPFLDARVLPSERSRVLDLIDRRVTERLPAAYLTGEAWLRGHRFHVDR
FT                   RVIVPRSPIAELLDEGLAPWVRDPLQVERALDMCTGSGCLAILAALAFPVAQVDAVDVS
FT                   SDALEVAARNVAEYGLQDRLTLRQGNLFEALPAAAYDVIVCNPPYVNQASMGALPQEYR
FT                   HEPALALAGGADGMDLVRRILAAAPGYLSADGVLVLEIGHERDHFEAAFPDLQPVWLDT
FT                   AESSDQILLLTREQLNT"
FT   misc_feature    complement(120264..120284)
FT                   /note="ScanRegExp hit to PS00092, N-6 Adenine-specific DNA
FT                   methylases signature."
FT   CDS_pept        complement(120894..122033)
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="BP1763"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis DapE TR:Q9ZEX1 (EMBL:AJ009834) (379 aa) fasta
FT                   scores: E(): 1.3e-146, 96.04% id in 379 aa, and similar to
FT                   Escherichia coli succinyl-diaminopimelate desuccinylase
FT                   DapE or MsgB or B2472 SW:DAPE_ECOLI (P24176) (375 aa) fasta
FT                   scores: E(): 5.5e-86, 58.49% id in 371 aa"
FT                   /db_xref="GOA:Q7VXJ5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXJ5"
FT                   /protein_id="CAE42050.1"
FT                   /translation="MTASAVLDLVKDLIARPSVTPDDVDCQMLLAQRLERIGFQCETIA
FT                   RGGVTNLWARRGAGAPLTVFAGHTDVVPPGPRDKWDSDPFVPTERDGFLYGRGAADMKS
FT                   SIAAFVVAAEEFVAVHPEHPGSIALLITSDEEGPAVDGTVIVCDELRQRGEQLDYCIVG
FT                   EPTSTEALGDVCKNGRRGSLSGRLLVKGVQGHVAYPHLARNPVHQLAPALTELVAIEWD
FT                   QGNEYFPPTTFQVSNLHAGTGATNVVPGEAVALFNFRFSTASTPGQLKARVHEVLDRHG
FT                   LEYQLDWELGGEPFLTPRGSLTDALVSAIQAETGLQAELSTTGGTSDGRFIARICPQVI
FT                   EFGPCNATIHKVNERIELSSLAPLKNIYRRTLENLLLAD"
FT   misc_feature    complement(121056..122006)
FT                   /note="HMMPfam hit to PF01546, Peptidase family
FT                   M20/M25/M40"
FT   CDS_pept        complement(122033..122854)
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="BP1764"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis 2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase DapD SW:DAPD_BORPE (Q9ZEX2) (273 aa)
FT                   fasta scores: E(): 2.3e-107, 100% id in 273 aa, and similar
FT                   to Escherichia coli
FT                   2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase DapD or B0166 SW:DAPD_ECOLI (P03948)
FT                   (274 aa) fasta scores: E(): 3.4e-76, 72.01% id in 268 aa"
FT                   /db_xref="GOA:P0A4U8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4U8"
FT                   /protein_id="CAE42051.1"
FT                   /translation="MTLDLQTTIEQAWENRANLSPVDASAEVRDAVEHTIDGLDLGRLR
FT                   VAEKIDDQWIVHQWIKKAVLLSFRLHDNAVMGQGPLQFYDKVPTKFAGYGEAAFKAGGY
FT                   RVVPPAVARRGAFIARNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGV
FT                   GIGGVLEPLQANPTIIEDNCFIGARSEVVEGVVVEENSVLAMGVFLSQSTKIYDRATGK
FT                   VSYGRVPSGSVVVPGSLPSEDGSHSLACAVIVKRVDAQTRAKTSINDLLRA"
FT   misc_feature    complement(122204..122257)
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats)"
FT   misc_feature    complement(122258..122311)
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats)"
FT   misc_feature    complement(122354..122407)
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats)"
FT   misc_feature    complement(122366..122452)
FT                   /note="ScanRegExp hit to PS00101, Hexapeptide-repeat
FT                   containing-transferases signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   misc_feature    complement(122408..122461)
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats)"
FT   CDS_pept        complement(join(122880..123602,123601..124074))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="dapC"
FT                   /locus_tag="BP1765"
FT                   /product="N-succinyl-L,L-diaminopimelate aminotransferase
FT                   (Pseudogene)"
FT                   /EC_number="2.6.1.17"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 158. The frameshift occurs within
FT                   a dimeric tract of (CG)2. Identical to the previously
FT                   sequenced Bordetella pertussis DapC TR:Q9ZEX3
FT                   (EMBL:AJ009834) (397 aa) fasta scores: E(): 4.1e-154,
FT                   96.48% id in 398 aa, and similar to Pseudomonas aeruginosa
FT                   probable aminotransferase Pa3659 TR:Q9HXY0 (EMBL:AE004785)
FT                   (402 aa) fasta scores: E(): 7.4e-88, 58.1% id in 401 aa"
FT                   /db_xref="PSEUDO:CAE42052.1"
FT   misc_feature    complement(join(122889..123602,123601..124074))
FT                   /note="HMMPfam hit to PF00155, Aminotransferase class I and
FT                   II"
FT   variation       complement(123602..123605)
FT                   /note="(CG)2 in pertussis; (CG)3 in parapertussis and
FT                   bronchiseptica"
FT   misc_feature    complement(124012..124041)
FT                   /note="ScanRegExp hit to PS00215, Mitochondrial energy
FT                   transfer proteins signature."
FT   tRNA            124120..124206
FT                   /note="tRNA Leu anticodon TAG, Cove score 68.96"
FT   CDS_pept        complement(124425..124754)
FT                   /transl_table=11
FT                   /locus_tag="BP1766"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches. Similar to BP0266,
FT                   BP2719, BP3099, BP3683, and BP3731"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXJ4"
FT                   /protein_id="CAE42053.1"
FT                   /translation="MKTLATALMLSLGPLSAGAQAAPNAEPNNLPYQGVYGQTDANAPT
FT                   RAQVQAELAQAKANGQYTFGELEYPAAQTGSTAAPSRDQVKAELAQAKASGQYTFGELD
FT                   YPPRN"
FT   misc_feature    complement(124692..124754)
FT                   /note="Signal peptide predicted for BP1766 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.903 between residues 21 and 22"
FT   CDS_pept        125137..126393
FT                   /transl_table=11
FT                   /gene="phg"
FT                   /locus_tag="BP1767"
FT                   /product="autotransporter"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis Phg protein TR:Q9Z5R3 (EMBL:AJ009835) (418 aa)
FT                   fasta scores: E(): 1.6e-154, 100% id in 418 aa"
FT                   /db_xref="GOA:Q79GU5"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q79GU5"
FT                   /protein_id="CAE42054.1"
FT                   /translation="MKPTSILARLPRYLGACALAALAALAVAPLAPAQAQTPLPAGLGA
FT                   AEVRQYLSGLPSDALRQQASWLAPALLRPYLSGLTDAQLRQYVQALTPGQITQGLAALT
FT                   PAQRARLQREFERQARRQVQQAVRAEVAARSARAVAMGQSASMLLLDAEMGTLAQRQGD
FT                   LRRGHDEGAFWARGSANRFKVDTPDTPAFDLRVEYLTLGADHGWRLDTGRLYLGAYAGV
FT                   SRARMDDNDIMHGRIESRFLGTYLTYVDNGGFYVDAVSKLGRIDESVSFDLPLGLGDYD
FT                   DDISHTTYTGSAEAGYHFKLPQRWFVEPQAQVIYSRSSQTSVQGRAGVRAGRDFTLAGG
FT                   ATLRPYVSASYLHEFSHDDSVDFGGKSYDAELPGSRWQLGAGAALDVGAHRAYADLRYG
FT                   HGANISQDLSLNIGYAYRF"
FT   misc_feature    125137..125241
FT                   /note="Signal peptide predicted for BP1767 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.914 between residues 35 and 36"
FT   CDS_pept        126468..126749
FT                   /transl_table=11
FT                   /locus_tag="BP1768"
FT                   /product="putative membrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="GOA:Q7VXJ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXJ3"
FT                   /protein_id="CAE42055.1"
FT                   /translation="MVYEDFFWFMAALVALALVGGALFGRLGRLAHSVIAMLGLAIAVG
FT                   VAVLLGARGEDVGPYAPLLAIAAFMFCLMIGGAATLVTRRVRRRHLTH"
FT   misc_feature    126468..126560
FT                   /note="Signal peptide predicted for BP1768 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.626) with cleavage site
FT                   probability 0.236 between residues 31 and 32"
FT   misc_feature    join(126483..126551,126564..126617,126645..126713)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BP1768 by TMHMM2.0 at aa 6-28, 33-50 and 60-82"
FT   CDS_pept        126791..127111
FT                   /transl_table=11
FT                   /locus_tag="BP1769"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXJ2"
FT                   /protein_id="CAE42056.1"
FT                   /translation="MDISSHLLAELANGVCLETRVDGQTIGTYVVLGPADLDAIADIVP
FT                   RQRVEEGADIHAAAVDSVDGAQMEIDQVIENMNPGDVAVFFCADGDCYGAALDLLGLPV
FT                   DE"
FT   CDS_pept        127418..127621
FT                   /transl_table=11
FT                   /gene="cspA"
FT                   /locus_tag="BP1770"
FT                   /product="cold shock-like protein"
FT                   /note="Identical to the previously sequenced Bordetella
FT                   pertussis cold shock-like protein CspA SW:CSPA_BORPE
FT                   (Q9Z5R4) (67 aa) fasta scores: E(): 3.4e-26, 100% id in 67
FT                   aa, and similar to Ralstonia solanacearum probable cold
FT                   shock-like CspC transcription regulator protein CspC
FT                   TR:CAD16944 (EMBL:AL646074) (67 aa) fasta scores: E():
FT                   5.5e-17, 67.69% id in 65 aa"
FT                   /db_xref="GOA:P0A352"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A352"
FT                   /protein_id="CAE42057.1"
FT                   /translation="METGVVKWFNAEKGYGFITPEAGGKDLFAHFSEIQANGFKSLEEN
FT                   QRVSFVTAMGPKGPQATKIQIL"
FT   misc_feature    127418..127618
FT                   /note="HMMPfam hit to PF00313, 'Cold-shock' DNA-binding
FT                   domain"
FT   misc_feature    127460..127519
FT                   /note="ScanRegExp hit to PS00352, 'Cold-shock' domain
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        127705..128271
FT                   /transl_table=11
FT                   /locus_tag="BP1771"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Caulobacter crescentus hypothetical
FT                   protein Cc2122 TR:Q9A6H2 (EMBL:AE005885) (187 aa) fasta
FT                   scores: E(): 1.9e-37, 54.74% id in 179 aa, and to Rhizobium
FT                   meliloti hypothetical protein Smc00282 TR:CAC46289
FT                   (EMBL:AL591788) (221 aa) fasta scores: E(): 5.3e-40, 54.25%
FT                   id in 188 aa"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXJ1"
FT                   /protein_id="CAE42058.1"
FT                   /translation="MSDSMAGPAALPDAATVLAFWREAGPARWYAKDEQFDRTFTMRFE
FT                   AAHMAAARGELMAWSASAEGMLALLILLDQFPRNAYRGTGHMFATDGLARQICEQAIAA
FT                   GLDRQGPEDLRQFYYMPLEHAEDLAAQEQCVSLMAPLHAETLRWAEIHRDIIARFGRFP
FT                   HRNTVLGRATTAEEQQFLDQGGFSG"
FT   CDS_pept        128617..128817
FT                   /transl_table=11
FT                   /gene="cspA"
FT                   /locus_tag="BP1772"
FT                   /product="cold shock-like protein"
FT                   /note="Similar to Bordetella pertussis cold shock-like
FT                   protein CspA SW:CSPA_BORPE (Q9Z5R4) (67 aa) fasta scores:
FT                   E(): 1.2e-15, 71.66% id in 60 aa, and to Escherichia coli
FT                   cold shock protein CspA or B3556 or Z4981 or Ecs4441 or
FT                   Sty4153 SW:CSPA_ECOLI (P15277) (69 aa) fasta scores: E():
FT                   6.2e-14, 68.42% id in 57 aa"
FT                   /db_xref="GOA:Q7VXJ0"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXJ0"
FT                   /protein_id="CAE42059.1"
FT                   /translation="MATGIVKWFNAEKGYGFIMPDDGSKDLFAHYSEICSEGYKSLQEN
FT                   QRVSFEVGQGPKGPRGQAPRT"
FT   misc_feature    128617..128793
FT                   /note="HMMPfam hit to PF00313, 'Cold-shock' DNA-binding
FT                   domain"
FT   misc_feature    128659..128718
FT                   /note="ScanRegExp hit to PS00352, 'Cold-shock' domain
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        complement(128929..129489)
FT                   /transl_table=11
FT                   /locus_tag="BP1773"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Bradyrhizobium japonicum PipA TR:Q9L8L2
FT                   (EMBL:AF200320) (193 aa) fasta scores: E(): 1.6e-48, 76.16%
FT                   id in 172 aa, and to Pasteurella multocida hypothetical
FT                   protein Pm1258 SW:YC58_PASMU (P57929) (192 aa) fasta
FT                   scores: E(): 4.5e-36, 56.52% id in 184 aa"
FT                   /db_xref="GOA:Q7VXI9"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXI9"
FT                   /protein_id="CAE42060.1"
FT                   /translation="MHPIQEPRLGPLPALIFSSRWLQLPLYLGLIVAQGVYVLLFLKEL
FT                   WHLVTHTLSFGEQEIMLIVLGLIDVVMISNLLVMVIVGGYETFVSRLRLEDHPDQPEWL
FT                   SHVNASVLKVKLAMAIIGISSIHLLRTFIEASNLGSPNSRFTETGVMWQTIIHVVFILS
FT                   AIGIAYVDRLTSQSVGHGAHPSH"
FT   misc_feature    complement(join(128980..129045,129238..129303,
FT                   129364..129429))
FT                   /note="3 probable transmembrane helices predicted for
FT                   BP1773 by TMHMM2.0 at aa 20-42, 62-84 and 148-170"
FT   CDS_pept        129686..130996
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="BP1774"
FT                   /product="trigger factor"
FT                   /note="Similar to Escherichia coli trigger factor Tig or
FT                   B0436 or Z0541 or Ecs0490 SW:TIG_ECOLI (P22257) (432 aa)
FT                   fasta scores: E(): 1.6e-53, 38.94% id in 434 aa, and to
FT                   Neisseria meningitidis trigger factor Tig or Nmb1313
FT                   SW:TIG_NEIMB (Q9JZ37) (437 aa) fasta scores: E(): 8.8e-62,
FT                   44% id in 434 aa"
FT                   /db_xref="GOA:Q7VXI8"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXI8"
FT                   /protein_id="CAE42061.1"
FT                   /translation="MQPVVETLSGLERRVDLAVSVAEVEKEVQAQLKRVGRTAKVAGFR
FT                   PGKAPLAMLERSHGPGIRYDVINSLVGRAFEQAVDGAKLRVAGSPTLTPKTEGVAEDTL
FT                   AFTATFEVYPEVTVPDLSALAVTRYDTPVTDAEVNQTLDVLRKQRAKFEIREGRASQDG
FT                   DRVVLDFAGTIDGVPFEGGKAEDFPFVLGQGRMLPEFEEAALGLKAGESKVFPLKFPDD
FT                   YQGKEVAGKTAEFTITVKEVAEGVLPEVDAEFAKSLGQAEGDVEKLKADIRTNIEREVK
FT                   ARLQGRTKGSVMDALVEAGKFDVPKALVDSDVEGRIAAAREELKQRGVPNADSVPMPAE
FT                   VFSTESERRVRLGLLVSELVKQAQLQAKPEQVRARIEEFAQNYEQPAQVVSYYLADRQR
FT                   RAEIEAIVLEDNVVAHVLENAKVADEKVPFDQLMGMA"
FT   misc_feature    130358..130381
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        130999..131652
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /gene_synonym="lopP"
FT                   /locus_tag="BP1775"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /EC_number="3.4.21.92"
FT                   /note="Similar to Escherichia coli ATP-dependent Clp
FT                   protease proteolytic subunit ClpP or LopP or B0437 or Z0542
FT                   or Ecs0491 SW:CLPP_ECOLI (P19245) (207 aa) fasta scores:
FT                   E(): 1.3e-50, 68.91% id in 193 aa, and to Neisseria
FT                   meningitidis ATP-dependent Clp protease proteolytic subunit
FT                   ClpP or Nma1525 SW:CLPP_NEIMA (Q9JU33) (204 aa) fasta
FT                   scores: E(): 3.7e-53, 74.09% id in 193 aa"
FT                   /db_xref="GOA:Q7VXI7"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXI7"
FT                   /protein_id="CAE42062.1"
FT                   /translation="MQRFTDFYAAMHGGSSVTPTGLGYIPMVIEQSGRGERAYDIYSRL
FT                   LRERLIFLVGPVNDNTANLVVAQLLFLESENPDKDISFYINSPGGSVYAGMAIYDTMQF
FT                   IKPDVSTLCTGLAASMGAFLLAAGKKGKRFTLPNSRIMIHQPSGGAQGQASDIQIQARE
FT                   ILDLRERLNRILAENTGQPVERIAVDTERDNFMSAEDAVSYGLVDKVLTSRAQT"
FT   misc_feature    131068..131637
FT                   /note="HMMPfam hit to PF00574, Clp protease"
FT   misc_feature    131395..131436
FT                   /note="ScanRegExp hit to PS00382, Endopeptidase Clp
FT                   histidine active site. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   CDS_pept        131757..133061
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /gene_synonym="lopC"
FT                   /locus_tag="BP1776"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit"
FT                   /note="Similar to Escherichia coli ATP-dependent Clp
FT                   protease ATP-binding subunit ClpX or LopC or B0438 or Z0543
FT                   or Ecs0492 SW:CLPX_ECOLI (P33138) (423 aa) fasta scores:
FT                   E(): 2.5e-101, 71.15% id in 423 aa, and to Pseudomonas
FT                   aeruginosa ATP-dependent Clp protease ATP-binding subunit
FT                   ClpX or Pa1802 TR:Q9I2U0 (EMBL:AE004606) (426 aa) fasta
FT                   scores: E(): 2.2e-104, 72.72% id in 418 aa"
FT                   /db_xref="GOA:Q7VXI6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXI6"
FT                   /protein_id="CAE42063.1"
FT                   /translation="MPEKKGSADAKVLHCSFCNKSQHEVRKLIAGPSVFICDECIDLCN
FT                   DIIREEAQATARAAIRSELPTPAEIKTFLDQYVIGQTSPKRMLAVAVYNHYKRIRHGEI
FT                   KGDEVELSKSNIMLIGPTGSGKTLLAQTLARMLNVPFVMADATTLTEAGYVGEDVENII
FT                   QKLLQNCNYDVEKAQRAIIYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVAS
FT                   VPPQGGRKHPNQDFVQVDTTNILFIVGGAFDGLEKVIRDRTEKSGIGFSAAVRAKSERG
FT                   VGELFSEAEPEDLIKFGLIPELVGRLPVVATLDELDEAVLVQILTEPKNALVKQFQKLF
FT                   AMEGAELDVRPDALKAISRKALKRKTGARGLRSILEGALLDTMYDLPSQGNVSRVVLEA
FT                   NAVEGVGKPLLIYADESEAASGEKAGRGEVRDAAA"
FT   misc_feature    132099..132722
FT                   /note="HMMPfam hit to PF00004, ATPase family associated
FT                   with various cellular activities (AAA)"
FT   misc_feature    132114..132137
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        133250..135703
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /gene_synonym="capR"
FT                   /gene_synonym="deg"
FT                   /gene_synonym="muc"
FT                   /gene_synonym="lopA"
FT                   /locus_tag="BP1777"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="Similar to Escherichia coli ATP-dependent protease
FT                   La Lon or CapR or Deg or Muc or LopA or B0439 SW:LON_ECOLI
FT                   (P08177) (784 aa) fasta scores: E(): 5.6e-127, 68.24% id in
FT                   781 aa, and to Neisseria meningitidis ATP-dependent
FT                   protease La Lon or Nma1398 TR:Q9JUC0 (EMBL:AL162755) (820
FT                   aa) fasta scores: E(): 4.7e-177, 67.83% id in 799 aa"
FT                   /db_xref="GOA:Q7VRY1"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VRY1"
FT                   /protein_id="CAE42064.1"
FT                   /translation="MSASQTLSSDPIDLPLLPLRDVVVFPHMVIPLFVGRPRSIRALEV
FT                   AMEAGKSIMLVAQKSAGKDDPTPEDVYEIGCVASILQMLKLPDGTVKVLVEGTQRARID
FT                   SIEDVDSHFTCQVTPIEPDTLQGSETEALRRAIVAQFEQYVKLNKKIPPEILTSLAGID
FT                   DAGRLADTIAAHLPLKLEQKQKMLEVVVTAERLEGLLTQLETEIDILQVEKRIRGRVKK
FT                   QMEKSQRDYYLNEQVKAIQKELGEGEEGADIEELEKKIIAAHMPKEARKKADGELKKLK
FT                   LMSPMSAEATVVRNYIDTLINLPWKRKSKINNSIGNAERVLDDDHYGLEKVKERILEYL
FT                   AVQQRVDKVKAPILCLVGPPGVGKTSLGQSIAKATNRKFVRMALGGVRDEAEIRGHRRT
FT                   YIGSMPGKILQNMSKVGVRNPLFLLDEIDKLGMDFCGDPSSALLEVLDPEQNHTFQDHY
FT                   IEVDFDLSDVMFVATSNTLNIPPALLDRMEVIRLSGYTEEEKIHIARDHLLPKLMKNNG
FT                   VKDNELTVDDSALRDIVRYYTREAGVRALEREVGKICRKVVKQLLIKSDEAKAAGNKTA
FT                   EAQTVLVNGDNLNDFLGVRRYTFGMAEKENQIGQVTGLAWTEVGGDLLTIEVADMPGKG
FT                   NIQRTGSLGDVMKESVEAARTVVRSRARRLGFADSVFEKHDMHVHVPEGATPKDGPSAG
FT                   IAITTAMVSALSRIPVRADVAMTGEITLRGEVLPIGGLKEKLLAAHRGGIKTVLIPEEN
FT                   VKDLAEIPDNVKNFLEIVPVRWIDKVLELALERMPEPLSEEEAVKEAIVAKPAEAGAAD
FT                   PVMKH"
FT   misc_feature    133286..133864
FT                   /note="HMMPfam hit to PF02190, ATP-dependent protease La
FT                   (LON) domain"
FT   misc_feature    134306..134890
FT                   /note="HMMPfam hit to PF00004, ATPase family associated
FT                   with various cellular activities (AAA)"
FT   misc_feature    134321..134344
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    135314..135340
FT                   /note="ScanRegExp hit to PS01046, ATP-dependent serine
FT                   proteases, lon family, serine active site. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   CDS_pept        complement(135827..136726)
FT                   /transl_table=11
FT                   /locus_tag="BP1778"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator Pa1826 TR:Q9I2R9 (EMBL:AE004609)
FT                   (301 aa) fasta scores: E(): 5e-36, 43.19% id in 294 aa, and
FT                   to Ralstonia solanacearum probable transcription regulator
FT                   protein Rsp1326 TR:CAD18477 (EMBL:AL646084) (306 aa) fasta
FT                   scores: E(): 1.2e-27, 38.17% id in 296 aa"
FT                   /db_xref="GOA:Q7VXI5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXI5"
FT                   /protein_id="CAE42065.1"
FT                   /translation="MLDLRRVRQFVTLGETLNFRRAADRLHMTQPPLTVAIQKLEAELG
FT                   TRLFERGGSGGVSLTPGGHAALAEARRLLFHNAQLLAAARAASSGTGGALKVGFVGSTT
FT                   NGVLQRIVRLFRVEYPGVELVLKEGTSVRIAERVDSGDLDVGLVRTPLLTPSRSHLAPL
FT                   LAEDFVAALPLGNPLAQKADIRMEELATESFVFYSREDAAGLHATAMLACQRAGFLPRV
FT                   TQEATQVQTVLSLVESGLGVALVPAVMQYNPSPRVAYRAIADVSPAAEIGLALLLPEPS
FT                   SAAAQRFREVALHCFGDD"
FT   misc_feature    complement(136286..136717)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    complement(136583..136675)
FT                   /note="ScanRegExp hit to PS00044, Bacterial regulatory
FT                   proteins, lysR family signature."
FT   misc_feature    complement(136613..136678)
FT                   /note="Predicted helix-turn-helix motif with score 1471
FT                   (+4.20 SD) at aa 34-55, sequence LNFRRAADRLHMTQPPLTVAIQ"
FT   CDS_pept        137005..138228
FT                   /transl_table=11
FT                   /locus_tag="BP1779"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa0446 TR:Q9I672 (EMBL:AE004482) (407 aa) fasta
FT                   scores: E(): 7.6e-94, 56.71% id in 402 aa, and to
FT                   Acinetobacter spNCIMB9871 L-carnitine dehydrogenase-like
FT                   protein Orf17 TR:BAB61747 (EMBL:AB026669) (405 aa) fasta
FT                   scores: E(): 4.3e-82, 51.11% id in 405 aa. Also similar to
FT                   BP0143 (68.059% identity in 407 aa overlap), and BP3309
FT                   (57.644% identity in 399 aa overlap)."
FT                   /db_xref="GOA:Q7VXI4"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXI4"
FT                   /protein_id="CAE42066.1"
FT                   /translation="MDTALGHIKVLDLTRILAGPWATQTLADMGAEVVKVERPRVGDDT
FT                   RAWGPPFLKDSEGNETADSSYFLAANRGKKSITVDLAHPDGQALIRDLAATADVVVENY
FT                   KVGTLARYGLDYESLKAINPRLVYCSITGFGQDGPYASLPDYDFVFQGMGGLMSITGQP
FT                   EGTPGDEPMKVGIAISDLLTGMYATTAILAALERRHVSGTGQHVDMSLLDCVVSISSYQ
FT                   AINHFLSGKIPRRMGNAHSNMVPYQVFRCKEGDVIVAVGNDGQYRALCKLIERDDLATD
FT                   ERYATPGQRNRNRDTLIPEIAQAMLARTMQEWVALMEAANVPCGPIYNMQQMFEDPHVQ
FT                   HRGMRLSLPHSAGVQAPAVASPIRLSDTPIQYGRSAPLLGEHTDSVLAQRLGLAPARIA
FT                   ELRARGAI"
FT   misc_feature    137233..137814
FT                   /note="HMMPfam hit to PF02515, CAIB/BAIF family"
FT   CDS_pept        138294..139265
FT                   /transl_table=11
FT                   /locus_tag="BP1780"
FT                   /product="putative exported protein"
FT                   /note="Similar to Comamonas testosteroni Orf4 protein
FT                   TR:Q9S155 (EMBL:AB024335) (325 aa) fasta scores: E():
FT                   6.8e-40, 39.93% id in 313 aa, and to Variovorax paradoxus,
FT                   and 2,4-diphenoxyacetic acid gene cluster TR:AAK81675
FT                   (EMBL:AB028643) (337 aa) fasta scores: E(): 1.7e-32, 35.57%
FT                   id in 312 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXI3"
FT                   /protein_id="CAE42067.1"
FT                   /translation="MLRHTFIRAALAAALAVCAAGAHAQAKPSSIRLVVPYPAGGAADQ
FT                   IARLVANDAGAILGTPIVIENKGGAGGMIAAESVLQAAPDGATFFVGSNAPIVINQAIY
FT                   EKMSYDPAKDFVPVAGMGKAPLLLVTRKDLGTADVKALAELGKREAGKLTMGSASSGNI
FT                   THLAGEYAASQMGFKVTHVPFKGSAPAITSLMGGNIDIMFDALPSCMAQAESGRIVPLA
FT                   ILDDQRFPQLRDVPTAKELGYSGLEAAAWFGVMACAGTPDSSIGAMNKAINQALQKQEL
FT                   IDKLRRIGAQPMPGSQQDFARFIDAERKQWVPLAKSLGVRAD"
FT   misc_feature    138294..138365
FT                   /note="Signal peptide predicted for BP1780 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.878 between residues 24 and 25"
FT   misc_feature    138330..138371
FT                   /note="ScanRegExp hit to PS00099, Thiolases active site."
FT   CDS_pept        139332..139733
FT                   /transl_table=11
FT                   /locus_tag="BP1781"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium leguminosarum nodulation
FT                   protein N NodN SW:NODN_RHILV (P08634) (161 aa) fasta
FT                   scores: E(): 4e-18, 43.84% id in 130 aa, and to
FT                   Mycobacterium tuberculosis hypothetical 16.0 kDa protein
FT                   rv0130 or mtci5.04 TR:P96807 (EMBL:Z92770) (151 aa) fasta
FT                   scores: E(): 6.5e-20, 48.43% id in 128 aa"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039375"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXI2"
FT                   /protein_id="CAE42068.1"
FT                   /translation="MGQPIVVDQSAIDTFGDVVHDRQWIHVDPVRAAAESPFGTTIAHG
FT                   LLTLSLITGWYHQLFEFPGRKLALNYGFDKVRFPAPVPSGSALVGSFRLARVDELGPDE
FT                   ARCLWEVDVRVAGAERPAMVAEWLMQLRY"
FT   misc_feature    139332..139670
FT                   /note="HMMPfam hit to PF01575, MaoC like domain"
FT   CDS_pept        139753..140550
FT                   /transl_table=11
FT                   /locus_tag="BP1782"
FT                   /product="probable enoyl-CoA hydratase/isomerase"
FT                   /EC_number="4.2.1.17"
FT                   /note="Similar to Escherichia coli probable enoyl-CoA
FT                   hydratase PaaG or B1394 SW:PAAG_ECOLI (P77467) (262 aa)
FT                   fasta scores: E(): 4e-24, 38.79% id in 250 aa, and to
FT                   Caulobacter crescentus enoyl-CoA hydratase/isomerase family
FT                   protein cc2575 TR:Q9A582 (EMBL:AE005925) (265 aa) fasta
FT                   scores: E(): 4.2e-25, 35.84% id in 265 aa"
FT                   /db_xref="GOA:Q7VXI1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXI1"
FT                   /protein_id="CAE42069.1"
FT                   /translation="MSVLEISRVGACAVLTLNRPAARNALDMDLRNALAKALPEIRDDA
FT                   TVRAVVLTGAGGHFCAGGDIRAIAAGQGNADVFEGRNRILSMQRWFDGLVDLEKPVIAA
FT                   VDGVAFGAGLSLALAADFVLASPRATFCAVFARLGYVPDLGGMYLLPRAVGLARAKALA
FT                   FSARVVGAPEALEMGIAHQLVDDRPVLDAALELAGRFEQAPAGALGIVKSVMNHAFESD
FT                   RRTVYMQEALAQALCRESAFHQEAARRFLDKQAPLYQWPQEQQ"
FT   misc_feature    139789..140307
FT                   /note="HMMPfam hit to PF00378, Enoyl-CoA
FT                   hydratase/isomerase family"
FT   misc_feature    140056..140118
FT                   /note="ScanRegExp hit to PS00166, Enoyl-CoA
FT                   hydratase/isomerase signature."
FT   CDS_pept        140547..140978
FT                   /transl_table=11
FT                   /locus_tag="BP1783"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pyrococcus abyssi AcaC protein or Pab0908
FT                   TR:Q9UYY6 (EMBL:AJ248287) (134 aa) fasta scores: E():
FT                   1.3e-05, 29.83% id in 124 aa, and to Archaeoglobus fulgidus
FT                   conserved hypothetical protein Af1292 TR:O28977
FT                   (EMBL:AE001015) (136 aa) fasta scores: E(): 3.8e-05, 29.66%
FT                   id in 118 aa"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXI0"
FT                   /protein_id="CAE42070.1"
FT                   /translation="MTEHPQAASALLPQQEYFAHLADGRFMIQRSRSSGEYVFYPRVAA
FT                   PRTGAQDLEWVAASGRGTVYATTVMRVRPPAAPYNVCLVELEEGPRMMSRVEGIGPEDV
FT                   QVGMAVRARIIRDDAGEPLVVFEPAGPSDAGIGQGRAAQ"
FT   misc_feature    140583..140921
FT                   /note="HMMPfam hit to PF01796, Domain of unknown function
FT                   DUF35"
FT   CDS_pept        140975..142132
FT                   /transl_table=11
FT                   /locus_tag="BP1784"
FT                   /product="putative thiolase"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa1016 TR:Q9I4V7 (EMBL:AE004534) (383 aa) fasta
FT                   scores: E(): 7.5e-88, 60.31% id in 378 aa, and to
FT                   Methanothermobacter thermautotrophicus lipid-transfer
FT                   protein Mth793 TR:O26884 (EMBL:AE000857) (383 aa) fasta
FT                   scores: E(): 8e-31, 32.03% id in 384 aa"
FT                   /db_xref="GOA:Q7VXH9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXH9"
FT                   /protein_id="CAE42071.1"
FT                   /translation="MIQERFPRGKTAIVACATYGIGESPGLSSLDLAVRASVQALDSVG
FT                   LTPADVDGLFIGLPDDFVSGLSFTEYLGISPRLTDNNRTGGSSFLTHAIHAALALEAGL
FT                   CDVALIAYGSNQRSGAGKLVSSMRPSPYEGAYKLARPVGAYALAASRYAAQYGLQKEQL
FT                   GAVALAARQWAQKNPEAYMRAPLTMDECLASRLVCDPFSVRDCCLVTDGAAAVVMVRAD
FT                   RARDLAARPAYLLGGAAAAWHKDITNMPDLTVTAASLSGPRAMAQAGVTPADIDVLELY
FT                   DAFTLNTILFLEDLGFCAKGEGGAFVEDGRIAPGGALPVNTNGGGLSCVHPGMYGLFTM
FT                   VEAAQQLAGAAGERQVAQARLALAHGNGGELSSQATLILGTEETI"
FT   misc_feature    140996..142108
FT                   /note="HMMPfam hit to PF00108, Thiolase, N-terminal domain"
FT   CDS_pept        142154..142930
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="BP1785"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="Similar to Escherichia coli 3-oxoacyl-[acyl-carrier
FT                   protein] reductase FabG or B1093 SW:FABG_ECOLI (P25716)
FT                   (244 aa) fasta scores: E(): 3.3e-24, 36.69% id in 248 aa,
FT                   and to Thermotoga maritima 3-oxoacyl-[acyl-carrier protein]
FT                   reductase FabG or Tm1724 SW:FABG_THEMA (Q9X248) (246 aa)
FT                   fasta scores: E(): 2.2e-27, 41.5% id in 253 aa"
FT                   /db_xref="GOA:Q7VXH8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXH8"
FT                   /protein_id="CAE42072.1"
FT                   /translation="MQDKLLTLENRQVIVTGAGQGIGRALASAIAGLGGRVVAVDLNAD
FT                   ALAALREALGHERCVTVAGNVADPSLAQQAVDAGVTAFGGVNGLVNNAGVTRTAMIDKM
FT                   SISDWQQVIDVHLSGSFYFLQALGRHLLGRAKAGGDGAGAIVNISSDAGRRGTIGQINY
FT                   GAAKAGVLGLTMCAAREWARYGIRTNTVGFGVVETPMTETIRGEKFRDTYLSQIPLGRW
FT                   GEADEVVRPVCFLLSDADSYVTGQHLSVNGGYTIGL"
FT   misc_feature    142184..142750
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase"
FT   misc_feature    142601..142687
FT                   /note="ScanRegExp hit to PS00061, Short-chain
FT                   dehydrogenases/reductases family signature."
FT   misc_feature    142811..142903
FT                   /note="HMMPfam hit to PF00678,"
FT   CDS_pept        join(142927..143838,143840..144082)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1786"
FT                   /product="putative acyl-CoA dehydrogenase (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 304. The sequence has been checked
FT                   and believed to be correct. Similar to Mycobacterium
FT                   tuberculosis CDC1551 acyl-CoA dehydrogenase, putative
FT                   Mt1984 TR:AAK46256 (EMBL:AE007053) (409 aa) fasta scores:
FT                   E(): 4e-26, 32.34% id in 405 aa, and to Sulfolobus
FT                   solfataricus acyl-CoA dehydrogenase Acd-1 TR:Q97YZ6
FT                   (EMBL:AE006732) (363 aa) fasta scores: E(): 6.6e-26, 33.81%
FT                   id in 346 aa"
FT                   /db_xref="PSEUDO:CAE42073.1"
FT   misc_feature    142969..143553
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal domain"
FT   misc_feature    143329..143367
FT                   /note="ScanRegExp hit to PS00072, Acyl-CoA dehydrogenases
FT                   signature 1. Confirmed by InterPro eMOTIF pattern match."
FT   misc_feature    143593..143655
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal domain"
FT   variation       143839
FT                   /note="G in pertussis; ACCGCCCGA in parapertussis and
FT                   ACCGCCCGG in bronchiseptica"
FT   CDS_pept        join(144104..144652,144652..145098)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1787"
FT                   /product="putative acyl-CoA dehydrogenase (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 183. The frameshift occurs within
FT                   a polymeric tract of (G)5. The sequence has been checked
FT                   and believed to be correct. Similar to Mycobacterium
FT                   tuberculosis CDC1551 acyl-CoA dehydrogenase, putative
FT                   Mt3668 TR:AAK48026 (EMBL:AE007168) (317 aa) fasta scores:
FT                   E(): 5.1e-13, 33.44% id in 311 aa, and to Pseudomonas
FT                   aeruginosa probable acyl-CoA dehydrogenase Pa1020 TR:Q9I4V4
FT                   (EMBL:AE004534) (370 aa) fasta scores: E(): 4.3e-09, 33.97%
FT                   id in 312 aa"
FT                   /db_xref="PSEUDO:CAE42074.1"
FT   variation       144648..144652
FT                   /note="(G)5 in pertussis; (G)6 in parapertussis and
FT                   bronchiseptica"
FT   misc_feature    144679..144963
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal domain"
FT   CDS_pept        145143..145811
FT                   /transl_table=11
FT                   /gene="pcaI"
FT                   /locus_tag="BP1788"
FT                   /product="3-oxoadipate CoA-transferase subunit A"
FT                   /EC_number="2.8.3.6"
FT                   /note="Similar to Pseudomonas putida 3-oxoadipate
FT                   CoA-transferase subunit A PcaI SW:PCAI_PSEPU (Q01103) (231
FT                   aa) fasta scores: E(): 1.9e-43, 52.51% id in 219 aa, and to
FT                   Ralstonia solanacearum probable 3-oxoadipate
FT                   CoA-transferase subunit A protein PcaI TR:CAD15961
FT                   (EMBL:AL646069) (229 aa) fasta scores: E(): 4.8e-44, 52.51%
FT                   id in 219 aa. Also similar to BP0221 (50.228% identity in
FT                   219 aa overlap), and to BP2401 (46.083% identity in 217 aa
FT                   overlap)."
FT                   /db_xref="GOA:Q7VXH7"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXH7"
FT                   /protein_id="CAE42075.1"
FT                   /translation="MLNKTCESADEAVSVVESGATILISGFGDIGLPFELLHALARTSV
FT                   KDLTIVSNNAGTGELGLSRLFRNRQVSRLIASFPSQPDSHHYFAAYQEGLVDLELVPQG
FT                   TLAERIRAAGAGLAGFFTPTGYGTELAQGKECRMFKGKGYVFEEALPGDFAFIKAHVAD
FT                   AYGNFRYRRASRTFNPIMAMAARTTIAEAKQMVPVGSIDPDDVHTPGVFVDRIVEVRDE
FT                   "
FT   misc_feature    145152..145802
FT                   /note="HMMPfam hit to PF01144, Coenzyme A transferase"
FT   CDS_pept        145804..146445
FT                   /transl_table=11
FT                   /gene="pcaJ"
FT                   /locus_tag="BP1789"
FT                   /product="3-oxoadipate CoA-transferase subunit B"
FT                   /EC_number="2.8.3.6"
FT                   /note="Similar to Pseudomonas putida 3-oxoadipate
FT                   CoA-transferase subunit B PcaJ SW:PCAJ_PSEPU (Q01104) (212
FT                   aa) fasta scores: E(): 8.3e-38, 52.45% id in 204 aa, and to
FT                   Caulobacter crescentus 3-oxoadipate CoA-transferase, beta
FT                   subunit Cc0207 TR:Q9ABM0 (EMBL:AE005695) (213 aa) fasta
FT                   scores: E(): 8e-36, 50.96% id in 208 aa. Also similar to
FT                   BP222 (50.472% identity in 212 aa overlap), and to BP2400
FT                   (46.667% identity in 210 aa overlap)."
FT                   /db_xref="GOA:Q7VXH6"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXH6"
FT                   /protein_id="CAE42076.1"
FT                   /translation="MSKGWSNDEIAARIAVDLPEHAIVNLGIGLPILVANHIPEGKTIF
FT                   FHSENGIIGLGPVPAPGQEDPDIVNAAKKHATLIAGASIVHHADSFSLIRGGRLDYSVL
FT                   GGLQVSSGGDIANWKVPGQKGGGGVGGAMDLAVGARNVLVMMRHQDKTGASKLVKSCTF
FT                   PLTAVSAVTRVYTELGIFECAGDAFIVRESAPGIGKDELLRKTEAALTFP"
FT   misc_feature    145819..146421
FT                   /note="HMMPfam hit to PF01144, Coenzyme A transferase"
FT   misc_feature    145939..145965
FT                   /note="ScanRegExp hit to PS01274, Coenzyme A transferases
FT                   signature 2."
FT   CDS_pept        join(146480..147190,147190..147441)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1790"
FT                   /product="putative exported protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 237. The frameshift occurs within
FT                   a polymeric tract of (A)3. The sequence has been checked
FT                   and believed to be correct. Similar to Rhizobium meliloti
FT                   hypothetical protein Sma1927 TR:Q92Y30 (EMBL:AE007292) (330
FT                   aa) fasta scores: E(): 2.8e-39, 38.36% id in 305 aa, and to
FT                   Agrobacterium tumefaciens strC58 Agr_l_312p TR:AAK88723
FT                   (EMBL:AE008213) (329 aa) fasta scores: E(): 1.4e-40, 37.22%
FT                   id in 317 aa"
FT                   /db_xref="PSEUDO:CAE42077.1"
FT   misc_feature    146480..146542
FT                   /note="Signal peptide predicted for BP1790 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 21 and 22"
FT   variation       147189..147191
FT                   /note="(A)3 in pertussis; (A)4 in parapertussis and
FT                   bronchiseptica"
FT   CDS_pept        join(147769..147912,148962..150293)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1793"
FT                   /product="autotransporter (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. Similar to the C-terminal regions of
FT                   Bordetella pertussis tracheal colonization factor TcfA2
FT                   TR:O86135 (EMBL:AJ009785) (647 aa) fasta scores: E():
FT                   5.5e-62, 56.83% id in 417 aa, and to Bordetella
FT                   parapertussis pertactin precursor Prn SW:PERT_BORPA
FT                   (P24328) (922 aa) fasta scores: E(): 2.5e-48, 48.95% id in
FT                   429 aa, and to Bordetella bronchiseptica pertactin
FT                   precursor Prn SW:PERT_BORBR (Q03035) (911 aa) fasta scores:
FT                   E(): 4.9e-48, 54.67% id in 364 aa"
FT                   /db_xref="PSEUDO:CAE42078.1"
FT   repeat_region   147911..147941
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   147911..148962
FT   CDS_pept        148012..148962
FT                   /transl_table=11
FT                   /locus_tag="BP1792"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA3"
FT                   /protein_id="CAE42079.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   misc_feature    148270..148335
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    148393..148926
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(148931..148962)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(150520..151170)
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /gene_synonym="exra"
FT                   /gene_synonym="spr"
FT                   /gene_synonym="tsl"
FT                   /gene_synonym="umuA"
FT                   /locus_tag="BP1794"
FT                   /product="LexA repressor"
FT                   /EC_number="3.4.21.88"
FT                   /note="Similar to Escherichia coli LexA repressor LexA or
FT                   ExrA or Spr or Tsl or UmuA or B4043 or Z5642 or Ecs5026
FT                   SW:LEXA_ECOLI (P03033) (202 aa) fasta scores: E(): 5.2e-23,
FT                   59.13% id in 208 aa, and to Ralstonia solanacearum probable
FT                   transcription regulation repressor transcription regulator
FT                   protein LexA TR:CAD15006 (EMBL:AL646063) (216 aa) fasta
FT                   scores: E(): 1e-49, 70.56% id in 214 aa"
FT                   /db_xref="GOA:Q7VRY0"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VRY0"
FT                   /protein_id="CAE42080.1"
FT                   /translation="MATKLTERQQEILDLIRQTVARTGFPPTRAEIAQALGFRSPNAAE
FT                   DHLKALARKGAIELTAGASRGIRLKVPDSATPSAQLTHPLLAQLVLPLVGRVAAGSPIL
FT                   ASEHVEREVGVDPGLFAQTPDYLLKVRGMSMRDAGILEGDLLAVKRAAEARNGQIVVAR
FT                   LGDEVTVKRLQRQNGRIELLPENPDFAPIVVANTDEFALEGIAVGLIRTQPLH"
FT   misc_feature    complement(150577..150936)
FT                   /note="HMMPfam hit to PF00717, Peptidase family S24"
FT   misc_feature    complement(150973..151167)
FT                   /note="HMMPfam hit to PF01726, LexA DNA binding domain"
FT   CDS_pept        complement(151299..152501)
FT                   /transl_table=11
FT                   /gene="tyrB"
FT                   /gene_synonym="aspC"
FT                   /locus_tag="BP1795"
FT                   /product="aromatic-amino-acid aminotransferase"
FT                   /EC_number="2.6.1.57"
FT                   /note="Similar to Escherichia coli aromatic-amino-acid
FT                   aminotransferase TyrB or B4054 SW:TYRB_ECOLI (P04693) (397
FT                   aa) fasta scores: E(): 6.9e-78, 52.51% id in 398 aa, and to
FT                   Pseudomonas aeruginosa aspartate aminotransferase AspC or
FT                   Pa3139 SW:AAT_PSEAE (P72173) (398 aa) fasta scores: E():
FT                   2e-105, 68.76% id in 397 aa. Also similar to BP2858,
FT                   49.622% identity (49.622% ungapped) in 397 aa overlap."
FT                   /db_xref="GOA:Q7VXH5"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXH5"
FT                   /protein_id="CAE42081.1"
FT                   /translation="MSTLFASVELAPRDPILGLNEQYNADTRPGKVNLGVGVYYDDEGR
FT                   IPLLQAVRKAEVARIEAAAARGYLPIEGIAGYNKGAQALLLGADSPLAAEGRVLTAQAL
FT                   GGTGALKIGADFLRQLLPQSKVLISDPSWENHRALFERAGFPVETYAYYDAATHGLNFE
FT                   AMLAALQAAPEQTIVVLHACCHNPTGVDPTPQQWEQIAAVVKARNLVPFLDIAYQGFGE
FT                   GLEQDAAVVRMFAALDLTMFISSSFSKSFSLYGERVGALTVVAGSKDEAARVLSQLKRV
FT                   IRTNYSNPPTHGGTVVSTVLNTPELFALWENELAGMRDRIRLMRKELVEKIKTQGVAQD
FT                   FSFVLAQRGMFSYSGLTAAQVDRLREEHGIYAVSSGRICVAALNSRNIDAVAAGIAAVL
FT                   K"
FT   misc_feature    complement(151302..152501)
FT                   /note="HMMPfam hit to PF00155, Aminotransferase class I and
FT                   II"
FT   misc_feature    complement(151725..151766)
FT                   /note="ScanRegExp hit to PS00105, Aminotransferases class-I
FT                   pyridoxal-phosphate attachment site. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   CDS_pept        152579..154615
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="BP1796"
FT                   /product="excinuclease ABC subunit B"
FT                   /note="Similar to Escherichia coli, and excinuclease ABC
FT                   subunit B UvrB or B0779 or Z0998 or Ecs0857 SW:UVRB_ECOLI
FT                   (P07025) (673 aa) fasta scores: E(): 2.4e-156, 67.42% id in
FT                   663 aa, and to Burkholderia cepacia excinuclease ABC
FT                   subunit B UvrB TR:AAK64610 (EMBL:AY036068) (697 aa) fasta
FT                   scores: E(): 7.6e-190, 75.92% id in 673 aa"
FT                   /db_xref="GOA:Q7VXH4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXH4"
FT                   /protein_id="CAE42082.1"
FT                   /translation="MTAPGFVEFPDSPFHLYQPYPPAGDQPGAIDALTEGVSDGLMFQT
FT                   LLGVTGSGKTYTMANMIARLGRPALVLAPNKTLAAQLYAEMREFFPRNAVEYFVSYYDY
FT                   YQPEAYVPTRDLFIEKDSSINEHIEQMRLSATKSLLERRDTVIVGTVSCIYGIGNPGDY
FT                   HAMVLILRTGDRISRREVLARLVAMQYTRNDADFTRGVFRVRCETIDIFPAESPELALR
FT                   LTLFDDEIESLELFDPLTGRVRQKLPRFTVYPGSHYVTPRETVLRAIETIKEELRERLA
FT                   QLIADGKLVEAQRLEQRTRFDLEMLQELGFCKGIENYSRHLSGAAPGEPPPTLIDYLPA
FT                   DALMFIDESHVTIGQLGGMYRGDRSRKETLVQYGFRLPSALDNRPLRLEEFEARMRQCV
FT                   FVSATPAAYEQEHADNVVEQVVRPTGLVDPIVEVRPAHTQVDDLLGEIHKRAALQERVL
FT                   VTTLTKRMAEDLTDFLSEHGVRVRYLHSDIDTVERVEIIRDLRLGVFDVLVGINLLREG
FT                   LDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNLNGRAILYADRITDSMRRAIDET
FT                   ERRRAKQIQHNTDHGITARGVSKAVRELIDGVVAPAGHDALESAVPAEVLTDEKAMARE
FT                   IRRLEKLMMDHARNLEFEQAAAARDALNALKSRLLLDGVGWSG"
FT   misc_feature    152720..152743
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    153980..154240
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain"
FT   misc_feature    154475..154582
FT                   /note="HMMPfam hit to PF02151, UvrB/uvrC motif"
FT   CDS_pept        154868..155359
FT                   /transl_table=11
FT                   /gene="ptpA"
FT                   /locus_tag="BP1797"
FT                   /product="low molecular weight
FT                   protein-tyrosine-phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="Similar to Streptomyces coelicolor low molecular
FT                   weight protein-tyrosine-phosphatase PtpA or Scq11.04C
FT                   SW:PTPA_STRCO (P53433) (164 aa) fasta scores: E(): 2.9e-20,
FT                   45.28% id in 159 aa, and to Pseudomonas aeruginosa
FT                   phosphotyrosine protein phosphatase Pt or Pa2978 TR:Q9HZM6
FT                   (EMBL:AE004723) (154 aa) fasta scores: E(): 6.6e-27, 51.29%
FT                   id in 154 aa"
FT                   /db_xref="GOA:Q7VXH3"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXH3"
FT                   /protein_id="CAE42083.1"
FT                   /translation="MMTKVLFVCMGNICRSPSAEGVFRYLVNDAGMGDVVRVDSAGTHA
FT                   FHIGEAPDARAQAAARKRGYDLTHCAARQVTADDFREFDLILAMDWDNLAALQQQCPKA
FT                   YQHKLMLLMRFANEFEEATVPDPYYGGPEGFGKVLDYLEDACQGVLELVRKRATQYQAA
FT                   "
FT   misc_feature    154874..155323
FT                   /note="HMMPfam hit to PF01451, Low molecular weight
FT                   phosphotyrosine protein phosphatase"
FT   CDS_pept        155575..156087
FT                   /transl_table=11
FT                   /locus_tag="BP1798"
FT                   /product="putative DNA-binding protein"
FT                   /note="Similar to Ralstonia solanacearum conserved
FT                   hypothetical protein Rsc1018 TR:CAD14720 (EMBL:AL646062)
FT                   (193 aa) fasta scores: E(): 9.9e-42, 70.58% id in 170 aa,
FT                   and to Neisseria meningitidis hypothetical protein
FT                   Nma1593/Nmb1378 precursor Nma1593 or Nmb1378 SW:YF93_NEIMA
FT                   (Q51134) (148 aa) fasta scores: E(): 6.3e-28, 60.87% id in
FT                   138 aa"
FT                   /db_xref="GOA:Q7VXH2"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR010242"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXH2"
FT                   /protein_id="CAE42084.1"
FT                   /translation="MRLTTKGRFAVTAMIDLAMRQHSGPVTLAAISQRQNISLSYLEQL
FT                   FGKLRRHELVDSVRGPGGGYSLARLARNVTVADIIFAVDEPLDATSCGGKRDCTSGNDG
FT                   KPGKCMTHELWTTLNRKMVDYLDSVSLQDLVDQQRVRQLQEAANQAQGCSAVRVNRSTP
FT                   VAANATA"
FT   misc_feature    155575..155952
FT                   /note="HMMPfam hit to PF02082, Uncharacterized protein
FT                   family UPF0074"
FT   misc_feature    155650..155715
FT                   /note="Predicted helix-turn-helix motif with score 1117
FT                   (+2.99 SD) at aa 39-60, sequence VTLAAISQRQNISLSYLEQLFG"
FT   CDS_pept        156105..157316
FT                   /transl_table=11
FT                   /gene="iscS"
FT                   /locus_tag="BP1799"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="4.4.1.-"
FT                   /note="Similar to Escherichia coli cysteine desulfurase
FT                   IscS or B2530 SW:ISCS_ECOLI (P39171) (404 aa) fasta scores:
FT                   E(): 7.6e-117, 74.56% id in 401 aa, and to Azotobacter
FT                   vinelandii cysteine desulfurase IscS SW:ISCS_AZOVI (O31269)
FT                   (403 aa) fasta scores: E(): 9.4e-112, 72.81% id in 401 aa"
FT                   /db_xref="GOA:Q7VXH1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXH1"
FT                   /protein_id="CAE42085.1"
FT                   /translation="MSNRPIYLDYSATTPVDPSVVEKMIPWLYESFGNPASRSHAFGWE
FT                   AEDAVEKAREEVAKLVNADPREIVWTSGATESDNLAIKGAANFYAERGKHIITVKTEHK
FT                   AVLDTCRELERQGFEVTYLDVQDDGLLSLDAFKAALRPDTILVSVMMVNNEIGVIQDIA
FT                   ALGEICREKGIIFHVDAAQATGKVEIDLQKLKVDLMSFSAHKTYGPKGIGALYVRRKPR
FT                   VRIEAQMHGGGHERGFRSGTLATHQIVGMGEAFRLAREEMGTENERVRMLRDRLLAGLT
FT                   QIEEVYVNGSMEHRVPHNLNISFNYVEGESLIMAIKELAVSSGSACTSASLEPSYVLRA
FT                   LGRNDELAHSSIRFTLGRFTTEQEIDFTIELIKSRVGKLRDMSPLWEMAQEGIDLNSVQ
FT                   WAAH"
FT   misc_feature    156150..157208
FT                   /note="HMMPfam hit to PF00266, Aminotransferase class-V"
FT   misc_feature    156690..156749
FT                   /note="ScanRegExp hit to PS00595, Aminotransferases class-V
FT                   pyridoxal-phosphate attachment site."
FT   CDS_pept        157354..157764
FT                   /transl_table=11
FT                   /gene="iscU"
FT                   /gene_synonym="nifU"
FT                   /locus_tag="BP1800"
FT                   /product="[Fe-S] cluster formation/repair protein"
FT                   /note="Similar to Azotobacter vinelandii IscU TR:O31270
FT                   (EMBL:AF010139) (128 aa) fasta scores: E(): 1.3e-40, 81.74%
FT                   id in 126 aa, and to Escherichia coli, and NifU-like
FT                   protein NifU or B2529 or Z3796 or ecs3395 SW:NIFU_ECOLI
FT                   (P77310) (128 aa) fasta scores: E(): 7.7e-42, 82.81% id in
FT                   128 aa"
FT                   /db_xref="GOA:Q7VXH0"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXH0"
FT                   /protein_id="CAE42086.1"
FT                   /translation="MAYSSKVLDHYENPRNVGSFDKGDDSVGTGMVGAPACGDVMKLQI
FT                   KVNEAGVIEDARFKTYGCGSAIASSSLVTEWVKGKTLDEAMNIRNTQIAEELALPPVKI
FT                   HCSILAEDAIKAAVQDYKTKHGAETPEAVAAN"
FT   misc_feature    157357..157737
FT                   /note="HMMPfam hit to PF01592, NifU-like N terminal domain"
FT   CDS_pept        157766..158089
FT                   /transl_table=11
FT                   /gene="iscA"
FT                   /locus_tag="BP1801"
FT                   /product="[Fe-S] cluster formation/repair protein"
FT                   /note="Similar to Azotobacter vinelandii IscA TR:O31271
FT                   (EMBL:AF010139) (107 aa) fasta scores: E(): 1.5e-28, 68.22%
FT                   id in 107 aa, and to Pseudomonas aeruginosa probable
FT                   iron-binding protein isca isca or pa3812 TR:Q9HXJ0
FT                   (EMBL:AE004799) (107 aa) fasta scores: E(): 1.5e-29, 71.02%
FT                   id in 107 aa. Also similar to BP2958, 39.623% identity
FT                   (40.000% ungapped) in 106 aa overlap."
FT                   /db_xref="GOA:Q7VXG9"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR011302"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXG9"
FT                   /protein_id="CAE42087.1"
FT                   /translation="MAVTLTQSAANHVGRYLQKRGKGIGLRLGVRTTGCSGMAYKLEYV
FT                   DEQAADDVVFDSFGVKVFIDPKSLAYLDGTELDYAREGLNEGFRFSNPNEKATCGCGES
FT                   FTV"
FT   misc_feature    157769..158083
FT                   /note="HMMPfam hit to PF01521, HesB-like domain"
FT   misc_feature    158027..158080
FT                   /note="ScanRegExp hit to PS01152, Hypothetical
FT                   hesB/yadR/yfhF family signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   CDS_pept        158092..158604
FT                   /transl_table=11
FT                   /gene="hscB"
FT                   /locus_tag="BP1802"
FT                   /product="chaperone protein"
FT                   /note="Similar to Escherichia coli chaperone protein HscB
FT                   or B2527 or Z3794 or Ecs3393 SW:HSCB_ECOLI (P36540) (171
FT                   aa) fasta scores: E(): 4.6e-14, 36.3% id in 157 aa, and to
FT                   Neisseria meningitidis chaperone protein HscB Nmb1383
FT                   TR:Q9JYX6 (EMBL:AE002486) (166 aa) fasta scores: E():
FT                   2.3e-17, 41.31% id in 167 aa"
FT                   /db_xref="GOA:Q7VXG8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXG8"
FT                   /protein_id="CAE42088.1"
FT                   /translation="MAADDHFSLFGLPTRFALDPVQLEQAWRAVAARVHPDRYATASAA
FT                   ERRVAMQWAARANEAYRQLRDPMLRARYLCEQAGVDLQTESNTAMDPAFLMQQMEWREM
FT                   LDDARRDPAAFAALRAELEQARLRMQQTLSELIDERGDYQQAGTKVREWMFVEKLAQEL
FT                   SAAQPMQ"
FT   misc_feature    158104..158322
FT                   /note="HMMPfam hit to PF00226, DnaJ domain"
FT   CDS_pept        158734..160596
FT                   /transl_table=11
FT                   /gene="hscA"
FT                   /gene_synonym="hsc"
FT                   /locus_tag="BP1803"
FT                   /product="chaperone protein"
FT                   /note="Similar to Escherichia coli chaperone protein HscA
FT                   or Hsc or B2526 or Z3793 or Ecs3392 SW:HSCA_ECOLI (P36541)
FT                   (616 aa) fasta scores: E(): 2.3e-119, 60.06% id in 626 aa,
FT                   and to Ralstonia solanacearum probable chaperone protein
FT                   HscA TR:CAD14726 (EMBL:AL646062) (621 aa) fasta scores:
FT                   E(): 1.1e-145, 69.35% id in 620 aa."
FT                   /db_xref="GOA:Q7VXG7"
FT                   /db_xref="InterPro:IPR010236"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXG7"
FT                   /protein_id="CAE42089.1"
FT                   /translation="MALLQISEPGDSPAPHQRKLAVGIDLGTTNSLVAAVRSSVPEVLA
FT                   DAQGQVLLPSAVRYLDGGAVRIGREALLEQARDPLNTIVSVKRFMGRSAADAAASGAPY
FT                   EFVDAPGMVRLRTVQGDLSPVEVSAQILAVLRQRAEDVLGDDLVGAVITVPAYFDDAQR
FT                   QATRDAARLAGLNVLRLLNEPTAAAIAYGLDQAAEGIYAVYDLGGGTFDISILRLTQGV
FT                   FEVIATGGDTALGGDDFDSAIVAHACAGEDVAALPVADRRALLVAARAAREALTDQAQA
FT                   PFEVTLRDGRAIQATLTRAQFEQLAEPLVGRTLDSARRALRDAGLAVGDVRGVVMVGGA
FT                   TRMPVVRQQVGALFGTEPLTNLDPDQVVALGAALQANLLAGNRALGEDWLLLDVIPLSL
FT                   GLETMGGLVERIIPRNSTIPVARAQEFTTFKDGQTAMSVHVVQGERDLVSDCRSLARFE
FT                   LRGIPPMVAGAARIRVTFQVDADGLLSVTAREQSTGVEAAVAVKPSYGLSDDEIARMLA
FT                   DSVTQADSDARARMLREQQVEARQLVESVGAALAADGDLLDPAERATVDQRLQAAAQAQ
FT                   SLDDVEAVRAAVQALSDATEEFAARRMDRSIRSALAGRKLDELA"
FT   misc_feature    158794..160545
FT                   /note="HMMPfam hit to PF00012, Hsp70 protein"
FT   misc_feature    158803..158826
FT                   /note="ScanRegExp hit to PS00297, Heat shock hsp70 proteins
FT                   family signature 1. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   misc_feature    159340..159381
FT                   /note="ScanRegExp hit to PS00329, Heat shock hsp70 proteins
FT                   family signature 2. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   misc_feature    159733..159777
FT                   /note="ScanRegExp hit to PS01036, Heat shock hsp70 proteins
FT                   family signature 3. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   CDS_pept        160606..160947
FT                   /transl_table=11
FT                   /gene="fdx"
FT                   /locus_tag="BP1804"
FT                   /product="ferredoxin, 2Fe-2S"
FT                   /note="Similar to Escherichia coli ferredoxin, 2Fe-2S Fdx
FT                   or B2525 or Z3792 or Ecs3391 TR:AAG57639 (EMBL:M88654) (111
FT                   aa) fasta scores: E(): 1.5e-28, 62.5% id in 112 aa, and to
FT                   Neisseria meningitidis putative ferredoxin Fdx or Nma1344
FT                   or Nmb1172 TR:Q9JQT7 (EMBL:AL162755) (113 aa) fasta scores:
FT                   E(): 7.3e-33, 67.25% id in 113 aa. Also similar to BP3174,
FT                   63.964% identity (64.545% ungapped) in 111 aa overlap."
FT                   /db_xref="GOA:Q7VXG6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR011536"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXG6"
FT                   /protein_id="CAE42090.1"
FT                   /translation="MPKLTVLPHPDVCPEGAVIEDAPKGVSICRVMLDNHIEIEHACEL
FT                   SCACTTCHVVVRQGFNSLEDATDDEEDLLDKAWGLTSTSRLSCQALIGEEDLTVEIPKY
FT                   TINHAKEQH"
FT   misc_feature    160627..160887
FT                   /note="HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster
FT                   binding domain"
FT   misc_feature    160732..160764
FT                   /note="ScanRegExp hit to PS00814, Adrenodoxin family,
FT                   iron-sulfur binding region signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   misc_feature    160750..160767
FT                   /note="ScanRegExp hit to PS00190, Cytochrome c family
FT                   heme-binding site signature."
FT   CDS_pept        160947..161141
FT                   /transl_table=11
FT                   /locus_tag="BP1805"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Azotobacter vinelandii hypothetical 7.9
FT                   kDa protein TR:O69223 (EMBL:AF010139) (68 aa) fasta scores:
FT                   E(): 1.3e-14, 62.5% id in 64 aa, and to Neisseria
FT                   meningitidis hypothetical protein Nma1347 or Nmb1175
FT                   TR:Q9JR02 (EMBL:AL162755) (65 aa) fasta scores: E():
FT                   9.5e-14, 60% id in 65 aa"
FT                   /db_xref="GOA:Q7VXG5"
FT                   /db_xref="InterPro:IPR007479"
FT                   /db_xref="InterPro:IPR036762"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXG5"
FT                   /protein_id="CAE42091.1"
FT                   /translation="MKWTDIYEIAAALADTHPDADPQTVRFTQLREWVLGLPGFADDPA
FT                   HCGEKILEAIQMAWIEEMD"
FT   CDS_pept        161266..162159
FT                   /transl_table=11
FT                   /locus_tag="BP1806"
FT                   /product="hypothetical protein"
FT                   /note="The C-terminal region of this CDS is similar to
FT                   Brucella abortus methylglyoxal synthase MgsA SW:MGSA_BRUAB
FT                   (Q44615) (125 aa) fasta scores: E(): 3.6e-10, 41.12% id in
FT                   124 aa, and to Rhizobium meliloti probable methylglyoxal
FT                   synthase protein TR:CAC41545 (EMBL:AL591782) (126 aa) fasta
FT                   scores: E(): 1.1e-07, 40.95% id in 105 aa"
FT                   /db_xref="GOA:Q7VXG4"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXG4"
FT                   /protein_id="CAE42092.1"
FT                   /translation="MTTASLRFGLAANRLHHETPDAALFTWLRACSATIREMGIQLHTV
FT                   GRTHDAIVREGMLQGYSGLVRYPYGREGGLMKLVARVTEGRDGDAPFDGAIYLIDPVDP
FT                   SSIFPEALALKRQCITHGRPFISTLAGAIEWIEVERVLAGLAPDATAARLFDFTGQTLA
FT                   LISHDALKEDMVAFAAEHFDLLSQFARRVATGTTGGLLNDLAWSRGWPKDRPWVHRYLS
FT                   GPLGGDAQIAELVLEHQCQRVIFFEDPHVARQHEADIQLLERAVRVVTASATCATSPSV
FT                   ARRWAQAVQRRQAGRA"
FT   misc_feature    161929..161955
FT                   /note="ScanRegExp hit to PS01335, Methylglyoxal synthase
FT                   active site. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        complement(162156..163106)
FT                   /transl_table=11
FT                   /locus_tag="BP1807"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q79H25"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H25"
FT                   /protein_id="CAE42093.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT"
FT   repeat_region   162156..162187
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(162156..163208)
FT   misc_feature    complement(162192..162725)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(162783..162848)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   repeat_region   complement(163177..163208)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(163231..164040)
FT                   /transl_table=11
FT                   /gene="paaG"
FT                   /locus_tag="BP1808"
FT                   /product="probable enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="Similar to Escherichia coli probable enoyl-CoA
FT                   hydratase PaaG or B1394 SW:PAAG_ECOLI (P77467) (262 aa)
FT                   fasta scores: E(): 2.3e-24, 38.79% id in 250 aa, and to
FT                   Rhizobium meliloti putative enoyl-CoA hydratase protein
FT                   TR:Q92TG7 (EMBL:AL603647) (263 aa) fasta scores: E():
FT                   7.3e-25, 37.73% id in 265 aa"
FT                   /db_xref="GOA:Q7VXG3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXG3"
FT                   /protein_id="CAE42094.1"
FT                   /translation="MSAADQPPRYGTLTLQTDGALAILTLDRPAALNAIDIAMARDLQA
FT                   AARWLQDRAALRVVLLRGAGKAFCAGGDIALFQGPPEEIRASLRALFTPLNDCVARIAA
FT                   MDQLWLADVHGVAAGAGLSLALACDLAIAADDARLVTAYLKLGATPDAGMTHALAHLLG
FT                   RRRALALLLRAEPIDAAQALQWGLVDRVAPAAERADQALAYARELAAHAPHDVAAAKRL
FT                   LRQAPATSLEQQLEDEAAAFLAAAGRADFAEGVQAFLAKRPPRFTGA"
FT   misc_feature    complement(163462..163977)
FT                   /note="HMMPfam hit to PF00378, Enoyl-CoA
FT                   hydratase/isomerase family"
FT   misc_feature    complement(163651..163713)
FT                   /note="ScanRegExp hit to PS00166, Enoyl-CoA
FT                   hydratase/isomerase signature."
FT   repeat_region   164139..164170
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   164139..165191
FT   CDS_pept        164241..165191
FT                   /transl_table=11
FT                   /locus_tag="BP1809"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA3"
FT                   /protein_id="CAE42095.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   misc_feature    164499..164564
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    164622..165155
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(165160..165191)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   165188..165219
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   165188..166240
FT   CDS_pept        165290..166240
FT                   /transl_table=11
FT                   /locus_tag="BP1810"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTJ9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTJ9"
FT                   /protein_id="CAE42096.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVSEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDKYNLLTVHS"
FT   misc_feature    165548..165613
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    165671..166204
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(166213..166240)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        join(166490..167056,167058..167513)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="kdgT"
FT                   /locus_tag="BP1811"
FT                   /product="2-keto-3-deoxygluconate permease (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 189. The frameshift occurs within
FT                   a tract of (T)2. The sequence has been checked and believed
FT                   to be correct. Similar to Erwinia chrysanthemi
FT                   2-keto-3-deoxygluconate permease KdgT SW:KDGT_ERWCH
FT                   (P15701) (339 aa) fasta scores: E(): 1.4e-32, 34.24% id in
FT                   330 aa, and to Erwinia carotovora 2-keto-3-deoxygluconate
FT                   permease KdgT SW:KDGT_ERWCA (Q9XB52) (318 aa) fasta scores:
FT                   E(): 1.3e-35, 37.78% id in 307 aa"
FT                   /db_xref="PSEUDO:CAE42097.1"
FT   variation       167055..167056
FT                   /note="(T)2 in pertussis; (T)1 in parapertussis and
FT                   bronchiseptica"
FT   CDS_pept        167514..168731
FT                   /transl_table=11
FT                   /locus_tag="BP1812"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Smb20670 TR:CAC49777 (EMBL:AL603646) (425 aa) fasta scores:
FT                   E(): 4.8e-08, 30.02% id in 433 aa, and to Escherichia coli
FT                   hypothetical protein YgbK or B2737 SW:YGBK_ECOLI (Q46889)
FT                   (388 aa) fasta scores: E(): 2.1e-07, 28.98% id in 383 aa"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXG2"
FT                   /protein_id="CAE42098.1"
FT                   /translation="MGGPYIGIVADDLTGSGDTAVQFVRAGWATQLSVGGAEQALADPA
FT                   VRQAEVLAVTTHSRPLAAADAAAVVRGEVERLRAAGVQRLYKKVDSTLRGAFKAEIDAA
FT                   RLAWGEGAIAVVCPAFPVTGRTVRQGVLYVSDRPVTETSAATDPVTPVTESHIPTLLGC
FT                   AQLAAQAGETPAELARRIAAAAPVVVVDALDDADVQRLARAIGVLGQRAVPVGSGGLAA
FT                   PLAWVWAGGQAAGPVLVVVTSQHSAARQQAAALQQAGARTWAPTLAQLADDRNWAAWTA
FT                   EVEAAEHGMPAVDALMLLAPEGRLAGLDADSVARRLGELAARLVLAHGAAGVVATGGDG
FT                   ASAVLAALQASGIALVDEVTGGVPLGTLTGGQAAGLPVVTKAGGFGEQDVLIRAAQAIR
FT                   ERRFTK"
FT   CDS_pept        168728..169783
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="BP1813"
FT                   /product="putative pyridoxal phosphate biosynthetic
FT                   protein"
FT                   /note="Similar to Escherichia coli pyridoxal phosphate
FT                   biosynthetic protein PdxA or B0052 SW:PDXA_ECOLI (P19624)
FT                   (329 aa) fasta scores: E(): 1.2e-18, 31.7% id in 287 aa,
FT                   and to Caulobacter crescentus pyridoxal phosphate
FT                   biosynthetic protein PdxA Cc1686 TR:Q9A7N4 (EMBL:AE005843)
FT                   (333 aa) fasta scores: E(): 1.1e-26, 36.33% id in 333 aa.
FT                   Also similar to BP2789, 46.233% identity (49.451% ungapped)
FT                   in 292 aa overlap."
FT                   /db_xref="GOA:Q7VXG1"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXG1"
FT                   /protein_id="CAE42099.1"
FT                   /translation="MTQDATPSRIPTLAVTLGDVAGIGPEITAKMLLGHDELRQRARLL
FT                   VVGDAAVLAQAVQAVGGDPARVRVIATPAEATNQPGSIEVIQAGPSLAHVPPGQLSAEA
FT                   GDGSVRYVTTACALARDGLIDGIVTAPLNKAAMHMAGHKWPGHTELLAHEFGVKTFSLV
FT                   LSAGDLYIFHATTHVSLRQAIEDVNPQRMRAVLRLAGSFARALGRADHPVAVAGLNPHA
FT                   GENGIFGTEDAEILAPAVTQANNAEGILAAGPIPADALFPQAVRGKWKFVIACYHDQGY
FT                   APFKSVYGDDGVNITVACRWCACRSTTAPRSTSPARASREDSLVLAAERAAQLAPGWHQ
FT                   VWETARSTTGG"
FT   CDS_pept        169788..170690
FT                   /transl_table=11
FT                   /locus_tag="BP1814"
FT                   /product="probable GntR-family transcriptional regulator"
FT                   /note="Similar to Rhizobium meliloti putative transcription
FT                   regulator protein Smc02340 TR:CAC47147 (EMBL:AL591791) (244
FT                   aa) fasta scores: E(): 3.8e-18, 33.47% id in 239 aa, and to
FT                   Deinococcus radiodurans transcriptional regulator, GntR
FT                   family Dra0211 TR:Q9RYU6 (EMBL:AE001863) (279 aa) fasta
FT                   scores: E(): 3.8e-17, 37.7% id in 244 aa"
FT                   /db_xref="GOA:Q7VXG0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXG0"
FT                   /protein_id="CAE42100.1"
FT                   /translation="MALSAIEPFALDRSGATPLHAQVADAIRNHIRDHRLTAGTVLPSE
FT                   AALCHSFGVARSVVRQALGALVAEGLIRRDPGRAPVVAPPREHRRMVQRSAGLYEQFAG
FT                   LGVALRTRVLACRPAEPPPEVAAFFGTTETLLLERLRSVDAQPLAYVRTWLPRAAIAGL
FT                   AADHLQDASLHRVLAQRFGLRPGRGRNRIRAVAAEAALAQALDVAPGSPLLMLEGQGLD
FT                   QDGHPLEWFTTWHRPENLVFDVDVGQERESVQPALTCGTAAVAPPAVAAPPSGALDAVE
FT                   QSLLQALQAVRRAREDQQE"
FT   misc_feature    169854..170033
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family"
FT   CDS_pept        170767..171639
FT                   /transl_table=11
FT                   /locus_tag="BP1815"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Smc02631 TR:CAC45671 (EMBL:AL591786) (283 aa) fasta scores:
FT                   E(): 1e-13, 36.45% id in 288 aa, and to Streptomyces
FT                   coelicolor conserved hypothetical protein 2 Scd46.31C
FT                   TR:Q9FCF3 (EMBL:AL391406) (294 aa) fasta scores: E():
FT                   4.9e-13, 34.89% id in 298 aa"
FT                   /db_xref="GOA:Q7VXF9"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXF9"
FT                   /protein_id="CAE42101.1"
FT                   /translation="MSTRIRSLHIYPVKSCAGIDLAESIVDRAGLAHDRRWMVTTAAGQ
FT                   FMTQRQYPQMARIRTALEDGMLVLRAPGMEDLRIPADGSELAERTQPVGVWRDTVIARA
FT                   EHPRSAEWLSRFLGLPCRLLKIDLRADRTANPEWVDTWLERHPEWAEDFAGDHFFGFAD
FT                   GFPLLVANQSSLDELNERLAARGQAPVPMNRFRANIVVEGDWPAFEEDQTACIVAGGVR
FT                   MAFVKPCTRCPMSNVDQVTAEVYDELGLTLTTFRSLEIGVVFGQNAIVDRTAPAPLRVG
FT                   DAVEIELDF"
FT   CDS_pept        171770..172138
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="BP1816"
FT                   /product="aspartate 1-decarboxylase precursor"
FT                   /EC_number="4.1.1.11"
FT                   /note="Similar to Escherichia coli aspartate
FT                   1-decarboxylase precursor PanD or B0131 or Z0142 or Ecs0135
FT                   SW:PAND_ECOLI (P31664) (126 aa) fasta scores: E(): 1.2e-21,
FT                   54.62% id in 119 aa, and to Alcaligenes eutrophus aspartate
FT                   1-decarboxylase precursor PanD SW:PAND_ALCEU (Q9ZHI5) (120
FT                   aa) fasta scores: E(): 2e-36, 77.5% id in 120 aa"
FT                   /db_xref="GOA:Q7VXF8"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXF8"
FT                   /protein_id="CAE42102.1"
FT                   /translation="MQRIMLRAKLHRVTVTEADLHYEGSCGIDEDLLDAAGMREFERIE
FT                   LYNVTNGERFDTYIIKAARGSGAISLNGAAARRAQVGDLLIICTYGPMSEEQSAAHKPQ
FT                   VVLVDDANRVKEIRKFPA"
FT   misc_feature    171770..172117
FT                   /note="HMMPfam hit to PF02261, Aspartate decarboxylase"
FT   CDS_pept        172196..173242
FT                   /transl_table=11
FT                   /gene="ascD"
FT                   /gene_synonym="rfbI"
FT                   /locus_tag="BP1817"
FT                   /product="CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehy
FT                   drase reductase"
FT                   /EC_number="1.17.1.-"
FT                   /note="Similar to Yersinia pestis and Y. pseudotuberculosis
FT                   CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydrase
FT                   reductase AscD or RfbI or Ypo3116 SW:ASCD_YERPE (P37911)
FT                   (328 aa) fasta scores: E(): 1.1e-37, 42.85% id in 336 aa,
FT                   and to Ralstonia solanacearum putative reductase
FT                   oxidoreductase protein Rsc2434 TR:CAD16141 (EMBL:AL646070)
FT                   (349 aa) fasta scores: E(): 2.8e-86, 61.2% id in 348 aa"
FT                   /db_xref="GOA:Q7VXF7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXF7"
FT                   /protein_id="CAE42103.1"
FT                   /translation="MSFQVTIEPSKHQFQAEAGQTVLDAALAAGIVLPYSCRTGACSTC
FT                   KGKVVAGEVDAGPYPAQILSPEDLAQGYTLFCQAKPQSDLVVESTEVRLASDIQIRKLP
FT                   SRVQTIERVAPDVAVLKLQLPASEQFRYYAGQYIEVILKDGKRRSYSMAGAPHTGSPLE
FT                   LHIRHMPGGLFTDHVFGAGDTQMKEREILRLEGPFGSFFLREDSDKPIVLLASGTGFAP
FT                   VKAIVEHMIHNQIQRPVVLYWGGRRPRDLYHDALAQSWAGRLPGFRYVPVVSDALDEDG
FT                   WSGRTGYVHEAVMQDLPDLSGYEVYACGTPLMVDAARREFSAQCGLPAEAFYADAFTSE
FT                   ADLAKATP"
FT   misc_feature    172208..172444
FT                   /note="HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster
FT                   binding domain"
FT   misc_feature    172304..172330
FT                   /note="ScanRegExp hit to PS00197, 2Fe-2S ferredoxins,
FT                   iron-sulfur binding region signature."
FT   misc_feature    172817..173155
FT                   /note="HMMPfam hit to PF00175, Oxidoreductase NAD-binding
FT                   domain"
FT   CDS_pept        173438..174694
FT                   /transl_table=11
FT                   /gene="dadA"
FT                   /gene_synonym="dadR"
FT                   /locus_tag="BP1818"
FT                   /product="D-amino acid dehydrogenase small subunit"
FT                   /EC_number="1.4.99.1"
FT                   /note="Similar to Escherichia coli D-amino acid
FT                   dehydrogenase small subunit DadA or DadR or B1189 or Z1952
FT                   or Ecs1684 SW:DADA_ECOLI (P29011) (432 aa) fasta scores:
FT                   E(): 4.2e-68, 45.14% id in 412 aa, and to Salmonella
FT                   typhimurium LT2 D-amino acid dehydrogenase subunit DadA
FT                   TR:AAL20718 (EMBL:AE008780) (432 aa) fasta scores: E():
FT                   3.7e-68, 44.63% id in 410 aa. Also similar to BP2634,
FT                   42.079% identity in 404 aa overlap"
FT                   /db_xref="GOA:Q7VXF6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXF6"
FT                   /protein_id="CAE42104.1"
FT                   /translation="MKVAVLGSGIIGVSSAWWLSQAGHDVVVVDRCTGAAQETSLANGA
FT                   QISVSYAEPWANPQAPFKLLKWMFQDDAPLLFRPQLDWRQWQWGLAFLRECLPSRLAPN
FT                   IRAMVRMAEYSRATLQGMRAELGIQYDHLERGILNFYRDQREFETSQRAAGLMRDFGVE
FT                   RRVINADEVVAIEPALAPHLQTIVGGDYTPEDESGDVHLFTAALARRCEAAGVEFRFST
FT                   RVTRLLGEGGRVQGVELIEPDGRYGRLDADAFVVAMGSFSAQLVRPLGVPCMVYPAKGY
FT                   SATFPVRPGALAPVVSLTDSSHKVVFSRLGERLRMAGTAELSGYSRGLNTGRCEAMTRL
FT                   ARELFPDALDFERVSYWSGLRPSTPSNVPLIGRTSVSNLYLNTGHGTLGWTMGVGSGRA
FT                   LADLLSGRRPEPEFPFLGL"
FT   CDS_pept        174714..176036
FT                   /transl_table=11
FT                   /gene="ugpB"
FT                   /locus_tag="BP1819"
FT                   /product="glycerol-3-phosphate-binding periplasmic protein
FT                   precursor"
FT                   /note="Similar to Escherichia coli
FT                   glycerol-3-phosphate-binding periplasmic protein precursor
FT                   UgpB or B3453 or Z4822 or Ecs4299 SW:UGPB_ECOLI (P10904)
FT                   (438 aa) fasta scores: E(): 5.3e-42, 30.76% id in 429 aa,
FT                   and to Yersinia pestis glycerol-3-phosphate-binding
FT                   periplasmic protein UgpB TR:CAC93263 (EMBL:AJ414159) (439
FT                   aa) fasta scores: E(): 1.7e-43, 32.54% id in 424 aa"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXF5"
FT                   /protein_id="CAE42105.1"
FT                   /translation="MTGFARAMRASRRACVLGLAMAAMGVAQAADSVEIQVWHTLSGPN
FT                   KAEFEKLAKQFNKEQGDVVVKLRDFGNQDDLKKEAVSAVKSKKGPNLVQLADNHSPEVV
FT                   AEHKSILPLHQLLAKYPVKDLNWFLPSTTSFTRDGKGRLLAFPWMAEVPVMFYNTAYYK
FT                   KAGLDPNKPARTWADLQAELLKLRDVANIDCPYATSDQVTVHLENLAPVNNQLYATLNN
FT                   GLDVAKKGSPSMQFDTLYMRHVSLMVSWKRSLLLTAYSDDNKSDQLFAKGECAVLTTSS
FT                   SALGQFLNTRSLSFGVAPLPYYDQVTKTGGRPFVSGSALWAMEGHPQAEEKATAKFLAW
FT                   LSKPVIAAEWHQRTGYLPLTEAAFRASDVSFYNKVPGAQQLVELMRNPPAATSRGFRIA
FT                   NYERIEPVLNTQLTAAFDGKTPPVAALNNAASQARSLAAQR"
FT   misc_feature    174714..174800
FT                   /note="Signal peptide predicted for BP1819 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 29 and 30"
FT   misc_feature    175131..176018
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding protein"
FT   CDS_pept        complement(176186..177142)
FT                   /transl_table=11
FT                   /locus_tag="BP1820"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator Pa1998 TR:Q9I2B1 (EMBL:AE004626)
FT                   (306 aa) fasta scores: E(): 4.7e-30, 36.3% id in 314 aa,
FT                   and to Rhizobium loti transcriptional regulator Mlr6981
FT                   TR:Q987N6 (EMBL:AP003010) (299 aa) fasta scores: E():
FT                   1.1e-28, 36.23% id in 287 aa"
FT                   /db_xref="GOA:Q7VXF4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXF4"
FT                   /protein_id="CAE42106.1"
FT                   /translation="MRPQADLSTRQLRAFVMLADLRHFTKAAQACHLSQPAFSALIQSL
FT                   EATLAMQLFDRSTRRVVLTQEGELFEPLARRLLADLGHAMTHIASFVELRRGRVHVAAL
FT                   PSLAAGWLPKVLHEFHAEHPDIELMLSDVLSDECIELVRSGQADFALASRGIRASDPAV
FT                   LHARELCSDTFHLICRKDHPLAREPRLTLKHLAPWPFIHLTRNSSVRQTVEAALRPQVA
FT                   KTILEVAQLATVAGMIEAGLGISVVPTFTLYQFERPGLLIRPISLPGLTRQIYIVRRQE
FT                   ERLSIAAQALYDLVVAKLGTPAASPARPRRRRTEKRD"
FT   misc_feature    complement(176690..177118)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    complement(176984..177076)
FT                   /note="ScanRegExp hit to PS00044, Bacterial regulatory
FT                   proteins, lysR family signature."
FT   misc_feature    complement(177014..177079)
FT                   /note="Predicted helix-turn-helix motif with score 1613
FT                   (+4.68 SD) at aa 30-51, sequence RHFTKAAQACHLSQPAFSALIQ"
FT   CDS_pept        join(177239..178276,178275..178613)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1821"
FT                   /product="conserved hypothetical protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 346 (The frameshift occurs within
FT                   a polymeric tract of (GC)5), and a stop codon at position
FT                   459. The sequence has been checked and believed to be
FT                   correct. Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa2886 TR:Q9HZW1 (EMBL:AE004714) (600 aa) fasta
FT                   scores: E(): 4.7e-32, 31.58% id in 611 aa, and to
FT                   Streptomyces coelicolor conserved hypothetical protein
FT                   Scd10.11 TR:Q9K3W5 (EMBL:AL359988) (558 aa) fasta scores:
FT                   E(): 2.1e-23, 31.84% id in 603 aa"
FT                   /db_xref="PSEUDO:CAE42107.1"
FT   misc_feature    177986..178009
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   variation       178268..178277
FT                   /note="(GC)5 in pertussis; (GC)6 in parapertussis and
FT                   bronchiseptica"
FT   variation       178404..178406
FT                   /note="GAG in pertussis; TAG stop in parapertussis"
FT   variation       178611..178613
FT                   /note="Stop codon in pertussis, parapertussis and
FT                   bronchiseptica. According to Fasta hits there is no stop
FT                   codon but a frameshift"
FT   CDS_pept        178615..178965
FT                   /transl_table=11
FT                   /locus_tag="BP1822"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXF3"
FT                   /protein_id="CAE42108.1"
FT                   /translation="MLVPLFRVAHARTGDKGDRSNISVIARDRALYPLLVEQLTPEVVL
FT                   AQFAHRRPAGAQRYLLPKLGAMNFVLDAVLDGGVNGALNLDAHGKALSYLILKTEIAVP
FT                   SDLVCRLAGSPG"
FT   CDS_pept        179013..180587
FT                   /transl_table=11
FT                   /locus_tag="BP1823"
FT                   /product="probable extracellular solute-binding protein"
FT                   /note="Similar to Rhizobium sp probable peptide ABC
FT                   transporter periplasmic binding protein Y4tO precursor y4tO
FT                   SW:Y4TO_RHISN (P55669) (531 aa) fasta scores: E(): 2e-70,
FT                   39.92% id in 521 aa, and to Bradyrhizobium japonicum
FT                   putative ABC transporter TR:Q9RH65 (EMBL:AF065159) (516 aa)
FT                   fasta scores: E(): 1.5e-64, 38.35% id in 524 aa"
FT                   /db_xref="GOA:Q7VXF2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXF2"
FT                   /protein_id="CAE42109.1"
FT                   /translation="MRYLKSTYAAVLLAIGTAVPHATTLAQEVKVAAEAPLRLLDPVGT
FT                   TAYITRNHAYMVYDTLFALDAQLKPQPQMVSTWSVSPDKLVYRFTLRDGLKFHDGSPVT
FT                   AADCVASIKRWAQRDLTGLRMMAAAKEITAKDDKTFEIVLEQPFGAVIEGLSKASSLPA
FT                   FIMPKRIADAPASQAITEVIGSGPFRFVASEYRPGLQVVYERNTDYVPRSEPPSGLAGG
FT                   KVVNVDRVVWLSLPDIQTEANALAKGEVDYVQTVYPDVVQTLEASKDVVIQKLASTTTP
FT                   TLRLNWLQPPFNNQKVRQALLHAVSQRDYMDAQVGDPKAYRVCWAMFGCDSPLASTAGV
FT                   VSQDDEADLNAAKALLKESGYKNEKAVVLHATDYPPTSAISPFTAQILRSIGMKAEVQS
FT                   MDWATFLTRRGKQDPVEKGGWSVAYGSWNTLDLMSPIANLNLDGRGKEGYAGWTESAEM
FT                   ESLRTQYAQATEPASRQQIAAKIQQLAYDQVFYIPLGTYSNYAARRSNVTPLLDAPVTV
FT                   FWGISKN"
FT   misc_feature    179013..179090
FT                   /note="Signal peptide predicted for BP1823 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.782 between residues 26 and 27"
FT   misc_feature    179178..179951
FT                   /note="HMMPfam hit to PF00496, Bacterial extracellular
FT                   solute-binding proteins, family 5"
FT   CDS_pept        180640..181584
FT                   /transl_table=11
FT                   /locus_tag="BP1824"
FT                   /product="probable inner membrane component of
FT                   binding-protein-dependent transport system"
FT                   /note="Similar to Rhizobium sp probable peptide ABC
FT                   transporter permease protein Y4tP SW:Y4TP_RHISN (Q53191)
FT                   (313 aa) fasta scores: E(): 7e-57, 48.89% id in 317 aa, and
FT                   to Rhizobium loti ABC transporter, permease protein Mlr6289
FT                   TR:Q989T3 (EMBL:AP003008) (314 aa) fasta scores: E():
FT                   9.3e-54, 45.36% id in 313 aa"
FT                   /db_xref="GOA:Q7VXF1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXF1"
FT                   /protein_id="CAE42110.1"
FT                   /translation="MQILRLLFLRLASAIPVVLVVVTVVFLLVRLTGDPATILAGDMAS
FT                   PEVVASVRADLGLDRPLLGQYAQWLWDLLQGNLGTSIVTKQPVATLIGERLESTLVLSL
FT                   SALVVTVLLAVPLGVLAAWRHNTLVDRVVMIYAVIGFSLPSFVVGYLLILMFSVWLGWL
FT                   PVQGYVSITDDIWLAAQHLVLPTLALAIFYMSLISRVTRASVLEVLNEDFVRTAKAKGV
FT                   PPLRILSQHVLRNAAIPIVTVIGIGLAFLISGVVITESVFNLPGLGRLTIDAVLSRDYP
FT                   VVQGVILFFACVYILVNLLIDMLYVVIDPRIRY"
FT   misc_feature    180640..180699
FT                   /note="Signal peptide predicted for BP1824 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.692) with cleavage site
FT                   probability 0.226 between residues 20 and 21"
FT   misc_feature    join(180658..180726,180934..181002,181036..181104,
FT                   181162..181230,181345..181413,181495..181563)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP1824 by TMHMM2.0 at aa 7-29, 99-121, 133-155, 175-197,
FT                   236-258 and 286-308"
FT   misc_feature    181252..181467
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   misc_feature    181255..181341
FT                   /note="ScanRegExp hit to PS00402, Binding-protein-dependent
FT                   transport systems inner membrane comp. sign. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   misc_feature    181357..181431
FT                   /note="ScanRegExp hit to PS00043, Bacterial regulatory
FT                   proteins, gntR family signature."
FT   CDS_pept        181602..182432
FT                   /transl_table=11
FT                   /locus_tag="BP1825"
FT                   /product="probable probable inner membrane component of
FT                   binding-protein-dependent transport system"
FT                   /note="Similar to Rhizobium sp probable peptide ABC
FT                   transporter permease protein Y4tQ SW:Y4TQ_RHISN (Q53192)
FT                   (291 aa) fasta scores: E(): 1e-49, 52.96% id in 270 aa, and
FT                   to Rhizobium loti ABC transporter, permease protein Mlr6290
FT                   TR:Q989T2 (EMBL:AP003008) (280 aa) fasta scores: E():
FT                   5.1e-46, 49.8% id in 261 aa"
FT                   /db_xref="GOA:Q7VXF0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXF0"
FT                   /protein_id="CAE42111.1"
FT                   /translation="MTSILRHNRLALLGGGVLLLMVAISVAASWIASTDPAMMQPRMRL
FT                   TPPGEAFLLGTDALGRDVYSRVVHGSRMSLAIGALVVLITIAIGTLIGLVAGASRIMDR
FT                   VLMRIMDGVMAIPGILLAVALVSLFGASLASVVIAIAVPEIPRVVRLVRSVVLSVREEP
FT                   YVEAAVGLGVPYPKVVWRHILPNCFVPLIVQASYVFAAAILLEAVLGFLGVGFPPEIPT
FT                   FGNILAEARPVFQRAPWATVAPGLLLAVTVLAVNLLGDGLRDSLDPKLARRAND"
FT   misc_feature    181602..181682
FT                   /note="Signal peptide predicted for BP1825 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.687 between residues 27 and 28"
FT   misc_feature    join(181635..181703,181827..181895,181956..182024,
FT                   182181..182249,182310..182378)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BP1825 by TMHMM2.0 at aa 12-34, 76-98, 119-141, 194-216 and
FT                   237-259"
FT   misc_feature    182067..182288
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   misc_feature    182070..182156
FT                   /note="ScanRegExp hit to PS00402, Binding-protein-dependent
FT                   transport systems inner membrane comp. sign. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   CDS_pept        182425..184059
FT                   /transl_table=11
FT                   /locus_tag="BP1826"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /note="Similar to Rhizobium meliloti probable ABC
FT                   transporter, ATP-binding protein Sma1434 TR:AAK65441
FT                   (EMBL:AE007265) (550 aa) fasta scores: E(): 4.3e-80, 48.08%
FT                   id in 549 aa, and to Pseudomonas aeruginosa probable
FT                   ATP-binding component of ABC transporter Pa2061 TR:Q9I254
FT                   (EMBL:AE004632) (536 aa) fasta scores: E(): 1.5e-76, 49.24%
FT                   id in 526 aa"
FT                   /db_xref="GOA:Q7VXE9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXE9"
FT                   /protein_id="CAE42112.1"
FT                   /translation="MTENTPKQRVLEVSGLAIRAGARTLVQDVTLSLAQGEILCLVGES
FT                   GSGKSLTASAVMGLLPGNLGVGAGSIRLDGEDLTAASPARMQALRGDRMAMVFQEPMTS
FT                   LNPLMRVGRQIAEVLQVHRPDLGAGQVRARVLELMGDVHLPTPEALMDAFPHQLSGGQR
FT                   QRIMIAMALALEPALIIADEPTTALDVTTQVQVLKLFRQLLAKHSSAVLFITHDFDVVR
FT                   DIADHVAVMQLGRIVEQGPAGQVLDAPRHDYTRKLLAAVPSGVPKTQQNASSDELLSVS
FT                   GLNLVYESRGLLGPARRTHAVADVGFTLKKGETLGVVGESGSGKSTLGRCITRAHAPTS
FT                   GRIVFDGVDIAGLSGKALRAVRRRVQMVFQDPYRSLNPRRRILHALIEGPIESGVDRKT
FT                   ACARAAELMALVGLPADGLQRYPHQFSGGQRQRICIARALAMEPDLIVADEAVSALDVS
FT                   VQAQVLELFEDLQKRLGFAMIFITHDLRVAAQVCDRIGVMQKGRLLELGPVRQVIHAPQ
FT                   HPYTRHLFDSLPGRVGQTAEPAMELQA"
FT   misc_feature    182530..183126
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    182551..182574
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    182896..182940
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   misc_feature    183358..183927
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    183379..183402
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    183697..183741
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        184056..185411
FT                   /transl_table=11
FT                   /locus_tag="BP1827"
FT                   /product="putative amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="Similar to Pseudomonas putida amidase SW:AMID_PSEPU
FT                   (O69768) (466 aa) fasta scores: E(): 2e-26, 32.39% id in
FT                   460 aa, and to Rhizobium meliloti putative amidase protein
FT                   Smc02881 TR:CAC41593 (EMBL:AL591782) (453 aa) fasta scores:
FT                   E(): 2.4e-38, 35.57% id in 447 aa"
FT                   /db_xref="GOA:Q7VXE8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXE8"
FT                   /protein_id="CAE42113.1"
FT                   /translation="MTSTDQHIARAGVAELARGIARGAFTPTEVTDVFLRRIQDLNPAI
FT                   GAFVAVYEDEARHAARQATQALAQGQRLSPLHGIPFAVKDIVDVAGKFTTYGSRTGAGR
FT                   QAGATAEYVRALLDAGMILLGKTHTVEFAFGGWGTNQRMGTPRNPLRADVPCATGGSSS
FT                   GSGAAVGAQMVPFAVGTDTGGSIRIPSAFCGLTGMRPSMGRHSGAGVMSLSHTLDTIGP
FT                   LARTVEDVQMLDDLLTGKTATDTAQPGSQAVARVRDARIGVLGAQWLGAIEPEVAHAYA
FT                   QSLRAFEAMGAMLVELALPFDREAFAQLTSTLIACEGLQFAGKYAHDPLSGMDEDVRAR
FT                   FLVGDQYDAEAYAGLLGRRSAMIDTFTQAMAGVKALLMPTTPCVAQPLAGLEQSPYNPA
FT                   VYTRLPAWLGCCALAVPNGTGAHGLPTSLQIVGLPESDRLVMSLGRAYQEYA"
FT   misc_feature    184140..185378
FT                   /note="HMMPfam hit to PF01425, Amidase"
FT   misc_feature    184413..184436
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    184530..184625
FT                   /note="ScanRegExp hit to PS00571, Amidases signature.
FT                   Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        join(185589..186017,186016..186321)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1828"
FT                   /product="putative lipoprotein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 143. The sequence has been checked
FT                   and believed to be correct. No significant database
FT                   matches"
FT                   /db_xref="PSEUDO:CAE42114.1"
FT   misc_feature    185607..185639
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    185817..185849
FT                   /note="ScanRegExp hit to PS00133, Zinc carboxypeptidases,
FT                   zinc-binding region 2 signature."
FT   variation       186023
FT                   /note="14 bp deletion in pertussis, relative to
FT                   parapertussis and bronchiseptica, around this position"
FT   CDS_pept        186318..187895
FT                   /transl_table=11
FT                   /locus_tag="BP1829"
FT                   /product="lipoprotein"
FT                   /note="Similar to Escherichia coli lipoprotein PilN
FT                   TR:O07372 (EMBL:AB021078) (560 aa) fasta scores: E():
FT                   2.3e-11, 24.69% id in 567 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXE7"
FT                   /protein_id="CAE42115.1"
FT                   /translation="MKARRLAMAGLSLALGGCSLSQQMQAMRDAATSLRARLLEGQQAV
FT                   GRAGERPAREAAQDVARPWLAGRAQPLAREVLLPPALRADVDTTLLFAGKATLPVLAER
FT                   LHRATGIAVRVHPDALLPRAAFLPRLAGQAELAAEPPAQAELRAGPRPLADTLDALAAQ
FT                   LYVHWRYHRGAIEFYRTETRVFDVRTLALAASAQARLGRAGSGETGSFDHASSTVLSAD
FT                   AGKALQAVRDRVAAFLTRAGVIAEIEAGGSTLAVTDTPEALARIEKYLQGENRALTRRV
FT                   RLVFEELTVRTTAAAEGGIDWQAVYASARAAASYAMPGGAGAAGALGARVLAGPWRDAR
FT                   ALIAALSTMGAVLRHRSIPMLTLNRRAVTHAVRTTFSYVDQVQRLSPTAAAPGGRDAVP
FT                   GLAVQQKRETVGTFLTLLPEARDDGRILLSISYDNTIAQPLRTLTFGEGGQQVSLQQIA
FT                   IDGSGIVQQVELLPGQPVILSGFDHSEDQYERHRLFPDAPLAAGGHDRTARERVTTVVM
FT                   VTAQIDEG"
FT   misc_feature    186318..186380
FT                   /note="Signal peptide predicted for BP1829 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.463 between residues 21 and 22"
FT   misc_feature    186339..186371
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        187899..189173
FT                   /transl_table=11
FT                   /locus_tag="BP1830"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="InterPro:IPR009663"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXE6"
FT                   /protein_id="CAE42116.1"
FT                   /translation="MRAATHPPLVLQQTQGGPMLAFGLTWFAVLGSHAALQGRARARAL
FT                   RATHYVVGGRHAVAAGCARLPRRYGAMAIHSAAQAYASLHPDGAQAGVASLPDGQGWLI
FT                   AVQDGAVLASADRLFADAAQAQACLRTLLAQRPDLREVPAQAALDTLLARPDPSARLAP
FT                   LASRWSRAPVAARAVVLALAVAGGASLWRGLGQAPPPAAPDPRAVWRAAQAEFLRGWPV
FT                   HTSSELARVLDTLQALPLQVAGWALRQAQCVPGPAWHCDADYHRVDAAATSLAFAAAVP
FT                   PGWRMRLHTLEHTRVAWTLAGDQHGLDRTAPASPADTLALAATLQRASAAFTHVSVGAA
FT                   QALAGPAWDGPPELAPPAAPELHRREVVLDGPLRSLALVWPLPAPIGWTAVSLRVVPDA
FT                   IATLRASVLSLHLQGSLYEQTTSRS"
FT   CDS_pept        189271..189645
FT                   /transl_table=11
FT                   /locus_tag="BP1831"
FT                   /product="hypothetical protein"
FT                   /note="The N-terminal region of this CDS is similar to
FT                   Streptomyces coelicolor hypothetical 7.7 kDa protein
FT                   Sc7h1.36C TR:O54195 (EMBL:AL021411) (81 aa) fasta scores:
FT                   E(): 0.24, 45.45% id in 66 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXE5"
FT                   /protein_id="CAE42117.1"
FT                   /translation="MRELLRRETLAAAQPPRPAAPAPWSDAPAARKAAPGPRADRIVLL
FT                   AIYGVGAALRAEVSINRRHWRYLAGQRRPFGQAPEARYQLEAIAAPCVHLRSGAVRRTA
FT                   CLAPAASLDNGAASAAGAAP"
FT   CDS_pept        join(189642..191003,191015..191368)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1832"
FT                   /product="putative general secretion pathway protein
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 454. The sequence has been checked
FT                   and believed to be correct. Similar to Klebsiella
FT                   pneumoniae general secretion pathway protein E PulE
FT                   SW:GSPE_KLEPN (P15645) (497 aa) fasta scores: E(): 9.5e-13,
FT                   27.78% id in 547 aa, and to Escherichia coli probable
FT                   general secretion pathway protein E GspE or b3326
FT                   SW:GSPE_ECOLI (P45759) (493 aa) fasta scores: E(): 8.8e-12,
FT                   24.13% id in 547 aa"
FT                   /db_xref="PSEUDO:CAE42118.1"
FT   misc_feature    190260..190634
FT                   /note="HMMPfam hit to PF00437, Bacterial type II secretion
FT                   system protein"
FT   misc_feature    190476..190499
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    190821..190907
FT                   /note="HMMPfam hit to PF00437, Bacterial type II secretion
FT                   system protein"
FT   variation       191004..191014
FT                   /note="11 bp insertion in pertussis relative to
FT                   parapertussis and bronchiseptica"
FT   CDS_pept        191361..192494
FT                   /transl_table=11
FT                   /locus_tag="BP1833"
FT                   /product="putative general secretion pathway protein"
FT                   /note="Similar to Escherichia coli integral membrane
FT                   protein PilR TR:O07376 (EMBL:AB021078) (365 aa) fasta
FT                   scores: E(): 3.3e-06, 24.07% id in 353 aa, and to
FT                   Caulobacter crescentus general secretion pathway protein F
FT                   Cc0175 TR:Q9ABQ1 (EMBL:AE005692) (403 aa) fasta scores:
FT                   E(): 0.052, 23.94% id in 355 aa"
FT                   /db_xref="GOA:Q7VXE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXE4"
FT                   /protein_id="CAE42119.1"
FT                   /translation="MAEHAALASAWRAAGALGQRLDAWRFGAERGDYYEYLADMLEGLQ
FT                   GRQTLRDIFETDAARHGEASVRGRLARRWLHRYQDCGGDLRATWARCLPEGDCTLLALA
FT                   QAAGGGALGIVLRDLAHLTRLTQGMRREFCVTIAAGLVAMTVACALLAAVPAFSAPRLR
FT                   LVFQAVPPDYHGAWSAGLFALARYVEAAWSAAVAALTAAVALVCWSLPRYAGRARVFLD
FT                   RWQPWRLYRDMQAIRFLALATVLLRQRGNIDTRLRTALLVQGADAPPWLAWHLERMLLR
FT                   VDAGVVDASVFDTGLFEPAHAWFMADMVAAHGLADGLARARTRVEAHMLPRLRRQAQGL
FT                   RWALLLGAVGAVLALALWHYAAIDDLRHALVSFYASQ"
FT   misc_feature    join(191757..191825,191922..191990,192375..192443)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BP1833 by TMHMM2.0 at aa 133-155, 188-210 and 339-361"
FT   CDS_pept        192532..193137
FT                   /transl_table=11
FT                   /locus_tag="BP1834"
FT                   /product="putative fimbrial protein"
FT                   /note="Similar to Escherichia coli type IV prepilin PilS
FT                   TR:O88170 (EMBL:AB007463) (204 aa) fasta scores: E(): 0.62,
FT                   24.49% id in 196 aa, and to Salmonella typhi PilS protein
FT                   TR:Q9ZIU9 (EMBL:AF000001) (206 aa) fasta scores: E(): 0.71,
FT                   29.78% id in 188 aa"
FT                   /db_xref="GOA:Q7VXE3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR014911"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXE3"
FT                   /protein_id="CAE42120.1"
FT                   /translation="MSHTILSGRQAGFSLVEVSIVTAIVLLVAIIGIPAIGSYVIESKV
FT                   PRVGEELQRFVARTKANAQGDGAAPYTGIGTASLAHALRDSSVVSVRGEGASATVAHGL
FT                   GGQGAGAHGVISVAPAAPGGAPPGSAFTLTLTNVNGAACPALASVMQRVSDIIAVQGKA
FT                   GPVVVKNALAVPALPYRAQAAQAQCVAGDRNTFVFTAR"
FT   misc_feature    192562..192624
FT                   /note="ScanRegExp hit to PS00409, Prokaryotic N-terminal
FT                   methylation site."
FT   CDS_pept        193134..193952
FT                   /transl_table=11
FT                   /locus_tag="BP1835"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXE2"
FT                   /protein_id="CAE42121.1"
FT                   /translation="MRSAHAQGGLALLELAVAAALAAMAAVWAANRLVQDAQDAAARGA
FT                   GVWLGEIQRGLDQLLQRHFDTLADGLAPRDERGRALFRDAWRPTLPELQAAGLLARSLP
FT                   RHSPLGTGVIMLVRRDPHCPRAGCRLDALAWLDRPLLDGHGQVDLMRMAPLVAATAGRG
FT                   GFAVAGGVRGAAFRFANPPWPGVARLPAGTPLAWAGLAAGKASPAFGGAYSVNSHVGCR
FT                   SYSGHTSRNPLTGQCSCPPGYASVIMAQAIDRVDGAPGFTSFVCVRPGKE"
FT   misc_feature    193134..193208
FT                   /note="Signal peptide predicted for BP1835 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.996) with cleavage site
FT                   probability 0.554 between residues 25 and 26"
FT   CDS_pept        194024..196648
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /gene_synonym="lovB"
FT                   /locus_tag="BP1836"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="Similar to Escherichia coli alanyl-tRNA synthetase
FT                   AlaS or LovB or B2697 SW:SYA_ECOLI (P00957) (876 aa) fasta
FT                   scores: E(): 3.9e-197, 62.1% id in 876 aa, and to Neisseria
FT                   meningitidis alanyl-tRNA synthetase AlaS or Nma1788
FT                   TR:Q9JTG4 (EMBL:AL162757) (874 aa) fasta scores: E():
FT                   9.7e-197, 62.2% id in 881 aa"
FT                   /db_xref="GOA:Q7VXE1"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXE1"
FT                   /protein_id="CAE42122.1"
FT                   /translation="MKSSEIRQKFLQFFQSKGHTIVPSSSLVPANDPTLLFTNSGMVQF
FT                   KDVFTGKEARAYKRATSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRE
FT                   AIQYAWELLTQVYKLPAEKLWVTVYQEDDEAYDIWAKEVGVPAERIIRIGDNKGARYAS
FT                   DNFWQMADTGPCGPCSEIFYDHGPEIWGGPPGSPEEDGDRYIEIWNLVFMQFERDAAGN
FT                   MERLPKPCVDTGMGLERIAAVLQHVHSNYEIDLFQKLIAAAARETGVKDLADNSLKVIA
FT                   DHIRACAFLIVDGIIPSNEGRGYVLRRIVRRALRHGYKLGQTKSFFHRLVPDLVAEMGE
FT                   AYPELAQVAERVAQVLRQEEERFGETLEHGMKILDGALAKVAKGDPLDGTTLFTLYDTY
FT                   GFPVDLTADICREREVEVDMAGFEAAMQRQREQARAAGKFKMAEGLSYEGAETRFEGYE
FT                   NLELSGVKVTALYVEGTQVEQVSAGQDAVVVLDATPFYAESGGQVGDTGLLEAGGVRFA
FT                   VADTLKIQPGVFGHHGTLEAGALKVGDTLLARVDAVRRARTVRNHSATHLMHKALREVL
FT                   GAHVQQRGSLVDPDKTRFDFAHDAPMTAEQIARVEAIVNAEVLANQATEAKVMAYDDAV
FT                   KGGAMALFGEKYGDTVRVLDIGFSRELCGGTHVRRTGDIGLFKVVSEGGVAAGVRRIEA
FT                   ITGDNALAWVQDQNALLQRAAGVLRAPAHELPERIAQVQEQLKALEKELEQARTKLAAS
FT                   AGNDLVATATVEVKGIKVLAASIGDVDPKALRGMVDNLKDRLKPAVVLLAAGSADGKIS
FT                   LVGGVTADLTGRIKAGDLVGFVAGQVGGKGGGRPDMAMGGGTDLAALPAAVASVQKWVD
FT                   ERL"
FT   misc_feature    194036..196129
FT                   /note="HMMPfam hit to PF01411, tRNA synthetases class II
FT                   (A)"
FT   misc_feature    194723..194752
FT                   /note="ScanRegExp hit to PS00339, Aminoacyl-transfer RNA
FT                   synthetases class-II signature 2."
FT   misc_feature    196406..196627
FT                   /note="HMMPfam hit to PF02272, DHHA1 domain"
FT   CDS_pept        196635..196889
FT                   /transl_table=11
FT                   /locus_tag="BP1837"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Neisseria meningitidis hypothetical
FT                   protein Nma0882 or Nmb0681 SW:Y882_NEIMA (Q9JR98) (74 aa)
FT                   fasta scores: E(): 1.1e-10, 61.66% id in 60 aa, and to
FT                   Pseudomonas aeruginosa hypothetical protein Pa1006
FT                   TR:Q9I4W7 (EMBL:AE004533) (83 aa) fasta scores: E():
FT                   1.6e-10, 45.23% id in 84 aa"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXE0"
FT                   /protein_id="CAE42123.1"
FT                   /translation="MSASDTGGLPSYQHEVDASGLTCPLPILRAKKALAQMESGQVLRV
FT                   VTTDPNAIRDFQAFARQTGNTLLAQREAEGRGEHFLQRR"
FT   misc_feature    196668..196883
FT                   /note="HMMPfam hit to PF01206, Uncharacterized protein
FT                   family UPF0033"
FT   misc_feature    196680..196754
FT                   /note="ScanRegExp hit to PS01148, Uncharacterized protein
FT                   family UPF0033 signature."
FT   CDS_pept        complement(196956..197537)
FT                   /transl_table=11
FT                   /locus_tag="BP1838"
FT                   /product="putative exported protein"
FT                   /note="Weakly similar to Bacillus subtilis endoglucanase
FT                   precursor TR:Q03882 (EMBL:M38634) (148 aa) fasta scores:
FT                   E(): 4, 26.71% id in 131 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXD9"
FT                   /protein_id="CAE42124.1"
FT                   /translation="MKHCSILAPLTRLAACGALAAVLAVPLPAAARVGDAALVSVTGQI
FT                   TAVDPATRTVTVRGPQGNEVPLQAGPDVRNFDRIKVGDTMRVDYYESVSIATRAKGSGV
FT                   PEVRSETVATRAKEGALPQGAVGRSTTITAEIWHIAKDGRTVILQGPQGGRETFHLRSA
FT                   AAQEKLRTLKEGDLVDFTVTRALAAAVRSR"
FT   misc_feature    complement(197445..197537)
FT                   /note="Signal peptide predicted for BP1838 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.885 between residues 31 and 32"
FT   misc_feature    complement(197514..197537)
FT                   /note="ScanRegExp hit to PS00443, Glutamine
FT                   amidotransferases class-II active site."
FT   CDS_pept        197841..198101
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="BP1839"
FT                   /product="30S ribosomal protein S16"
FT                   /note="Similar to Escherichia coli 30S ribosomal protein
FT                   S16 RpsP or B2609 or Z3903 or Ecs3472 SW:RS16_ECOLI
FT                   (P02372) (82 aa) fasta scores: E(): 5.3e-17, 58.44% id in
FT                   77 aa, and to Ralstonia solanacearum probable 30S ribosomal
FT                   subunit protein S16 RpsP TR:CAD14635 (EMBL:AL646061) (84
FT                   aa) fasta scores: E(): 1.3e-23, 72.61% id in 84 aa"
FT                   /db_xref="GOA:Q7VXD8"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXD8"
FT                   /protein_id="CAE42125.1"
FT                   /translation="MLVIRLARGGSKKRPFYNLVATDSRNRRDGRFVERVGFYNPVAAE
FT                   GTENLRIALDRVQYWTGNGALLSPAVERLVKEYSAKVSAAA"
FT   misc_feature    197862..198044
FT                   /note="HMMPfam hit to PF00886, Ribosomal protein S16"
FT   CDS_pept        198267..198890
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="BP1840"
FT                   /product="16S rRNA processing protein"
FT                   /note="Similar to Escherichia coli 16S rRNA processing
FT                   protein RimM or B2608 SW:RIMM_ECOLI (P21504) (182 aa) fasta
FT                   scores: E(): 0.00051, 29.29% id in 198 aa, and to Xylella
FT                   fastidiosa probable 16S rRNA processing protein RimM or
FT                   Xf0108 SW:RIMM_XYLFA (Q9PH38) (170 aa) fasta scores: E():
FT                   1.7e-06, 28.35% id in 194 aa"
FT                   /db_xref="GOA:Q7VXD7"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXD7"
FT                   /protein_id="CAE42126.1"
FT                   /translation="MSEAAHSGAAPADLVELGRIASAYGVKGWVKVQPHSAQAEVLRTV
FT                   SHWWLTRPAPQAARDVVASVPRAYQVLQARVHGGAVVAQLAGIDDRDQAEALRGCFVQA
FT                   ARSAFPAPADDEYYWVDLIGCALYSDADGEPRLLGVVDEVFDNGAHAVLKVLRQQIQPG
FT                   QPGPVPLLDPKGRPLEELVPFVRAHIRHVDLAARRIDSDWPLDY"
FT   misc_feature    198312..198887
FT                   /note="HMMPfam hit to PF01782, RimM"
FT   CDS_pept        198890..199663
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="BP1841"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /EC_number="2.1.1.31"
FT                   /note="Similar to Escherichia coli tRNA
FT                   (guanine-N1)-methyltransferase TrmD or B2607 or Z3901 or
FT                   Ecs3470 SW:TRMD_ECOLI (P07020) (255 aa) fasta scores: E():
FT                   5.3e-46, 53.54% id in 254 aa, and to Salmonella typhimurium
FT                   tRNA (guanine-N1)-methyltransferase TrmD or Stm2674
FT                   SW:TRMD_SALTY (P36245) (255 aa) fasta scores: E(): 1.7e-46,
FT                   54.33% id in 254 aa"
FT                   /db_xref="GOA:Q7U361"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7U361"
FT                   /protein_id="CAE42127.1"
FT                   /translation="MRFDVVTLFPDMFGLVRDQGVTGRAHAQGLWALHAWNPRDFTHDV
FT                   HRTVDDRPYGGGPGMVMMAAPLEAAVAAAQAARAAQGLQAAPVILLSPAGRRYDQAEAT
FT                   TLAAGTGAIFICGRYEGVDQRFIERCVTHELSLGDFVLSGGELAALAMMDAAVRLLPGV
FT                   LNDGDSALQDSFNAALDGLLDSPHYTRPEVYEGVPVPQPLLSGHHANIARWRREQSLRL
FT                   TASRRPELIERARGEGRLSKADERFLASLAGERES"
FT   misc_feature    198953..199603
FT                   /note="HMMPfam hit to PF01746, tRNA
FT                   (Guanine-1)-methyltransferase"
FT   CDS_pept        complement(199660..200868)
FT                   /transl_table=11
FT                   /locus_tag="BP1842"
FT                   /product="probable class-V aminotransferase"
FT                   /note="Similar to Escherichia coli selenocysteine lyase
FT                   CsdB or SufS or B1680 SW:CSDB_ECOLI (P77444) (406 aa) fasta
FT                   scores: E(): 1.3e-18, 29.57% id in 355 aa, and to
FT                   Streptomyces capreolus capreomycin acetyltransferase Cac
FT                   TR:Q53824 (EMBL:U13077) (359 aa) fasta scores: E():
FT                   8.9e-38, 39.33% id in 361 aa"
FT                   /db_xref="GOA:Q7VXD6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXD6"
FT                   /protein_id="CAE42128.1"
FT                   /translation="MPATLTDELVAALRARTPGAQGAFIHFNHAGASLPSAGTLQAIKA
FT                   HLRLEATQGPMEAGVQAREQAERARLLAARLLNAQPAEVALTTGNSAGWGAAFAALGPW
FT                   RAGDRILVARHEWGGNLAAMRLAAQRAGATIGTIASDESGAVDPGALQAMLDERVRLIA
FT                   LTWLPANGGLVNPAAAVGRIARRHGIAYFVDAAQAVGQLPIDVAEVGCDVLSGAGRKAL
FT                   RGPRGTGLLYVRQAFLERLAPAWVDTWSAPLGEDGCPIVRGDAARFESAENSVALRCGL
FT                   AHALHEALELDIASIRARIDAVATRLRTRLAALDGITLLDQGRVRSGLIAFDVAGWQAD
FT                   AVQRELARQGIALGCNGVAYTPLDMQARGLRQIARASVSYLTTEAEIDALLDALAALAR
FT                   RAP"
FT   misc_feature    complement(199699..200763)
FT                   /note="HMMPfam hit to PF00266, Aminotransferase class-V"
FT   misc_feature    complement(200176..200238)
FT                   /note="ScanRegExp hit to PS00595, Aminotransferases class-V
FT                   pyridoxal-phosphate attachment site."
FT   CDS_pept        complement(200894..201367)
FT                   /transl_table=11
FT                   /locus_tag="BP1843"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Smc02103 TR:CAC46072 (EMBL:AL591787) (154 aa) fasta scores:
FT                   E(): 2.4e-22, 50% id in 156 aa, and to Agrobacterium
FT                   tumefaciens strC58 Agr_c_2535p TR:AAK87164 (EMBL:AE008063)
FT                   (156 aa) fasta scores: E(): 8.6e-21, 46.75% id in 154 aa"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXD5"
FT                   /protein_id="CAE42129.1"
FT                   /translation="MTASISVRVAELGLTLEPANAPAANYVPFVRDGNLLYISGQVPRV
FT                   DGKPVHLGRLGDSVSDEEGVQAARQAALGVLAQLAAATGDRLQGVARIVRLGVFVAAAP
FT                   DFNRHSAIANGASDLMVNVFGEAGRHARSAVGVASLPNGVAVEVEAVVALAQA"
FT   misc_feature    complement(200906..201316)
FT                   /note="HMMPfam hit to PF01042, YjgF family"
FT   CDS_pept        complement(201441..202391)
FT                   /transl_table=11
FT                   /locus_tag="BP1844"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA4"
FT                   /protein_id="CAE42130.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIPPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   repeat_region   201441..201472
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(201441..202493)
FT   misc_feature    complement(201477..202010)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(202068..202133)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   repeat_region   complement(202462..202493)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(202490..203506)
FT                   /transl_table=11
FT                   /locus_tag="BP1845"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli unknown protein from
FT                   2D-PAGE YgfZ or B2898 SW:UP14_ECOLI (P39179) (325 aa) fasta
FT                   scores: E(): 7.2e-17, 31.3% id in 345 aa, and to
FT                   Pseudomonas aeruginosa hypothetical protein Pa0759
FT                   TR:Q9I5H0 (EMBL:AE004511) (314 aa) fasta scores: E():
FT                   1.6e-13, 32.91% id in 316 aa"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXD4"
FT                   /protein_id="CAE42131.1"
FT                   /translation="MHAFYDSIPARADGSAQCAPLASLRVIGAAGADALAFLHGQLTQD
FT                   VTGQPADHARLAGYCTAKGRLLATLVMWLAAAADESAPVWQALVRADVAEAVLKRLSMF
FT                   VLRAKARLAPVPAWAAGVQCAPAALAALQDAAGGALPAAPWQRAELPTGTWIGAPSADA
FT                   QPRWWWIATEAQLERAGALAAHLGRASESAWQAADLAAGLPWIGAATQDVFIPQTVNLD
FT                   LIGGVSFTKGCYPGQEVVARSHYRGTVKRRMAHGVIAEAPADLPDPLAGQDIYDSARPD
FT                   EPCGRVVDAARSDGQLALLFETTLASLPDGDLRLLSAQGPRIALAPLPYELAGNAAG"
FT   CDS_pept        203685..204719
FT                   /transl_table=11
FT                   /locus_tag="BP1846"
FT                   /product="putative exported protein"
FT                   /note="Similar to Ralstonia solanacearum conserved
FT                   hypothetical protein Rsc1783 TR:CAD15485 (EMBL:AL646066)
FT                   (377 aa) fasta scores: E(): 1.8e-60, 50% id in 334 aa, and
FT                   to Pseudomonas aeruginosa hypothetical protein Pa2963
FT                   TR:Q9HZN7 (EMBL:AE004722) (349 aa) fasta scores: E():
FT                   3.3e-46, 44.27% id in 332 aa"
FT                   /db_xref="GOA:Q7VXD3"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXD3"
FT                   /protein_id="CAE42132.1"
FT                   /translation="MRKRIRFYFLLLVLVALLGAALAAGGAWTWMHRPVALKSDRIDFV
FT                   VDPGSAPRAIARTLNQAGVAVWEPGFVWMARLSELDKQIKAGGYQAIDGDSPWQLLQRL
FT                   ARGDMSQRQITFLEGWTFRQMRQALREHPDVKQTLGETSDEALMERLGSTVTHPEGMFF
FT                   PDTYVFTPGSTDFDILRRAYQEGQRILESTWAKRQDGLPVGTPYEALILASIVEKETGH
FT                   GSERARVAGVFANRLRIGMLLQTDPTVIYGMGEAYQGRIRKRDLQTDTPWNTYTRPGLP
FT                   PTPIAAPGRAALLAAVQPERHKYLFFVSRGNGTSEFSVNLNDHNRNVSRYILGQGQPQQ
FT                   GSQQ"
FT   misc_feature    203685..203753
FT                   /note="Signal peptide predicted for BP1846 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.721 between residues 23 and 24"
FT   misc_feature    203685..204686
FT                   /note="HMMPfam hit to PF02618, Uncharacterized BCR, YceG
FT                   family COG1559"
FT   misc_feature    204009..204074
FT                   /note="Predicted helix-turn-helix motif with score 1112
FT                   (+2.97 SD) at aa 113-134, sequence MSQRQITFLEGWTFRQMRQALR"
FT   CDS_pept        204716..205342
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="BP1847"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="Similar to Escherichia coli thymidylate kinase Tmk
FT                   or B1098 SW:KTHY_ECOLI (P37345) (213 aa) fasta scores: E():
FT                   2.1e-22, 42.18% id in 211 aa, and to Pseudomonas aeruginosa
FT                   thymidylate kinase Tmk or pa2962 SW:KTHY_PSEAE (Q9HZN8)
FT                   (210 aa) fasta scores: E(): 7.3e-36, 55.1% id in 196 aa"
FT                   /db_xref="GOA:Q7VXD2"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXD2"
FT                   /protein_id="CAE42133.1"
FT                   /translation="MTPRGRFITLEGVDGAGKSTHTAWMVQALRDLGLTVLATREPGGT
FT                   PVGEKLRELLLSEPMALETETLLMFAARCEHVREVIAPALARGEWVVCDRFTDASYAYQ
FT                   GGGRQLGAARVAALEQWVHPDLQPDRTWLFDVPLDVARARLARSRQLDRFEREEDAFFE
FT                   RTRAAYHERARSSDGRIRIIDSSRPLEVVRAQLDSEVRELVAQAA"
FT   misc_feature    204743..205303
FT                   /note="HMMPfam hit to PF02223, Thymidylate kinase"
FT   misc_feature    204749..204772
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    205124..205153
FT                   /note="ScanRegExp hit to PS00215, Mitochondrial energy
FT                   transfer proteins signature."
FT   CDS_pept        205339..206391
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="BP1848"
FT                   /product="DNA polymerase III, delta' subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="Similar to Escherichia coli DNA polymerase III,
FT                   delta' subunit HolB or B1099 SW:HOLB_ECOLI (P28631) (334
FT                   aa) fasta scores: E(): 8e-10, 29.94% id in 354 aa, and to
FT                   Neisseria meningitidis putative DNA polymerase III, delta'
FT                   subunit HolB or Nma0980 TR:Q9JV62 (EMBL:AL162754) (325 aa)
FT                   fasta scores: E(): 3.6e-17, 34.4% id in 343 aa"
FT                   /db_xref="GOA:Q7VXD1"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXD1"
FT                   /protein_id="CAE42134.1"
FT                   /translation="MSLGRFLPWQTEIARSWLSGRDRFAHAWLIHGNGGIGKLDFTAAA
FT                   AASLLCESPRQGLACGECAACAWVASGNHPDLRRIRPEAVALEEGADQTEGAEEAEAGS
FT                   GGAAAKRAPSKDIRIDQIRALEPWFNTATHRGGWRVALLYPAHALNVISANALLKVLEE
FT                   PPAHTVFLLVADAPDRLLPTLVSRCRRLPLPTPSAGQALQWLGEQGVEPAADWLAAAGG
FT                   APLAAQRLAARGDAPCPAWLAQLVQPLAAGKAPDVGTLTENLEKVAAAEWIDALQRLFT
FT                   DLTLAAHGAASRYYPLLAEPVRQAAARAQPAQLAETARWLSRQRGLATHPLNAKLFVHA
FT                   ALQRVVLSCQ"
FT   CDS_pept        206441..207211
FT                   /transl_table=11
FT                   /locus_tag="BP1849"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Neisseria meningitidis hypothetical
FT                   protein Nmb0771 TR:Q9K050 (EMBL:AE002431) (259 aa) fasta
FT                   scores: E(): 1.5e-44, 50% id in 252 aa, and to Vibrio
FT                   cholerae hypothetical protein Vc2014 TR:Q9KQI4
FT                   (EMBL:AE004276) (255 aa) fasta scores: E(): 1.7e-43, 49.8%
FT                   id in 255 aa"
FT                   /db_xref="GOA:Q7VXD0"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXD0"
FT                   /protein_id="CAE42135.1"
FT                   /translation="MYVDSHCHLNFPELAQDLPAVLDRMAANQVTHALVVSVNMPDWPG
FT                   LMQLVEPHGNLWASVGVHPDYEDTPDPEPAELERLAAHPKVVAIGETGLDYYRLSEPLD
FT                   WQRERFRRHIRAARSTGLPLIVHTRASAQDTVRLLREEGADEVGGVMHCFTESWEIAQQ
FT                   AVALNFHISLSGIVTFKNAQLVHEVAANMPLDRLLIETDSPYLAPVPYRGKLNDPSKVI
FT                   HVAEKIAELKGIPVAEVAHASTENFFKLFNKIKR"
FT   misc_feature    206444..206470
FT                   /note="ScanRegExp hit to PS01137, TatD deoxyribonuclease
FT                   family signature 1. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   misc_feature    206459..207196
FT                   /note="HMMPfam hit to PF01026, TatD related DNase"
FT   misc_feature    207002..207052
FT                   /note="ScanRegExp hit to PS01091, TatD deoxyribonuclease
FT                   family signature 3."
FT   CDS_pept        207262..208098
FT                   /transl_table=11
FT                   /locus_tag="BP1850"
FT                   /product="putative exported protein"
FT                   /note="Similar to Chromatium vinosum ankyrin homolog
FT                   precursor SW:ANKH_CHRVI (Q06527) (323 aa) fasta scores:
FT                   E(): 3.1e-09, 32.87% id in 219 aa"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXC9"
FT                   /protein_id="CAE42136.1"
FT                   /translation="MKPLRTRFLRWRGAAAGGLLAGALLASPAWAAKQADWWVYVHNDK
FT                   ARDIGALLAAGADPNVRYDNGQPAIMRAVVDNAWEVFDVLAANRRTDLNAENPAGETPL
FT                   MYLAVAGQTERAQALIARGAQVNRLGWTPLHYAASKGRLETARMLLGKQALVNAPSPDG
FT                   TTPLMMAAYSGDRRMVQLLLDAGADITTRNLKGMSAADWAAFGKSEALARELKPMIARA
FT                   EAERQARHGAVATSKLAPAAETPPTAQPAAASAAASQPGEGRSLSGVSGVRLNSYD"
FT   misc_feature    207262..207354
FT                   /note="Signal peptide predicted for BP1850 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 31 and 32"
FT   misc_feature    207454..207555
FT                   /note="HMMPfam hit to PF00023, Ank repeat"
FT   misc_feature    207556..207645
FT                   /note="HMMPfam hit to PF00023, Ank repeat"
FT   misc_feature    207646..207744
FT                   /note="HMMPfam hit to PF00023, Ank repeat"
FT   misc_feature    207745..207843
FT                   /note="HMMPfam hit to PF00023, Ank repeat"
FT   CDS_pept        208294..209034
FT                   /transl_table=11
FT                   /locus_tag="BP1851"
FT                   /product="probable transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator Pa3174 TR:Q9HZ60 (EMBL:AE004741)
FT                   (242 aa) fasta scores: E(): 1e-28, 41.77% id in 237 aa, and
FT                   to Vibrio cholerae transcriptional regulator, putative
FT                   Vca0029 TR:Q9KND6 (EMBL:AE004346) (244 aa) fasta scores:
FT                   E(): 2.7e-19, 34.02% id in 241 aa"
FT                   /db_xref="GOA:Q7VXC8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXC8"
FT                   /protein_id="CAE42137.1"
FT                   /translation="MQEQAIAGGAERVLYVLATLAREEAPLTVAALAERTGLAQSTLYR
FT                   QVALLKRWGFVLEQAGAYTPGPLCVQLARGFDQSSYLIQEALPDMTRLAADSGETVGLL
FT                   VAMSDQAVCLEMVESRHPLRCSFVKGRGLPPLARGASAKSLMAFMAPARLQGRLHELAG
FT                   QGVDAAALARDLEAIRAAGYAVSDSEVDAGVWGCSAPVFERPHQAAGSVTLMAPSTRVA
FT                   ERTANLINLTLAAAKRISSRLQHS"
FT   misc_feature    208372..208437
FT                   /note="Predicted helix-turn-helix motif with score 1775
FT                   (+5.23 SD) at aa 27-48, sequence LTVAALAERTGLAQSTLYRQVA"
FT   misc_feature    208480..209019
FT                   /note="HMMPfam hit to PF01614, Bacterial transcriptional
FT                   regulator"
FT   CDS_pept        209109..209852
FT                   /transl_table=11
FT                   /locus_tag="BP1852"
FT                   /product="putative glutamine-binding periplasmic protein
FT                   precursor"
FT                   /note="Similar to Escherichia coli glutamine-binding
FT                   periplasmic protein precursor GlnH or B0811 or Z1033 or
FT                   Ecs0889 SW:GLNH_ECOLI (P10344) (248 aa) fasta scores: E():
FT                   5.1e-24, 36% id in 250 aa, and to Yersinia pestis putative
FT                   glutamine-binding periplasmic protein glnH TR:CAC91317
FT                   (EMBL:AJ414152) (247 aa) fasta scores: E(): 9.6e-25, 38.79%
FT                   id in 250 aa"
FT                   /db_xref="GOA:Q7VXC7"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXC7"
FT                   /protein_id="CAE42138.1"
FT                   /translation="MTTRRQLLTAALTLNLAWGAGAAHAQETIRAVTDATFPPMEFVKD
FT                   GKRTGFDIELVEALAQAMGKKIEWIDIDFKGLIPALQAGRADIAVSAIYITAERQKVVD
FT                   FTDPYYAGGLVVLTKKDGPVKSLKDLEGRKVSVQVGTKSVNYLKEHFPKVQRVEVEKNQ
FT                   EMFNLVQIGRADAAVTGKPAAKLFAQSTQNLAVLSEQITTEEYGIAVPKSKSGLTRELN
FT                   EALKKLKADGTYERIVNKWFEAQAK"
FT   misc_feature    209109..209183
FT                   /note="Signal peptide predicted for BP1852 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 25 and 26"
FT   misc_feature    209193..209840
FT                   /note="HMMPfam hit to PF00497, Bacterial extracellular
FT                   solute-binding proteins, family 3"
FT   misc_feature    209256..209297
FT                   /note="ScanRegExp hit to PS01039, Bacterial extracellular
FT                   solute-binding proteins, family 3 signature."
FT   CDS_pept        join(209849..210241,210245..210517)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1853"
FT                   /product="glutamine transport system permease (Pseudogene)"
FT                   /note="Pseudogene. This CDS contains an in-frame TAG stop
FT                   codon. The sequence has been checked and believed to be
FT                   correct. Similar to Salmonella typhimurium glutamine
FT                   transport system permease TR:P74887 (EMBL:U73111) (219 aa)
FT                   fasta scores: E(): 3e-22, 37.15% id in 218 aa, and to
FT                   Thermotoga maritima amino acid ABC transporter, permease
FT                   protein tm0592 TR:Q9WZ61 (EMBL:AE001734) (216 aa) fasta
FT                   scores: E(): 8.8e-31, 48.14% id in 216 aa"
FT                   /db_xref="PSEUDO:CAE42139.1"
FT   misc_feature    join(209906..209974,210011..210079,210092..210160)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BP1853 by TMHMM2.0 at aa 20-42, 55-77 and 82-104"
FT   variation       210242..210244
FT                   /note="In-frame TAG stop codon in pertussis; CAG in
FT                   parapertussis and bronchiseptica"
FT   misc_feature    210413..210481
FT                   /note="1 probable transmembrane helix predicted for BP1854
FT                   by TMHMM2.0 at aa 56-78"
FT   CDS_pept        210514..211287
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="BP1855"
FT                   /product="glutamine transport ATP-binding protein"
FT                   /note="Similar to Bacillus stearothermophilus glutamine
FT                   transport ATP-binding protein GlnQ SW:GLNQ_BACST (P27675)
FT                   (242 aa) fasta scores: E(): 1.3e-40, 52.84% id in 246 aa,
FT                   and to Archaeoglobus fulgidus glutamine ABC transporter,
FT                   ATP-binding protein af0680 TR:O29577 (EMBL:AE001058) (242
FT                   aa) fasta scores: E(): 5.3e-44, 59.83% id in 244 aa.
FT                   Similar to several B. pertussis CDSs: BP1181, P3828,
FT                   BP1534, BP0054, BP1575, BP1362, P0768, and BP1510."
FT                   /db_xref="GOA:Q7VXC6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXC6"
FT                   /protein_id="CAE42140.1"
FT                   /translation="MSTQEMIRIRGLRKAYGEHEVLRGIDFNVEASQVVVVIGPSGSGK
FT                   STLLRCCNGLEVAQGGTIDICGHNLLKDGRLLPEAELNRLRMQVGMVFQGFNLFPHLSV
FT                   LDNVTVGPRTLRGMSRAQAEELGGDLLAKVGLREKMAAMPGSLSGGQKQRVAIARALAM
FT                   QPRVMLFDEPTSALDPELVGEVLQVMKLLAREGMTMMVVTHEMGFAREVADVVAVMDGG
FT                   SIVESGPPELIFSQPREARTRAFLQAVLSASQGAA"
FT   misc_feature    210607..211179
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    210628..210651
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    210952..210996
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   CDS_pept        join(211284..211463,211462..212232)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1856"
FT                   /product="probable arginase (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 60. The frameshift occurs within a
FT                   dimeric tract of (GCGGC)2. The sequence has been checked
FT                   and believed to be correct. Similar to Ralstonia
FT                   solanacearum probable arginase protein Rsc2645 TR:CAD16352
FT                   (EMBL:AL646071) (325 aa) fasta scores: E(): 1.2e-59, 57.37%
FT                   id in 312 aa, and to Pseudomonas aeruginosa probable
FT                   arginase family protein pa3175 TR:Q9HZ59 (EMBL:AE004741)
FT                   (311 aa) fasta scores: E(): 4.8e-47, 51.66% id in 300 aa"
FT                   /db_xref="PSEUDO:CAE42141.1"
FT   variation       211454..211463
FT                   /note="(GCGGC)2 in pertussis relative; (GCGGC)3 in
FT                   bronchiseptica"
FT   misc_feature    211549..211788
FT                   /note="HMMPfam hit to PF00491, Arginase family"
FT   misc_feature    211636..211677
FT                   /note="ScanRegExp hit to PS00147, Arginase family signature
FT                   1."
FT   misc_feature    211723..211749
FT                   /note="ScanRegExp hit to PS00148, Arginase family signature
FT                   2."
FT   misc_feature    211993..212154
FT                   /note="HMMPfam hit to PF00491, Arginase family"
FT   misc_feature    212002..212067
FT                   /note="ScanRegExp hit to PS01053, Arginase family signature
FT                   3."
FT   CDS_pept        212425..213714
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /gene_synonym="gdh"
FT                   /locus_tag="BP1857"
FT                   /product="glutamate dehydrogenase"
FT                   /EC_number="1.4.1.3"
FT                   /note="Similar to Thermotoga maritima glutamate
FT                   dehydrogenase GdhA or Gdh or Tm1015 SW:DHE3_THEMA (P96110)
FT                   (415 aa) fasta scores: E(): 2.3e-86, 55.17% id in 406 aa,
FT                   and to Deinococcus radiodurans glutamate dehydrogenase,
FT                   putative Dr0980 TR:Q9RVP5 (EMBL:AE001950) (392 aa) fasta
FT                   scores: E(): 3.4e-85, 67.08% id in 322 aa"
FT                   /db_xref="GOA:Q7VXC5"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXC5"
FT                   /protein_id="CAE42142.1"
FT                   /translation="MSQAPAHSLPSYLDAEHLGPWGIYLQQVDRVTPYLGPLARWVETL
FT                   KRPKRALIVDVPIEMDNGSIAHFEGYRVQHNTSRGPGKGGVRFHQDVTLSEVMALAAWM
FT                   SIKNAAVNLPYGGAKGGVRVDPRTLSHSELERMTRRYTSEIGVIIGPSKDIPAPDVNTN
FT                   AQTMAWMMDTYSMNEGATATGVVTGKPIALGGSLGRVEATGRGVFVVGCEAARDLNLDV
FT                   SKARIVVQGFGNVGGTAARLFHEAGAKVIAVQDHTGTIHNDGGLDVHKLLAHVGNQGGV
FT                   AGFTGAQQLADDDFWGLETDFLIPAALEGQINENNAARVRAKVVVEGANGPTTPEADDI
FT                   LRENGVYVVPDVLANAGGVTVSYFEWVQDFSSFFWSEEEINQRLERLMREAYSAVSQVA
FT                   KEHKVTLRTAAFIVACTRILQARQVRGLYP"
FT   misc_feature    212761..212802
FT                   /note="ScanRegExp hit to PS00074, Glu / Leu / Phe / Val
FT                   dehydrogenases active site. Confirmed by InterPro eMOTIF
FT                   pattern match."
FT   misc_feature    213004..213702
FT                   /note="HMMPfam hit to PF00208,
FT                   Glutamate/Leucine/Phenylalanine/Valine dehydrogenase"
FT   misc_feature    213313..213354
FT                   /note="ScanRegExp hit to PS01039, Bacterial extracellular
FT                   solute-binding proteins, family 3 signature."
FT   CDS_pept        complement(join(213790..213936,213935..215275))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="aldH"
FT                   /locus_tag="BP1858"
FT                   /product="probable aldehyde dehydrogenase (Pseudogene)"
FT                   /EC_number="1.2.1.3"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 447. The sequence has been checked
FT                   and believed to be correct. Similar to Escherichia coli
FT                   putative aldehyde dehydrogenase AldH or B1300 SW:DHAL_ECOLI
FT                   (P23883) (495 aa) fasta scores: E(): 5.4e-98, 53.92% id in
FT                   497 aa, and to Pseudomonas aeruginosa probable aldehyde
FT                   dehydrogenase Pa0219 TR:Q9I6R9 (EMBL:AE004460) (496 aa)
FT                   fasta scores: E(): 1.7e-109, 60.61% id in 490 aa"
FT                   /db_xref="PSEUDO:CAE42143.1"
FT   misc_feature    complement(join(213801..213942,213935..215197))
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
FT                   family"
FT   variation       complement(213935..213937)
FT                   /note="11 bp deletion in pertussis, relative to
FT                   parapertussis, following this codon"
FT   misc_feature    complement(214358..214393)
FT                   /note="ScanRegExp hit to PS00070, Aldehyde dehydrogenases
FT                   cysteine active site."
FT   misc_feature    complement(214457..214480)
FT                   /note="ScanRegExp hit to PS00687, Aldehyde dehydrogenases
FT                   glutamic acid active site."
FT   CDS_pept        complement(215325..216572)
FT                   /transl_table=11
FT                   /gene="amaB"
FT                   /locus_tag="BP1859"
FT                   /product="N-carbamoyl-L-amino acid amidohydrolase"
FT                   /EC_number="3.5.1.-"
FT                   /note="Similar to Bacillus stearothermophilus
FT                   N-carbamoyl-L-amino acid amidohydrolase AmaB SW:AMB2_BACST
FT                   (Q53389) (409 aa) fasta scores: E(): 6.5e-52, 41.08% id in
FT                   404 aa, and to Pseudomonas aeruginosa
FT                   N-carbamoyl-beta-alanine amidohydrolase Pa0444 TR:Q9I673
FT                   (EMBL:AE004481) (427 aa) fasta scores: E(): 2.8e-98, 61.97%
FT                   id in 405 aa. Also similar to BP2301,70.120% identity
FT                   (70.803% ungapped) in 415 aa overlap."
FT                   /db_xref="GOA:Q7VXC4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXC4"
FT                   /protein_id="CAE42144.1"
FT                   /translation="MSNNSPISIDGQRLWQSLMDLARIGATPKGGNCRLALTALDGQGR
FT                   DLVTGWMRDAGLTVRVDQVGNIFARRAGRDPSRAPVMTGSHIDTQPTGGKFDGCYGVLA
FT                   GLEVMRTLDDHGVQTDAPLEVAIWTNEEGSRFLPVMMGSGVFAGKFPLETALTARDAEG
FT                   KSVADELRAIGYAGADPVGGRAVDAYFEAHIEQGPILEHEDRIVGVVTGSLGVRWYDVV
FT                   VQGMEMHAGPTPMPIRKDALYAASHLLQAVVEIANAHQPHGRDTVGEIHAYPGSRNVIP
FT                   GQVRFTVDLRHEDEATLATMDALWRQACADTAARHAVSVQCEQVQYFAPTPFHPDLVGK
FT                   VRDGAQRRGLPAMDIVTGAGHDAVYMAAVAPTAMIFVPCKDGISHNEIEDAQPAHLEAG
FT                   CNVLLDAMVARANAPR"
FT   misc_feature    complement(215490..216026)
FT                   /note="HMMPfam hit to PF01546, Peptidase family
FT                   M20/M25/M40"
FT   misc_feature    complement(216078..216101)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    complement(216294..216383)
FT                   /note="HMMPfam hit to PF01546, Peptidase family
FT                   M20/M25/M40"
FT   CDS_pept        complement(216582..218291)
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="BP1860"
FT                   /product="acetolactate synthase large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="Similar to Escherichia coli acetolactate synthase
FT                   isozyme II large subunit IlvG or B3767 SW:ILVG_ECOLI
FT                   (P00892) (548 aa) fasta scores: E(): 3.7e-41, 28.54% id in
FT                   522 aa, and to Rhizobium loti acetolactate synthase large
FT                   subunit Mlr1615 TR:Q98K66 (EMBL:AP002997) (549 aa) fasta
FT                   scores: E(): 4e-111, 51.8% id in 554 aa"
FT                   /db_xref="GOA:Q7VXC3"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXC3"
FT                   /protein_id="CAE42145.1"
FT                   /translation="MTTPALPERNGGQILMQQLRVHGARRVFMIPGESYLPCIDALNEH
FT                   RGAIDAIVCRQESGAAYMAEAYGKLTGEPGICFVTRGPGATNASIGVHTAYQDSTPMIL
FT                   FIGQVGNDFMEREAFQEIDYRRMFGQMAKWVAQIDRTERIPEFIARAFAVATSGRPGPV
FT                   VLALPEDTLWGRARVADMPRYRRARCLPGAADLARMVELLDQAKRPFMLLGGTGWSAEA
FT                   IGQAAAFAERFELPVGTAWRRLECFDQRHPNAAGHVGWAMAPELRQRIAGADLVLAVGT
FT                   RMGEATTEGYTVIESPLPRQRLVHVYPDPNELGRVFAPTLGIVADPAGFAAALDALRPG
FT                   HRASRAQAVRAAHDEYLATLAPLPSPGPLNLDSAAAYVNQHIPADACITVGAGNYALYP
FT                   HRYRQFSGPGTSLAPTVGAMGYGLPAAISAKLENPARTVVCYAGDGCFQMNMQELGVAL
FT                   QYRVGVVVLVFNNGIWGTIRAHQEREFPGRAIALDFQNPDFTQFVRAYGGYGEAVERTE
FT                   DFGPAFERARAFAEREQLPALLEIRYEADGIAPGQTLTEIRQAAQAQAAGVQ"
FT   misc_feature    complement(216669..218237)
FT                   /note="HMMPfam hit to PF00205, Thiamine pyrophosphate
FT                   enzyme, central domain"
FT   CDS_pept        complement(218288..219226)
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="BP1861"
FT                   /product="citrate lyase beta chain"
FT                   /EC_number="4.1.3.6"
FT                   /note="Similar to Escherichia coli citrate lyase beta chain
FT                   CitE or B0616 SW:CILB_ECOLI (P77770) (302 aa) fasta scores:
FT                   E(): 4.8e-19, 31.48% id in 289 aa, and to Salmonella
FT                   enteritidis CitE TR:AAK97548 (EMBL:AF376036) (280 aa) fasta
FT                   scores: E(): 3.7e-18, 30.96% id in 281 aa"
FT                   /db_xref="GOA:Q7VXC2"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXC2"
FT                   /protein_id="CAE42146.1"
FT                   /translation="MTPISNPGGQRRPASLRRSWMFVPGLLEQAQAAGLASGADALVAD
FT                   LEEFTAPADRPAARRRIVALLAQCRAAGVIGAVRINKLEEDGLDDLRGIMAGAPDAIFL
FT                   PHAESAAQIAALDRAISACEAEAGLAPGSTEIVPTLESALGVTRACEILTASPRVSACL
FT                   LAAEDLTASLGAERGPDGIELHALRARFLVDCVAAGCLPIDCPFNYRDPAAQQADLLWA
FT                   RRIGLKSKCAVFAEQVPAIHAAFTPDADRVAAARDLAARFEAQRDGRDAGGARVDPPDY
FT                   NTARRLLARHAEFEQWAARAARPRESQGEQS"
FT   CDS_pept        complement(219223..220506)
FT                   /transl_table=11
FT                   /locus_tag="BP1862"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Rhizobium meliloti putative
FT                   C4-dicarboxylate transport system, permease large protein
FT                   transmembrane Smb21436 TR:CAC49665 (EMBL:AL603646) (426 aa)
FT                   fasta scores: E(): 1.5e-80, 54.97% id in 422 aa, and to
FT                   Caulobacter crescentus DedA family protein Cc1448 TR:Q9A8A6
FT                   (EMBL:AE005819) (426 aa) fasta scores: E(): 8.7e-55, 39.37%
FT                   id in 419 aa"
FT                   /db_xref="GOA:Q7VXC1"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXC1"
FT                   /protein_id="CAE42147.1"
FT                   /translation="MSTGALFLMGVFTVTVLIDMPIAFGLVLACLAYLAVYDAAPMMVA
FT                   AQQYVVGLDSFTLLAIPLFILAAQLMNGAGLTQRIVRLCAAIVGDIKGGLAVVAVLACL
FT                   MFGALSGSGVADVIAIGSLLLPAMARSGYDKGFSCALIGSAGATSTIIPPSIVLIVYGT
FT                   ITDTSVGKLFLAGIIPGILLGASLIVVAIWQARKHNWAGGQPFSWGELRAAAIDALPAL
FT                   MVPVLIIGGIRFGIFTATEAASSAIVYALLVGFFWYRTLSLKSLWESLKSTGEGSASIL
FT                   LLIGASGLFAWVLVAEQVPQALSGLLVDWTDSKIAVLLVLTVVLLLLGTFMEAIPVIII
FT                   VAPVVMPVLAHYNIDPVHFGILLSINMAIGANTPPVGVDLMAACKIGGINMMQTLRPLS
FT                   WMMLAMTAVMLLLTFVPELVLFLPRHVQ"
FT   misc_feature    complement(join(219247..219312,219373..219438,
FT                   219469..219561,219622..219678,219724..219780,
FT                   219796..219861,219922..219987,220024..220089,
FT                   220120..220176,220183..220248,220294..220359,
FT                   220396..220461))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BP1862 by TMHMM2.0 at aa 15-37, 49-71, 86-108, 110-129,
FT                   139-161, 173-195, 215-237, 242-261, 276-295, 315-346,
FT                   356-378 and 398-420"
FT   misc_feature    complement(219631..220107)
FT                   /note="HMMPfam hit to PF00597, DedA family"
FT   misc_feature    complement(220420..220506)
FT                   /note="Signal peptide predicted for BP1862 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.782) with cleavage site
FT                   probability 0.234 between residues 29 and 30"
FT   CDS_pept        complement(220510..220992)
FT                   /transl_table=11
FT                   /locus_tag="BP1863"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Rhizobium meliloti putative
FT                   C4-dicarboxylate transport system, permease small protein
FT                   transmembrane Smb21437 TR:CAC49666 (EMBL:AL603646) (186 aa)
FT                   fasta scores: E(): 1.7e-15, 40.13% id in 147 aa, and to
FT                   Agrobacterium tumefaciens strC58 Agr_l_3346p TR:AAK90250
FT                   (EMBL:AE008369) (183 aa) fasta scores: E(): 1.8e-05, 27.04%
FT                   id in 159 aa"
FT                   /db_xref="GOA:Q7VXC0"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXC0"
FT                   /protein_id="CAE42148.1"
FT                   /translation="MLGRISHALSGLSKAIAALAVALLAALITYVVFERFVMHTTPHWA
FT                   EELPRLVLVWAAFIGGVTCSHERTHLMAGLLPFVVRNPRALAISDRVNQALIIVGLAAL
FT                   GYAGWQLAELTMDQTLPALDVSAGTVYLALPAACAITIVVHLAQLFQPADPVAAKD"
FT   misc_feature    complement(join(220546..220611,220657..220707,
FT                   220894..220947))
FT                   /note="3 probable transmembrane helices predicted for
FT                   BP1863 by TMHMM2.0 at aa 15-33, 95-112 and 127-149"
FT   misc_feature    complement(220918..220992)
FT                   /note="Signal peptide predicted for BP1863 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.973) with cleavage site
FT                   probability 0.895 between residues 25 and 26"
FT   CDS_pept        complement(220993..221979)
FT                   /transl_table=11
FT                   /locus_tag="BP1864"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti putative
FT                   C4-dicarboxylate transport system, C4-dicarboxylate-binding
FT                   protein precursor signal peptide Smb21438 TR:Q926B4
FT                   (EMBL:AL603646) (332 aa) fasta scores: E(): 1.1e-71, 56.44%
FT                   id in 326 aa, and to Pasteurella multocida hypothetical
FT                   protein Pm1252 TR:Q9CLH9 (EMBL:AE006164) (328 aa) fasta
FT                   scores: E(): 6.7e-35, 33.75% id in 320 aa"
FT                   /db_xref="GOA:Q7VXB9"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXB9"
FT                   /protein_id="CAE42149.1"
FT                   /translation="MQLTRTLTSLFAAAGLALAVAPAAHALDIKLGHVLAPSHSWNKAA
FT                   EGFAAEVKEKTAGRVNLILFPSGQLGNEKTMLEGLQIGSQGAAIIGSGSLQPIEPKFGI
FT                   VELPYTWTTSQQAYKAYDGELGAALAKLAEKKNLVIVSWWENGFRHLTNNRGPVNTPAD
FT                   LNGLKTRVTPDKMRLDTFTALGANPAPLAFGELYSALQQKVFDAQENPLSIIYTSSFFE
FT                   VQKYLSLTGHVWGPASLIVSKPIWNRISADDRKIVQAAADKWRDAQRQMITEGDLQFVA
FT                   QLKEKGMQVNEVDKAPFAAAVAPIWKTYETAYGPELMGLLQKYREAK"
FT   misc_feature    complement(221902..221979)
FT                   /note="Signal peptide predicted for BP1863 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 26 and 27"
FT   CDS_pept        complement(222152..222871)
FT                   /transl_table=11
FT                   /locus_tag="BP1865"
FT                   /product="GntR-family transcriptional regulator"
FT                   /note="Similar to Erwinia chrysanthemi exu regulon
FT                   transcriptional regulator ExuR SW:EXUR_ERWCH (Q9X9E0) (259
FT                   aa) fasta scores: E(): 1.5e-19, 34.57% id in 214 aa, and to
FT                   Rhizobium meliloti putative transcriptional regulator
FT                   protein Smb20441 TR:CAC48823 (EMBL:AL603643) (246 aa) fasta
FT                   scores: E(): 3.4e-23, 40% id in 235 aa"
FT                   /db_xref="GOA:Q7VXB8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXB8"
FT                   /protein_id="CAE42150.1"
FT                   /translation="MGSFQAVAPTRLYRMIADQIAGRIRAGDFPAGGRLPAERELAEQL
FT                   QVSRASVREALIALEIEGYVEVRVGTGVFVAAPRADGDYGVAPAPQPGHTDIGPFDLLD
FT                   TRLLLEPECASLAAQKASPAQIAAISSAHAAMSLSDSPGAHDQAFHGAIAAACGNAALA
FT                   AAISHIWHLSATSPVFSRLEQHFVTTKVWEAAEREHERILAAIVDRDPIRARHAMHDHL
FT                   VGILARLREDFGSGAIR"
FT   misc_feature    complement(222647..222826)
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family"
FT   misc_feature    complement(222695..222769)
FT                   /note="ScanRegExp hit to PS00043, Bacterial regulatory
FT                   proteins, gntR family signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   CDS_pept        complement(222988..223938)
FT                   /transl_table=11
FT                   /locus_tag="BP1866"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q79H25"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q79H25"
FT                   /protein_id="CAE42151.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT"
FT   repeat_region   222988..223019
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   complement(222988..224040)
FT   misc_feature    complement(223024..223557)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   misc_feature    complement(223615..223680)
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   repeat_region   complement(224009..224040)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        complement(join(224037..224051,224057..224425))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1867"
FT                   /product="conserved hypothetical protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 123. The frameshift occurs within
FT                   a polymeric tract of (CGCGG)3. The sequence has been
FT                   checked and believed to be correct. Similar to Rhizobium
FT                   loti Mll7394 protein TR:Q986E6 (EMBL:AP003011) (120 aa)
FT                   fasta scores: E(): 1.1e-17, 52.63% id in 114 aa, and to
FT                   Streptomyces coelicolor hypothetical 13.8 kDa protein
FT                   Sc2h2.18 TR:Q9F3D7 (EMBL:AL450289) (119 aa) fasta scores:
FT                   E(): 4.2e-16, 43.1% id in 116 aa"
FT                   /db_xref="PSEUDO:CAE42152.1"
FT   variation       complement(224042..224056)
FT                   /note="(CGCGG)3 in pertussis; (CGCGG)2 in parapertussis and
FT                   bronchiseptica"
FT   CDS_pept        224480..224695
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1868"
FT                   /product="putative cytochrome (Pseudogene)"
FT                   /note="Pseudogene. This CDS is disrupted by the insertion
FT                   of IS481 element. The stop codon for this CDS is encoded
FT                   within the IS481 element. Similar to Thiobacillus novellus
FT                   C-type cytochrome SoxD precursor SoxD TR:Q9LAH4
FT                   (EMBL:AF139113) (84 aa) fasta scores: E(): 0.54, 35.55% id
FT                   in 45 aa, and to Synechococcus sp CytM TR:Q9Z3G2
FT                   (EMBL:U39811) (145 aa) fasta scores: E(): 0.014, 39.06% id
FT                   in 64 aa"
FT   misc_feature    224642..224659
FT                   /note="ScanRegExp hit to PS00190, Cytochrome c family
FT                   heme-binding site signature."
FT   repeat_region   224708..225107
FT   CDS_pept        <224712..225107
FT                   /transl_table=11
FT                   /locus_tag="BP1869"
FT                   /product="transposase (partial)"
FT                   /note="Partial CDS (truncated at the N-terminal region).
FT                   transposase for IS481 element"
FT                   /db_xref="GOA:Q7VXB7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXB7"
FT                   /protein_id="CAE42154.1"
FT                   /translation="PDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAAL
FT                   CHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWH
FT                   RPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   misc_feature    224760..225071
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(225076..225107)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        join(225110..225289,225293..226321)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1870"
FT                   /product="putative membrane protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS seems to be disrupted by the
FT                   insertion of IS481 element, and contains an in-frame stop
FT                   codon. The sequence has been checked and believed to be
FT                   correct. Similar to Agrobacterium tumefaciens putative
FT                   transmembrane protein DctM TR:Q9F7C8 (EMBL:AF282677) (416
FT                   aa) fasta scores: E(): 5.9e-53, 42.06% id in 378 aa, and to
FT                   Rhizobium meliloti hypothetical protein Sma0151 TR:Q930W3
FT                   (EMBL:AE007202) (866 aa) fasta scores: E(): 3.5e-42, 36.48%
FT                   id in 370 aa"
FT                   /db_xref="PSEUDO:CAE42155.1"
FT   misc_feature    225194..225262
FT                   /note="1 probable transmembrane helix predicted for BP1870
FT                   by TMHMM2.0 at aa 29-51"
FT   variation       225290..225292
FT                   /note="In-frame TAG stop codon in pertrussis; TGG in
FT                   parapertussis and bronchiseptica"
FT   misc_feature    join(225344..225403,225440..225508,225551..225619,
FT                   225680..225748,225761..225817,225854..225922,
FT                   225950..226018,226037..226096,226109..226177,
FT                   226214..226282)
FT                   /note="10 probable transmembrane helices predicted for
FT                   BP1871 by TMHMM2.0 at aa 10-29, 42-64, 79-101, 122-144,
FT                   149-167, 180-202, 212-234, 241-260, 265-287 and 300-322"
FT   misc_feature    225440..225907
FT                   /note="HMMPfam hit to PF00597, DedA family"
FT   CDS_pept        join(226344..226589,226593..227063)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1871"
FT                   /product="hypothetical protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS contains an in-frame TAG stop
FT                   codon. The sequence has been checked and believed to be
FT                   correct. No significant database matches"
FT                   /db_xref="PSEUDO:CAE42156.1"
FT   variation       226590..226592
FT                   /note="In-frame TAG stop codon in pertussis; CAG in
FT                   parapertussis and bronchiseptica"
FT   CDS_pept        227124..228473
FT                   /transl_table=11
FT                   /locus_tag="BP1874"
FT                   /product="putative amidase"
FT                   /note="Similar to Rhizobium meliloti putative amidase
FT                   protein Smc03245 TR:CAC47672 (EMBL:AL591792) (435 aa) fasta
FT                   scores: E(): 1.1e-55, 44.98% id in 429 aa, and to
FT                   Agrobacterium tumefaciens StrC58 Agr_l_3143p TR:AAK90146
FT                   (EMBL:AE008359) (403 aa) fasta scores: E(): 2.7e-54, 45.88%
FT                   id in 401 aa"
FT                   /db_xref="GOA:Q7VXB6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXB6"
FT                   /protein_id="CAE42157.1"
FT                   /translation="MLPTLKQQSLALQEGRDTSSGLTQAALARAADPAGEGARVFTRVY
FT                   AEQARAEARAADALRAAGVTRSAIDGLPISIKDLFDVAGETTMAGSVARQGEPAAVRDA
FT                   VVVRRLRAAGAVIVGRTNMTEFAYSGLGLNPHYGTPRNPWDRATGRIPGGSSSGAAVSV
FT                   TDGMASGAIGSDTGGSVRIPAALCGLAGFKPSAQRVSMQGVLPLSANLDSIGPLAPSVR
FT                   CCATLDAILAGGDDADMPAPAALRGLRLAVPTTLALDGLDAHVSATFAATLAKLAEAGA
FT                   CIDEIAVPEFAQLADINSKGGFTAAEAWAWHRDLIERAADRYDPRVVARIRRGADMSAA
FT                   DYIDLLAARQAWRAGVEARIAGYDALVLPTVPVVAPAIADLEASDALFGSTNLLILRNP
FT                   TLINFLDGSALSLPCHEAGTAPVGLMVAAANGSDRRVLAIGMAIEDLLGG"
FT   misc_feature    227184..228434
FT                   /note="HMMPfam hit to PF01425, Amidase"
FT   CDS_pept        228531..229325
FT                   /transl_table=11
FT                   /locus_tag="BP1875"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa2116 TR:Q9I1Z9 (EMBL:AE004639) (265 aa) fasta
FT                   scores: E(): 3e-59, 63.11% id in 244 aa, and to Bacillus
FT                   subtilis hypothetical 28.1 kDa protein in sipU-kipI
FT                   intergenic region YcsI SW:YCSI_BACSU (P42966) (257 aa)
FT                   fasta scores: E(): 1.7e-57, 56.8% id in 257 aa"
FT                   /db_xref="GOA:Q7VXB5"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXB5"
FT                   /protein_id="CAE42158.1"
FT                   /translation="MTILSLAGAGHQARLDARGGMLTGPTANLAPGHVQANLAILPQAV
FT                   AGDFLRFCQRNPKPCPLLAVSEPGDPSLPELGLDIDIRTDVPRYRVWRDGKLVDEPLDV
FT                   RGLWRDDLVAFLIGCSFSFEEAMLENGLPVRHIEQGCNVPMYRTNIATHPAGPFSGPLV
FT                   VSMRPLKAADAIRAIQVTSRFPSVHGAPVHLGDPALIGIADLGRPDYGDAVEIRAGEIP
FT                   VFWACGVTPQSVVAAVRPEFCITHAPGHMLVTDLLNSRLAAF"
FT   CDS_pept        229459..230334
FT                   /transl_table=11
FT                   /gene="bvgR"
FT                   /locus_tag="BP1876"
FT                   /product="regulatory protein BvgR"
FT                   /note="Previously sequenced as Bordetella pertussis BvgR
FT                   TR:O85677 (EMBL:AF071567) (291 aa) fasta scores: E():
FT                   5.1e-121, 100% id in 291 aa"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q79GT7"
FT                   /protein_id="CAE42159.1"
FT                   /translation="MIHWTNSARSSFEASLSPSRRTLRARLAPVEGPTVAELRAALKRD
FT                   EFIPAFQPVVDAGTGSLFGVATTIQWAHRHWGLVPEHCYMAALVRDNLHIALAQQLLAQ
FT                   VFDLAAAMRRGNRHVGLFIQPEPICLMSRSYSDDVLRNLDHRGLPPFALTLAVSPSLLQ
FT                   SPYGQQSLHSLRRLHRAGCNLVLTVSTFDAESPPHLDALEICGIALMPELMYALRQGGR
FT                   AGEACRAIAQQASAQRIPVMAAGVVDEAMAQAADLLPCRYLLGDHVAPPMTGQRFLYWY
FT                   YRREMPPNYP"
FT   CDS_pept        complement(230378..234094)
FT                   /transl_table=11
FT                   /gene="bvgS"
FT                   /locus_tag="BP1877"
FT                   /product="virulence sensor protein"
FT                   /note="Previously sequenced as Bordetella pertussis
FT                   virulence sensor protein BvgS precursor bvgS SW:BVGS_BORPE
FT                   (P16575) (1238 aa) fasta scores: E(): 0, 99.83% id in 1238
FT                   aa"
FT                   /db_xref="GOA:P16575"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="PDB:3MPK"
FT                   /db_xref="PDB:3MPL"
FT                   /db_xref="PDB:4Q0C"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16575"
FT                   /protein_id="CAE42160.1"
FT                   /translation="MPAPHRLYPRSLICLAQALLAWALLAWAPAQASQELTLVGKAAVP
FT                   DVEVALDGDDWRWLARKRVLTLGVYAPDIPPFDVTYGERYEGLTADYMAIIAHNLGMQA
FT                   KVLRYPTREQALSALESGQIDLIGTVNGTDGRQQSLRLSVPYAADHPVIVMPIGARHVP
FT                   ASNLAGQRLAVDINYLPKETLARAYPQATLHYFPSSEQALAAVAYGQADVFIGDALTTS
FT                   HLVSQSYFNDVRVVAPAHIATGGESFGVRADNTRLLRVVNAVLEAIPPSEHRSLIYRWG
FT                   LGSSISLDFAHPAYSAREQQWMADHPVVKVAVLNLFAPFTLFRTDEQFGGISAAVLQLL
FT                   QLRTGLDFEIIGVDTVEELIAKLRSGEADMAGALFVNSARESFLSFSRPYVRNGMVIVT
FT                   RQDPDAPVDADHLDGRTVALVRNSAAIPLLQRRYPQAKVVTADNPSEAMLMVANGQADA
FT                   VVQTQISASYYVNRYFAGKLRIASALDLPPAEIALATTRGQTELMSILNKALYSISNDE
FT                   LASIISRWRGSDGDPRTWYAYRNEIYLLIGLGLLSALLFLSWIVYLRRQIRQRKRAERA
FT                   LNDQLEFMRVLIDGTPNPIYVRDKEGRMLLCNDAYLDTFGVTADAVLGKTIPEANVVGD
FT                   PALAREMHEFLLTRVAAEREPRFEDRDVTLHGRTRHVYQWTIPYGDSLGELKGIIGGWI
FT                   DITERAELLRKLHDAKESADAANRAKTTFLATMSHEIRTPMNAIIGMLELALLRPTDQE
FT                   PDRQSIQVAYDSARSLLELIGDILDIAKIEAGKFDLAPVRTALRVLPEGAIRVFDGLAR
FT                   QKGIELVLKTDIVGVDDVLIDPLRMKQVLSNLVGNAIKFTTEGQVVLAVTARPDGDAAH
FT                   VQFSVSDTGCGISEADQRQLFKPFSQVGGSAEAGPAPGTGLGLSISRRLVELMGGTLVM
FT                   RSAPGVGTTVSVDLRLTMVEKSVQAAPPAAATAATPSKPQVSLRVLVVDDHKPNLMLLR
FT                   QQLDYLGQRVIAADSGEAALALWREHAFDVVITDCNMPGISGYELARRIRAAEAAPGYG
FT                   RTRCILFGFTASAQMDEAQRCRAAGMDDCLFKPIGVDALRQRLNEAVARAALPTPPSPQ
FT                   AAAPATDDATPTAFSAESILALTQNDEALIRQLLEEVIRTNRADVDQLQKLHQQADWPK
FT                   VSDMAHRLAGGARVVDAKAMIDTVLALEKKAQGQAGPSPEIDGLVRTLAAQSAALETQL
FT                   RAWLEQRPHQDQP"
FT   misc_feature    complement(230822..231178)
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain"
FT   misc_feature    complement(231251..231601)
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, phytochrome-like ATPase"
FT   misc_feature    complement(231740..231940)
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain"
FT   misc_feature    complement(232157..232351)
FT                   /note="HMMPfam hit to PF00989, PAS domain"
FT   misc_feature    complement(232217..232240)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    complement(232406..232471)
FT                   /note="1 probable transmembrane helix predicted for BP1877
FT                   by TMHMM2.0 at aa 541-563"
FT   misc_feature    complement(232511..233170)
FT                   /note="HMMPfam hit to PF00497, Bacterial extracellular
FT                   solute-binding proteins, family 3"
FT   misc_feature    complement(233999..234094)
FT                   /note="Signal peptide predicted for BP1877 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.996) with cleavage site
FT                   probability 0.816 between residues 32 and 33"
FT   CDS_pept        complement(234103..234732)
FT                   /transl_table=11
FT                   /gene="bvgA"
FT                   /locus_tag="BP1878"
FT                   /product="virulence factors transcription regulator"
FT                   /note="Previously sequenced as Bordetella pertussis
FT                   virulence factors putative positive transcription regulator
FT                   BvgA bvgA SW:BVGA_BORPE (P16574) (209 aa) fasta scores:
FT                   E(): 3e-77, 100% id in 209 aa"
FT                   /db_xref="GOA:P0A4H2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A4H2"
FT                   /protein_id="CAE42161.1"
FT                   /translation="MYNKVLIIDDHPVLRFAVRVLMEKEGFEVIGETDNGIDGLKIARE
FT                   KIPNLVVLDIGIPKLDGLEVIARLQSLGLPLRVLVLTGQPPSLFARRCLNSGAAGFVCK
FT                   HENLHEVINAAKAVMAGYTYFPSTTLSEMRMGDNAKSDSTLISVLSNRELTVLQLLAQG
FT                   MSNKDIADSMFLSNKTVSTYKTRLLQKLNATSLVELIDLAKRNNLA"
FT   misc_feature    complement(234106..234297)
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR family"
FT   misc_feature    complement(234163..234246)
FT                   /note="ScanRegExp hit to PS00622, Bacterial regulatory
FT                   proteins, luxR family signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   misc_feature    complement(234178..234243)
FT                   /note="Predicted helix-turn-helix motif with score 1131
FT                   (+3.04 SD) at aa 164-185, sequence MSNKDIADSMFLSNKTVSTYKT"
FT   misc_feature    complement(234388..234726)
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain"
FT   CDS_pept        235159..245931
FT                   /transl_table=11
FT                   /gene="fhaB"
FT                   /locus_tag="BP1879"
FT                   /product="filamentous hemagglutinin/adhesin"
FT                   /note="Previously sequenced as Bordetella pertussis
FT                   filamentous hemagglutinin FhaB or BP1879 SW:FHAB_BORPE
FT                   (P12255) (3591 aa) fasta scores: E(): 0, 99.91% id in 3573
FT                   aa. Also similar to Bordetella bronchiseptica adhesin FhaB
FT                   TR:Q9JP78 (EMBL:AF111796) (3634 aa) fasta scores: E(): 0,
FT                   92.38% id in 3639 aa. The product of this CDS is also
FT                   similar to B. pertussis BP2667 E(): 9.8e-120 37.940%
FT                   identity in 2670 aa and BP2907 fasta scores: E(): 9e-125,
FT                   33.52% id in 2750 aa."
FT                   /db_xref="GOA:P12255"
FT                   /db_xref="InterPro:IPR008619"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="PDB:1RWR"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12255"
FT                   /protein_id="CAE42162.1"
FT                   /translation="MNTNLYRLVFSHVRGMLVPVSEHCTVGNTFCGRTRGQARSGARAT
FT                   SLSVAPNALAWALMLACTGLPLVTHAQGLVPQGQTQVLQGGNKVPVVNIADPNSGGVSH
FT                   NKFQQFNVANPGVVFNNGLTDGVSRIGGALTKNPNLTRQASAILAEVTDTSPSRLAGTL
FT                   EVYGKGADLIIANPNGISVNGLSTLNASNLTLTTGRPSVNGGRIGLDVQQGTVTIERGG
FT                   VNATGLGYFDVVARLVKLQGAVSSKQGKPLADIAVVAGANRYDHATRRATPIAAGARGA
FT                   AAGAYAIDGTAAGAMYGKHITLVSSDSGLGVRQLGSLSSPSAITVSSQGEIALGDATVQ
FT                   RGPLSLKGAGVVSAGKLASGGGAVNVAGGGAVKIASASSVGNLAVQGGGKVQATLLNAG
FT                   GTLLVSGRQAVQLGAASSRQALSVNAGGALKADKLSATRRVDVDGKQAVALGSASSNAL
FT                   SVRAGGALKAGKLSATGRLDVDGKQAVTLGSVASDGALSVSAGGNLRAKQLVSSAQLEV
FT                   RGQREVALDDASSARGMTVVAAGALAARNLQSKGAIGVQGGEAVSVANANSDAELRVRG
FT                   RGQVDLHDLSAARGADISGEGRVNIGRARSDSDVKVSAHGALSIDSMTALGAIGVQAGG
FT                   SVSAKDMRSRGAVTVSGGGAVNLGDVQSDGQVRATSAGAMTVRDVAAAADLALQAGDAL
FT                   QAGFLKSAGAMTVNGRDAVRLDGAHAGGQLRVSSDGQAALGSLAAKGELTVSAARAATV
FT                   AELKSLDNISVTGGERVSVQSVNSASRVAISAHGALDVGKVSAKSGIGLEGWGAVGADS
FT                   LGSDGAISVSGRDAVRVDQARSLADISLGAEGGATLGAVEAAGSIDVRGGSTVAANSLH
FT                   ANRDVRVSGKDAVRVTAATSGGGLHVSSGRQLDLGAVQARGALALDGGAGVALQSAKAS
FT                   GTLHVQGGEHLDLGTLAAVGAVDVNGTGDVRVAKLVSDAGADLQAGRSMTLGIVDTTGD
FT                   LQARAQQKLELGSVKSDGGLQAAAGGALSLAAAEVAGALELSGQGVTVDRASASRARID
FT                   STGSVGIGALKAGAVEAASPRRARRALRQDFFTPGSVVVRAQGNVTVGRGDPHQGVLAQ
FT                   GDIIMDAKGGTLLLRNDALTENGTVTISADSAVLEHSTIESKISQSVLAAKGDKGKPAV
FT                   SVKVAKKLFLNGTLRAVNDNNETMSGRQIDVVDGRPQITDAVTGEARKDESVVSDAALV
FT                   ADGGPIVVEAGELVSHAGGIGNGRNKENGASVTVRTTGNLVNKGYISAGKQGVLEVGGA
FT                   LTNEFLVGSDGTQRIEAQRIENRGTFQSQAPAGTAGALVVKAAEAIVHDGVMATKGEMQ
FT                   IAGKGGGSPTVTAGAKATTSANKLSVDVASWDNAGSLDIKKGGAQVTVAGRYAEHGEVS
FT                   IQGDYTVSADAIALAAQVTQRGGAANLTSRHDTRFSNKIRLMGPLQVNAGGAVSNTGNL
FT                   KVREGVTVTAASFDNETGAEVMAKSATLTTSGAARNAGKMQVKEAATIVAASVSNPGTF
FT                   TAGKDITVTSRGGFDNEGKMESNKDIVIKTEQFSNGRVLDAKHDLTVTASGQADNRGSL
FT                   KAGHDFTVQAQRIDNSGTMAAGHDATLKAPHLRNTGQVVAGHDIHIINSAKLENTGRVD
FT                   ARNDIALDVADFTNTGSLYAEHDATLTLAQGTQRDLVVDQDHILPVAEGTLRVKAKSLT
FT                   TEIETGNPGSLIAEVQENIDNKQAIVVGKDLTLSSAHGNVANEANALLWAAGELTVKAQ
FT                   NITNKRAALIEAGGNARLTAAVALLNKLGRIRAGEDMHLDAPRIENTAKLSGEVQRKGV
FT                   QDVGGGEHGRWSGIGYVNYWLRAGNGKKAGTIAAPWYGGDLTAEQSLIEVGKDLYLNAG
FT                   ARKDEHRHLLNEGVIQAGGHGHIGGDVDNRSVVRTVSAMEYFKTPLPVSLTALDNRAGL
FT                   SPATWNFQSTYELLDYLLDQNRYEYIWGLYPTYTEWSVNTLKNLDLGYQAKPAPTAPPM
FT                   PKAPELDLRGHTLESAEGRKIFGEYKKLQGEYEKAKMAVQAVEAYGEATRRVHDQLGQR
FT                   YGKALGGMDAETKEVDGIIQEFAADLRTVYAKQADQATIDAETDKVAQRYKSQIDAVRL
FT                   QAIQPGRVTLAKALSAALGADWRALGHSQLMQRWKDFKAGKRGAEIAFYPKEQTVLAAG
FT                   AGLTLSNGAIHNGENAAQNRGRPEGLKIGAHSATSVSGSFDALRDVGLEKRLDIDDALA
FT                   AVLVNPHIFTRIGAAQTSLADGAAGPALARQARQAPETDGMVDARGLGSADALASLASL
FT                   DAAQGLEVSGRRNAQVADAGLAGPSAVAAPAVGAADVGVEPVTGDQVDQPVVAVGLEQP
FT                   VATVRVAPPAVALPRPLFETRIKFIDQSKFYGSRYFFEQIGYKPDRAARVAGDNYFDTT
FT                   LVREQVRRALGGYESRLPVRGVALVAKLMDSAGTVGKALGLKVGVAPTAQQLKQADRDF
FT                   VWYVDTVIDGQKVLAPRLYLTEATRQGITDQYAGGGALIASGGDVTVNTDGHDVSSVNG
FT                   LIQGRSVKVDAGKGKVVVADSKGAGGGIEADDEVDVSGRDIGIEGGKLRGKDVRLKADT
FT                   VKVATSMRYDDKGRLAARGDGALDAQGGQLHIEAKRLETAGATLKGGKVKLDVDDVKLG
FT                   GVYEAGSSYENKSSTPLGSLFAILSSTTETNQSAHANHYGTRIEAGTLEGKMQNLEIEG
FT                   GSVDAAHTDLSVARDARFKAAADFAHAEHEKDVRQLSLGAKVGAGGYEAGFSLGSESGL
FT                   EAHAGRGMTAGAEVKVGYRASHEQSSETEKSYRNANLNFGGGSVEAGNVLDIGGADINR
FT                   NRYGGAAKGNAGTEEALRMRAKKVESTKYVSEQTSQSSGWSVEVASTASARSSLLTAAT
FT                   RLGDSVAQNVEDGREIRGELMAAQVAAEATQLVTADTAAVALSAGISADFDSSHSRSTS
FT                   QNTQYLGGNLSIEATEGDATLVGAKFGGGDQVSLKAAKSVNLMAAESTFESYSESHNFH
FT                   ASADANLGANAVQGAVGLGLTAGMGTSHQITNETGKTYAGTSVDAANVSIDAGKDLNLS
FT                   GSRVRGKHVVLDVEGDINATSKQDERNYNSSGGGWDASAGVAIQNRTLVAPVGSAGFNF
FT                   NTEHDNSRLTNDGAAGVVASDGLTGHVKGDANLTGATIADLSGKGNLKVDGAVNAQNLK
FT                   DYRDKDGGSGGLNVGISSTTLAPTVGVAFGRVAGEDYQAEQRATIDVGQTKDPARLQVG
FT                   GGVKGTLNQDAAQATVVQRNKHWAGGGSEFSVAGKSLKKKNQVRPVETPTPDVVDGPPS
FT                   RPTTPPASPQPIRATVEVSSPPPVSVATVEVVPRPKVETAQPLPPRPVAAQVVPVTPPK
FT                   VEVAKVEVVPRPKVETAQPLPPRPVVAEKVTTPAVQPQLAKVETVQPVKPETTKPLPKP
FT                   LPVAKVTKAPPPVVETAQPLPPVKPQKATPGPVAEVGKATVTTVQVQSAPPKPAPVAKQ
FT                   PAPAPKPKPKPKPKAERPKPGKTTPLSGRHVVQQQVQVLQRQASDINNTKSLPGGKLPK
FT                   PVTVKLTDENGKPQTYTINRREDLMKLNGKVLSTKTTLGLEQTFRLRVEDIGGKNYRVF
FT                   YETNK"
FT   CDS_pept        246001..246444
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="fimA"
FT                   /locus_tag="BP1880"
FT                   /product="fimbrial protein (pseudogene)"
FT                   /note="Previously sequenced as Bordetella pertussis FimA
FT                   protein FimA SW:FIMA_BORPE (P35076) (145 aa) fasta scores:
FT                   E(): 3.9e-53, 99.31% id in 145 aa. This CDS seems to be
FT                   truncated at the N-terminal region relative to its
FT                   homologues in B. parapertussis and B. bronchiseptica, which
FT                   removes teh signal sequence present on both of the other
FT                   proteins. Similar to BP1568 (Fim3), 47.403% identity
FT                   (51.773% ungapped) in 154 aa overlap, and to BP1119 (Fim2),
FT                   39.610% identity (42.657% ungapped) in 154 aa overlap, and
FT                   to BP2674 (FimX), 40.260% identity (43.357% ungapped) in
FT                   154 aa overlap"
FT                   /db_xref="PSEUDO:CAE42163.1"
FT   misc_feature    246010..246441
FT                   /note="HMMPfam hit to PF00419, Fimbrial protein"
FT   CDS_pept        246694..247428
FT                   /transl_table=11
FT                   /gene="fimB"
FT                   /gene_synonym="fhaD"
FT                   /locus_tag="BP1881"
FT                   /product="chaperone protein"
FT                   /note="Previously sequenced as Bordetella pertussis
FT                   chaperone protein fimb/fhad precursor fimb or fhaD
FT                   SW:FIMB_BORPE (P33409) (244 aa) fasta scores: E(): 2.6e-99,
FT                   99.59% id in 244 aa"
FT                   /db_xref="GOA:P33409"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/Swiss-Prot:P33409"
FT                   /protein_id="CAE42164.1"
FT                   /translation="MARWRRRLGVAALGAAMLASLAPAARASLVITGTRVIYNAGSPET
FT                   TVKMSNEGQAPALMQAWIDDGNAEAKPDEVQVPFFLTPPLARVDPGKGQTLRIFFNGYP
FT                   DGKTLPSDRESVFWLNVLEVPPKATPEEGHGVLQLTIRSRLKLFYRPKGLSGNPLTAAA
FT                   DLTFKRKPNGVLEVHNPTPYYVNLQKLEVGENGAHGSKTPWMLAPLSSDELRLKGTGAK
FT                   SVQYWAIDDFGGVTPYQAAIAD"
FT   misc_feature    246715..246783
FT                   /note="1 probable transmembrane helix predicted for BP1881
FT                   by TMHMM2.0 at aa 38-60"
FT   misc_feature    246793..247392
FT                   /note="HMMPfam hit to PF00345, Gram-negative pili assembly
FT                   chaperone, N-terminal domain"
FT   misc_feature    247018..247071
FT                   /note="ScanRegExp hit to PS00635, Gram-negative pili
FT                   assembly chaperone signature. Confirmed by InterPro eMOTIF
FT                   pattern match."
FT   CDS_pept        247491..250112
FT                   /transl_table=11
FT                   /gene="fimC"
FT                   /gene_synonym="fhaA"
FT                   /locus_tag="BP1882"
FT                   /product="outer membrane usher protein precursor"
FT                   /note="Previously sequenced as Bordetella pertussis outer
FT                   membrane usher protein FimC precursor FimC or fhaA
FT                   SW:FIMC_BORPE (P33410) (873 aa) fasta scores: E(): 0, 100%
FT                   id in 873 aa"
FT                   /db_xref="GOA:P33410"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/Swiss-Prot:P33410"
FT                   /protein_id="CAE42165.1"
FT                   /translation="MKQIPLILAMSLAFAAAAKGESAPDMQAAVNFDSAMLWGGANGAD
FT                   LSRFNYSNALRPGNYIVDIYANNYPLIRQQVRFVAAQTSGQGLKTAPAVACFTYGQLEA
FT                   MQVRLRALDPALVADLKSSGRCEVLGKLFPDSRESFDFGENRLEVSIPQAYTINRFRRD
FT                   ISPDEWDSGITAFRLGYQYNYADYIGGLRAGRRLDLNLYSGFNFKGWYLRNSSTLGWGQ
FT                   GRFTRRSQRTSLQTDIPSWRARLVFGDVFSSGEYFAPYSMRGMLVGSDTAMLPYSERLY
FT                   RPTIRGVARTRANVKVYQAGVLVFQDAVPPGPFAIDDYSPASYGGDLRVVVTEANGAVQ
FT                   TFTVPYASAVRLILPGQTQWSFSAGRYRNYRNDGQDRPWVTQLTGRHGVADGVNLYGGL
FT                   LIAQAYQAGLAGLSWNTPWGAMAADATLSRSQLSTTGNANGSSLRFSYSKTLSGTNTAI
FT                   RLATLRYSSSGFWNFADAVNAGPVETNGRNGRFGLYSLLGRERPRGDFSVTLSQPLGGY
FT                   GSLYVSALRRTYWGSSRVDQQTQLGYSTQVGRVGVNLDVSRTENRRSTEHQVMLNLSIP
FT                   LYGATSSGVVTGSLARTGSAPVQQSVNYSGMSGERDQYTYGLGVQRAGTSAQYALNGSW
FT                   SGTYGEVSGQLTHGRSYSQYQINGSGGLVAHAGGVTFGQYQAGTIGLIQAEAAAGAKVV
FT                   NTRNAAVDRSGYGLVSLTPYSLNEVELSPQDLPLDVQLESTVEQVIPRAGAVVALRFPT
FT                   RHDVAAMLVAEPGSEGALVFGTEVRDGAGKVVGVAGQGASALVRGVSASGTLEVTRADG
FT                   SICRATYDLKSAGQAVHGLPRIALACAPQGGGERGARAAGQAVAQPSAISISGKDHEPD
FT                   IR"
FT   misc_feature    247491..247544
FT                   /note="Signal peptide predicted for BP1882 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.459 between residues 18 and 19"
FT   misc_feature    247578..249956
FT                   /note="HMMPfam hit to PF00577, Fimbrial Usher protein"
FT   misc_feature    248415..248447
FT                   /note="ScanRegExp hit to PS01151, Fimbrial biogenesis outer
FT                   membrane usher protein signature. Confirmed by InterPro
FT                   eMOTIF pattern match."
FT   CDS_pept        250126..251223
FT                   /transl_table=11
FT                   /gene="fimD"
FT                   /gene_synonym="fhaE"
FT                   /locus_tag="BP1883"
FT                   /product="fimbrial adhesin"
FT                   /note="Previously sequenced as Bordetella pertussis protein
FT                   FhaE precursor FhaE or FimD SW:FHAE_BORPE (Q00879) (376 aa)
FT                   fasta scores: E(): 1.9e-143, 100% id in 365 aa"
FT                   /db_xref="GOA:Q00879"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00879"
FT                   /protein_id="CAE42166.1"
FT                   /translation="MPARVISFCGAALAVWAGLAVQPAMAVDPPVDCGRALGLHFWSSA
FT                   SLISDQTPDGTLIGKPVVGRSLLSKSCKVPDDIKEDLSDNHDGEPVDIVLELGSNYKIR
FT                   PQSYGHPGIVVDLPFGSTEETGIAIYIDFGSSPMQKVGERQWLYPQKGEVLFDVLTING
FT                   DNAEVRYQAIKVGPLKRPRKLVLSQFPNLFTYKWVFMRGTSQERVLAQGTIDTDVATST
FT                   IDLKTCRYTSQTVSLPIIQRSALTGVGTTLGMTDFQMPFWCYGWPKVSVYMSATKTQTG
FT                   VDGVALPATGQAAGMASGVGVQLINGKTQQPVKLGLQGKIALPEAQQTESATFSLPMKA
FT                   QYYQTSTSTSAGKLSVTYAVTLNYD"
FT   misc_feature    250126..250203
FT                   /note="Signal peptide predicted for BP1883 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 26 and 27"
FT   misc_feature    250786..251220
FT                   /note="HMMPfam hit to PF00419, Fimbrial protein"
FT   CDS_pept        251216..252970
FT                   /transl_table=11
FT                   /gene="fhaC"
FT                   /locus_tag="BP1884"
FT                   /product="hemolysin activator-like protein"
FT                   /note="Previously sequenced as Bordetella pertussis
FT                   hemolysin activator-like protein FhaC precursor fhaC
FT                   SW:FHAC_BORPE (P35077) (584 aa) fasta scores: E(): 0, 100%
FT                   id in 584 aa, and to Bordetella bronchiseptica FhaC
FT                   TR:Q9RGR3 (EMBL:AF111795) (583 aa) fasta scores: E(): 0,
FT                   97.43% id in 584 aa"
FT                   /db_xref="GOA:P35077"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="PDB:3NJT"
FT                   /db_xref="PDB:4QKY"
FT                   /db_xref="PDB:4QL0"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35077"
FT                   /protein_id="CAE42167.1"
FT                   /translation="MTDATNRFRPGLVGRALVRAGLLFAVAACAQAQLLPGARDLNRID
FT                   DRQRKEQLQRDIERALTRPPVELNPQSEAAAPARKPDATSGHTVTVHAVDLDFGVEGRL
FT                   FDPAPLVQDYLNRPLDNEQLFLLVKALSAALYDRGYATSIVTFVPPGVVDGVLKLKVEW
FT                   GRIKGWLIDGKPLEGTRDRMMVFSAMPGWQDKVLNVFDIDQAIYNINNGGKTGNITIVP
FT                   ADEYGYSYLDLQLQRRALPRVSLGMDNSGPGTPENGRYKYNASVTANDLLGLNDTLGLY
FT                   IGNRYYRDAGHDAERNYDLMYSVPLGRTRLDLQTGYSTYRNLLKTRYGQYQSAGNSRSF
FT                   GLKATRLLYRDTRSQFSVYGGLKLRQNKNYLAGTRLDVSSKHYSDVTVGMQYSTQRGAN
FT                   AYFGDLSFTRGVGVNNGKYAAYDERGPQGNVSRFNGSLAWTRYMALAGQPIQWASQLGF
FT                   QYSRQQLLNSYQITVGDEYTVRGYNLRTSQSGDSGVYLSNTLTVPVQFSLLGKQASVAP
FT                   FVGADVGALKSNHPDARTIRMAGLAAGVRFDLPYARMSFTYSKPVGAQPGGAPRAPVWL
FT                   YINAGLSF"
FT   misc_feature    251216..251311
FT                   /note="Signal peptide predicted for BP1884 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.940) with cleavage site
FT                   probability 0.578 between residues 32 and 33"
FT   misc_feature    251738..251767
FT                   /note="ScanRegExp hit to PS00215, Mitochondrial energy
FT                   transfer proteins signature."
FT   CDS_pept        complement(join(252996..253409,253411..254295))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1885"
FT                   /product="conserved hypothetical protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 295. The sequence has been checked
FT                   and believed to be correct.Previously sequenced as
FT                   Bordetella pertussis OrfC protein TR:Q45366 (EMBL:X64876)
FT                   (389 aa) fasta scores: E(): 2.5e-100, 97.39% id in 307 aa,
FT                   and to Rhizobium meliloti hypothetical protein Sma0151
FT                   TR:AAK64739 (EMBL:AE007202) (866 aa) fasta scores: E():
FT                   2.8e-42, 37.63% id in 372 aa"
FT                   /db_xref="PSEUDO:CAE42168.1"
FT   variation       complement(253409..253410)
FT                   /note="CC in pertussis; (AC)CC in parapertussis and
FT                   bronchiseptica"
FT   CDS_pept        complement(254288..254788)
FT                   /transl_table=11
FT                   /locus_tag="BP1886"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas spDJ-1. transmembrane protein
FT                   FcbT2 TR:Q9RBR0 (EMBL:AF051771) (181 aa) fasta scores: E():
FT                   0.011, 26.89% id in 145 aa, and to Pseudomonas aeruginosa
FT                   hypothetical protein Pa3780 TR:Q9HXL5 (EMBL:AE004797) (164
FT                   aa) fasta scores: E(): 0.31, 27.21% id in 147 aa"
FT                   /db_xref="GOA:Q7VXB4"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXB4"
FT                   /protein_id="CAE42169.1"
FT                   /translation="MRRFLDRLYGAAGLLAGLCTIGVLVSVLAAIIARQVGLNIPGTDA
FT                   YAGYFMAAAGFLALASTLKHGEHIRVTLLLNALPAPGHRRLDIFALCVGAILAAAFAWF
FT                   SVKLAHDSWLFNDISTANDATPLWLPQLTMAAGTILFFIALLDELVRRVRGQGFAKSQQ
FT                   IHE"
FT   misc_feature    complement(join(254351..254416,254477..254530,
FT                   254600..254650,254696..254761))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BP1886 by TMHMM2.0 at aa 9-31, 46-63, 86-104 and 124-146"
FT   misc_feature    complement(254702..254788)
FT                   /note="Signal peptide predicted for BP1886 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.995) with cleavage site
FT                   probability 0.954 between residues 29 and 30"
FT   CDS_pept        complement(254795..255769)
FT                   /transl_table=11
FT                   /locus_tag="BP1887"
FT                   /product="putative exported protein"
FT                   /note="Similar to Ralstonia solanacearum putative signal
FT                   peptide protein Rsc2166 TR:CAD15873 (EMBL:AL646068) (339
FT                   aa) fasta scores: E(): 4.6e-38, 34.37% id in 320 aa, and to
FT                   Pasteurella multocida hypothetical protein Pm1252 TR:Q9CLH9
FT                   (EMBL:AE006164) (328 aa) fasta scores: E(): 1.3e-11, 26.23%
FT                   id in 324 aa"
FT                   /db_xref="GOA:Q7VXB3"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="PDB:2PFZ"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXB3"
FT                   /protein_id="CAE42170.1"
FT                   /translation="MYKKLSLLAGTIVLAFGAGAQAQTKWDLPTAYPASNLHVENLTQF
FT                   VKDVDSLSGGKLKITLHNNASLYKAPEIKRAVQGNQAQIGEILLTNFANEDPVYELDGL
FT                   PFLATGYDASFKLYQAQKPFLEKKLASQGMMLLYSVAWPPQGIFANRDIKQVSDMKGLK
FT                   WRAYSPVTAKIAELVGAQPVTVQQAELAQAMATGVIDSYMSSGSTGFDTKTYEYIKKFY
FT                   DTEAWLPKNAVLVNKKAFDALDPATQQALKKAGAQAEERGWKLSQEKNSWYKEQLAKNG
FT                   MAIIAPTAELKSGLTEVGKRMLDDWLKKAGADGQAMIDAYRKQ"
FT   misc_feature    complement(255704..255769)
FT                   /note="Signal peptide predicted for BP1889 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.863 between residues 22 and 23"
FT   CDS_pept        complement(join(256033..256905,256908..257333))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1888"
FT                   /product="putative membrane protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 142. The sequence has been checked
FT                   and believed to be correct. Similar to Agrobacterium
FT                   tumefaciens putative transmembrane protein Dctm TR:Q9F7C8
FT                   (EMBL:AF282677) (416 aa) fasta scores: E(): 5.6e-48, 37.71%
FT                   id in 411 aa, and to Pseudomonas spDJ-12. transmembrane
FT                   protein FcbT3 TR:Q9RBQ9 (EMBL:AF051771) (439 aa) fasta
FT                   scores: E(): 1.2e-39, 32.63% id in 432 aa"
FT                   /db_xref="PSEUDO:CAE42171.1"
FT   misc_feature    complement(join(256057..256122,256168..256233,
FT                   256297..256362,256408..256473,256534..256599,
FT                   256612..256677,256741..256806))
FT                   /note="7 probable transmembrane helices predicted for
FT                   BP1888 by TMHMM2.0 at aa 15-37, 58-80, 84-106, 126-148,
FT                   163-185, 206-228 and 243-265"
FT   misc_feature    complement(256537..256560)
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    complement(256699..256827)
FT                   /note="ScanRegExp hit to PS00041, Bacterial regulatory
FT                   proteins, araC family signature."
FT   variation       complement(256903..256906)
FT                   /note="CGGG in pertussis; GA in parapertussis and
FT                   bronchiseptica"
FT   misc_feature    complement(join(256974..257039,257103..257168,
FT                   257214..257312))
FT                   /note="3 probable transmembrane helices predicted for
FT                   BP1889 by TMHMM2.0 at aa 7-40, 55-77 and 98-120"
FT   misc_feature    complement(257244..257333)
FT                   /note="Signal peptide predicted for BP1889 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.995) with cleavage site
FT                   probability 0.485 between residues 30 and 31"
FT   CDS_pept        complement(257326..257817)
FT                   /transl_table=11
FT                   /locus_tag="BP1890"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa3780 TR:Q9HXL5 (EMBL:AE004797) (164 aa) fasta
FT                   scores: E(): 1e-05, 32.05% id in 156 aa, and to Pseudomonas
FT                   spDJ-12 transmembrane protein FcbT2 TR:Q9RBR0
FT                   (EMBL:AF051771) (181 aa) fasta scores: E(): 1.2e-06, 31.12%
FT                   id in 151 aa"
FT                   /db_xref="GOA:Q7VXB2"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXB2"
FT                   /protein_id="CAE42172.1"
FT                   /translation="MPILDRIAVASGAVAALFLALIGAIVAAQIASRLIGMQIPAADDF
FT                   AAWSMAASVFLALPYAMLRGDHIRVTLLLQFLPKTAHRPYELAATALGLALSAWAAWQT
FT                   AGFVHESFAYDEVAQGMLRVPLWIPQICMPIGLALLTLMLARRLAMVARGRQPEETAHG
FT                   "
FT   misc_feature    complement(join(257383..257439,257500..257565,
FT                   257629..257679,257725..257790))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BP1890 by TMHMM2.0 at aa 19-41, 56-73, 94-116 and 136-155"
FT   misc_feature    complement(257734..257817)
FT                   /note="Signal peptide predicted for BP1890 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.579 between residues 28 and 29"
FT   CDS_pept        complement(257831..258796)
FT                   /transl_table=11
FT                   /locus_tag="BP1891"
FT                   /product="putative exported protein"
FT                   /note="Similar to Ralstonia solanacearum putative signal
FT                   peptide protein Rsc2510 TR:CAD16217 (EMBL:AL646070) (338
FT                   aa) fasta scores: E(): 3.2e-27, 30.15% id in 325 aa, and to
FT                   Salmonella typhimurium LT2 putative dicarboxylate-binding
FT                   periplasmic protein Stm3169 TR:AAL22043 (EMBL:AE008845)
FT                   (327 aa) fasta scores: E(): 3.1e-11, 25.62% id in 281 aa"
FT                   /db_xref="GOA:Q7VXB1"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="PDB:2PFY"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXB1"
FT                   /protein_id="CAE42173.1"
FT                   /translation="MKTTFAVLAAALALSTGAQAATSWTMTAEQPDANYLTQNARQFAD
FT                   EVKAATAGALEIKVQSNSTLLKRPEVKRGVQQGVVQIGEVLVSALGNEDPLFEIDSVPF
FT                   LASSFNESEKLWKATRPLLAQRLDKQGIVLVYGSPWPPQGIYTKKPVAALADLKGTRFR
FT                   AYSASTSHMAALMGAVPTTVQTPEVPQAFSTGVIDAMLTSPATGVDSQAWDYVKYYYDA
FT                   QAFIPQSFVIANKRAFQRLPAEVRQAVLDAGAKAEIRGWQTARAKTRELTDTLARNGMS
FT                   VEPLPPQLAKELQAIGATMVSDWSKKAGADGQQLLDAYRK"
FT   misc_feature    complement(258737..258796)
FT                   /note="Signal peptide predicted for BP1891 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.997 between residues 20 and 21"
FT   CDS_pept        complement(258817..259494)
FT                   /transl_table=11
FT                   /locus_tag="BP1892"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Agrobacterium tumefaciens strC58
FT                   Agr_l_563p TR:AAK88851 (EMBL:AE008228) (228 aa) fasta
FT                   scores: E(): 1.7e-09, 29.25% id in 188 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXB0"
FT                   /protein_id="CAE42174.1"
FT                   /translation="MEKHVAAPIRHDRDAMGELFIWTDIDPAHEEDFNQWYDREHMAER
FT                   AGIAGFRWARRYRSQHGRRRYLALYRTEDLHVFGSAAYRQAFERQTPWSLANFARMRDT
FT                   HRRVMVVSPLAGAGTGAALGLLRLGSVELAARAAALAASAQEIEGVLALRVLTPDPQLS
FT                   TPLPSEDPAARVLDPVLIIDATTEPAAAAARSLAEQLELPTDGIQTFHLLWDLRADDLR
FT                   AAP"
FT   CDS_pept        complement(join(259682..259801,259803..260549))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1893"
FT                   /product="putative LysR-family transcriptional regulator
FT                   (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 249. The frameshift occurs as a
FT                   result of a 48 bp internal deletion relative to B.
FT                   parapertussis and B. bronchiseptica. The sequence has been
FT                   checked and believed to be correct. Similar to Streptomyces
FT                   coelicolor putative LysR-family transcriptional regulator
FT                   Scf55.13C TR:Q9RJQ1 (EMBL:AL132991) (295 aa) fasta scores:
FT                   E(): 3.3e-16, 31.9% id in 279 aa, and to Pseudomonas
FT                   aeruginosa probable transcriptional regulator Pa2115
FT                   TR:Q9I200 (EMBL:AE004639) (317 aa) fasta scores: E():
FT                   2.9e-37, 43.82% id in 251 aa"
FT                   /db_xref="PSEUDO:CAE42175.1"
FT   variation       complement(259803..259805)
FT                   /note="48 bp deletion in pertussis relative to
FT                   parapertussis and bronchiseptica"
FT   misc_feature    complement(260118..260543)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    complement(260409..260501)
FT                   /note="ScanRegExp hit to PS00044, Bacterial regulatory
FT                   proteins, lysR family signature."
FT   misc_feature    complement(260439..260504)
FT                   /note="Predicted helix-turn-helix motif with score 1265
FT                   (+3.50 SD) at aa 16-37, sequence RSFKAAAGKLHLTQAAISGRIA"
FT   CDS_pept        260693..261205
FT                   /transl_table=11
FT                   /locus_tag="BP1894"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Agrobacterium tumefaciens StrC58
FT                   Agr_c_1544p TR:AAK86653 (EMBL:AE008017) (152 aa) fasta
FT                   scores: E(): 0.22, 28.47% id in 144 aa, and to
FT                   Agrobacterium tumefaciens StrC58 Agr_pat_395p TR:AAK90650
FT                   (EMBL:AE007897) (147 aa) fasta scores: E(): 1.6, 26.81% id
FT                   in 138 aa"
FT                   /db_xref="GOA:Q7VXA9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR014601"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXA9"
FT                   /protein_id="CAE42176.1"
FT                   /translation="MSSTPLIASSAHLASGRAPDLSEVEFGLMIASHAFNRWTVRCMAA
FT                   VGLPDLTANDVMVMHHVYHRQRPKKLADICFTLNVEDTHIVSYSLKKLERHDVVRGDRS
FT                   GKEVFYSVTPKGAEIIKRYAEVREQCLLDGLEAGAAGGLEFTRQLAHTLRSLSGLYDQA
FT                   ARAATSL"
FT   CDS_pept        261284..264907
FT                   /transl_table=11
FT                   /gene="oplaH"
FT                   /locus_tag="BP1895"
FT                   /product="5-oxoprolinase"
FT                   /EC_number="3.5.2.9"
FT                   /note="Similar to Rattus norvegicus 5-oxoprolinase OplaH
FT                   SW:OPLA_RAT (P97608) (1288 aa) fasta scores: E(): 3.5e-94,
FT                   45.17% id in 1264 aa, and to Rhizobium loti 5-oxoprolinase
FT                   Mlr1573 TR:Q98K99 (EMBL:AP002997) (1210 aa) fasta scores:
FT                   E(): 0, 59.37% id in 1216 aa"
FT                   /db_xref="GOA:Q7VXA8"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXA8"
FT                   /protein_id="CAE42177.1"
FT                   /translation="MKWQFWVDRGGTFTDIVARRPDGATVTAKMLSENPEQYRDAAVAG
FT                   IRKLLGIAPGQPVPADQVECVKMGTTVATNALLERKGERTLLVTTRGFRDALRIAYQSR
FT                   PRLFDRNVQLPEMLYEAVVEADERLAADGTVVRALAEDGLRADLRRVFDDGIRAVAIVF
FT                   MHAWKEGVHEQRAAAIAREIGFTQVSTSHEASPLIKFVSRGDTTVVDAYLSPILMRYVE
FT                   QVGSELPGVRLMFMQSSGGLTDAHRFRGKDAILSGPAGGIVGMVRTSELAGFDRVIGFD
FT                   MGGTSTDVSHYAGEFEREFETLVAGVRMRAPMMSIHTVAAGGGSILHFDGARLRVGPDS
FT                   AGANPGPACYRRGGPLAVTDCNVLLGKIQPDFFPSVFGPDADQPLDVAAVRARFAAMAE
FT                   EVRTATGREMSAEQLAEGFLEIAVGNMAEAIKRISVQRGHDVTEYALTTFGGAGGQHAC
FT                   LVADALGMTTVFAHPLGGVLSAYGMGLADQTEMRQKTVEQVLDAALMAQLEAGLDELAG
FT                   QASAELLRQHVPADKVAVQRRLHLKYRGTDTALEVAFGPLEQVRAAFEAGYRQRYSFLM
FT                   PGRELVVETISVEATGGGEAATEAPVTRTRAAPLAARRTIRMFSAGQWRETPLYVREDL
FT                   APGDMMAGPAIISEPNQTTVIEPGWQAEVTPRDHLVLRRVQARVQRRAIGTQADPVMLE
FT                   VFNNLFMSIAEQMGYRLQNTAYSVNIKERLDFSCAIFDAEGNLIANAPHMPVHLGSMGE
FT                   SIKTVMRANASRMRPGDAYVVNDPYHGGTHLPDVTVITPVFDRAGQDILFFVGSRGHHA
FT                   DIGGTTPGSMPPDSRTVEDEGVLFTNFQLVGNGEFRDREAREILASGRWPARNPDQNIA
FT                   DLHAQIAANEKGVQELLRMCDHFGLDVVRAYMGHVQDNAEEAVRRVISVLKDGRYTYRL
FT                   DNGAVIEVAVRVDRQARSAVVDFTGTSGQLENNFNAPGAIAVAAVLYVFRTLVDDEIPL
FT                   NAGCLKPLEIIIPEGSMLRPNPPASVVAGNVETSMCIVNALYGALGVLAASQGTMNNFT
FT                   FGNARYQYYETISGGTGAGPLRIDAAGPADAGFAGTSVVQAHMTNSRLTDPEVLELRFP
FT                   VRLESYEIRHGSGGAGRYRGGDGGVRRVRFLEPMTAAILSNNRRHAPFGLAGGEAGAMG
FT                   RNYVERADGRVEPLGPQDSAELAAGDVFVVETPGGGGYGPA"
FT   misc_feature    261293..262942
FT                   /note="HMMPfam hit to PF01968, Hydantoinase/oxoprolinase"
FT   misc_feature    262094..262123
FT                   /note="ScanRegExp hit to PS00339, Aminoacyl-transfer RNA
FT                   synthetases class-II signature 2."
FT   misc_feature    263345..264898
FT                   /note="HMMPfam hit to PF02538, Hydantoinase B/oxoprolinase"
FT   misc_feature    264464..264484
FT                   /note="ScanRegExp hit to PS00227, Tubulin subunits alpha,
FT                   beta, and gamma signature."
FT   CDS_pept        complement(264921..265952)
FT                   /transl_table=11
FT                   /locus_tag="BP1896"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum conserved
FT                   hypothetical protein Rsc1742 TR:CAD15444 (EMBL:AL646066)
FT                   (350 aa) fasta scores: E(): 2.1e-57, 46.84% id in 333 aa,
FT                   and to Emericella nidulans acyl-coenzyme acyl coenzyme
FT                   A:6-aminopenicillanic-acid-acyltransferase precursor PendE
FT                   or Aat SW:AAAA_EMENI (P21133) (357 aa) fasta scores: E():
FT                   4.9e-06, 24.31% id in 329 aa"
FT                   /db_xref="InterPro:IPR005079"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXA7"
FT                   /protein_id="CAE42178.1"
FT                   /translation="MAFKPVSITGTRRQTGQALGKLARPLMATYLEQSTVWAALRPWRG
FT                   HAYLEALAHEASQALPEIWDELEGLAEGLRMPLVDILLWNCRGDLLHKTSDGCTSIAWR
FT                   GDEDTRWIAHNEDGDPFLYGRCHMVDVRPDDAPGYISFYYPGSLPGHTFAANRAGLVQT
FT                   INNVRIRQRHAGVPRMLLARAVLDCATLDDALAVLRDHPRAGGFHHTLGAAGEPRLYSV
FT                   EASPAACSIGEVARGNGHANHLVHPGSEAIGQIVTDSSRSRQRHIENLMDHWQPPVDGA
FT                   RLVATLLDREGELPILRCSADDPDEENTLATALFEMRDGGLTLQVHDRRDQPALRVTVC
FT                   PAA"
FT   repeat_region   265955..265986
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   265955..266381
FT   CDS_pept        join(266057..266449,266449..267006)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1897"
FT                   /product="transposase (Pseudogene)"
FT                   /note="Pseudogene. Transposase for IS481 element. This
FT                   transposase appears to have a frameshift following codon
FT                   131. The frameshift occurs within a homopolymeric tract of
FT                   (C)4"
FT                   /db_xref="PSEUDO:CAE42179.1"
FT   repeat_region   266382..266453
FT   misc_feature    join(266438..266449,266449..266970)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   266446..267006
FT   variation       266448..266451
FT                   /note="some reads show (C)4, others show (C)5"
FT   repeat_region   complement(266975..267006)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        267112..267945
FT                   /transl_table=11
FT                   /locus_tag="BP1898"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Agrobacterium tumefaciens StrC58
FT                   Agr_c_1937p TR:AAK86858 (EMBL:AE008035) (273 aa) fasta
FT                   scores: E(): 3.7e-33, 44.39% id in 232 aa, and to Rhizobium
FT                   loti Mlr4006 protein TR:Q98EZ8 (EMBL:AP003003) (283 aa)
FT                   fasta scores: E(): 1.4e-30, 39.23% id in 260 aa"
FT                   /db_xref="GOA:Q7VXA6"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXA6"
FT                   /protein_id="CAE42180.1"
FT                   /translation="MKETLNEISTLMPQLVDLGINLGVALLILILGWWASSLLGGWVRR
FT                   AAQRSPRIDPTIVPMFQSTVIWTVRIFTLIAVLARFGVQTASLIAVLGAAGLAVGLALQ
FT                   GTLQNIAAGIMLLILRPIRAGEYVALSSGSDGTVEEVGLFLTRLVQVDGIHITLPNSTV
FT                   WNATIINYSRNANRRLDIPVTVHYGDDLGEAIARLEALVRGHEMVLQDPAPIVKASEYR
FT                   DNGTVVNVRVWTQAAQYWDLRWDLFHQIRRALGEAGFRAPIPVREIQGGGKDAAA"
FT   misc_feature    join(267169..267237,267280..267348,267367..267435)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BP1898 by TMHMM2.0 at aa 42-64, 79-101 and 108-130"
FT   misc_feature    267295..267897
FT                   /note="HMMPfam hit to PF00924, Mechanosensitive ion
FT                   channel"
FT   CDS_pept        complement(267959..268717)
FT                   /transl_table=11
FT                   /locus_tag="BP1899"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Rhizobium meliloti putative transcription
FT                   regulator protein Smc00263 TR:Q92PP5 (EMBL:AL591788) (282
FT                   aa) fasta scores: E(): 6.2e-22, 36.03% id in 247 aa, and to
FT                   Rhizobium loti transcription regulator Mll9009 TR:Q982L6
FT                   (EMBL:AP003015) (269 aa) fasta scores: E(): 1.6e-15, 32.89%
FT                   id in 228 aa"
FT                   /db_xref="GOA:Q7VXA5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXA5"
FT                   /protein_id="CAE42181.1"
FT                   /translation="MQETDSGAGPRTLRRGLMVLAALRDQGPRGLSVTDIARQTGIQRP
FT                   TIYRLLAALLDAGLVVPLQGTKKYRTQLAADADLAAPNPRVRQMLPVLRRLADRTGDAV
FT                   FLVVRDGDDSVSLHREIGSYPVQILATYAGKRQPLGVGSGSMALLAALPDEVAHAIVQR
FT                   NSGRLDEYGGMTPQEMHRLIENTRARGYSVVGNHAVRGALGVGCALLDAQGAPVLAVSV
FT                   TAIIDRMPAQRQREIAGWIGAELARLAPKA"
FT   misc_feature    complement(267974..268576)
FT                   /note="HMMPfam hit to PF01614, Bacterial transcriptional
FT                   regulator"
FT   misc_feature    complement(268562..268627)
FT                   /note="Predicted helix-turn-helix motif with score 1869
FT                   (+5.55 SD) at aa 48-69, sequence LSVTDIARQTGIQRPTIYRLLA"
FT   CDS_pept        268879..269871
FT                   /transl_table=11
FT                   /locus_tag="BP1900"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Sma1927 TR:AAK65716 (EMBL:AE007292) (330 aa) fasta scores:
FT                   E(): 1.1e-55, 48.32% id in 329 aa, and to Agrobacterium
FT                   tumefaciens StrC58 Agr_l_312p TR:AAK88723 (EMBL:AE008213)
FT                   (329 aa) fasta scores: E(): 2.7e-52, 46.6% id in 324 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXA4"
FT                   /protein_id="CAE42182.1"
FT                   /translation="MTKSQLPRLGRFAVRLFAGILGAAAIGATAHTAYPDKPVRIVVGF
FT                   SAGGTTDVIARIMAKELTEALGQSFVVENKPGGGSNIATDYVARATPDGYTLLFVAVTS
FT                   AINQTLYKNVNFDLTKDFAPVALGAKVPNILVLNPSVPVKSVQELVAYTKANPGKLAFA
FT                   SSGSGTSIHMAGELFKQRAGIDVLHVPYKGSAPAVTDLIGGQVQFMFDNMPSSWPHVQA
FT                   GKLRALAVTTTERSASAPDLPTMKESGFENFDVSSWFGLIAPAGTPPEVVNTLNAAMVK
FT                   ALDKPEVLQSYEKLGAVAQKTTPAEFGAFIKSEVEGWAPVVKASGATVD"
FT   misc_feature    268879..268968
FT                   /note="Signal peptide predicted for BP1900 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.996) with cleavage site
FT                   probability 0.485 between residues 30 and 31"
FT   CDS_pept        complement(270089..270865)
FT                   /transl_table=11
FT                   /locus_tag="BP1901"
FT                   /product="probable methyltransferase"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   methyltransferase Pa3817 TR:Q9HXI5 (EMBL:AE004799) (257 aa)
FT                   fasta scores: E(): 2.5e-30, 41.93% id in 248 aa, and to
FT                   Azotobacter vinelandii hypothetical 28.2 kDa protein
FT                   TR:O69217 (EMBL:AF010139) (257 aa) fasta scores: E():
FT                   1e-28, 41.15% id in 243 aa"
FT                   /db_xref="GOA:Q7VXA3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="PDB:3KTY"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXA3"
FT                   /protein_id="CAE42183.1"
FT                   /translation="MTQAFSRVRFIMTQPSHPGNVGSAARAIKTMGFGELVLVAPRFPD
FT                   MTAQPEAVALASGALDVLERAAVHDTLEEALAPVTLAFALTTRVRDLGPPPCDIREAAG
FT                   LARRHLDDTEAGVVAIVLGTERAGLTNAQIELCHRICHIPANPQYSSLNVAQALQLAAW
FT                   ELRYALLAGTGQSLLPASSAQQANPGAAPADGAAVQALLAHWEQALVAVGFLDPAHPKK
FT                   LMPRMKHLLTRSALSRDEVDMLRGVCTAMIAPNRPK"
FT   misc_feature    complement(270377..270847)
FT                   /note="HMMPfam hit to PF00588, SpoU rRNA Methylase family"
FT   CDS_pept        270973..271755
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /gene_synonym="ssyA"
FT                   /locus_tag="BP1902"
FT                   /product="inositol-1-monophosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /note="Similar to Escherichia coli extragenic suppressor
FT                   protein SuhB or SsyA or b2533 SW:SUHB_ECOLI (P22783) (267
FT                   aa) fasta scores: E(): 3.2e-41, 46.33% id in 259 aa, and to
FT                   Ralstonia solanacearum probable inositol monophosphatase
FT                   suhB TR:CAD14862 (EMBL:AL646063) (270 aa) fasta scores:
FT                   E(): 7.4e-54, 55.34% id in 262 aa. Also similar to BP2813,
FT                   40.000% identity (43.200% ungapped) in 270 aa overlap"
FT                   /db_xref="GOA:Q7VXA2"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXA2"
FT                   /protein_id="CAE42184.1"
FT                   /translation="MHPMLNTAIKAARRAGTIINRASLDLERLTVARKGPRDYVTEVDR
FT                   ASEEVIVEVLRTAYPDHAVLGEEFGLQGPEQAEFQWIIDPLDGTTNYIHGLPNYAVSIA
FT                   LLHRRQVTQAVVYDPSRNELFTASRGSGTFLNDRRVRVSGRIRYHDALLGAHWPHSTDP
FT                   DQGSGRFRAMAEGSASVRRLGSTVLDLAYVACGRLDGFCGVGLKPWDVAAGSLLVLEAG
FT                   GLLADFDGEQGWLDTGNVLAGTPKVFTHMLTALQPRTA"
FT   misc_feature    271162..271407
FT                   /note="HMMPfam hit to PF00459, Inositol monophosphatase
FT                   family"
FT   misc_feature    271213..271254
FT                   /note="ScanRegExp hit to PS00629, Inositol monophosphatase
FT                   family signature 1. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   misc_feature    271510..271653
FT                   /note="HMMPfam hit to PF00459, Inositol monophosphatase
FT                   family"
FT   misc_feature    271597..271641
FT                   /note="ScanRegExp hit to PS00630, Inositol monophosphatase
FT                   family signature 2. Confirmed by InterPro eMOTIF pattern
FT                   match."
FT   CDS_pept        271882..273468
FT                   /transl_table=11
FT                   /locus_tag="BP1903"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Salmonella enterica subspenterica serovar
FT                   Typhi putative membrane protein Sty1958 TR:CAD05511
FT                   (EMBL:AL627272) (519 aa) fasta scores: E(): 1e-110, 59.22%
FT                   id in 515 aa, and to Escherichia coli hypothetical protein
FT                   YoaE or B1816 or Z2859 or Ecs2525 SW:YOAE_ECOLI (P76262)
FT                   (518 aa) fasta scores: E(): 6.4e-109, 57.87% id in 527 aa"
FT                   /db_xref="GOA:Q7VXA1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VXA1"
FT                   /protein_id="CAE42185.1"
FT                   /translation="MEWLQDPAAWVGLLTLVVLEIVLGIDNLIFIAILADKLPPAQRDR
FT                   ARIVGLSLALLMRLGLLSVMSWLVTLTTPWFSVGPMSFSGRDLILMLGGLFLLFKGTME
FT                   LHERIEGGQSLDTGGPRVYASFWVIVTQIVVLDAVFSLDSVITAVGMVDHLAIMMIAVI
FT                   IAIGIMLLASKPLTRFVNAHPTVVVLCLGFLLMIGFSLLAESFGFKVPKGYLYAAIGFS
FT                   VAIEALNQVARRNLLKLDARRPMRERTATAVLRMLGKRPPASDESDLPSAMPAVPAFGV
FT                   EERNMVSGVLTLAERSIRSIMTPRTDVSWVNIDDDAATIRQQLTAAPHSFFPVCRGSLD
FT                   EVVGIGRAKDLVADLITEGRVRRNRLRDPIIVHESIGILRLMDTLKRSRGQLVLVADEF
FT                   GAIEGLVTPIDVFEAIAGEFPDEDELPDIVAESENVWKVDGAADLHHLEQVLEIEGLID
FT                   ESEDYSTLAGYLLARFGHLPKPGDTCEFEGSHHRRVRFEVLQMDGRRVALVRVERLPYD
FT                   TVDESEAADAD"
FT   misc_feature    join(271918..271986,272023..272091,272134..272187,
FT                   272245..272304,272332..272400,272437..272505)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP1903 by TMHMM2.0 at aa 31-53, 66-88, 103-120, 140-159,
FT                   169-191 and 204-226"
FT   misc_feature    272785..272949
FT                   /note="HMMPfam hit to PF00571, CBS domain"
FT   misc_feature    272968..273129
FT                   /note="HMMPfam hit to PF00571, CBS domain"
FT   CDS_pept        273493..274356
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="BP1904"
FT                   /product="bacitracin resistance protein"
FT                   /EC_number="2.7.1.66"
FT                   /note="Similar to Escherichia coli bacitracin resistance
FT                   protein BacA or B3057 or Z4410 or Ecs3940 SW:BACA_ECOLI
FT                   (P31054) (273 aa) fasta scores: E(): 2.9e-16, 41.86% id in
FT                   289 aa, and to Azospirillum brasilense bacitracin
FT                   resistance protein homolog SW:BACA_AZOBR (P39438) (187 aa)
FT                   fasta scores: E(): 1.6e-17, 45.27% id in 201 aa"
FT                   /db_xref="GOA:Q7VXA0"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VXA0"
FT                   /protein_id="CAE42186.1"
FT                   /translation="MTDSTLHLLKAFFLGIVEGLTEFIPVSSTGHLIVIGDWINFASSS
FT                   GKVFEVVIQFGSILAVMWIFRARLWQLIRGTLTGVRQEVNFTRNLLLAFLPAAVIGAIF
FT                   IKSIKQVFYHPGVVAVTLVVGGFIMLWVERRAPHTPGDAPGAADDTASDERASAHTLEQ
FT                   ISAKQALGVGVAQCVAMIPGVSRSGATIIGGMIAGIQRKTATEFSFFLAMPTMLGAAVY
FT                   DLYRNIGLLSQHDMSAIAVGFVAAFLSALVVVRAVLRFVANHTYRVFAWYRIALGLVVA
FT                   AWIYAK"
FT   misc_feature    join(273529..273597,273634..273687,273748..273807,
FT                   273820..273888,274111..274170,274198..274266,
FT                   274297..274350)
FT                   /note="7 probable transmembrane helices predicted for
FT                   BP1904 by TMHMM2.0 at aa 13-35, 48-65, 86-105, 110-132,
FT                   207-226, 236-258 and 269-286"
FT   misc_feature    273952..274305
FT                   /note="HMMPfam hit to PF02673, Bacitracin resistance
FT                   protein BacA"
FT   CDS_pept        complement(274564..275313)
FT                   /transl_table=11
FT                   /gene="lpxH"
FT                   /locus_tag="BP1905"
FT                   /product="UDP-2,3-diacylglucosamine hydrolase"
FT                   /EC_number="3.6.1.-"
FT                   /note="Similar to Escherichia coli
FT                   UDP-2,3-diacylglucosamine hydrolase LpxH or B0524
FT                   SW:LPXH_ECOLI (P43341) (240 aa) fasta scores: E(): 4.6e-28,
FT                   43.98% id in 216 aa, and to Salmonella typhimurium LT2
FT                   UDP-2,3-diacylglucosamine hydrolase LpxH TR:AAL19489
FT                   (EMBL:AE008720) (240 aa) fasta scores: E(): 2.3e-27, 43.51%
FT                   id in 216 aa"
FT                   /db_xref="GOA:Q7VX99"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VX99"
FT                   /protein_id="CAE42187.1"
FT                   /translation="MWLASDLHLGPATPATAEAFLGLLQAAADEASALLLPGDIFDAWI
FT                   GDDVIRAAPPWLAAVLHGIRAAAGRIPVYLGRGNRDFLIGQELADALGAHLLPEPVLLE
FT                   TDYGRILLTHGDEYCTDDSAYQQFRAMVRNPQWQAQFLAKSIPERLAMAEQARGESQAA
FT                   NQAKSMEIMDVNPAAVEAALREADVDVLVHGHTHRPARHVLSVDGRKRERWVLPDWDCD
FT                   HADPPRGGWLVIDRDGLQCFDLVEDED"
FT   CDS_pept        complement(275333..275842)
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="BP1906"
FT                   /product="peptidyl-prolyl cis-trans isomerase B"
FT                   /EC_number="5.2.1.8"
FT                   /note="Similar to Escherichia coli peptidyl-prolyl
FT                   cis-trans isomerase B ppiB or B0525 SW:PPIB_ECOLI (P23869)
FT                   (164 aa) fasta scores: E(): 2.3e-41, 66.87% id in 163 aa,
FT                   and to Ralstonia solanacearum probable peptidyl-prolyl
FT                   cis-trans isomerase B PpiB TR:CAD14866 (EMBL:AL646063) (179
FT                   aa) fasta scores: E(): 1.8e-49, 75.73% id in 169 aa"
FT                   /db_xref="GOA:Q7VX98"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX98"
FT                   /protein_id="CAE42188.1"
FT                   /translation="MSTNPRVKLHTNQGDIIITLNAEKAPKSVENFVAYTKDGFYDGTV
FT                   FHRVIDGFMIQGGGFEPGMKQKPTKAPIENEANNGLKNDKYTLAMARTSDPHSATAQFF
FT                   INVSDNDFLNFTAPTPNGWGYAVFGVVTEGTEVVDKIKNVKTGNRGFHQNVPAEDVIIE
FT                   KAEVLE"
FT   misc_feature    complement(275336..275824)
FT                   /note="HMMPfam hit to PF00160, Cyclophilin type
FT                   peptidyl-prolyl cis-trans isomerase"
FT   misc_feature    complement(275669..275722)
FT                   /note="ScanRegExp hit to PS00170, Cyclophilin-type
FT                   peptidyl-prolyl cis-trans isomerase signature. Confirmed by
FT                   InterPro eMOTIF pattern match."
FT   CDS_pept        complement(275971..276654)
FT                   /transl_table=11
FT                   /locus_tag="BP1907"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhodobacter sphaeroides hypothetical 21.1
FT                   kDa protein putative Orf TR:Q53172 (EMBL:Z50182) (197 aa)
FT                   fasta scores: E(): 0.41, 29.33% id in 150 aa, and to
FT                   Desulfotomaculum thermocisternum hypothetical 25.2 kDa
FT                   protein TR:Q9ZH15 (EMBL:AF074396) (224 aa) fasta scores:
FT                   E(): 0.098, 25.98% id in 127 aa"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX97"
FT                   /protein_id="CAE42189.1"
FT                   /translation="MTTKPRLCTALLTLAIAVSASAPVLAQSMAGGSAKNRYANQTKLD
FT                   PYPPEGGWQGLANLLEAAKPGVDTRLDPTPSQITDRIEELLNRGANEEALSLIERREAA
FT                   IKGQRGADVQLMFQHARALAALGRADEAIAVYSDMTTQFPELPEPWNNLAALYASRGEL
FT                   ERAQDSLQMALRANPDYAAARANLGDIQLMMALRTYRQEEARGVPGMKARVEEIESLLK
FT                   DKQPK"
FT   misc_feature    complement(276115..276216)
FT                   /note="HMMPfam hit to PF00515, TPR Domain"
FT   misc_feature    complement(276577..276654)
FT                   /note="Signal peptide predicted for BP1907 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.971 between residues 26 and 27"
FT   CDS_pept        276894..278354
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BP1908"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="Similar to Escherichia coli cysteinyl-tRNA
FT                   synthetase CysS or B0526 SW:SYC_ECOLI (P21888) (461 aa)
FT                   fasta scores: E(): 2.2e-57, 50% id in 496 aa, and to
FT                   Neisseria meningitidis cysteinyl-tRNA synthetase Nmb2083
FT                   TR:Q9JXE6 (EMBL:AE002558) (473 aa) fasta scores: E():
FT                   1.3e-78, 52.98% id in 502 aa"
FT                   /db_xref="GOA:Q7VX96"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VX96"
FT                   /protein_id="CAE42190.1"
FT                   /translation="MLHIYNTLSRTKEPFKPAHAGQVRMYVCGMTVYDYCHLGHARMLV
FT                   AFDVVQRWLRASGLAVDYVRNITDIDDKIIRRAVETGRRIGEVTEYYIAAMHADERALG
FT                   VQPPDREPRATQYVGEMLDIIGRLESKGLAYRAEDGDVNYAVRGFADYGKLSGKSLDDL
FT                   RAGERVAVGSAKRDPLDFVLWKSAKPQEPDDTKWESPYGLGRPGWHIECSAMSKTLLGL
FT                   PLDIHGGGPDLKFPHHENEIAQTEGAFGGALANVWMHCGPLMVDADKMSKSLGNFRTIR
FT                   QTIAQGPLSDTQAEYAVNPREAEMLRFFIVRNHYRSPQNYAPDNLVDAQNALDRLYQAL
FT                   QNTAADGQGVDWSEEPQAQAFKAAMDDDFNSSGAVAALFELASEANRTGSARAVGQLKA
FT                   LGAVLGLLQQDPPAYFQSPTRYSAAARGQGAPAAALDAAAIEARIAERAAAKAARDFAR
FT                   ADAIRAELRAAGIELDDKPGGLTQWRRA"
FT   misc_feature    276933..277736
FT                   /note="HMMPfam hit to PF01406, tRNA synthetases class I
FT                   (C)"
FT   misc_feature    277797..278306
FT                   /note="HMMPfam hit to PF01406, tRNA synthetases class I
FT                   (C)"
FT   CDS_pept        278374..279018
FT                   /transl_table=11
FT                   /locus_tag="BP1909"
FT                   /product="DNA-3-methyladenine glycosylase"
FT                   /EC_number="3.2.2.21"
FT                   /note="Similar to Schizosaccharomyces pombe
FT                   DNA-3-methyladenine glycosylase Mag1 or Spapb24d3.04C
FT                   SW:MAG1_SCHPO (Q92383) (228 aa) fasta scores: E(): 2e-16,
FT                   34.84% id in 198 aa, and to Halobacterium sp
FT                   3-methyladenine DNA glycosylase AlkA or Vng1311G TR:Q9HQ62
FT                   (EMBL:AE005053) (191 aa) fasta scores: E(): 5.2e-20, 38.74%
FT                   id in 191 aa"
FT                   /db_xref="GOA:Q7VX95"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX95"
FT                   /protein_id="CAE42191.1"
FT                   /translation="MSSADIVIVKPEYWDDAVAHLMRRDRILKRIIPQHGETWLTSRGS
FT                   PFVTLARAIIGQQISVKAADALWQRFLETVGKRPTPATVLRAGVPALRAAGLSQRKAEY
FT                   LVDLATHFGQRLVHPEKWAAMDDEAVIAELVAIRGIGRWTAEMFLIFNLQRPDVLPLDD
FT                   LGLLKAISLHYFSGEPVSRFEAREVSLAWQPWRTVATWYLWRSLEPAAVQY"
FT   misc_feature    278512..278961
FT                   /note="HMMPfam hit to PF00730, HhH-GPD superfamily base
FT                   excision DNA repair protein"
FT   CDS_pept        279055..280020
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="BP1910"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /EC_number="6.4.1.2"
FT                   /note="Similar to Escherichia coli acetyl-coenzyme A
FT                   carboxylase carboxyl transferase subunit alpha AccA or
FT                   B0185 or Z0197 or Ecs0187 SW:ACCA_ECOLI (P30867) (318 aa)
FT                   fasta scores: E(): 5e-76, 65.17% id in 313 aa, and to
FT                   Neisseria meningitidis putative acetyl-CoA carboxylase
FT                   carboxyl transferase subunit AccA or Nma1349 TR:Q9JUF0
FT                   (EMBL:AL162755) (319 aa) fasta scores: E(): 2.5e-82, 67.29%
FT                   id in 318 aa"
FT                   /db_xref="GOA:Q7VX94"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VX94"
FT                   /protein_id="CAE42192.1"
FT                   /translation="MRNTFLEFEQPLAELENKIEQLRYVQADSAVDISDEIGRLQQKSQ
FT                   NLAKEIYGKLTPWQTALVARHPQRPYTLDYVREIFTDFHELHGDRMYADDQSIVGGLAR
FT                   FNGSACMVIGHQKGRDTKERAARNFGMPRPEGYRKALRLMRLAEKFRLPIFTFIDTPGA
FT                   YPGIGAEERGQSEAIGRNLYAMAELKVPVICTVIGEGGSGGALAIAVGNAVLMLQYATY
FT                   SVISPEGCASILWRSADKAPEAAEALAITAPRLKDLGLVDRVVNEPVGGAHRDPRVMAR
FT                   LLRRALGDALRQLQGLGPEQLVDQRLQRLMSYGRFQEVRA"
FT   repeat_region   280017..280048
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   280017..281069
FT   CDS_pept        280119..281069
FT                   /transl_table=11
FT                   /locus_tag="BP1911"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7VX93"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX93"
FT                   /protein_id="CAE42193.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVSEAARAYGVTAPTVRKW
FT                   LGRFLAHGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIPPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT"
FT   misc_feature    280377..280442
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    280500..281033
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(281038..281069)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        281199..282164
FT                   /transl_table=11
FT                   /locus_tag="BP1912"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli putative cell cycle
FT                   protein MesJ or B0188 SW:MESJ_ECOLI (P52097) (432 aa) fasta
FT                   scores: E(): 8e-17, 34.89% id in 278 aa, and to Ralstonia
FT                   solanacearum putative cell cycle protein MesJ TR:CAD14872
FT                   (EMBL:AL646063) (462 aa) fasta scores: E(): 8.5e-28, 43.55%
FT                   id in 326 aa"
FT                   /db_xref="GOA:Q7VX92"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VX92"
FT                   /protein_id="CAE42194.1"
FT                   /translation="MAAALRALDPAPARLAVAVSGGADSAMLAVAAAAALPPGCTLRLF
FT                   HVHHGLQAAADQWAAQVRGLGALLGVPVDEARVTVPPGQGLGMEAAARLARYQALAGLA
FT                   RQHGVRHILLAHHRNDQAETVLLRLLRGTGLQGMAAMAPFSERDGVAYLRPWLDVDHAA
FT                   ILALAGAVRAQCGWQAVQDPTNTDPRYARAAVRTQLAPALDARWPGWQAIVARHARQMA
FT                   EAAEIVAEVAQADFATLEPADAGRSFSLAAWRGLSAARQAQALRHWLASQDAPMPTEAR
FT                   LAELQRQLRQLHALGHDRHLRWQHAGRVVRCERGRVWIDD"
FT   CDS_pept        282264..283529
FT                   /transl_table=11
FT                   /gene="ask"
FT                   /locus_tag="BP1913"
FT                   /product="aspartokinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="Similar to Mycobacterium smegmatis aspartokinase Ask
FT                   SW:AK_MYCSM (P41403) (421 aa) fasta scores: E(): 2e-66,
FT                   46.28% id in 417 aa, and to Ralstonia solanacearum probable
FT                   aspartate kinase protein LysC TR:CAD14873 (EMBL:AL646063)
FT                   (416 aa) fasta scores: E(): 3.7e-120, 77.34% id in 415 aa"
FT                   /db_xref="GOA:Q7VX91"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX91"
FT                   /protein_id="CAE42195.1"
FT                   /translation="MSLIVQKYGGTSMGSVERIKNVARRVAKWHAAGHKVVVVPSAMAG
FT                   ETNRLLSLAREISPQPDGRELDMIAATGEQASSGMLAIALQAEGVPARSYAGWQVPVRT
FT                   DSSYTKARIKSIDDKRVLADLDAGRVVIVTGFQGVDDDGHITTLGRGGSDTSAVAVAAA
FT                   IKADECLIFTDVDGVYTTDPRVVPEARRMAVVSFEEMLEMASLGSKVLQIRSVEFAGKY
FT                   HVPTRVLSSLTDPLIPLEEEMRSGTLITFEEDEKMEAAVVSGIAFSRDEAKITLLAVPD
FT                   KPGIAYSILGPVAAANIDVDMIVQNQSVAGTTDFSFTVNRNEYQRTLDLLKREVIPAVS
FT                   ARELVTDEKVAKVSIVGIGMRSHVGVASLMFQTLSQEGINIQMISTSEIKTSVIIDDKY
FT                   MELAVRSLHKAFGLDQVPGDQV"
FT   misc_feature    282267..282866
FT                   /note="HMMPfam hit to PF00696, Amino acid kinase family"
FT   misc_feature    282276..282302
FT                   /note="ScanRegExp hit to PS00324, Aspartokinase signature."
FT   misc_feature    283080..283295
FT                   /note="HMMPfam hit to PF01842, ACT domain"
FT   misc_feature    283323..283520
FT                   /note="HMMPfam hit to PF01842, ACT domain"
FT   tRNA            283614..283706
FT                   /note="tRNA Ser anticodon GCT, Cove score 69.50"
FT   repeat_region   complement(283893..285124)
FT                   /note="Insertion sequence"
FT   CDS_pept        complement(283923..284939)
FT                   /transl_table=11
FT                   /locus_tag="BP1914"
FT                   /product="transposase for IS1663"
FT                   /note="Similar to Neisseria meningitidis putative
FT                   invertase/transposase Nma1800 TR:Q9JTF3 (EMBL:AL162757)
FT                   (318 aa) fasta scores: E(): 2e-17, 28.48% id in 316 aa and
FT                   Acinetobacter spSE19. pilin inverting protein ChnY
FT                   TR:Q9F7E1 (EMBL:AF282240) (324 aa) fasta scores: E():
FT                   8.2e-50, 47.516% id in 322 aa"
FT                   /db_xref="GOA:Q7TTN4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTN4"
FT                   /protein_id="CAE42196.1"
FT                   /translation="MADSSLLSAGGQVHVFIGIDVSKAKLDCTLLTAEADKCKTKVVVN
FT                   TAAGVQALLAWCAKHGAQPAQLHAILEPTGLYHEQAATALPQVRVSLVNPAQARDFAKA
FT                   LALRSKNDALDSYVLARYGQTLSPALWHPAPLHARQLRALLTRREALSKDLLRELNRKE
FT                   KSQFSPSAPLVDGSIDKAIAFLREQIKQIERAIDQHIDNHPDLKQDCELLNSIPAIGPQ
FT                   AGNAILAVMHNRHIDSAQSLAAYLGVVPVQRQSGSSLNSCARLSKAGPSQVRATLYMAA
FT                   LVGTRHNPHIRALYQRLLKAGKSKKAALGAAMRKLVHLCFGVLKNRIPYQPNYAMNG"
FT   misc_feature    complement(284055..284387)
FT                   /note="HMMPfam hit to PF02371, Transposase
FT                   IS116/IS110/IS902 family"
FT   misc_feature    complement(284400..284687)
FT                   /note="HMMPfam hit to PF01548, Transposase"
FT   CDS_pept        285283..285783
FT                   /transl_table=11
FT                   /locus_tag="BP1915"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces glaucescens tetracenomycin
FT                   polyketide synthesis protein TcmJ SW:TCMJ_STRGA (P16558)
FT                   (149 aa) fasta scores: E(): 0.00089, 26.84% id in 149 aa,
FT                   and to Streptomyces coelicolor 16.7 kDa protein in whie
FT                   locus Sc6g9.14 SW:WH16_STRCO (P23157) (157 aa) fasta
FT                   scores: E(): 1.1e-05, 34.4% id in 93 aa"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX90"
FT                   /protein_id="CAE42197.1"
FT                   /translation="MKQQHEPGIAVVVGPDEGDSFWQPVPANGFVRTLLNRANTGASVD
FT                   FSAGTQTVAPGCHVREHFHDDREEVIFITEGTGTALIDGVEHPLAPGACLFLGKSRKHS
FT                   FLNAGPEPLSFFWILMPGGLDDFFRQIGRVRQPGEPAPQSFARPADIDRIEANTVFGWT
FT                   AKS"
FT   misc_feature    285559..285582
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        285825..286139
FT                   /transl_table=11
FT                   /locus_tag="BP1916"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Sma0797 TR:AAK65090 (EMBL:AE007233) (108 aa) fasta scores:
FT                   E(): 8.5e-16, 42.15% id in 102 aa, and to Agrobacterium
FT                   tumefaciens StrC58 Agr_l_1239p TR:AAK89197 (EMBL:AE008260)
FT                   (104 aa) fasta scores: E(): 2.3e-17, 42.71% id in 103 aa"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX89"
FT                   /protein_id="CAE42198.1"
FT                   /translation="MFIEERDYRIKPGKAGLFVATYEAHGLALQKKYLGRFLGYFMSEI
FT                   GELNHVVAWWAYDSLDERDAARSRMLADPQWQAYLERVTDLIDLQQTRILKPVSFSPIQ
FT                   "
FT   CDS_pept        286149..287090
FT                   /transl_table=11
FT                   /locus_tag="BP1917"
FT                   /product="putative 3-hydroxyacyl-CoA dehydrogenase"
FT                   /note="Similar to Oryctolagus cuniculus lambda-crystallin
FT                   SW:CRYL_RABIT (P14755) (319 aa) fasta scores: E(): 2.2e-28,
FT                   35.43% id in 302 aa, and to Rhizobium loti Mll1034 protein
FT                   TR:Q98LG2 (EMBL:AP002996) (315 aa) fasta scores: E():
FT                   3.9e-35, 39.39% id in 297 aa"
FT                   /db_xref="GOA:Q7VX88"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX88"
FT                   /protein_id="CAE42199.1"
FT                   /translation="MNHVAVIGGGIIGASWAIVFARRGLEVTIVERDAACLAGLPARLA
FT                   GMIERSASLLRAGEQPGDVAARIGATDALAAAVGRADYVQEAVSENLAFKRTLFAELDA
FT                   LAPGHALLASSTSTYGASQFTEALAGRARCLVAHPMTPPHLSPVVEMAASAWTDPQALA
FT                   GAETFMRSLGQHPVRIRKEIPGFVLNRLQGALLMEMFRVIADDVISPADADALISQGLG
FT                   LRWATLGPLEGVDLNAPGGIADYLQRYGHIFNDMAAGQGLPAPVDAELISALDGAMRAA
FT                   LPLERLEAKRGWRDRAIAGVRVALHDYTGEKP"
FT   misc_feature    286158..286988
FT                   /note="HMMPfam hit to PF00725, 3-hydroxyacyl-CoA
FT                   dehydrogenase, C-terminal domain"
FT   CDS_pept        287087..287611
FT                   /transl_table=11
FT                   /locus_tag="BP1918"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Bacillus halodurans C4-dicarboxylate
FT                   transport system Bh2672 TR:Q9K9H5 (EMBL:AP001516) (183 aa)
FT                   fasta scores: E(): 1.4e-07, 29.6% id in 152 aa, and to
FT                   Agrobacterium tumefaciens StrC58 Agr_l_3346p TR:AAK90250
FT                   (EMBL:AE008369) (183 aa) fasta scores: E(): 2.4e-06, 30.3%
FT                   id in 165 aa"
FT                   /db_xref="GOA:Q7VX87"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX87"
FT                   /protein_id="CAE42200.1"
FT                   /translation="MKLIRAVDGLNRLACWLMAGLMLGMTLCTLWQVSVRFLLTGLGWN
FT                   VAAPWSEEVSRYLMIWIIFLGAGVACRKAQLIALELVVTLLPAPLGRALRFAALLGCLV
FT                   FFTLMIYLGLEFMEFGAIETSPVLSMPKTWIYLAMPVGFGLMFLNTATLIAECLLQGID
FT                   IRHASQQEAQE"
FT   misc_feature    join(287123..287191,287255..287323,287357..287425,
FT                   287483..287551)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BP1918 by TMHMM2.0 at aa 13-35, 57-79, 91-113 and 133-155"
FT   CDS_pept        287614..288882
FT                   /transl_table=11
FT                   /locus_tag="BP1919"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pasteurella multocida hypothetical
FT                   protein Pm0273 TR:Q9CNZ7 (EMBL:AE006062) (427 aa) fasta
FT                   scores: E(): 1.8e-62, 43.91% id in 419 aa, and to Bacillus
FT                   halodurans C4-dicarboxylate transport system bh2671
FT                   TR:Q9K9H6 (EMBL:AP001516) (426 aa) fasta scores: E():
FT                   4.3e-65, 46.77% id in 419 aa"
FT                   /db_xref="GOA:Q7VX86"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX86"
FT                   /protein_id="CAE42201.1"
FT                   /translation="MLSAVVLLLLLFAASIPVALSLGIAPLPALLARDVPLLAVPQTMF
FT                   ESMDSFALMAVPFFVLAGRLMQTGGIAGRLMDLGLALIGWVKGGLGGAAVLTTMFFSTI
FT                   CGSSSATTAAIGSVMIPEMERRGYPRPFAASVVASSGELGVILPPSVPMIIYAMLTGTS
FT                   VAQMFVAGILPGLLIGLSLIITILIMSRLGDYGGSQRVSVGEWALNVWRALRRASLSLL
FT                   MPVIILGGIYGGLFTATEAAVVAVAYTFVVSVFIYREIKWKDLPEIFWSSAVTSGIVLL
FT                   IVGFASVFAYVLSLYQAPQQVAALLLGVSDNPLVFLLLVNIALLVVGLFMETFAAILIL
FT                   APVLAPVAVSLGIDPVHFGLIVIVNLAVGMVTPPVGVNLFLVCGIARVSMERLMRPLSV
FT                   FLGVLLLDLIIITYGPVLYARFF"
FT   misc_feature    287614..287676
FT                   /note="Signal peptide predicted for BP1919 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.458 between residues 21 and 22"
FT   misc_feature    join(287632..287700,287743..287811,287845..287913,
FT                   288025..288093,288112..288180,288286..288381,
FT                   288415..288483,288526..288594,288613..288672,
FT                   288700..288768,288802..288870)
FT                   /note="11 probable transmembrane helices predicted for
FT                   BP1919 by TMHMM2.0 at aa 7-29, 44-66, 78-100, 138-160,
FT                   167-189, 225-256, 268-290, 305-327, 334-353, 363-385 and
FT                   397-419"
FT   misc_feature    287998..288483
FT                   /note="HMMPfam hit to PF00597, DedA family"
FT   CDS_pept        288911..289894
FT                   /transl_table=11
FT                   /locus_tag="BP1920"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti putative ABC
FT                   transporter periplasmic solute-binding protein Smb20036
FT                   TR:CAC48439 (EMBL:AL603642) (338 aa) fasta scores: E():
FT                   4.7e-25, 32.12% id in 330 aa, and to Bacillus halodurans
FT                   C4-dicarboxylate transport system bh0701 TR:Q9KEZ8
FT                   (EMBL:AP001509) (341 aa) fasta scores: E(): 2.1e-23, 31.2%
FT                   id in 282 aa"
FT                   /db_xref="GOA:Q7VX85"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX85"
FT                   /protein_id="CAE42202.1"
FT                   /translation="MNVVKSLFAALALAGASFGASAEPIQINIGHALGDTSSYQVAGLH
FT                   FAELMKQKVGDKVKVTLYPSGGLGGELKLVQGARTGVVDAMIIAQASLENTVREYRVLS
FT                   LPYLFTDYEEANRIMQGPVGDRLLDVLPKYNMVGLGWGAVYARSLASMKPVPDLAAMKG
FT                   LKVRVIQSPGFVEAYRALGSQPTPTAYAELFLSLQNGVVDAAELSPDQTVADGFAEVIK
FT                   YYSVTAAHQLPSLFIISKAKFDRLPEDVRKAVEEAGRESMQVAVKFQDQKLAEAFDVLK
FT                   QRGVQVQYPDQAPLREAARGAWDQIAKAAPGGEQFLVEIEAARAAK"
FT   misc_feature    288911..288976
FT                   /note="Signal peptide predicted for BP1920 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.986 between residues 22 and 23"
FT   CDS_pept        289891..290700
FT                   /transl_table=11
FT                   /gene="bioH"
FT                   /locus_tag="BP1921"
FT                   /product="putative hydrolase"
FT                   /note="Similar to Kurthia sp538-KA26 BioH TR:Q9AJM9
FT                   (EMBL:AB045874) (267 aa) fasta scores: E(): 1.4e-15, 30.36%
FT                   id in 247 aa, and to Caulobacter crescentus hydrolase,
FT                   alpha/beta hydrolase fold family Cc2797 TR:Q9A4N3
FT                   (EMBL:AE005945) (269 aa) fasta scores: E(): 6.7e-19, 36.54%
FT                   id in 249 aa"
FT                   /db_xref="GOA:Q7VX84"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX84"
FT                   /protein_id="CAE42203.1"
FT                   /translation="MIRQRMTDFTVILPDGARLAARETGAGEAVLLVSGLGGTGAFWTP
FT                   VAAGLQGRRCVVFDQRGVAGSTRGDAAVDIARLAADAWAVLDARGIERAHLVGHSTGGC
FT                   IVQEMALSAPARAASLVLGGTWGGRNAYMQSLFAMRAALLAASPALYEQAGAYLSYPAA
FT                   WLLAHPEAVPAAAAPWPAQRVAVVRERIAALLAYDRLDDLPGLDAPALVLGARDDQIVP
FT                   FALQQQLARVLPGAQLRPLEHGGHFFPIVRGADYVAALLDWFGHHSL"
FT   misc_feature    290047..290682
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold"
FT   CDS_pept        290697..291500
FT                   /transl_table=11
FT                   /locus_tag="BP1922"
FT                   /product="putative exported protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa3505 TR:Q9HYA4 (EMBL:AE004771) (267 aa) fasta
FT                   scores: E(): 3.2e-24, 38.88% id in 270 aa, and to
FT                   Methanococcus jannaschii hypothetical protein Mj0915
FT                   SW:Y915_METJA (Q58325) (267 aa) fasta scores: E(): 4.2e-20,
FT                   33.85% id in 257 aa. Also similar to BP0567, 41.036%
FT                   identity in 251 aa overlap."
FT                   /db_xref="GOA:Q7VX83"
FT                   /db_xref="InterPro:IPR002811"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011182"
FT                   /db_xref="InterPro:IPR020626"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VX83"
FT                   /protein_id="CAE42204.1"
FT                   /translation="MTHRIAFIGLGAIASDVAAGLLADAAQPCQLAALTRNAADLPPAL
FT                   AGRVALLDGLPGLLAWRPDLVVEAAGQQAIAEHAEGCLTAGLDMIICSAGALADDALRA
FT                   RLIAAAEAGGARIRVPAGAIAGLDYLQAVAGRDDAEVVYESRKPVAAWRAELPGMGIDP
FT                   DTLAESRTLFSGPAREAALRFPKNLNVAATLALAGIGMTRTRVEVVVDPQARGNQHRIQ
FT                   VRSPLGEMQIELVNAPSPANPKTSWLVAHSVLATIRRHLARFTIG"
FT   misc_feature    290697..290765
FT                   /note="Signal peptide predicted for BP1922 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.986) with cleavage site
FT                   probability 0.626 between residues 23 and 24"
FT   misc_feature    290706..291491
FT                   /note="HMMPfam hit to PF01958, Domain of unknown function
FT                   DUF108"
FT   CDS_pept        291515..292282
FT                   /transl_table=11
FT                   /locus_tag="BP1923"
FT                   /product="probable short chain dehydrogenase"
FT                   /note="Similar to Brevibacterium spHCU cyclohexanol
FT                   dehydrogenase ChnA TR:AAK73164 (EMBL:AF257214) (256 aa)
FT                   fasta scores: E(): 8.4e-30, 42.29% id in 253 aa, and to
FT                   Streptomyces coelicolor probable oxidoreductase Scf41.15
FT                   TR:Q9RJV4 (EMBL:AL117387) (263 aa) fasta scores: E():
FT                   2.4e-31, 45.23% id in 252 aa"
FT                   /db_xref="GOA:Q7VX82"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX82"
FT                   /protein_id="CAE42205.1"
FT                   /translation="MTQRLSGRIAIVTGAGSGIGEATARLMAREGAVVVVADKAIEVAE
FT                   RVAQAIVAEGGRAEARQADVGEAQSVRALVDAVAARWERIDVLVNNAGYGIAATVVDTD
FT                   EADWSALMRVNVDGVFLGCKYVIPIMQRQGAGVIVNTASAGALVGLRQRAAYCASKGAV
FT                   AALTRAMALDHATEGIRINCVAPGTIESPYFREIYARSDDPEALRASLAARQPMNRLGQ
FT                   PEEVARAIVFLASDDASFATGSTLVLDGGLTAA"
FT   misc_feature    291536..292090
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase"
FT   misc_feature    291941..292027
FT                   /note="ScanRegExp hit to PS00061, Short-chain
FT                   dehydrogenases/reductases family signature."
FT   misc_feature    292166..292258
FT                   /note="HMMPfam hit to PF00678,"
FT   CDS_pept        292370..293008
FT                   /transl_table=11
FT                   /locus_tag="BP1924"
FT                   /product="probable TetR-family transcriptional regulator"
FT                   /note="Similar to Burkholderia pseudomallei regulator AmrR
FT                   TR:O87934 (EMBL:AF072887) (187 aa) fasta scores: E(): 0.18,
FT                   26.11% id in 180 aa, and to Agrobacterium tumefaciens
FT                   StrC58 Agr_c_1821p TR:AAK86802 (EMBL:AE008030) (208 aa)
FT                   fasta scores: E(): 0.092, 24.36% id in 197 aa"
FT                   /db_xref="GOA:Q7VX81"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX81"
FT                   /protein_id="CAE42206.1"
FT                   /translation="MKATPAQVPMKERIKEVATDMLIAHGSSGFRFQQIAQALDCTRGN
FT                   IHYHYRHKHELVEDVTIEYCQRTIGHFDQIWLSDSTLSQKIQLSMQFNEMRYLKRNPQG
FT                   DTSHPWSLIARMRLESALITPAAREALARYSHELQRSVVAGVRRAVEKGELRPDTPVEM
FT                   VALPIIEMANSADPITRDAGRFDRLRQMYQAVDRLIHDAYGMAGHRPAP"
FT   misc_feature    292409..292549
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family"
FT   misc_feature    292457..292522
FT                   /note="Predicted helix-turn-helix motif with score 1410
FT                   (+3.99 SD) at aa 46-67, sequence FRFQQIAQALDCTRGNIHYHYR"
FT   CDS_pept        complement(293013..293966)
FT                   /transl_table=11
FT                   /locus_tag="BP1925"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="Similar to Escherichia coli transcriptional
FT                   activator protein LysR or B2839 SW:LYSR_ECOLI (P03030) (311
FT                   aa) fasta scores: E(): 1.7e-20, 30.63% id in 284 aa, and to
FT                   Rhizobium loti transcriptional regulator Mlr7023 TR:Q987J8
FT                   (EMBL:AP003010) (301 aa) fasta scores: E(): 1.9e-20, 31.72%
FT                   id in 290 aa"
FT                   /db_xref="GOA:Q7VX80"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX80"
FT                   /protein_id="CAE42207.1"
FT                   /translation="MSPLPVGLAKPKALHEPSFAQLGVFHAIMITSSVSRAARLMGMTQ
FT                   SAASKMLRQLEDDTGLRLFERQHQRLVPTPHAQGLQDSVEQLYGAYGVVQRQINSLADP
FT                   DTGHVNVAAIPTQATTFLPQAIKRLRERYQGITVTVEILANQPIVDRVQSGQADFGLVH
FT                   DITPSVSTLNEDLGLQHVVCVAPAGHRYAGLPHVAAHDLRNETFLSYGPQTNFGAMLET
FT                   AFASAGVRMPVAVEVTSSAALLALIRAGVGVGLVEPAAIAPFGATGFVIKPFLPALPVR
FT                   SRIVRSRLRPLTRHAELLLEAYRAVVLQARPDSFQA"
FT   misc_feature    complement(293484..293912)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family"
FT   misc_feature    complement(293778..293870)
FT                   /note="ScanRegExp hit to PS00044, Bacterial regulatory
FT                   proteins, lysR family signature."
FT   misc_feature    complement(293808..293873)
FT                   /note="Predicted helix-turn-helix motif with score 1505
FT                   (+4.31 SD) at aa 44-65, sequence SSVSRAARLMGMTQSAASKMLR"
FT   CDS_pept        294078..295202
FT                   /transl_table=11
FT                   /locus_tag="BP1926"
FT                   /product="putative extracellular solute-binding protein"
FT                   /note="Similar to Rhizobium loti ABC transporter, binding
FT                   protein Mlr7676 TR:Q985H2 (EMBL:AP003012) (370 aa) fasta
FT                   scores: E(): 5.6e-54, 41.92% id in 353 aa, and to
FT                   Agrobacterium tumefaciens StrC58 Agr_l_1237p TR:AAK89196
FT                   (EMBL:AE008260) (336 aa) fasta scores: E(): 7.3e-34, 34.81%
FT                   id in 316 aa"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX79"
FT                   /protein_id="CAE42208.1"
FT                   /translation="MKMSVPQDGWLADAAELALQSPGLTSARRRQLLGMLGAAGLASLA
FT                   PMRPAAAAADRIVVYNWGGDAIKNQPLVWGKPYEKATGTKVEFDGTGPSFGKIRTMVES
FT                   RNVAWDVCDANLAAGHSLGKRGYLEPIDYSVVDRNKVRPGFSSEFGVSHFIYSFVLTYD
FT                   KKAFGDRPPRTWADFWNTKDFPGTRILPDRVLATLEAALMADGVPADASQLYPIDERRA
FT                   LDKIAAIKDKTIFWKTGAESQQLLRQGEATMGLVWHTRATVMRREPGSTIDFTWNQGIL
FT                   IPAGWLVPKGNPAGRKVFDFIASTQSPESQIELLRLMGNGPANPAANALVPPELRQDNP
FT                   TDEENFRQQVVANYTWHGDNQDRIYNEYVKVITG"
FT   CDS_pept        join(295213..296436,296436..296837)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1927"
FT                   /product="conserved hypothetical protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 408. The sequence has been checked
FT                   and believed to be correct. Similar to Rhizobium meliloti
FT                   hypothetical protein Sma0101 TR:AAK64708 (EMBL:AE007199)
FT                   (541 aa) fasta scores: E(): 6.5e-27, 32.35% id in 547 aa,
FT                   and to Caulobacter crescentus hypothetical protein Cc0658
FT                   TR:Q9AAE4 (EMBL:AE005742) (544 aa) fasta scores: E():
FT                   3.4e-26, 31.12% id in 543 aa"
FT                   /db_xref="PSEUDO:CAE42209.1"
FT   variation       296433..296435
FT                   /note="(C)3 in pertussis; (C)3(GAGCGCGGAAATGGCC) in
FT                   parapertussis and bronchiseptica"
FT   CDS_pept        296840..297667
FT                   /transl_table=11
FT                   /locus_tag="BP1928"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="Similar to Rhizobium loti ABC transporter, permease
FT                   protein Mlr7677 TR:Q985H1 (EMBL:AP003012) (277 aa) fasta
FT                   scores: E(): 3.1e-35, 39.62% id in 265 aa, and to Rhizobium
FT                   loti Mll2950 protein TR:Q98HA9 (EMBL:AP003000) (294 aa)
FT                   fasta scores: E(): 3.3e-35, 41.98% id in 262 aa"
FT                   /db_xref="GOA:Q7VX78"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX78"
FT                   /protein_id="CAE42210.1"
FT                   /translation="MRRSLPALLVLPAAVLIGGMFLLPVLRILAISFTEPHAGLGNYAA
FT                   LFTEPLYLKIMATTARICAWTTLIALGLGYVLAYVMANSSPRMRSWMIIGLLVPFWLSV
FT                   LVRAFAWVLLLAREGPVNATLMALGVIDSPLALLRNETGVLIGMVHYMIPYAVLPMLTN
FT                   MLGIDRSLMAAARALGAGPVATFLRVYLPLSLPGVLAAGVLVFIFSLGFFITPALLGGG
FT                   KTVMVAQYIEFGISETMNWGISTAFAATLLVAVIMSLVLVSRVVRVPSLFGAP"
FT   misc_feature    296840..296929
FT                   /note="Signal peptide predicted for BP1928 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.973) with cleavage site
FT                   probability 0.689 between residues 30 and 31"
FT   misc_feature    join(296858..296926,297011..297079,297116..297184,
FT                   297272..297340,297431..297499,297557..297625)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP1928 by TMHMM2.0 at aa 7-29, 58-80, 93-115, 145-167,
FT                   198-220 and 240-262"
FT   misc_feature    297326..297535
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   misc_feature    297488..297511
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        297664..298467
FT                   /transl_table=11
FT                   /locus_tag="BP1929"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="Similar to Rhizobium loti ABC transporter, permease
FT                   protein Mll2949 TR:Q98HB0 (EMBL:AP003000) (265 aa) fasta
FT                   scores: E(): 3.9e-31, 40.4% id in 250 aa, and to
FT                   Pseudomonas aeruginosa probable permease of ABC transporter
FT                   Pa0606 TR:Q9I5T2 (EMBL:AE004497) (276 aa) fasta scores:
FT                   E(): 3.3e-30, 38.4% id in 263 aa"
FT                   /db_xref="GOA:Q7VX77"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX77"
FT                   /protein_id="CAE42211.1"
FT                   /translation="MSVRPSWWFAAAAVVAALVLAFLFLPALVVIPVSFTDRSYLSFPA
FT                   ESWSWQHYRQLVDSPVWRGSLLQSVAVSAVSTLAATLLGAAAAIGAWRLGARLGALVRL
FT                   LALLPLIVPTIVGALAYYRLYIDLGLLDTFTGVVIAHVVAAMPFVFVSVGSALANFDPR
FT                   LEQAARSMGARPWQVLWRITLPGVRSGLVSGAIFAFIVSWDELVVLLFVTTRNVYLLPR
FT                   AMWDGINENVDPTIAAVATLMIVITFIRLCAERLLAHHRQKQELS"
FT   misc_feature    297664..297750
FT                   /note="Signal peptide predicted for BP1929 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.857 between residues 29 and 30"
FT   misc_feature    join(297682..297750,297871..297939,297958..298026,
FT                   298069..298137,298198..298266,298363..298422)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP1929 by TMHMM2.0 at aa 7-29, 70-92, 99-121, 136-158,
FT                   179-201 and 234-253"
FT   misc_feature    298129..298350
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component"
FT   misc_feature    298132..298218
FT                   /note="ScanRegExp hit to PS00402, Binding-protein-dependent
FT                   transport systems inner membrane comp. sign."
FT   CDS_pept        298464..299555
FT                   /transl_table=11
FT                   /locus_tag="BP1930"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /note="Similar to Rhizobium loti ABC transporter,
FT                   ATP-binding protein Mll2948 TR:Q98HB1 (EMBL:AP003000) (371
FT                   aa) fasta scores: E(): 3.5e-46, 43.86% id in 367 aa, and to
FT                   Pseudomonas aeruginosa probable ATP-binding component of
FT                   ABC transporter Pa0603 TR:Q9I5T5 (EMBL:AE004496) (369 aa)
FT                   fasta scores: E(): 8.6e-46, 43.37% id in 362 aa"
FT                   /db_xref="GOA:Q7VX76"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX76"
FT                   /protein_id="CAE42212.1"
FT                   /translation="MTAAATTPTPLLRVRALNKRFGAFQALRGVDFELGAGEFLTLLGP
FT                   SGSGKTTTLMSIAGFVAPTSGDILYQGASITGQAPEARGFGMVFQGYALFPHMTVEQNV
FT                   RFPLAIRGVGREQARRRAQQALEQVQLGSYGARYPRQLSGGQQQRVALARALVYDLRIL
FT                   LLDEPLSALDKKLRADLQWELRKLNKESGASFLYVTHDQEEALSMSDRIAIFNEGGIAQ
FT                   IGSPTELYERPANLFVAGFLGRSNVLAGKVRQAGADGVAVEYEGGVLEVPKPRRQYAPG
FT                   EAVSLVVRPHQMRLDAAGRQGLAAKVEAISYAGNLMNYLLRTPRGTALFAEAVAGAGAA
FT                   LRQDDLVSVGLDAAAVSLLEAAD"
FT   misc_feature    298572..299117
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    298593..298616
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    298887..298931
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature. Confirmed by InterPro eMOTIF pattern match."
FT   tRNA            299637..299713
FT                   /note="tRNA Arg anticodon ACG, Cove score 86.25"
FT   CDS_pept        complement(299962..300990)
FT                   /transl_table=11
FT                   /locus_tag="BP1931"
FT                   /product="probable NADH-dependent flavin oxidoreductase"
FT                   /note="Similar to Vibrio cholerae NADH-dependent flavin
FT                   oxidoreductase, Oye family Vca0998 TR:Q9KKV2
FT                   (EMBL:AE004426) (347 aa) fasta scores: E(): 1.1e-27, 35.46%
FT                   id in 344 aa, and to Xylella fastidiosa NAD Xf1732
FT                   TR:Q9PCP6 (EMBL:AE003996) (368 aa) fasta scores: E():
FT                   5.4e-26, 35.92% id in 348 aa"
FT                   /db_xref="GOA:Q7VX75"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX75"
FT                   /protein_id="CAE42213.1"
FT                   /translation="MNLLSPIDIAGIALRNRIAVAPMSRTQADAHGHPAAETAAYYARY
FT                   ARHGAGLVITEALYTAGPAARAYFNQPGLASEAQAEHWRAAVRAVHQEGGRVIAQLQHA
FT                   GKLAEPGLHARPLGLVDGAAQGLSWQTQQPNAPAHAATAEEIERIIEGFALSARLAHYA
FT                   GFDGVEIHGARGYLVNDFLSAYNVRDDEWGADRARIAEAVLRAVRQACPLPIGFNYSIY
FT                   KMDEYRYQPPGGGAEIAALLARLCQAGADILHISSRRVLKPEPWGGLLAQLARAAAPKA
FT                   LMVNGGLATLQDCETVLAATQADLVSLARPFLANPDWLARSLAGEPLRAYEPGMEQRPL
FT                   LD"
FT   misc_feature    complement(300004..300987)
FT                   /note="HMMPfam hit to PF00724, NADH:flavin oxidoreductase /
FT                   NADH oxidase family"
FT   CDS_pept        complement(join(300987..301148,301152..301853))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1932"
FT                   /product="probable transcriptional regulator (pseudogene)"
FT                   /note="Pseudogene. This CDS contains an in-frame TGA stop
FT                   codon at position 235. The sequence has been checked and
FT                   believed to be correct. Similar to Pseudomonas putida pca
FT                   regulon regulatory protein PcaR SW:PCAR_PSEPU (Q52154) (291
FT                   aa) fasta scores: E(): 2.8e-28, 41.93% id in 217 aa, and to
FT                   Rhizobium loti transcriptional regulator, PcaR Mlr4184
FT                   TR:Q98EM2 (EMBL:AP003003) (256 aa) fasta scores: E():
FT                   2.5e-28, 39.46% id in 223 aa"
FT                   /db_xref="PSEUDO:CAE42214.1"
FT   variation       complement(301149..301151)
FT                   /note="In-frame TGA stop codon in pertussis; TGG in
FT                   parapertussis and bronchiseptica"
FT   misc_feature    complement(301152..301652)
FT                   /note="HMMPfam hit to PF01614, Bacterial transcriptional
FT                   regulator"
FT   misc_feature    complement(301698..301763)
FT                   /note="Predicted helix-turn-helix motif with score 1388
FT                   (+3.91 SD) at aa 31-52, sequence LTLAEAAYRTGLSRAAARRVLL"
FT   CDS_pept        complement(301862..303982)
FT                   /transl_table=11
FT                   /locus_tag="BP1933"
FT                   /product="putative pimeloyl-CoA synthetase"
FT                   /note="Similar to Pseudomonas mendocina pimeloyl-CoA
FT                   synthetase TR:Q9ZER2 (EMBL:AJ012480) (711 aa) fasta scores:
FT                   E(): 1.5e-62, 35.15% id in 694 aa, and to Pseudomonas
FT                   aeruginosa pimeloyl-CoA synthetase pa1017 TR:Q9I4V6
FT                   (EMBL:AE004534) (715 aa) fasta scores: E(): 1.1e-62, 34.97%
FT                   id in 712 aa"
FT                   /db_xref="GOA:Q7VX74"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX74"
FT                   /protein_id="CAE42215.1"
FT                   /translation="MSTLADNAPRMAGAGDWIDAALAPRSVAIVGASDNPEKIGGRPIK
FT                   YMLQHGYQGRILPINPGRDRVQGIAAWHSLDAVNVPIDMLLVCVAGEAAVQAVRDGARL
FT                   GVRVCVVISSGFAETGEPGRQAQKHMKAAAAAAGMRLLGPNTQGLANFSNGALATFATL
FT                   LGEVAPADGPVAVISQSGAMSMVPYAHLRAEGIGVRYSVATGNECDLNVADFTEAVLRD
FT                   PEVRLILLYMESLPAPATLARAAALARSRQVPVLALKAGVSPQGLQAAQSHTGAIATED
FT                   KALDAWFRQHGILRVPDARSLVMGAQLLLRCGHLPGNRLAILSNSGAACVTGADAAERH
FT                   GLQVPPLPAETRARIDAVLPGFASSLNPIDLTAALLSNNHLFGQVLPILASARACDALF
FT                   ITLPMSGKGYDTDQFARDAAAFTAETGLPVVVSCPLAASRRIFAQAGLATFEHDEDALA
FT                   ALGQLARLSGLRETALRLARPAPHAPAAPVPRTAGLLSEADSLEQIEAIGIRTAPWRLC
FT                   LDADSMGSALGSLPGPWAVKACSAQIPHKSEYGLVHLGIADEQRARALFPVLRQEVLGM
FT                   GKSFDGVIVASMVKPRREFMIGARWDSQFGCIVIVGDGGKYVEAMPDVATLVYPFDQAH
FT                   AEECLRKLRVAALFDGVRGENPLPVQELAHAATRLGAWLHAQQGAVASVDINPLIAGPD
FT                   GRLYAADALVEI"
FT   misc_feature    complement(303575..303913)
FT                   /note="HMMPfam hit to PF02629, CoA binding domain"
FT   CDS_pept        complement(303983..304939)
FT                   /transl_table=11
FT                   /locus_tag="BP1934"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Sma1927 TR:Q92Y30 (EMBL:AE007292) (330 aa) fasta scores:
FT                   E(): 1.1e-48, 47.26% id in 311 aa, and to Agrobacterium
FT                   tumefaciens StrC58 Agr_l_312p TR:AAK88723 (EMBL:AE008213)
FT                   (329 aa) fasta scores: E(): 3.6e-43, 41.08% id in 314 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX73"
FT                   /protein_id="CAE42216.1"
FT                   /translation="MKWIASMALALCAGGAFAADYPARPITLIVPYGPGGTNDILARAI
FT                   ANKISPTLGQTVVVNNRPGAGGNIGAQQVATAEPDGYTLLLASSGVFAVNKWLYRSLRY
FT                   DPAQAFAPVILAGSVPNVLIVDTEVPAKTLPELVKYAKSAQPSLNYASMGTGTSGHLCA
FT                   ELFKAQAGIEAEHIAYPGSAAALTALLGHQVQLMCDNLPTALPQIKAGRARALAVSSAE
FT                   RAPLLPDTPTVAESGFPGFDATAWFGIAAPAGTPAPIVERLNKEINAALQAPDVARILG
FT                   EQGVSFRPNTPAQFSQFISAESAKWRDVIERTGSRAD"
FT   misc_feature    complement(304886..304939)
FT                   /note="Signal peptide predicted for BP1934 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 18 and 19"
FT   CDS_pept        complement(305008..305400)
FT                   /transl_table=11
FT                   /locus_tag="BP1935"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Sma2289 TR:AAK65890 (EMBL:AE007308) (130 aa) fasta scores:
FT                   E(): 2.1e-10, 34.4% id in 125 aa, and to Streptomyces
FT                   coelicolor conserved hypothetical protein Sc9c7.14C
FT                   TR:Q9ZBJ6 (EMBL:AL035161) (132 aa) fasta scores: E():
FT                   2e-09, 37.81% id in 119 aa"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX72"
FT                   /protein_id="CAE42217.1"
FT                   /translation="MHSSLQAVLPPGANPNSTFSPAVRAGGFLYISGMTALNEQREIVG
FT                   VGDIAAQARYIYQKIAAILAQAGGNLSQVVETVDYVTTFDGYGQTADVRREVFGAGPFP
FT                   AATGVLVSGLVRPAALIEIRAVAYLG"
FT   misc_feature    complement(305014..305370)
FT                   /note="HMMPfam hit to PF01042, YjgF family"
FT   CDS_pept        complement(305404..305880)
FT                   /transl_table=11
FT                   /locus_tag="BP1936"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical 15.2
FT                   kDa protein Scd82.08 TR:Q9L0M3 (EMBL:AL160431) (142 aa)
FT                   fasta scores: E(): 0.0063, 26.38% id in 144 aa"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX71"
FT                   /protein_id="CAE42218.1"
FT                   /translation="MQPPRQLAAADLAVGQVVAQREIRLDAQAFAQFAALTGDAHPIHY
FT                   DAGYAQRQGLRAPIAHGLLLVAISALGATPLSAQLHDAMVAMVDVEAVFMRPVYVDETV
FT                   QCVYRVAQIEHVAKGRSKTTIEVSIHTTDAPPDAARQAHCVVHLTFLLKTHLQG"
FT   misc_feature    complement(305485..305850)
FT                   /note="HMMPfam hit to PF01575, MaoC like domain"
FT   CDS_pept        complement(305894..306229)
FT                   /transl_table=11
FT                   /locus_tag="BP1937"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX70"
FT                   /protein_id="CAE42219.1"
FT                   /translation="MQRTLDITQAMIDGYGRINGDNDIIHYDHDYAVQRGFRGTLLHGP
FT                   HMTALAADLGARRYASDWLYRGKLHTKWIGPVCPGDTFVAALNEQGEIEAVSGGKTVMV
FT                   GSASLAD"
FT   CDS_pept        complement(306236..306685)
FT                   /transl_table=11
FT                   /locus_tag="BP1938"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX69"
FT                   /protein_id="CAE42220.1"
FT                   /translation="MTRPSDIKPREGDTPGTPYAAFVEGAALGPVSFDITPAIVQEYFE
FT                   ASQADPALYRVDVRQAAAPNVILPYMTVPVYQTYPPIQGIVMAELEMSWHRPIWADETT
FT                   RVTATGTILRKFEKRGRRYVQWEGRFRGADGQPIATLLNTFHVPE"
FT   CDS_pept        306893..307192
FT                   /transl_table=11
FT                   /locus_tag="BP1939"
FT                   /product="putative ArsR-family transcriptional regulator"
FT                   /note="Similar to Rhizobium meliloti putative transcription
FT                   regulator protein Smc01226 TR:CAC46144 (EMBL:AL591787) (96
FT                   aa) fasta scores: E(): 1.5e-27, 72.04% id in 93 aa, and to
FT                   Pseudomonas aeruginosa hypothetical protein Pa4354 R:Q9HW47
FT                   (EMBL:AE004851) (100 aa) fasta scores: E(): 1.6e-23, 60% id
FT                   in 100 aa"
FT                   /db_xref="GOA:Q7VX68"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX68"
FT                   /protein_id="CAE42221.1"
FT                   /translation="MAINTEDILKALAHPARRNILAWLKEPQRHFPQQEHPLELGVCAG
FT                   QFERCGLSQSTVSTHLAILQRAGLIHSRRVGQWVFYQRNEACIAEFLQTMQAEL"
FT   misc_feature    306917..307186
FT                   /note="HMMPfam hit to PF01022, Bacterial regulatory
FT                   protein, arsR family"
FT   misc_feature    307013..307078
FT                   /note="Predicted helix-turn-helix motif with score 1176
FT                   (+3.19 SD) at aa 41-62, sequence GVCAGQFERCGLSQSTVSTHLA"
FT   CDS_pept        307245..308357
FT                   /transl_table=11
FT                   /gene="nemA"
FT                   /locus_tag="BP1940"
FT                   /product="N-ethylmaleimide reductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="Similar to Escherichia coli N-ethylmaleimide
FT                   reductase NemA or B1650 SW:NEMA_ECOLI (P77258) (365 aa)
FT                   fasta scores: E(): 7.3e-64, 51.74% id in 373 aa, and to
FT                   Rhizobium loti morphinone reductase Mll2211 TR:Q98IX0
FT                   (EMBL:AP002999) (371 aa) fasta scores: E(): 5.3e-102,
FT                   71.96% id in 371 aa"
FT                   /db_xref="GOA:Q7VX67"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX67"
FT                   /protein_id="CAE42222.1"
FT                   /translation="MSTLFQPLNAGKLRLANRIVMAPLTRNRSPNAVPPPLTATYYAQR
FT                   ASAGLIITEATAISHQGQGYADVPGLYAPEQLAGWRRVTDAVHAAGGTIVVQLWHVGRI
FT                   SHTTLQPGQGAPVAPSAIRAQARTYLVDAQGKGQFADTSEPRALALDELPGIVEDYRRA
FT                   ARAAIDHGFDGVELHAANGYLLDQFLRSGSNHRDDAYGGSIENRARLLLRALDAVCAEV
FT                   GADRVGIRLSPVTPANDAHDDQPQPLFEYVLRELARRGLAYVHVIEGATGGDRAYQQGP
FT                   APFDYAALKAAYRAAGGAGAWMVNNGYDISLAEQKLSSGQADLVAFGKPFIANPDLVAR
FT                   LRQGAALNEGDRDTFYGGGERGYTDYPALA"
FT   misc_feature    307251..308288
FT                   /note="HMMPfam hit to PF00724, NADH:flavin oxidoreductase /
FT                   NADH oxidase family"
FT   CDS_pept        complement(308362..308952)
FT                   /transl_table=11
FT                   /locus_tag="BP1941"
FT                   /product="putative membrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="GOA:Q7VX66"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX66"
FT                   /protein_id="CAE42223.1"
FT                   /translation="MHQHGVADGLLYGCWYRIVRPLLVILTWVAFSLYIHHSLVTVGGT
FT                   AAQIAELLVYITVVATMAAALTAWMIVCRFHGWIRARDNEEVGVGLDPEYALPPRWPLP
FT                   EGANRLLVDHDEAGAIVQVSAWYVPAAIEPVVAAAMASAVMPEAAPLSEPAPVAAALPD
FT                   EADELAAWSGPPMQRQPDGRIEPTLHDGRALTL"
FT   misc_feature    complement(join(308737..308796,308833..308898))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BP1941 by TMHMM2.0 at aa 31-53 and 65-85"
FT   CDS_pept        complement(308981..310240)
FT                   /transl_table=11
FT                   /gene="hmsR"
FT                   /locus_tag="BP1942"
FT                   /product="putative glycosyl transferase"
FT                   /note="Similar to Staphylococcus caprae IcaA TR:Q9AIQ8
FT                   (EMBL:AF246926) (411 aa) fasta scores: E(): 1.1e-55, 37.28%
FT                   id in 405 aa, and to Yersinia pestis HmsR TR:Q56941
FT                   (EMBL:U22837) (457 aa) fasta scores: E(): 2.7e-76, 48.66%
FT                   id in 411 aa"
FT                   /db_xref="GOA:Q7VX65"
FT                   /db_xref="InterPro:IPR023853"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX65"
FT                   /protein_id="CAE42224.1"
FT                   /translation="MNDSVKSVLSSFVFYYPFFMSYFWIVGGLLHFFLFEQGRKHRATL
FT                   LPRVPRVAIVVPCYNEGENVAEVIAHLDRMHYPNYRIIAVNDGSRDNTGALLNELAEQY
FT                   PRLLVVHQSRNEGKAIGLNTAAQLSDAEFLLCIDGDSLPHPDSITYMLTHFLHAGHVGA
FT                   VTGNPRIRNRSTVLGRMQVGEFSSIVGLIKRTQQLYGKLMTVSGVMTMFRKQALHQVGY
FT                   WSPDMQTEDIDISWKLQLAGWTLRYEPRALTWILMPETFRGLFKQRYRWARGGIETALK
FT                   YAPRMLNPRQILMWPIFLEFSLSVLWAYAMLFLICMAVLGQFVALPPAWQFEIFPRWHG
FT                   TLLFLTCLAQLFAGCIVDRAYDYRIFRYFADAVWYPIAFWIIGMITTVFALPRVLFRRA
FT                   QSRARWVSPDRGIKHESVDH"
FT   misc_feature    complement(join(309059..309124,309170..309226,
FT                   309263..309328,310139..310204))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BP1942 by TMHMM2.0 at aa 12-34, 304-326, 338-357 and
FT                   372-394"
FT   misc_feature    complement(309578..310084)
FT                   /note="HMMPfam hit to PF00535, Glycosyl transferase"
FT   CDS_pept        complement(310244..312349)
FT                   /transl_table=11
FT                   /gene="hmsF"
FT                   /locus_tag="BP1943"
FT                   /product="putative hemin storage protein"
FT                   /note="Similar to Yersinia pestis HmsF protein TR:Q9R7V4
FT                   (EMBL:AL031866) (673 aa) fasta scores: E(): 1.3e-94, 40.2%
FT                   id in 679 aa, and to Escherichia coli hypothetical
FT                   lipoprotein YcdR precursor YcdR or B1023 SW:YCDR_ECOLI
FT                   (P75906) (672 aa) fasta scores: E(): 3.3e-89, 39.38% id in
FT                   655 aa"
FT                   /db_xref="GOA:Q7VX64"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR023854"
FT                   /db_xref="InterPro:IPR032772"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX64"
FT                   /protein_id="CAE42225.1"
FT                   /translation="MTAMHRTLLKWFACCALGLLMLPARAYKVDMLPPPDPDDGLTFRV
FT                   LCMHDVRDNLRASFADMPDQFAIETRTLTDLFEWIRVKGFNLISMQQIIDSRAGVRPLP
FT                   PRPILLTFDDGYASTYTKVFPLLKKFNYPAVVAVVTSWTDAPAGTKIRLSPKIEVPHDF
FT                   FMTWAQLREMAQSGLVELASHSHNLHRGVLANPQGNEQPAASSRQYLPASGRYENDAEY
FT                   RARVRQDLKTSADLIREHTGVTIRSIVWPYGAHNRDTDQVAAEVGLNIGLTLQPGPNTP
FT                   DVSLTQIRRSLVDYEVNVATVARAMREPVSYHGQVRPIERIVQVDLDYIYDPDPEQQNR
FT                   NLGQLIDRMKDLAPSAVYLQAFAYPKGDGDITEVYFPNRHLPMRADLFNRVAWQLKTRA
FT                   GVMVYAWLPVLTFSVPPGNPAYGKVVQSTTRKPGERGLGSPTRLSPFHPDAHRVISEIY
FT                   EDLAKAAHFDGLLFHDDAVLDDTEDSSPEALATYQGWGLPPDIAAIRADPKLAQQWSKG
FT                   KIRYLIDFTMHLRHIVSGYQNDRDMVVARNLYAQPVLDPVSEAWYGQSLPEFLKSYDFV
FT                   ALMAMPNMEGAARPEQWMRQLVAAVARQKGLDRTIFELQARDWRVGKPIDTEILRKQMV
FT                   QLRSLGAINYGYYPDDFIANHPDAEVLRDVMSLKSTLEKRRLTKAQELSRQTTLYGSAS
FT                   QAEPTQR"
FT   misc_feature    complement(312272..312349)
FT                   /note="Signal peptide predicted for BP1943 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.809 between residues 26 and 27"
FT   CDS_pept        complement(312355..314340)
FT                   /transl_table=11
FT                   /gene="hmsH"
FT                   /locus_tag="BP1944"
FT                   /product="putative hemin storage protein"
FT                   /note="Similar to Yersinia pestis HmsH TR:Q56939
FT                   (EMBL:U22837) (822 aa) fasta scores: E(): 1.5e-25, 24.39%
FT                   id in 701 aa"
FT                   /db_xref="GOA:Q7VX63"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023870"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX63"
FT                   /protein_id="CAE42226.1"
FT                   /translation="MNNDQTRRTRPASVRGLRRTRLLVAGLAFVGAAAAAAPSVRDQVQ
FT                   EASRSGAANLALDLATEHRALFTPLEYAQLQHAAIAQRLRWSRAETWNLTGPERFATLD
FT                   AALADGWQLLDSLPLAPEYASLRTAVISDMIYGLGLRGRYADAIKLYEGLRATNTPVHP
FT                   YVLVSAGNAYAYEERYDEAIVCYEEALAKAGPGDIDRVPTQESLFFAYMDRGRYEDAEQ
FT                   LLQRIEKTSPQYVENAPVAERPNEDYATAQRLRAQYLMYSGETEAGTLAIDALQHDAPF
FT                   SSGLRNAAASARLGDARPREAKAAFTTALAERPDDIQAMTGLARASMALREYPEAEAIV
FT                   TTLSERFPESSSVRNLQRDYEVYQSPLLTMDFGGDIGHGGDNSNNDNSTIANREWSLNT
FT                   MLYTSPISHNYRLFFHQFTGYADLGDGHKSRVRNGAGLEYRRGSIEASTELHQSTGPSG
FT                   RFGASANVAWLPSDGWRLAANFDSDSNDLPWKAYRAGIHGWSSGVSARYQPTERTYYDV
FT                   AYQLQHYSDSNTRQTIGATWFQNLWTVPRHSVSTWTSVAYSNNSKTDTECFSPDHDLTA
FT                   QVTAMYEWRPWRDGQYAFRQRVYATGGVYNQAEHGNSALWQLRLEQVWDLPRQTSITYG
FT                   VGYGRHSYDGDPENRTLFYLTLNIPF"
FT   CDS_pept        314549..314785
FT                   /transl_table=11
FT                   /locus_tag="BP1945"
FT                   /product="putative membrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="GOA:Q7VX62"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX62"
FT                   /protein_id="CAE42227.1"
FT                   /translation="MRRAAKWWGPAATWTLAALLVLLVGHGVVPEAARVSDAPLLHAMA
FT                   GHAYLLNWAAGLMALIGWGDSLVLYRRTRRRAV"
FT   misc_feature    314549..314629
FT                   /note="Signal peptide predicted for BP1945 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.674) with cleavage site
FT                   probability 0.384 between residues 27 and 28"
FT   misc_feature    join(314567..314635,314693..314761)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BP1945 by TMHMM2.0 at aa 7-29 and 49-71"
FT   tRNA            314837..314913
FT                   /note="tRNA Arg anticodon ACG, Cove score 86.25"
FT   CDS_pept        315130..315615
FT                   /transl_table=11
FT                   /locus_tag="BP1946"
FT                   /product="MarR-family transcriptional regulator"
FT                   /note="Similar to Rhizobium loti transcriptional regulator
FT                   Mll4876 TR:Q98D38 (EMBL:AP003005) (153 aa) fasta scores:
FT                   E(): 1.3e-15, 44.44% id in 135 aa, and to Pseudomonas
FT                   aeruginosa probable transcriptional regulator Pa1603
FT                   TR:Q9I3B8 (EMBL:AE004588) (140 aa) fasta scores: E():
FT                   3.1e-12, 37.03% id in 135 aa"
FT                   /db_xref="GOA:Q7VX61"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX61"
FT                   /protein_id="CAE42228.1"
FT                   /translation="MPASQDKPDVPPGPYHFSEQVGHLLRRAYQRHVAIFQQTIPDSKL
FT                   TAAQFVVLCALRDQGACSLVDVVKATAIDQATVRGVIERLKARKLLAVSHDPADRRKVL
FT                   VTLTPDGRALVEEMVPFAEQITQSTFGGLNPAERVAIVYLLRKMSDADDLVGRQSES"
FT   misc_feature    315262..315573
FT                   /note="HMMPfam hit to PF01047, MarR family"
FT   repeat_region   315881..315912
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   315881..316381
FT   CDS_pept        315983..316933
FT                   /transl_table=11
FT                   /locus_tag="BP1947"
FT                   /product="transposase"
FT                   /note="transposase for IS481 element"
FT                   /db_xref="GOA:Q7TTA4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTA4"
FT                   /protein_id="CAE42229.1"
FT                   /translation="MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKW
FT                   LGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVS
FT                   RVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEG
FT                   AGWDFVFVAIDDHARVAFTDIPPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAF
FT                   RSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKS
FT                   WLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS"
FT   misc_feature    316241..316306
FT                   /note="Predicted helix-turn-helix motif with score 2406
FT                   (+7.38 SD) at aa 87-108, sequence LTQARIAQALGVSASTVSRVLA"
FT   misc_feature    316364..316897
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   316382..316933
FT   repeat_region   complement(316902..316933)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   CDS_pept        316980..318188
FT                   /transl_table=11
FT                   /locus_tag="BP1948"
FT                   /product="branched-chain amino acid-binding protein"
FT                   /note="Similar to Pseudomonas aeruginosa leucine-,
FT                   isoleucine-, valine-, threonine-, and alanine-binding
FT                   protein precursor BraC or Pa1074 SW:BRAC_PSEAE (P21175)
FT                   (373 aa) fasta scores: E(): 3.9e-12, 24.37% id in 357 aa,
FT                   and to Streptococcus pneumoniae branched-chain amino acid
FT                   ABC transporter, amino acid-binding protein Sp0749
FT                   TR:Q97RQ0 (EMBL:AE007382) (386 aa) fasta scores: E():
FT                   9.5e-12, 24.3% id in 362 aa"
FT                   /db_xref="GOA:Q7VX60"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX60"
FT                   /protein_id="CAE42230.1"
FT                   /translation="MNGRNRYARLLGATCLTLLGASAWAQDTIKIGEINSYKSQPAFLE
FT                   PYKKGMQLALDEVNDAGGIAGKKLELVIRDDNANPGEAVRAAEELISRERVDMLTGSFL
FT                   SHIGLALTDFAKQKKVFFLASEPLTDKIVWQDGNRYTYRLRTSTYMQVAMLVPEALKLK
FT                   KKRWAIVYPNYEYGQSAVATFKTLMKAGQPDIEFVSEQAAPLGKVDAGSVVQALADSKP
FT                   DAIFNVLFAADVTKFVREGTTRGLFKDRPVVSVLTGEPEYLDTFRDETPAGWIVTGYPW
FT                   QFIETPEHQAFLKAYQAKFKDYPRLGSVVGYSAIKSLAEGIKRAGGKTDTESMIKAFAG
FT                   LKLTIPFGPIEYRTLDNQSTMGAYVGKLASKDGKGVMVDFRYVDGAAAQPSDEEVRKLR
FT                   KAD"
FT   misc_feature    316980..317054
FT                   /note="Signal peptide predicted for BP1948 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 25 and 26"
FT   CDS_pept        318280..320229
FT                   /transl_table=11
FT                   /locus_tag="BP1949"
FT                   /product="putative permease component of branched-chain
FT                   amino acid transport system"
FT                   /note="Similar to Pseudomonas aeruginosa putative membrane
FT                   spanning protein OhbE TR:O87621 (EMBL:AF087482) (614 aa)
FT                   fasta scores: E(): 1e-31, 31.4% id in 449 aa"
FT                   /db_xref="GOA:Q7VX59"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX59"
FT                   /protein_id="CAE42231.1"
FT                   /translation="MDLTGFLAQLLNGLAEASSLFLVAAGLSLIFGVTRIVNFAHGSLY
FT                   MLGVYVAYSIVERVGGTALGFWFGLVAASLAVGVVGAAIEVVLLRRIYRAPELFQLLAT
FT                   FALVLVINDAALWIWGAEDLLGRRAPGLTGAIDLLGRRYPVYNLVLIVVGPVVLGLLWL
FT                   LLTRTRWGTLVRAATQDREMLGALGVNQAWLFTGVFALGAMLAGLGGALQLPREPASLS
FT                   LDLRTIGDAFVIVVVGGMGSIPGAYVAALIIAEIKALCIGLGTVTLLGLSISFSKLTLV
FT                   VEFAFMALVLVFRPWGLFGRPQGASRNSAPIEAPLRPAAPRLRILWGVLLASLAVLPLL
FT                   AQWLPYAVVLTQDILIAVLFAVSLHFMMGPGGMHSFGHAAYFGLGAYGAALLLKAASLP
FT                   MEAALAFAPLVGALGALVFGWFCVRLSGVYLAMLTLAFSQIVWSVVFQWDDFTGGSNGM
FT                   IGVWPAEWLSGTAYYYLALAVVAAAVLGLRRVLFSPFGYAMRAGRDSSLRADAIGIDVK
FT                   RVQWAAFVVAGAFGGLAGALYAFSKGSISPDTMAVSKSVDGLVMVLLGGIQTLIGPVVG
FT                   ATAFNVLQDYIMRATEYWRALFGGVILLLVLVFPQGIAGFCRQAGQWWSARAGKDRPPR
FT                   KGGAFIGGPREKQA"
FT   misc_feature    318295..319188
FT                   /note="HMMPfam hit to PF02653, Branched-chain amino acid
FT                   transport system / permease component"
FT   misc_feature    join(318307..318375,318394..318447,318475..318543,
FT                   318580..318639,318706..318774,318835..318903,
FT                   318970..319038,319057..319125,319252..319320,
FT                   319339..319407,319483..319542,319555..319623,
FT                   319687..319755,319834..319902,319960..320028,
FT                   320065..320124)
FT                   /note="16 probable transmembrane helices predicted for
FT                   BP1949 by TMHMM2.0 at aa 10-32, 39-56, 66-88, 101-120,
FT                   143-165, 186-208, 231-253, 260-282, 325-347, 354-376,
FT                   402-421, 426-448, 470-492, 519-541, 561-583 and 596-615"
FT   misc_feature    319294..320133
FT                   /note="HMMPfam hit to PF02653, Branched-chain amino acid
FT                   transport system / permease component"
FT   CDS_pept        320226..321002
FT                   /transl_table=11
FT                   /locus_tag="BP1950"
FT                   /product="putative ATP-binding component of branched-chain
FT                   amino acid ABC transporter"
FT                   /note="Similar to Streptococcus pneumoniae branched-chain
FT                   amino acid ABC transporter, ATP-binding protein sp0752
FT                   TR:Q97RP7 (EMBL:AE007382) (254 aa) fasta scores: E():
FT                   1.2e-30, 42.23% id in 251 aa, and to Rhizobium meliloti
FT                   putative high-affinity branched-chain amino acid transport
FT                   ATP-binding ABC transporter protein smc02357 TR:CAC47163
FT                   (EMBL:AL591791) (244 aa) fasta scores: E(): 3e-27, 40.98%
FT                   id in 244 aa"
FT                   /db_xref="GOA:Q7VX58"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX58"
FT                   /protein_id="CAE42232.1"
FT                   /translation="MSLLQVRNLSKAFGGVRAVDDISFDLAAGELLALIGPNGAGKSTT
FT                   FNMVGGQLPATTGSVRLDGHELVGMRPRDIWRLGVGRTFQIAATFASLTVVENVQMALL
FT                   SHHRRIFSFGSLAARQYREPALALLEQVGMRDQAERPCSELAYGDVKRVELAMGLANDP
FT                   KLLLMDEPTAGMAPQERNALMALTKRLVVDRGMAVLFTEHSMDVVFAYADRMIVLARDR
FT                   LIAEGGAQEIRNHPKVQEVYFGTGKTFEKHSAGAAA"
FT   misc_feature    320310..320888
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    320331..320354
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   CDS_pept        320999..321769
FT                   /transl_table=11
FT                   /locus_tag="BP1951"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /note="Similar to Pseudomonas aeruginosa putative substrate
FT                   binding protein OhbG TR:O87623 (EMBL:AF087482) (239 aa)
FT                   fasta scores: E(): 5.2e-31, 46.44% id in 239 aa, and to
FT                   Rhizobium meliloti putative ATP-binding ABC transporter
FT                   protein Smc03119 TR:CAC47553 (EMBL:AL591792) (233 aa) fasta
FT                   scores: E(): 9.8e-31, 43.69% id in 238 aa"
FT                   /db_xref="GOA:Q7VX57"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX57"
FT                   /protein_id="CAE42233.1"
FT                   /translation="MSTVAEPTRAAAATQAPALLRVAGLNAWYGAAHILFDVDLEVRRG
FT                   EVVALMGRNGAGKSTTFKAVMGLLAKRRGAVEFMGRDIAGLQPFEIARLGLGFVPEDRR
FT                   VFTDLTVTENLEVGRQPARRWPDGSAAPNWQPGALYELFPNLGAMQDCPGGQMSGGEQQ
FT                   MLTVARTLMGNPFLVLLDEPSEGVAPVIVEQMAGMILALKAQGASILLSEQNVHFAELV
FT                   SDRVYVLEKGQIRYSGSMAELADNEEVRRAYLTV"
FT   misc_feature    321131..321694
FT                   /note="HMMPfam hit to PF00005, ABC transporter"
FT   misc_feature    321152..321175
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   misc_feature    321467..321511
FT                   /note="ScanRegExp hit to PS00211, ABC transporters family
FT                   signature."
FT   CDS_pept        complement(join(321924..322373,322372..324216))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1952"
FT                   /product="putative cytochrome (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 615. The sequence has been checked
FT                   and believed to be correct. Weakly similar to Rhizobium
FT                   meliloti putative aldehyde dehydrogenase protein Smb20404
FT                   TR:CAC48790 (EMBL:AL603643) (746 aa) fasta scores: E():
FT                   4.2e-12, 30.36% id in 550 aa, and to Escherichia coli
FT                   hypothetical protein YagR or B0284 SW:YAGR_ECOLI (P77489)
FT                   (732 aa) fasta scores: E(): 5.9e-06, 25.89% id in 614 aa"
FT                   /db_xref="PSEUDO:CAE42234.1"
FT   misc_feature    complement(321990..322241)
FT                   /note="HMMPfam hit to PF00034, Cytochrome c"
FT   misc_feature    complement(322200..322217)
FT                   /note="ScanRegExp hit to PS00190, Cytochrome c family
FT                   heme-binding site signature."
FT   variation       complement(322371)
FT                   /note="large deletion in pertussis relative to
FT                   parapertussis at this position"
FT   misc_feature    complement(322516..322533)
FT                   /note="ScanRegExp hit to PS00190, Cytochrome c family
FT                   heme-binding site signature."
FT   variation       complement(322704)
FT                   /note="~30 bp deletion in pertussis relative to
FT                   parapertussis"
FT   variation       complement(323599..323606)
FT                   /note="(CG)4 in pertussis; (CG)3 in parapertussis"
FT   CDS_pept        complement(324213..324734)
FT                   /transl_table=11
FT                   /locus_tag="BP1953"
FT                   /product="probable oxidoreductase"
FT                   /note="Similar to Brevundimonas diminuta isoquinoline
FT                   1-oxidoreductase alpha subunit IorA SW:IORA_BREDI (Q51697)
FT                   (152 aa) fasta scores: E(): 1.7e-22, 49.27% id in 138 aa,
FT                   and to Pseudomonas aeruginosa probable oxidoreductase
FT                   Pa1602 TR:Q9I3B9 (EMBL:AE004588) (163 aa) fasta scores:
FT                   E(): 3e-38, 65.98% id in 147 aa"
FT                   /db_xref="GOA:Q7VX56"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX56"
FT                   /protein_id="CAE42235.1"
FT                   /translation="MPRRIEVCRIAMLAATRDFTLEVNASRHTVTADPDTPLLYILRND
FT                   LCLNGPKFGCGLGECGACAVLIDGVAARACTIPVRGAAGHAITTLEGLGTPQAPGPVQQ
FT                   AFIDEQAAQCGYCLNGMIIATQALLLRNAAPTDEEIRHELQYHLCRCGTHIEIMAAVRR
FT                   AARLWAARQA"
FT   misc_feature    complement(324246..324470)
FT                   /note="HMMPfam hit to PF01799, [2Fe-2S] binding domain"
FT   misc_feature    complement(324492..324680)
FT                   /note="HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster
FT                   binding domain"
FT   misc_feature    complement(324546..324572)
FT                   /note="ScanRegExp hit to PS00197, 2Fe-2S ferredoxins,
FT                   iron-sulfur binding region signature."
FT   misc_feature    complement(324657..324734)
FT                   /note="ScanRegExp hit to PS00430, TonB-dependent receptor
FT                   proteins signature 1."
FT   CDS_pept        complement(324811..325962)
FT                   /transl_table=11
FT                   /locus_tag="BP1954"
FT                   /product="putative monooxygenase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   salicylate hydroxylase Sce29.14C TR:Q9Z4Y6 (EMBL:AL035707)
FT                   (420 aa) fasta scores: E(): 2.3e-46, 40.42% id in 329 aa,
FT                   and to Acinetobacter SpADP1. hypothetical 42.4 kDa protein
FT                   TR:O24844 (EMBL:AF009672) (381 aa) fasta scores: E():
FT                   1.2e-50, 38.19% id in 377 aa"
FT                   /db_xref="GOA:Q7VX55"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX55"
FT                   /protein_id="CAE42236.1"
FT                   /translation="MQGKPRIAVIGAGLGGTAGAALMARAGFNVRLYEQAPAFSLLGAG
FT                   IHLGPNVMKIMRRIGIEDELNRQGSHPDYWYSRDWQTGAELARIPLGDYAVSHYGATYL
FT                   TVHRGDFHALMTAALPAGLLQFNKRLTRVDEDDDVVRLHFADGSVEEAEIVIGADGVNS
FT                   RLREHLLGAELPKYTGYVAHRAVFPTPLDSGSLPFDMCVKWWSDDRHMMVYFVTGKRDE
FT                   IYYVTGVPEQQWDMGKSWVPSSKEEMRAAFAGWHPTVQALIEATPEVSKWPLLERDPLP
FT                   LWSRGRIVLLGDACHPMKPHMAQGAAMAIEDAAMLTRIFEQTGLQDHAAAFRLYEDNRA
FT                   ERASRVQRVSHDNTWLRTNENPDWCFGYDVYAEPLVEGRRAAA"
FT   misc_feature    complement(324910..325512)
FT                   /note="HMMPfam hit to PF01360, Monooxygenase"
FT   misc_feature    complement(325531..325944)
FT                   /note="HMMPfam hit to PF01494, FAD binding domain"
FT   misc_feature    complement(325894..325962)
FT                   /note="Signal peptide predicted for BP1954 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.973) with cleavage site
FT                   probability 0.516 between residues 23 and 24"
FT   CDS_pept        326263..327015
FT                   /transl_table=11
FT                   /gene="maiA"
FT                   /locus_tag="BP1955"
FT                   /product="maleate cis-trans isomerase"
FT                   /note="Similar to Serratia marcescens maleate cis-trans
FT                   isomerase MaiA TR:Q9KWI0 (EMBL:AB035810) (250 aa) fasta
FT                   scores: E(): 8.2e-69, 79.67% id in 246 aa, and to Bacillus
FT                   stearothermophilus maleate cis-trans isomerase MaiA
FT                   TR:Q9WX57 (EMBL:AB015134) (251 aa) fasta scores: E():
FT                   1.1e-56, 65.46% id in 249 aa. Identical to BP0579, 99.600%
FT                   identity (99.600% ungapped) in 250 aa overlap."
FT                   /db_xref="GOA:Q7TTH1"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="InterPro:IPR028615"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTH1"
FT                   /protein_id="CAE42237.1"
FT                   /translation="MQKTYRIGQIVPSSNTTMETEIPAMLLARQQIRGERFTFHSSRMR
FT                   MKKVVKEELAAMDAESDRCAVELSDARVDVLGYACLVAIMAMGRGYHRQSQARLTAHTA
FT                   ANGGEAPVITSAGALVDALKVMGARKIAVVAPYMKPLTELVVDYIGNEGYEVVDYRALE
FT                   IADNLEVGRHDAGRLPEIVAGLDYREADVIVLSACVQMPSLGAIAKVEAQTGKPVVTAA
FT                   VATTYAMLKALGLEAVVPGAGALLSGAY"
FT   CDS_pept        join(327035..327685,327687..327854)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1956"
FT                   /product="probable alpha/beta hydrolase (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 217. The sequence has been checked
FT                   and believed to be correct. Similar to Coccidioides immitis
FT                   hypothetical alpha/beta hydrolase TR:Q9P418 (EMBL:AF284472)
FT                   (201 aa) fasta scores: E(): 1.3e-40, 56.12% id in 196 aa.
FT                   Identical to BP0580 (Pseudogene), 99.634% identity
FT                   (100.000% ungapped) in 273 aa overlap."
FT                   /db_xref="PSEUDO:CAE42238.1"
FT   misc_feature    join(327200..327685,327687..327830)
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold"
FT   variation       327686
FT                   /note="G in pertussis; G(AG) in parapertussis and
FT                   bronchiseptica"
FT   CDS_pept        327882..328913
FT                   /transl_table=11
FT                   /locus_tag="BP1957"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pyrococcus horikoshii hypothetical 38.8
FT                   kDa protein Ph1046 TR:O58751 (EMBL:AP000004) (350 aa) fasta
FT                   scores: E(): 3.5e-09, 27% id in 274 aa, and to Pyrococcus
FT                   horikoshii hypothetical 34.8 kDa protein Ph1048 TR:O58749
FT                   (EMBL:AP000004) (320 aa) fasta scores: E(): 1.5e-06, 25.42%
FT                   id in 350 aa. Identical to BP0581, 100.000% identity
FT                   (100.000% ungapped) in 343 aa overlap."
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTJ1"
FT                   /protein_id="CAE42239.1"
FT                   /translation="MPVSDYEMIRAWTQVLRLSRLQAGQTVTVLTSAATHPQTLGTALV
FT                   AAQSLGAVVNRLDLPPVNGEKALSRDALAYLGTTPLTGNKAAIAMLKASDLVLDLMTLL
FT                   FSPEQHEILQGGTRILLAVEPPEVLARLVPTEGDRQRVKAAAARIAGAREMTVESEAGT
FT                   RLRCGLGEFPAISEYGYVDEPGRWDHWPSGFALTWPDEGSANGTIVIDRGDILLPQKSY
FT                   VSEPIVLTVENGYATRIEGGLDAEMLREYVATFKDPQAYAISHIGWGLQPRASWTTLGL
FT                   YDREATIGMDARAYEGNFLFSLGPNNEAGGSRTTACHIDIPLRRCTVRLDGREVVREGK
FT                   VLD"
FT   CDS_pept        328929..329546
FT                   /transl_table=11
FT                   /locus_tag="BP1958"
FT                   /product="putative isochorismatase"
FT                   /note="Similar to Arthrobacter sp N-carbamoylsarcosine
FT                   amidase SW:CSH_ARTSP (P32400) (264 aa) fasta scores: E():
FT                   2e-14, 32.67% id in 202 aa, and to Arthrobacter keyseri
FT                   putative phthalate ester hydrolase pehA TR:Q9AGK9
FT                   (EMBL:AF331043) (218 aa) fasta scores: E(): 3.4e-19, 37.3%
FT                   id in 193 aa. Identical to BP1958, 100.000% identity
FT                   (100.000% ungapped) in 205 aa overlap."
FT                   /db_xref="GOA:Q7TTD2"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTD2"
FT                   /protein_id="CAE42240.1"
FT                   /translation="MSNDLGSYERQGFGAALPLKAPYGLLIVDFVNGFADPAQFGGGNI
FT                   AAAIETTRTVLAAARERGWAVAHSRIVYADDDADGNIFSIKVPGMLTLKEHAPASAIVP
FT                   QLAPQAGEYVVRKSTPSAFYGTMLAAWLAQRGVQTLLVAGATTSGCVRASVVDAMSAGF
FT                   RPLVLSDCVGDRALGPHEANLFDMRQKYAAVMTHDEALAKTK"
FT   misc_feature    328998..329477
FT                   /note="HMMPfam hit to PF00857, Isochorismatase family"
FT   misc_feature    329346..329378
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   repeat_region   329553..330783
FT                   /note="Insertion sequence"
FT   CDS_pept        329738..330754
FT                   /transl_table=11
FT                   /locus_tag="BP1959"
FT                   /product="transposase for IS1663"
FT                   /note="Similar to Neisseria meningitidis putative
FT                   invertase/transposase Nma1800 TR:Q9JTF3 (EMBL:AL162757)
FT                   (318 aa) fasta scores: E(): 2e-17, 28.48% id in 316 aa and
FT                   Acinetobacter spSE19. pilin inverting protein ChnY
FT                   TR:Q9F7E1 (EMBL:AF282240) (324 aa) fasta scores: E():
FT                   8.2e-50, 47.516% id in 322 aa"
FT                   /db_xref="GOA:Q7TTM7"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTM7"
FT                   /protein_id="CAE42241.1"
FT                   /translation="MADSSLLSAGGQVHVFIGIDVSKAKLDCTLLTAEADKRKTKVVVN
FT                   TAAGVQALLAWCAKHGAQPAQLHAILEPTGLYHEQAATALPQVRVSLVNPAQARDFAKA
FT                   LALRSKNDALDSYVLARYGQTLSPALWHPAPLHARQLRALLTRREALSKDLLRELNRKE
FT                   KSQFSPSAPLVDGSIDKAIAFLREQIKQIERAIDQHIDNHPDLKQDCELLNSIPAIGPQ
FT                   AGNAILAVMHNRHIDSAQSLAAYLGVVPVQRQSGSSLNSCARLSKAGPSQVRATLYMAA
FT                   LVGTRHNPHIRALYQRLLKAGKSKKAALGAAMRKLVHLCFGVLKNRIPYQPNYAMNG"
FT   misc_feature    329990..330277
FT                   /note="HMMPfam hit to PF01548, Transposase"
FT   misc_feature    330290..330622
FT                   /note="HMMPfam hit to PF02371, Transposase
FT                   IS116/IS110/IS902 family"
FT   CDS_pept        join(330868..331455,331455..332771)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1960"
FT                   /product="probable aldehyde dehydrogenase (Pseudogene)"
FT                   /note="Pseudogene. This CDS appears to have a frameshift
FT                   mutation following codon 196. The sequence has been checked
FT                   and believed to be correct. Similar to Pseudomonas
FT                   aeruginosa probable aldehyde dehydrogenase Pa1601 TR:Q9I3C0
FT                   (EMBL:AE004588) (748 aa) fasta scores: E(): 1.3e-103, 50%
FT                   id in 750 aa"
FT                   /db_xref="PSEUDO:CAE42242.1"
FT   misc_feature    331039..331284
FT                   /note="HMMPfam hit to PF01315, Aldehyde oxidase and
FT                   xanthine dehydrogenase, a/b hammerhead domain"
FT   variation       331441
FT                   /note="large deletion in pertussis relative to
FT                   parapertussis"
FT   misc_feature    331476..331904
FT                   /note="HMMPfam hit to PF01315, Aldehyde oxidase and
FT                   xanthine dehydrogenase, a/b hammerhead domain"
FT   misc_feature    332298..332321
FT                   /note="ScanRegExp hit to PS00030, Eukaryotic RNA
FT                   Recognition Motif (RRM) RNP-1 region signature."
FT   misc_feature    332358..332597
FT                   /note="HMMPfam hit to PF01315, Aldehyde oxidase and
FT                   xanthine dehydrogenase, a/b hammerhead domain"
FT   CDS_pept        332893..334233
FT                   /transl_table=11
FT                   /locus_tag="BP1961"
FT                   /product="putative flavocytochrome"
FT                   /note="Similar to Vibrio cholerae oxidoreductase, putative
FT                   Vca0151 TR:Q9KN15 (EMBL:AE004356) (450 aa) fasta scores:
FT                   E(): 6.2e-50, 35.92% id in 451 aa, and to Pseudomonas
FT                   aeruginosa hypothetical protein Pa0545 TR:Q9I5Z1
FT                   (EMBL:AE004491) (434 aa) fasta scores: E(): 8e-43, 44.02%
FT                   id in 452 aa"
FT                   /db_xref="GOA:Q7VX54"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX54"
FT                   /protein_id="CAE42243.1"
FT                   /translation="MRRLRTIFILLVAALSVLWLSQNPPGAWGEGFWVMRKPLIYYTGI
FT                   LALGMMSLGVILAARPARFEGALGGLDKFYRLHKWLGLGGVALALTHWLLKIVPPWMAA
FT                   QGWTVRPPRVPAPAGQAALYDPFQAWHGVAKSLGEWGLYALLLLAALALYKRFPYRHFF
FT                   RTHRLMPALYLVFVFHAVVLMAPAYWRGPIGPVMAVVMAAGGAGALLSLLGLIGRPRQA
FT                   AGRIARLERFADNAVMQVDVQLETRWPGHKAGQFAFVAFDRAEGAHPFTISSAWRDDGL
FT                   LRFSIKGLGDYTRSLPARLRVGDGVTVEGPYGRFDFRANGRPQILVAGGIGITPFLARL
FT                   QDMAAARSDGAPAHEVDLVYSTNAPDPDFIGELRALAERARVGLHVLVTQRDGKLSAER
FT                   LVDMLPRAAQSEVWFCGPAGFGQALREGLAARGMPPACFHQELFEMR"
FT   misc_feature    332893..332979
FT                   /note="Signal peptide predicted for BP1961 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.927 between residues 29 and 30"
FT   misc_feature    332902..334218
FT                   /note="HMMPfam hit to PF01794, Ferric reductase like
FT                   transmembrane component"
FT   misc_feature    join(332911..332979,333007..333069,333130..333198,
FT                   333301..333354,333391..333459,333469..333537)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BP1961 by TMHMM2.0 at aa 7-29, 39-59, 80-102, 137-154,
FT                   167-189 and 193-215"
FT   misc_feature    333853..334164
FT                   /note="HMMPfam hit to PF00175, Oxidoreductase NAD-binding
FT                   domain"
FT   CDS_pept        complement(334244..336352)
FT                   /transl_table=11
FT                   /gene="bfrI"
FT                   /locus_tag="BP1962"
FT                   /product="putative ferrisiderophore receptor"
FT                   /note="Similar to Pseudomonas aeruginosa hydroxamate-type
FT                   ferrisiderophore receptor FiuA TR:O68595 (EMBL:AF051691)
FT                   (802 aa) fasta scores: E(): 1.7e-71, 36.83% id in 714 aa,
FT                   and to Salmonella typhimurium ferrichrome iron receptor
FT                   FhuA TR:O86925 (EMBL:Y14025) (729 aa) fasta scores: E():
FT                   2e-65, 35.72% id in 725 aa"
FT                   /db_xref="GOA:Q7VX53"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX53"
FT                   /protein_id="CAE42244.1"
FT                   /translation="MHTRTPQRQRPVAPRLLHLSLAASLAAGAAQAQTATEATTLPTVQ
FT                   VTGRGETATGPVDGYAATRSATATKTDTPLSETPQAVTVIPREQIIDQGAQNVQDTMNY
FT                   AAGVRPNAYGVDNRGDYVRVRGVEPVQYLDGLKQFFNYNNPRTEVYGLERVEVLRGPAS
FT                   MLYGQGSTGGVVNLVSKRPQPEAMREIGVTVGNHNRKEIQADLTGPLTEDGTWLYQVVA
FT                   LGRDSDTQVQYTKDDRMMLAPSLTWQPSAATSLTLQAYWQKDKSGTTQAFLPWSGTVSG
FT                   NPNGRIPTRRFTSEPGFDRYDTEQFSVGWQFEHKFNDNWKVRQNLRHTSSKVDYSTLYP
FT                   AVYGNPDNPFIDADQRVVNRYLYIKNPRMRSLLADQNLEGKVNWGRAEHTLLMGVDYSR
FT                   YRETGETGSGFGAPLDLYQPVYGTLPDYAMSDVPKNKQQQIGVYLQDQIKFDRNWIVVA
FT                   GLRHDRVANSVEGADKETDNATTKRLGLMYAADNGWSPYLSYSESFTPIAGTDNSGNRW
FT                   VPMRGKQWEAGLKYMPQDTGYEATLAAYDLRERNRQTNDPSDPTNQVQTGKTKTRGIEL
FT                   EFRGRVTPQMDVIANYNYTDIDPQLEGLPKHTFSLWSKYRFSVGDVHGFAAGAGVRYLN
FT                   AFRDGSAPETGSVALFDAMLSYDTGSWRYALNVANIADKTYEVVCLRRGDCFYGQRRTV
FT                   TLSAMYRF"
FT   misc_feature    complement(334247..334558)
FT                   /note="HMMPfam hit to PF00593, TonB dependent receptor
FT                   C-terminal region"
FT   misc_feature    complement(335879..335908)
FT                   /note="ScanRegExp hit to PS00339, Aminoacyl-transfer RNA
FT                   synthetases class-II signature 2."
FT   misc_feature    complement(336257..336352)
FT                   /note="Signal peptide predicted for BP1962 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.945 between residues 32 and 33"
FT   CDS_pept        complement(join(336486..336767,336771..337013))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1963"
FT                   /product="putative transcriptional regulator (Pseudogene)"
FT                   /note="Pseudogene. This CDS contains an in-frame TGA stop
FT                   codon. The sequence has been checked and believed to be
FT                   correct. Similar to Rhizobium loti transcriptional
FT                   regulator Mll8302 TR:Q983J5 (EMBL:AP003013) (146 aa) fasta
FT                   scores: E(): 8.1e-08, 34.66% id in 150 aa, and to
FT                   Caulobacter crescentus transcriptional regulator, MarR
FT                   family cc2188 TR:Q9A6A6 (EMBL:AE005891) (144 aa) fasta
FT                   scores: E(): 2.9e-05, 31.69% id in 142 aa"
FT                   /db_xref="PSEUDO:CAE42245.1"
FT   variation       complement(336768..336770)
FT                   /note="In-frame TGA stop codon in pertussis; TGG in
FT                   parapertussis and bronchiseptica"
FT   CDS_pept        337107..338072
FT                   /transl_table=11
FT                   /locus_tag="BP1965"
FT                   /product="putative exported protein"
FT                   /note="Similar to Ralstonia spU2 NagM TR:Q9Z3X3
FT                   (EMBL:AF036940) (341 aa) fasta scores: E(): 1.1e-27, 32.39%
FT                   id in 321 aa, and to Rhizobium meliloti hypothetical
FT                   protein Sma1927 TR:Q92Y30 (EMBL:AE007292) (330 aa) fasta
FT                   scores: E(): 7.3e-25, 30.06% id in 306 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX52"
FT                   /protein_id="CAE42246.1"
FT                   /translation="MFKSMLAAVLALGMSGPVAQAAAPLDGPLTIVVGYAPGGSSDRIA
FT                   RLVAERLKDRVGVPVIVENKTGAGGRIAAQALRQASAQQNVLMLANPAVMVVAPLVYAQ
FT                   PGYDAQRDFQPLSLASRYKFALTVPAGSPLRTLADLRQWIAAHPKQLTVGVPATGSLPH
FT                   FFALMLGREVGEDVEVVGYRGSGPLITELIGGILGQGIDTLDTLLPQHQAGKLRILATS
FT                   GQTRDAQLPDVPTFREAGVDLAADGWNAFFAPAAMPADKVERLGRDIAAVMSEPAMQQA
FT                   VRAVNLEPVAQDAAQTAASLQAYRDQWEPVVRQSGFTATQ"
FT   misc_feature    337107..337169
FT                   /note="Signal peptide predicted for BP1965 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.878 between residues 21 and 22"
FT   CDS_pept        join(338089..338880,338884..339654)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1966"
FT                   /product="putative sulfatase (Pseudogene)"
FT                   /note="Pseudogene. This CDS contains an in-frame TAG stop
FT                   codon. The sequence has been checked and believed to be
FT                   correct. Similar to Prevotella spRS2 mucin-desulfating
FT                   sulfatase MdsA precursor mdsA TR:Q9L5W0 (EMBL:AF248951)
FT                   (517 aa) fasta scores: E(): 2.2e-14, 23.7% id in 540 aa,
FT                   and to Pseudomonas aeruginosa probable sulfatase pa2333
FT                   TR:Q9I1E5 (EMBL:AE004659) (538 aa) fasta scores: E():
FT                   3.4e-103, 49.71% id in 517 aa"
FT                   /db_xref="PSEUDO:CAE42247.1"
FT   variation       338881..338883
FT                   /note="In-frame TAG stop codon in pertussis; CAG in
FT                   parapertussis and bronchiseptica"
FT   misc_feature    339355..339378
FT                   /note="ScanRegExp hit to PS00017, ATP/GTP-binding site
FT                   motif A (P-loop)."
FT   repeat_region   339676..339707
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   repeat_region   339676..340727
FT   CDS_pept        339778..341046
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BP1968"
FT                   /product="fusion between a transposase and a C-terminal
FT                   portion of a regulatory protein (Pseudogene)"
FT                   /note="Pseudogene. This CDS resulted from the fusion of a
FT                   transposase for IS481 element to the C-terminal region of a
FT                   regulatory protein."
FT                   /db_xref="PSEUDO:CAE42248.1"
FT   misc_feature    340159..340692
FT                   /note="HMMPfam hit to PF00665, Integrase core domain"
FT   repeat_region   complement(340697..340727)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS481 element"
FT   misc_feature    340795..340992
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR family"
FT   CDS_pept        341350..342012
FT                   /transl_table=11
FT                   /locus_tag="BP1969"
FT                   /product="putative LuxR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   two-component response regulator Pa1980 TR:Q9I2C7
FT                   (EMBL:AE004624) (225 aa) fasta scores: E(): 2.7e-08, 31.19%
FT                   id in 218 aa, and to Streptomyces coelicolor putative two
FT                   component response regulator sci5.09C TR:Q9X9Z1
FT                   (EMBL:AL079332) (210 aa) fasta scores: E(): 1.9e-07, 29.85%
FT                   id in 211 aa"
FT                   /db_xref="GOA:Q7VX51"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX51"
FT                   /protein_id="CAE42249.1"
FT                   /translation="MRMTTVLIEDYALLRIAIQHVLEHGRGAGQVRALASAELEAVASS
FT                   VERPPELAILGCSGVSEHDQLMLTRVIATLAPRNMLLLYLELDLAVLTAAARAGVAGYV
FT                   AKSLSPDALGAAISLVMAGGQCYPLPVQASATPVRGAMQLTQRQEQILRLMVQGKTMRE
FT                   ISREVGTSVATVKSHARTLYWKLNARNQAAAAYAAVSLGLVPGLREDKDTGPADPPA"
FT   misc_feature    341770..341967
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR family"
FT   misc_feature    341824..341889
FT                   /note="Predicted helix-turn-helix motif with score 1305
FT                   (+3.63 SD) at aa 159-180, sequence KTMREISREVGTSVATVKSHAR"
FT   CDS_pept        342114..343541
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="BP1970"
FT                   /product="phosphoglucomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="Similar to Bordetella bronchiseptica
FT                   phosphoglucomutase Pgm TR:Q9S3V9 (EMBL:AF171632) (392 aa)
FT                   fasta scores: E(): 4.2e-74, 50.89% id in 393 aa, and to
FT                   Pseudomonas aeruginosa phosphomannomutase AlgC or Pa5322
FT                   SW:ALGC_PSEAE (P26276) (462 aa) fasta scores: E(): 5.6e-67,
FT                   43.57% id in 459 aa"
FT                   /db_xref="GOA:Q7VX50"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX50"
FT                   /protein_id="CAE42250.1"
FT                   /translation="MDTPTMHGSFDWDGSRTGAGVFGPYDIRGRTGEEIDAGFAHALGL
FT                   TLGRRAVATHAGAVVVGRDATLSSVALAAALQAGIRAAGTHVIDIGRVTTPMMYYATRL
FT                   TETGAGVAVTGRRDGQAHSSFKIMMHGAALYGAGLGELREAMIEADGAVDAAESPGARR
FT                   QLAVLPCYQARLLSDIRLRRPLKVALDCGHGVTSLYAPDLLRELGCEVTALFADGDPGP
FT                   ADHPANPGDPRNLQDLIYCLRYSDCEVGLAFDGDGDRLAVVSKSGEIIWADRLLVLLAR
FT                   DVLARRPGASVIYDVKCGRLAPRGIEQAGGEPLIWKSGPGQIKARMQETGALLAGEMSG
FT                   RLYFKDRWYGFDDAIYAAARVLELLSGVADATALLTQAPASFTAPETRVALPEADLQAI
FT                   LAAMQVRGGFPGARRITYLDGVRVDYDDGFGLVRQACGAAVLALRFEGDTAAALARIQA
FT                   EFRRELARIASHLSITF"
FT   misc_feature    342165..343475
FT                   /note="HMMPfam hit to PF00408,
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain"
FT   CDS_pept        343551..345122
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="BP1971"
FT                   /product="putative glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="Similar to Zymomonas mobilis glucose-6-phosphate
FT                   isomerase Pgi SW:G6PI_ZYMMO (P28718) (507 aa) fasta scores:
FT                   E(): 6.4e-34, 31.46% id in 464 aa, and to Xanthomonas
FT                   campestris glucose-6-phosphate isomerase Pgi TR:O68824
FT                   (EMBL:AF054807) (562 aa) fasta scores: E(): 1.4e-32, 31.1%
FT                   id in 524 aa. Also similar to BP3142, 40.891% identity
FT                   (43.238% ungapped) in 516 aa overlap."
FT                   /db_xref="GOA:Q7VX49"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX49"
FT                   /protein_id="CAE42251.1"
FT                   /translation="MPENAQPHAVIPAADLQLSAQSPQWRVFAAAAAGAPLVARPLRVI
FT                   EAAGIYVDLSMQRHSSALAQAGLALLQARDVLGARAALFAPGAQDAAHGRYPVLRAGYG
FT                   AHPEEQCDIEVEIEYARMLEFVRELDRGGAYPAVLYLGGGAGQWALRLALQAFGGPAQR
FT                   RQLRLVSGGDAAALHEALAGLDPRRTLVVAASRGFEPSETLDNARAAIDWLRRAGIDDV
FT                   SAHLVAVTGNESAARALGVAAARVFRLPSWLQPRHELWSVGALPVALALGVDMLKALRS
FT                   GAAAMDQHFLQAASAVNAPMQMALAAVANTSAMHWPTHALAVYSARLAALPACVQQLEM
FT                   TLAGRAPASLPAYPVVWSPAGAPGPGAFFEWLHRAPAGAPVDFIAGLDEYPASPPAHRA
FT                   LLANCLAQREALLRGLPAGPGQPAAGGGRPSTLVVLRQVDPRAVGALLALYEHKAFVQA
FT                   ALWGAALGGADEAQACQRLAQDIARQLAVPPEAGPVDWGHDSSTAFWIDRYREQGGAGA
FT                   AAGRTA"
FT   misc_feature    344007..344792
FT                   /note="HMMPfam hit to PF00342, Phosphoglucose isomerase"
FT   misc_feature    344826..344936
FT                   /note="HMMPfam hit to PF00342, Phosphoglucose isomerase"
FT   CDS_pept        345305..346258
FT                   /transl_table=11
FT                   /gene="srpH"
FT                   /locus_tag="BP1972"
FT                   /product="serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="Similar to Synechococcus sp serine
FT                   acetyltransferase, plasmid SrpH SW:SRPH_SYNP7 (Q59967) (319
FT                   aa) fasta scores: E(): 8.6e-57, 53.07% id in 309 aa, and to
FT                   Trypanosoma cruzi serine acetyltransferase Sat TR:Q9BKB1
FT                   (EMBL:AF296848) (348 aa) fasta scores: E(): 1.1e-28, 48.93%
FT                   id in 188 aa"
FT                   /db_xref="GOA:Q7VX48"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX48"
FT                   /protein_id="CAE42252.1"
FT                   /translation="MSGSSHYPVANWNLDGIVSGLRGARQEWRGPRGRLREESESGVRE
FT                   FPSQESLRDIMRQLFGALFPMRLGPIDLREEVEDFYVGHTIGAALDALLHQVCLELQHL
FT                   GRDDPQPYGQVLERAVDIVRRFGAELPAVRKALDLDVTAAYQGDPAARSVDEVLLCYPG
FT                   VTAMIHHRLANVLYRLGAPMLARIVAEIAHSDTGIDIHPGATIGRSFFIDHGTGVVIGE
FT                   TAIIGERVRLYQMVTLGAKRFPPGENGELKKGLPRHPIIEDDVVIYAGATILGRITIGQ
FT                   GSTIGGNVWLTHSVPPNSTVTQAGVINDMPDCGLGG"
FT   misc_feature    345953..346006
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats)"
FT   misc_feature    346076..346129
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats)"
FT   misc_feature    346130..346183
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats)"
FT   CDS_pept        346320..347546
FT                   /transl_table=11
FT                   /locus_tag="BP1973"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa probable Mfs
FT                   transporter Pa1286 TR:Q9I458 (EMBL:AE004558) (399 aa) fasta
FT                   scores: E(): 2.4e-63, 49.5% id in 400 aa, and to
FT                   Agrobacterium tumefaciens StrC58 Agr_c_1918p TR:AAK86848
FT                   (EMBL:AE008034) (414 aa) fasta scores: E(): 1.2e-55, 43.07%
FT                   id in 390 aa. Also similar to BP1546, 42.569% identity
FT                   (43.333% ungapped) in 397 aa overlap."
FT                   /db_xref="GOA:Q7VX47"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX47"
FT                   /protein_id="CAE42253.1"
FT                   /translation="MKSDSHPVNPAPPLWPIILAAGIVLGLSLGQRHSVGLYQLPLVQS
FT                   FGLTRETFSFAIAIQNIVWGLAQPFSGYLADRYGTARVVAGGALLYVAGLLLTTVSDGR
FT                   LSLTLSAGVLVGLGLAGTAWTVNGVVGRRAPAARRSAALGAVSAMGALGQFVMLPLGMY
FT                   LIGAFGWQGALGLCAAVLACMAPLAWLLREAPRQPSAAPAAPATQSGGGVRAALGNRDL
FT                   WLLWLGFMACGFHLAFIATHLPAYLADKGIGGGTAALALGLVGLFNIAGTFFFGLMGER
FT                   YPKKYVLAFLYLVRTAVITVYFLAPVSQFSTLLFASAMGFLWLGTAPVTTGLVAQLFGL
FT                   GTLSTLFGVVFLGHQVGSFLGVWLGGVIFDLSGSYDAVWLLSIAIGLFSAAMHLPVREP
FT                   ARRLAAAAP"
FT   misc_feature    join(346356..346415,346473..346541,346560..346613,
FT                   346641..346709,346746..346814,346824..346892,
FT                   346986..347054,347082..347150,347175..347243,
FT                   347271..347339,347358..347426,347454..347507)
FT                   /note="12 probable transmembrane helices predicted for
FT                   BP1973 by TMHMM2.0 at aa 13-32, 52-74, 81-98, 108-130,
FT                   143-165, 169-191, 223-245, 255-277, 286-308, 318-340,
FT                   347-369 and 379-396"
FT   misc_feature    347139..347156
FT                   /note="ScanRegExp hit to PS00267, Tachykinin family
FT                   signature."
FT   CDS_pept        347559..348383
FT                   /transl_table=11
FT                   /locus_tag="BP1974"
FT                   /product="putative Sir2-like regulatory protein"
FT                   /note="Similar to Homo sapiens sirtuin type 4 SirT4
FT                   TR:Q9Y6E7 (EMBL:AF083109) (314 aa) fasta scores: E():
FT                   7e-45, 46.29% id in 270 aa, and to Streptomyces coelicolor
FT                   putative Sir2-like regulatory protein scf51a.30 TR:Q9RL35
FT                   (EMBL:AL121596) (299 aa) fasta scores: E(): 1.3e-42, 46.76%
FT                   id in 263 aa"
FT                   /db_xref="GOA:Q7VX46"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026587"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7VX46"
FT                   /protein_id="CAE42254.1"
FT                   /translation="MDSRMSDLQALRGFLGGSERLFVLTGAGCSTASGIPDYRDGQGQW
FT                   KRKPPIDFQAFMGGQPARARYWARSMVGWRHFGQARPNAAHHALARLAQRGQVDLLVTQ
FT                   NVDRLHQAAGGREVLDLHGRLDEVRCMQCDWRGPRGPWQHTLELANPQWAALQAGAAPD
FT                   GNADLEGQDFSRFVVPSCPRCGGIVKPDVVFFGETVPRERVQRAYAALEHADAVLVVGS
FT                   SLMLYSGYRFVQAAARAGLPIAAINLGRTRADDMLALKVSRPCDEVLAEVVP"
FT   misc_feature    347634..348242
FT                   /note="HMMPfam hit to PF02146, Sir2 family"
FT   CDS_pept        complement(348452..349303)
FT                   /transl_table=11
FT                   /locus_tag="BP1975"
FT                   /product="putative inositol monophosphatase"
FT                   /note="Similar to Escherichia coli extragenic suppressor
FT                   protein SuhB or SsyA or B2533 SW:SUHB_ECOLI (P22783) (267
FT                   aa) fasta scores: E(): 3.5e-13, 32.43% id in 222 aa, and to
FT                   Rhizobium loti monophosphatase-like protein Mlr0048
FT                   TR:Q98NP3 (EMBL:AP002994) (275 aa) fasta scores: E():
FT                   1.1e-49, 48.7% id in 271 aa"
FT                   /db_xref="GOA:Q7VX45"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:Q7VX45"
FT                   /protein_id="CAE42255.1"
FT                   /translation="MNRTFSRDETRRIAALLAEAARSEVLPRFRHLTEDAVRGKSSPRD
FT                   LVTIADEEAERHIAARLGKLYPGAVLIGEEASARNPALLNMLVDADLAFLIDPIDGTRN
FT                   YVAGLPLFGMMVAVCHRGDVLAGVIYDPIGHDAALAVRGEGAWINYEDGTQQALHVAGA
FT                   APANEMDGMISTSNLPDGLREQVTANQARLGSTASLRCAAHEYRLAASGHCHVLLYNKL
FT                   TPWDHAAGWLLHREAGGYSAHFDGSPYKPTHRSGGLLYAPDGGTWHAAHQALLGDAVPL
FT                   AV"
FT   misc_feature    complement(348569..348643)
FT                   /note="HMMPfam hit to PF00459, Inositol monophosphatase
FT                   family"
FT   misc_feature    complement(348857..349093)
FT                   /note="HMMPfam hit to PF00459, Inositol monophosphatase
FT                   family"
XX
SQ   Sequence 349354 BP; 54937 A; 115951 C; 121982 G; 56484 T; 0 other;
     aaccgcgcaa cggccgcgcc gcgacgaccg gcgcgcgccg cgccccggcc cagtaaccct        60
     gagcgcgtca ccggtactgg ccgatccgcc cgccgccctg cctagaatcg gcaggagcgt       120
     gtctttcaag ggagcggcct gcgggccgcg tcgatgcggc gctccatcgt cctttcggcg       180
     gactacttat ggtcgaggcc atcgagacgt tccattgggg cgccatattc cagatcgttc       240
     tgatcgacat cctgctcggc ggcgataacg ccgtcgtgat cgcgctggcc tgtcgcaacc       300
     tgccgcaccg gcaacgcatc aagggcatcc tgtggggcac ggccggcgcg gtgctgctgc       360
     gcgtgctgct gatcgccttc gcgctggtcc tgctcgacat tccgtttctc aaggccctgg       420
     gctgcctgct gctggtctgg ataggcgtca agctgctggc cccgcatgag gacgcgcacg       480
     gcaacatcac cggcggcacc tcggtgctgg ccgcgatccg caccatcatc ctggccgatt       540
     tcgccatgag cctggacaac gtcatcgcca tcgccggcgc ggcccagaac gcgcaggccg       600
     accaccagct gtactacgtg atcttcgggc tgtgcgtgag cgtgcccatc atcgtctggg       660
     gtagcacgct ggtgctcaag ctgatcgacc gcttcccgct ggtcgtcacc ctgggcgccg       720
     gcctgctggg ctggatcgcc ggcggcatgc tcatcaccga catctacgtg gtcgagcgct       780
     ggggcgagcc cgcgcccatg ctgaagctgg ccgtggaagc cgccggggcg ctggtggtgg       840
     tggcggccgg caagtggctg gcggcccgcc gccgccatgc ccggccgacc cacgacgaat       900
     cggcctccac cacgccgggc ggctagctgt gaagattcaa taggttgtat gcatggttca       960
     tccgaaccgg atttgagaaa ctggaaatcg ccaacccccc agttcactca aggagcccgg      1020
     ccggatgaac acccataagc atgcccgatt gaccttccta cgtcgactcg aaatggtcca      1080
     gcaattgatc gcccatcaag tttgtgtgcc tgaagcggcc cgcgcctatg gggtcaccgc      1140
     gccgactgtg cgcaaatggc tgggccgctt cctggctcag ggccaggcgg gcttggccga      1200
     tgcgtcctcg cgcccgacgg tctcgccccg agcgattgcg ccggccaagg cgctggctat      1260
     cgtggagctg cgccgcaagc ggctgaccca agcgcgcatc gcccaggcgc tgggcgtgtc      1320
     agccagcacc gtcagccgcg tcctggcccg cgccggtctg tcgcacctgg ccgacctgga      1380
     gccggccgag ccggtggtgc gctacgagca tcaggccccc ggcgatctgc tgcacatcga      1440
     catcaagaag ctgggacgta tccagcgccc tggccaccgg gtcacgggca accgacgcga      1500
     taccgttgag ggggccggct gggacttcgt cttcgtggcc atcgatgacc acgcccgcgt      1560
     ggccttcacc gacatccacc ccgacgagcg cttccccagc gccgtccagt tcctcaagga      1620
     cgcagtggcc tactaccagc gcctgggcgt gaccatccag cgcttgctca ccgacaatgg      1680
     ctcggccttt cgcagccgcg ccttcgccgc gctgtgccat gagctgggca tcaagcaccg      1740
     ctttacccga ccttaccgcc cacagaccaa tggcaaggcc gaacgcttca tccagtcggc      1800
     cttgcgtgag tgggcttacg ctcacaccta ccagaactcc caacaccgag ccgatgccat      1860
     gaaatcctgg ttacaccact acaactggca tcgaccccac caaggcatcg ggcgcgctgt      1920
     acccatctcc agactcaacc tggacgaata caacctattg acagttcaca actaggcggc      1980
     gtcggctcgg tcgccggcgc gatcttcggc gcgagcctgc tgaccctgct tccgcaggtg      2040
     ctgacggtgt tcgccgacta cgaacccctc atcctgggcc tgaccatgat gctggtcatg      2100
     atcttcctgc ccgaaggcct ggttccgtcc atcatgcgca cgatacgagg aaggaaaaaa      2160
     tgagcctgct ggaaatccac ggcctgggca ttacctttgg cggcctgcgc gccgtgcacg      2220
     acgtcgcctt cagcgtcgag ccgggcgaga tcgtgtccgt catcgggccc aacggcgcgg      2280
     gcaagaccac cctgttcaac atgatctcgg gcatctaccg gcccggcgcc ggccgcgtcg      2340
     tgctggaccg cgacgacgtc accggcatgg cgccgttccg cctggcgcgg cgcggcatgt      2400
     cgcgcacctt ccagaacctg cagatcttcc agaacatgac cgtgctggag aacgccatcg      2460
     cgggctttca cctgcaggag caaggcgcgc tgctgtccga cctcttcaac ctgcgcgcct      2520
     cgcgggcccg cgcccggcgc gccgaagaag gcgcccgcgc gctcctgcag cgcgtgggcc      2580
     tggaacgcgc ggccgaacgc gaggccgcca gcctctccta cggctcgctc aagcggctgg      2640
     agatcgcccg cgcgctggcc ctgcagccca aggtgctgct gctggacgaa ccggccgccg      2700
     gctgcaatgc ggtcgaaacc gaggaaatcg accacctgat cgccgaggtc gccgccacgg      2760
     gcgtcgccat cctgctggtc gaacacgata tgaaaatggt catgcgcatt tccaaccaca      2820
     tcgtcgtgct cgatcacggc gagaaaatcg ccgaaggccc gccggacgcc atcagccgcg      2880
     acccggcggt catcgccgcc tacctgggca ccgacagcca gccgggagac cgcccatgct      2940
     gaccgtgcaa ggactacgct cgtgctacgg gcgcatcgaa gtgctgcacg gcatcgacct      3000
     gcaagtcgac agcggcgaga tcgtcaccgt cgtcggcgcc aatggcgcgg gcaagaccac      3060
     cttgctgcgc tgcctgtccg gcgtgcagcc cgtctcggcc ggcgccatta ccttccgcgg      3120
     cgaggccctg gccgccgtgc ccgcccatcg ccgcctggcg cgcgggctgg cgcactcgcc      3180
     cgaaggccgg cagatcttca ccaacctcag cgtcgaggaa aacctgcggc tgggcgccta      3240
     cctgtacgcc gacgaccggg tcgaacgcga catggacgac gctttccaga tgttccccat      3300
     cctgcgcgaa aaacgccatc tggccgcagg cggcctgtcg ggcgggcagc agcagatgct      3360
     ggcgatggcg cgcgccctga tgggcaggcc gtcctgcctg ctgctggacg agccctcgat      3420
     gggcctggcg ccgatcatcg tgcagcagat cttcgacgtc atccgcgggc tgaaggcgct      3480
     cggcgtcacc gtgctgctga tcgaacagaa tgcctacggc gcgctgcaga tcgccgaccg      3540
     cggctacgtc atggaaaccg gcaacatcac catgcaaggc gcggccagcg ccttgatcgc      3600
     cgacccgcgc atacgcgccg cctacctggg gatatgaacc atgcggtgaa ccctgcggcg      3660
     cgggccggcc cgcgcattgc cgccggggcc atgtggccct acaattagcg gttgcctcag      3720
     tcatgagttc acgcgctgtc gttgcttggc atcgggcagc gtctttaagc gggcgcgtcc      3780
     tgcctatgcc aggcaccgcc cactgcaggc ggcgagtgta cgacgaacag cggcacgacg      3840
     aacagccatc gcggcactcg cgtcatcgga ggtgttttgg cccgtacgag atctgcggat      3900
     tacgagaata tccgcgacac catcatcgag cgcgcggcgg caatgtttgc gcgccaaggc      3960
     tactcggaaa catccattgg cgatatcgcc cgggcctgcg agtgctcgaa atcgcgcctg      4020
     taccattact tcgacagcaa ggaagcggta ttgcgcgaca tgctcaccac gcacgtcgac      4080
     tccctgctgg aacgctgccg ccaggtcctg tacggctcga acgaaccgaa gacgcgcttt      4140
     ctccagatcg taaagctgtt tctcgagatc tacgccacgt cgcgcgaccg gcacgtcgtg      4200
     atgctgacct gcctggacgc cctgcccgaa gaccagcgca aggcgctgat cgccaagcag      4260
     cgcgaactga tcgcctatgt gcgcgacgcg cttctgcaac tgcgccccga catggccgcc      4320
     aaccgcaccc tggcccacgt cgacaccatg ctgttcttcg gcatgatcaa ctggacctac      4380
     acctggtaca aggccgatgg cagcgtctcg cccgatgcgc tcgccgagcg caccgtgcaa      4440
     ctgttcctgg acggctacct caacctgccc tcggcctgat cgcgcagcaa ctgcatcggc      4500
     tcgaagccgg gccgctcgac ctcgccacgg ccgaccgcgc gcccggcttc cagcagcttc      4560
     ttgccgacca tatacgcccg cccgtcattg agcgcatcga ccgaaatcaa gcggtcggcg      4620
     cggaagtacc aatgcgactc gcccttggcc gacgcatggc tgaccaccgc gtcgtagccg      4680
     cggttcagcc cgacgatctg cagcttcatg tcgtattgat ccgaccagaa ccacgggacg      4740
     ggctgatacg gccgcccctg ccccagcata tcgtcggcca ccgcctcggc ctggtcgatg      4800
     gcgttctgca cgctctcgag acgggccggc tcgccgccca gcacgaaccg cgcgcaatcc      4860
     cccgccgccc agacatccgg cgccgacgta cgtccgtacg catcgaccag gatcccgtcg      4920
     tcgcaatcga tcccggccgc ctcggccagc gccgtttgcg gcgccacccc caccccggcc      4980
     accaccaggt cgcaggcaat gcgcagccca ttgtccagct ccacaccggt tagggcctcg      5040
     tcgccttcgg tacccgccac cgtgcgcccc tcatggatga gcaccccgtg gcgctggtgc      5100
     agggcgcgga tggccgcggc cgtggccggg cacgccaccc gctccaggac ccgggacgcg      5160
     cgctccacca cctgcaccga caaccccgcc tgcgcggcga ccgcggccgt ttccagcccg      5220
     atatagccgc cccccagcac cagcagcctg cgcccggcca ggaacgccgg ctgcaagcgc      5280
     tgcacatcgg ccagattgcg cagctcgaac acattgctgc ggcccgcgaa cgccgccggc      5340
     aaagggcgcg gcgcggcgcc cgtggtcaac gccctgcttg cggcacgcct gggccatgcc      5400
     gtagagcaca gccacgcaaa agcatcaacg ctgacatcga tatgccctcg aaccgttatg      5460
     gatagcggcg ggatgccggg ctacccgtac ggcgacgcgt gcccgatggc ccgtgccgtc      5520
     atccgtgccc gattagtgga ataggcaacg ctcgcgttcc atgcgtcaga accgcgggcg      5580
     gcaatcagag agaatcaaga ctcccgggct gcgcaggcgc cggaagagaa aacagccgcc      5640
     attgctggcg gctgcggaag gacttgcacc tgcggcagaa tccagggcgc cacgcgagcc      5700
     tgactaggtg tgaagattca ataggttgta tgcatggttc atccgaaccg gatttgagaa      5760
     actggaaatc gccgaccccc cagttcactc aaggagcccg gccggatgaa cacccataag      5820
     catgcccgat tgaccttcct acgtcgactc gaaatggtcc agcaattgat cgcccatcaa      5880
     gtttgtgtgc ctgaagcggc ccgcgcctat ggggtcaccg cgccgactgt gcgcaaatgg      5940
     ctgggccgct tcctggctca gggccaggcg ggcttggccg atgcgtcctc gcgcccgacg      6000
     gtctcgcccc gagcgattgc gccggccaag gcgctggcta tcgtggagct gcgccgcaag      6060
     cggctgaccc aagcgcgcat cgcccaggcg ctgggcgtgt cagccagcac cgtcagccgc      6120
     gtcctggccc gcgccggtct gtcgcacctg gccgacctgg agccggccga gccggtggtg      6180
     cgctacgagc atcaggcccc cggcgatctg ctgcacatcg acatcaagaa gctgggacgt      6240
     atccagcgcc ctggccaccg ggtcacgggc aaccgacgcg ataccgttga gggggccggc      6300
     tgggacttcg tcttcgtggc catcgatgac cacgcccgcg tggccttcac cgacatccac      6360
     cccgacgagc gcttccccag cgccgtccag ttcctcaagg acgcagtggc ctactaccag      6420
     cgcctgggcg tgaccatcca gcgcttgctc accgacaatg gctcggcctt tcgcagccgc      6480
     gccttcgccg cgctgtgcca tgagctgggc atcaagcacc gctttacccg accttaccgc      6540
     ccacagacca atggcaaggc cgaacgcttc atccagtcgg ccttgcgtga gtgggcttac      6600
     gctcacacct accagaactc ccaacaccga gccgatgcca tgaaatcctg gctacaccac      6660
     tacaactggc atcgacccca ccaaggcatc gggcgcgctg tacccatctc cagactcaac      6720
     ctggacgaat acaacctatt gacagttcac acctagccgg gcggggccaa ccccatgtgc      6780
     cgcaggaaca cctgcgccag ctcgtcgacg cgacgcaggc cgggtgcggc gctgccctgg      6840
     ccgccggcct gccagatcag gtaatcggta cggccgtccg gctcgcccag gcgccggtac      6900
     acctcggcca tgatgggcac atggtcgcca tacacgcaca ggcctgccgg gcgcgacagg      6960
     ccgcgcatgg ccgccgccag tccggtgaac atggcgtcgg cattgcgcag atgccgcgca      7020
     tacgccacca ggtcggcgca gccaggcgca agcggcccgt ccagcaccgc cgcggcgtcg      7080
     gccgcgtcga cgctttccca atgcagcgga ccatagttct ccatggtgat gacatgcacg      7140
     tacaacggct ggctgccctg cccggccagc cgctcggcca cgtagcgcgc cagcgccgcg      7200
     tcggccacat agggcccggc gcgcggcgcg tcggcgaagg cgtccaggtg cacgaactcg      7260
     tcgaagccca gccagggcat gacccggtca cggccgtaga agctggcgtg gaagggatgc      7320
     acgcacaccg tgcggtagcc gcgctggcgc agatggctgg ccaggctggg ctgcggctgg      7380
     cgcaggcgcc ggtacgggtt gtagcggtgc acgcccagcg ccgacgcggc cagcccggtc      7440
     aggaaggcga attcggtgcg caccgtattg gcgccccagg ccgccacctc gagctggccg      7500
     tgctccaggg cctcggcgcg cagcgcatcc aggccggcca gcacctcggg cttgagcgtc      7560
     ccgaacacgc gccgcgcgtc gaagaatgac tcgctctgca cgctgaccag gtgcggcagc      7620
     gggccggcgc ctgccgccgc gggcgccgcg ccgaacggac cggatcgcat ggcgggcgtc      7680
     caaggctggc gctcggccct tccatacagc cacagggtgg ccaccagacc caggcgccgc      7740
     aagtcctgat ccgcctcgta ggtcagcccg gcgtcgcggt ggccggccag cacagccagc      7800
     gccgcgccgg cagccgccag cgccagcgtg gcgccccaga acggggccgg cgcagcatgg      7860
     gcggcccagg ccgccgtgcg cgccccggta gccgaggact ccagcgccag tccggcccac      7920
     aacgccaggc cgtacccgca cgccagcagc agcgccgccg gccaccccag gaacggcagg      7980
     tacaggcgcg gatggcgcag cgcatcggtg aagtattcga aatcgctgta gacgaacggc      8040
     tcgcgcagca cgcgcgcctt ggcggcgctg accagcacca gcaccgcctc gatggccaat      8100
     acgttgatcg cgccgaagta cggccggcga aacagggcca gctcgagcgc gaacagcagg      8160
     gtccagacgc cggcatgcag cagcagcatc caggccggcc gccgccatgg cggctgcacc      8220
     ggcggacgca gcaatgcctc cagcgcccac gacagcacca gtccgccggc ccaggcgggc      8280
     gccaatgcca gccagaacgt ctcagccacc gtagcccagc cagcgcagca ggcggctgga      8340
     gaccgccggg tgcgcgagcc ccaggaacca gcagcccagg ttgagcggaa acggaaagct      8400
     gatgcgcgcg cggttggccg ccagcccgcg ccgtatcgcg cgggccgctt tcccgggcgg      8460
     ccacaggaat ggcttgggcc ctggcatggc cgcgcacatc ggcgaggcca cgtagcccgg      8520
     catgatgaca ttcacccgca cgccctgcgg cgccagccag tcgcgcaacg cctcgccata      8580
     cgccttgacc gcggccttgc tggcgctgta gctgggcgtg tcgggcaggc cgcgccaggc      8640
     ggccagcgag ctcatcagcg cgatctgccc ctggccgcgc gcgcgcatgg ccggcagcag      8700
     gccatgcacc gtcgcctggg ccgcgcgcag attggtgtcc atcaccatgc acacgtcttc      8760
     ccagcgctcg ccggcgcgat cgggcccgat gtcgatattg acgtccgcgt tgatgatggc      8820
     caggtcgggc gggtgcgtag cgttcacctc ctccagccac gccagcaggc gctcggtggc      8880
     gcggatgtcg aaagccgcca cgctgagggt ggcgccgcgc tcgcggcaca gcccgaccag      8940
     ctcgtcgagc cgccccaggc gccggccttg caggatcagc cgcacgccgg gcgcggcgta      9000
     ctccagcgcc agcgcccggc caatctcgcc gctggcgccg gtcagcagca cgcatgccgg      9060
     ccagttcgat ctcatagcaa ttcctccagg gccgagcgcg gcgccgtcag gcgtcccacc      9120
     gcattggcca ccgctaggtg tgaactgtca ataggttgta ttcgtccagg ttgagtctgg      9180
     agatgggtac agcgcgcccg atgccttggt ggggtcgatg ccagttgtag tggtgtagcc      9240
     aggatttcat ggcatcggct cggtgttggg agttctggta ggtgtgagcg taagcccact      9300
     cacgcaaggc cgactggatg aagcgttcgg ccttgccatt ggtctgtggg cggtaaggtc      9360
     gggtaaagcg gtgcttgatg cccagctcat ggcacagcgc ggcgaaggcg cggctgcgaa      9420
     aggccgagcc attgtcggtg agcaagcgct ggatggtcac gcccaggcgc tggtagtagg      9480
     ccactgcgtc cttgaggaac tggacggcgc tggggaagcg ctcgtcgggg tggatgtcgg      9540
     tgaaggccac gcgggcgtgg tcatcgatgg ccacgaagac gaagtcccag ccggccccct      9600
     caacggtatc gcgtcggttg cccgtgaccc ggtggccagg gcgctggata cgtcccagct      9660
     tcttgatgtc gatgtgcagc agatcgccgg gggcctgatg ctcgtagcgc accaccggct      9720
     cggccggctc caggtcggcc aggtgcgaca gaccggcgcg ggccaggacg cggctgacgg      9780
     tgctggctga cacgcccagc gcctgggcga tgcgcgcttg ggtcagccgc ttgcggcgca      9840
     gctccacgat agccagcgcc ttggccggcg caatcgctcg gggcgagacc gtcgggcgcg      9900
     aggacgcatc ggccaagccc gcctggccct gagccaggaa gcggcccagc catttgcgca      9960
     cagtcggcgc ggtgacccca taggcgcggg ccgcttcagg cacacaaact tgatgggcga     10020
     tcaattgctg gaccatttcg agtcgacgta ggaaggtcaa tcgggcatgc ttatgggtgt     10080
     tcatccggcc gggctccttg agtgaactgg ggggttggcg atttccagtt tctcaaatcc     10140
     ggttcggatg aaccatgcat acaacctatt gaatcttcac agttagccat gcggccgggt     10200
     ccgtggctga tggcgctggc ggcctgcgcc gtggcgtcgt ccgcatgggg ccagcaaggc     10260
     ctgcggctga gcaaggacga cctgcaaaag cgcgccaatg gcgtgctggc gctgatgtcg     10320
     ttctccatcg ttcccgacat caccaccagc gccctgaaca tcgccggcgg cgggggctcg     10380
     accagcgggt cgaccgagtt ctacatgacg cagctgggcg gcggcgacac catctcgaaa     10440
     tccgtgcccc tctacctgga aggcgtgctg gcggccagcc gctacgatcc gaccttcgtc     10500
     gccacccagg gcgccgattc gcgccgcatc cccgccaagt ggaacagcgt ctcggccacc     10560
     ggcggcatag gctgggattt tccgctgacc gacgagctca agctgcggcc catcttcaat     10620
     gtggcgctgg gcaacgtgac cagcgacctg cgcgcggcca gctggtacgt gggacggcag     10680
     accgggcagg acgtcgactt cctggaccgc ggctcgctca atgcctacgg gctgggcggg     10740
     tcgctgatgc tggattacga gcattaccgg ccgggctacg aggtggacgt ggaattgcgc     10800
     tactcggata tccggctgcg cagcttcgat agttcggcgg cggtgcgtgg ccaggccacg     10860
     gcgcaatcgg ccaatctgtg ggcgcgctac cgggcgccca ccggcgcgac gctgctgcag     10920
     cggccgctgc gctatgtgct ggagctgacg cattcggagt tcctgggcga ccagcgcggc     10980
     gtcctgggct tcgatcgcct gacctcggtg ggcgcgggcc tggagctcga ttccagcgcc     11040
     tacgacgtat tcgtgacgcg cacccggctg gtcggccgct atgtgttcgg caacaatgta     11100
     tcggggttct cggtcggcct ggcggtcagc ttctgagcgt ggtcgcacgg caaatgcaat     11160
     tcgaaatggg tgccgcgcgc cacctcgcgt cacagaatgc gcgcctgcat gccgctcagg     11220
     ccgcgcccgg gactggctgc ggccggcgcc ggccgcccgc cgcgaaagcc cgcgccgtcg     11280
     tcgataacgg cgatgaccgc gtgcgcgggc tccagccggg tgctcacggt caggcggcgc     11340
     gctcgcgcat gcttgaggat attggtgaac acctcctgca ggatgcgcag cacgtgcagc     11400
     gcggccggcg gcgtcagcca ggacaccggc ggcagcgggc cgacccgcca gtcgagcgcc     11460
     agcccggcgg cctgcaggcg cggtccgagc cgaaagcgca gcgtggccag cagcagggcc     11520
     aggtcggtct gcgcgggctc gagcgaatcg atggtaagcc gcagatcgtc caggcattcc     11580
     tgcagcacct gcgccaccgc gccttccgag ctgttgccgt gctgcaccat gcgcagcgcc     11640
     gacaccagcg atgaacccag gccgtcgtgc atgtcctgca tgaggcgttc gcgctcgccg     11700
     gccaggatac gggtgcgctc gatctcgcgc aggcggcggt ggctgcgctc cagttcccgc     11760
     tcgcgctcgg ccaggcggcg ctgcagcgtg gcctgcgcgc cggcggcctg ggccagcgcg     11820
     ttgacgtaac gccgataggc gacatacagg aagatgacga acatgccgat gccggtatag     11880
     ggcagcaggt agacatgctc catgctgagt cggtagttct gcagcagcat gtcgtgcacc     11940
     gccaccggga tggccgccag gttccagcag gccagcacca ggccgtcgcg cgagcgggcc     12000
     cgccacgcgc cccagaccgc cagcaggcag gcgaacaggg cgaccacggt aatgcccagg     12060
     taggccagcg gcgccagcag caccaggtgc gggtggatct gccagaccgg cagcatcgcg     12120
     gccgtgagcg ctcccatgcc ggccagcatg gcgcgctcgc tgcgcggata ggcgcggccg     12180
     tgcaggcgga acgcgaagaa atacgaggca atcgccagcc agccgaccga ggtgatggtc     12240
     agccagctga accattcgtc gtccagcagc agctggaacg gcccggcgtg gtaatgcagg     12300
     caacgcaggt agaacaccac cgaagccgcg aagaacaggc cgtagatgga ttccttgcgg     12360
     cgcaccgccc acacgcccag cgcgaacagg ccgagcgcca ggaacacggc gctggccagg     12420
     tacggcaggt cctgttgcag ccagcggcgc agctcgtagc gccagcgcag ctcgccggcg     12480
     gcgccgaccc agacggtcga tagccccgcg cccgcgccgt ccaggctgct gatgcgtagc     12540
     agcagcagcg tcgcgggcgg cgcgccgccg gcggccaggg gcagccatac cggccggttg     12600
     aagccgctcc attgcgcgct gccgcccgag cggtacagca acttgccgtc gccatagacg     12660
     gccaggcggc cgaccgtctg ccagcgcggc aggtacagca cagggtcgtc gacaccgccg     12720
     gcgtcgaggt ccagccggta ccaggccagc gccgcgtcgc cggcctgcgg atcgggcacc     12780
     acgcggcgct gcaggccggc atggggcagc gccacgcttt gccagtcgcc gggcgggccg     12840
     cgcgccggca cgagatccgg cgcagcggcc gctgcctcgt cctgcagcag gaactgcgcg     12900
     gtcgtgacat ggcggggctc ggccagcacg gccgccggca gcgccagcca cagccaggcc     12960
     agcaccgccc aggcccgccg catcagccgc cggcgctcat tcatgcgggc gcaggccggg     13020
     cgcggcattg atcgcgtcga ccttggaatg gacctgcagc ttgcggtaga tgcgccgcac     13080
     gaaggtctgc accgtatggc gcgaaacttc gagctcgctg gcgatttcgt cgtaggtgta     13140
     gcccagcgtg atccgttcga gcacctgccg ctcgcgtggc gataacgctg tcgcggcggg     13200
     cggttcggcc ggcggcaggc cctcgcgcag ccggtcgagc agctggcgcg cgatcagcgg     13260
     gctgatcggg ctgccgccgt cgcgcagcgc gcaaatatcg cgcacgatgc cggcgggctc     13320
     gctgtccttg agcaggtagc cgcaggcgcc ggcctcgatg gagcgcagca cgtggacgtc     13380
     gtcgccgaac atggtgttga ccatgatgcc gcagtcgcgc cacaggcgcc gcgcctgcca     13440
     gatgacatcg atgtccgagc cgtcgggcag gcccaggtcg accagcagca cgtcggccgg     13500
     cgggccttgc agcatggcca gcgcgtcggc gcacgtctgc gcctgggcca ggaccgacat     13560
     gccgggctcg tgcgcgatcg ccgcgaccac ggcgtggcga aacgccgggt cgtcctcgac     13620
     gatggcgata cgcagcgatc cggcaggccg cgccggcgta caggtttgca tggcgtgcgt     13680
     ctccgtgcgg ccccggctgt ccccagttcg ggggacagac acagagcgaa agtaatcgta     13740
     acttttgctg cactgtagcg cggcccatgg gccgcgacaa cccggactcg atgctcgttc     13800
     atgaaaccga ttttccgaat cgaacaccca tttggatcgt tgcccgcgcg ggccgcgcgc     13860
     gccggactgc tgctggccgg cgcgctggcc tgtagcgctg ccgcgcatgc cgagctgctg     13920
     ggcgtggacg gcggcgggcc gtccggcggc gcgggcgcca gcggcccggg gctggcggga     13980
     cagccgggca acggacccgc gccgggcctg ggcggcgaca ggacgatgcc caggcccggc     14040
     ggtaacggcg gcgccggcgg cggcgccggc gccgcgagcg gcggcagcga attgattcat     14100
     tacggcgggg gcggcggcgg cagcgacagt ggaggaggcg gcggtatagc catcatcgat     14160
     ccgatggggg cggcgggcgg caacggcggc ggcgtggccc aggcgctcag cgccggcgcg     14220
     gatctccaat ccagtcgcgg cggcgcgggc gacgacggcg gcgccatgag ctccggctcg     14280
     gagcctggcg gtggcggcgg tggcggcgga agcggcgcgg ccgtgcttgc cggcggcggt     14340
     tatcgtgcgc tggccgtgtc catcgtgggc gggcgtggag gggcgggcgg cgcggggttc     14400
     gagtcgggtg gcggcggggg cggcggccac ggcatacgca tcgatgcggc ggatgtacgg     14460
     atcgagttgc tcgcgacgca ggccgcgggc ggccagggcg gagacggcgg cgccggttct     14520
     gggagcagcg gcggcggcgg cgacggcggg catggcctgg cgggcgcggc gaacgatctg     14580
     cgcctgcacg tggccgcgga cagcaccctg cgcggcggcg atggcggcgc ctcgcggccg     14640
     gttacccaca gggcgggcgc gggcggcccc gacgggaccg gcctgtcctt gtcggcgtcg     14700
     cggtggcagg tgaaaaccgc gggcctgatc cagggcggca acgggggccg gggcgaggcc     14760
     agccgcgaat tcgacggcgg caagggcggc gcgggcggcg cgggcctggc attggccggc     14820
     aacatgggca cgctgcacaa ccgcggccgg atacaaggcg gccagggcgc gacgggcggc     14880
     acgagcgtgc tggccgcgcc cggcgcggcg ggcgcgggcg gcgtcggcgt gcggatcgcc     14940
     ggcaacggca atcgcctggt caacgccggc cgcatcgccg gcggggcgtc ggcggacggc     15000
     cagcaggccg acgcggtgcg tatcgatggc gccggcaaca ccttcgaact gcacgcaggg     15060
     tccgtcctgc aaggcaatgc cgtcgccacg ggcagcgcca acgtgctggc cctggggggc     15120
     gcgcagccgg gcgtcttcga cgtgtcggcg ctggcggccg gcgcgccggc cgcgtggagc     15180
     ggggtgcccc ggtatgccgg tttcgcggcc tacgagaaga ccggcgcggg aacctggcgc     15240
     ctgaccggcg gcaacgcggc ggccctgtcc tggaccgtac gcgccggacg cctggcggtg     15300
     gatgccgaga tggcggggtc ggccatgacg gtggccgccg gcggcacgct gggcggcacg     15360
     ggcacggtgg gcgacaccac cgtccgggcc ggcggcgcgc tggcgccggg caattccatc     15420
     ggcaccttgc gcgtggcggg cgacctggtg ttcgagccgg gttcgcgctt cgaggtcgaa     15480
     gccgacccgg acggcacggc cagcgatcgc gtcgtggtca gcggcaccgc cgacatccgc     15540
     ggcggcgcgg tcctgcatgt cgggccggaa ggcgggttcg aggcgcgcca gcgctacgtg     15600
     atcctcaccg ccggccagcg gcgcgggcag ttcgacgccg tcggctcggg ctacgcctat     15660
     ctcgcgccgg cgctgtcgta tgacgcgacc agcgtggcgc tgatcctgca gcgccgcggt     15720
     gcgccaggca gcggcgacct ggctttcgcc gacctggccg atacggccaa ccagcgcgcc     15780
     accgcccgcg ccgtcgagac gctgccggct gcccacccgg tctaccgcgc gatagagacg     15840
     ctgcccgaag gcgcgccgcc ggcggccttc gatgccttgt cgggcgaggt gcacgccagc     15900
     acgcgcagcg cgctgctgac gggcgcgcgc caggcgcagc gggtcaacct ggggcgtttg     15960
     cgcgaccacc tgggcctggc ctggcaggcc ggcgcgccga tggcggccag cggcggcgcg     16020
     cccggcgcgg cggcgctgcc gggcgcgccg tcgccggcct gggccgaggt ggtcggcgcc     16080
     tggcaacgcc tggacggcga cggcaacgcg gcgcaggtgc gccagcatgt cggcgggctg     16140
     ttcgtcggcg ccgataccgc gctggccaac ggctggcgcg tgggcggctc gctgggcttt     16200
     accgatggcc ggatcgaggt cgacgcacgc gcctcgcaaa ccgacgtcgc cagctacacc     16260
     gccgcgctct atggcggccg cgcctgggat gcgggcgccg ggcgcctgaa cctgctggct     16320
     ggcgccgcct atacctggca cgacatcgcc agcgaacgcc gcgtcgacgt gggcgacctg     16380
     cggcaggaac tgacggcgga ctacggcgcc agcaccacgc agctgttcac cgaactgagc     16440
     tacgccatgc cgctgggcat gacagccgaa ctggagccat tcgcggggct ggcctggaac     16500
     cagttgcgcg tgcgcggctt caccgagacg ggcggcagcg ccgcgttgag cggcgcaagc     16560
     agccgcgacg acatggccat cacgaccctc ggggcgcgcg tggcggcgcc gctcggcgcc     16620
     ggtgccacgc tgcgggcgat ggccggctgg cggcatgcct tcggcgatcg cacgccgcaa     16680
     agcacgctgg ccttcggcca gggcagcgcc ttcgaggtgg ccggcgcgcc gatcgcgcgc     16740
     gatgcggcct tgctgggcgt gggcgccggg atcgaggtgg cgcgcaatgc cttcctggac     16800
     gcggcgtacg cgggggaatt cggcggcggc aaccgccagc acaccgccag cgtggtgctg     16860
     cgctggcggt tctgaatcgc agcttgcctt acgcggtccg cagcgctcgc acggcaatgt     16920
     ccggggcgct tgccactatt ttcagaagcg ccatggcagg gtccgtcgga ttgcggtgcc     16980
     cttgctccca gttctgcagc gtgcggacac tgacgtggat ggctttggcg aattccgttt     17040
     gagacatgtg cgttttttcg cgcgttgcct tcacatccac tgtctcaacc ttgaatacac     17100
     gcgatggcgg catcttgcct tggcgaatgg ccacggcttg cttcaggctg gcctgcaggt     17160
     cgttgaacac cgtgttgtct tttttcatcg ttacagctcc ttgaccagtt cgcgcagcgc     17220
     cgcgatttcg tccggggtca ggttgatctt cttcgacttt gcataagccg caagcatgta     17280
     gatctgacaa tcctggctga tccagtaata aatgacccgg atgccacctc gcttgcccgt     17340
     gccttgccgg ccgtaatgca tctttcgtat accgccgccc ccacgcagtt catggaagaa     17400
     tatacgtcat tgacgtatat ttcaatcgcc agcacgccgc cagcgcggtg ctgcgctggc     17460
     ggttctgagc gggacccgga cctgcctccg gcgacgcgcc gctcagccgt tcatctcggc     17520
     cagcgcgcgc tgcacggccg gccgcgcgcc gacgcgcgcc aggtagtcgg ccagcttggg     17580
     aaagcgcgtc atgtcgacgc tgtcgccttc catccagctg ccgacggtgt acagatagcc     17640
     gtcgactacg ctgaagcgct cgcccagtgc ccaggggccg atgatctgcg attccaggta     17700
     gccggcgatg gccgtcatgt tctcggggat cttggcgcgc atggcctcgt gcgcggccgg     17760
     gtcgtcggcc cagcgcgcgc cgcgccgttt gtgcgcgtgc gcgacgtgcg cggtggaggc     17820
     caggtagttg gccagttcct gcatgcgcgc gaacgcgaac ggatcgccca gcggcgccag     17880
     ctgcgcctgc ggaaagctct gcgcgatgaa agcgagcagg gcggggttct cggtcagcac     17940
     gccatgttcg gtggccagcg ccggcacgcg gcccttgggg ttgacgcgca ggtagtcggg     18000
     gctttgctgc tgcgtggcgc cgaaatccag cttgaccaga tcgaaatcgg cgccggcttc     18060
     gtgcagcgcg atgtgcgtcg ccagcgcaca ggtgccaggg gcggtataga aggtccagcg     18120
     ggacatcgtc atcctcgtcg tgtgtcgttt gccagcggta tcgccgcgtt gccgcggcgg     18180
     actgcgtaca gagtagcgcg ggccgcgggg caagcatagc cccgcgcgct ggcggcgtcg     18240
     ccgccgggcg cgcatcgcat tcgatttcct gatggggcga gattgaaatt tctcgcttgt     18300
     agcggtatgg cgcgactcct accatcctcg catcccgaag atgatcgggc aacgccagga     18360
     ggacgaacca tgaccatcac cattaccccc atacagggcg agatcgccgc gtcgatcggc     18420
     ggcatcgatg tgcgccgcgg cgtgaccgac gaccaggtcc aggccatcga gcgcgcgctg     18480
     gaccagtaca tcgtggtcgt gttgcgcggc cagccgctgg acgacgacct gcagcaggac     18540
     ttcatccagc gtttcgggcc ggcgatcgtc accaacacga tcaaggagct gacctccagg     18600
     cgcagccatc gcccgcatct gctggacatc acgacggtcg atgaacatgg cgagccgctc     18660
     aaggacagat cgttcatgaa gctgtacatg ctggccaacc agctgtggca ttccgatggc     18720
     tcgcacatcc agccgccgac ccggttgacc gccttgtcga cccgcatgct gccgagcgac     18780
     ccgcccgata ccgaattcgc cgatatgcgc gcggcctggg acgcgttgcc cgccgatcag     18840
     caggagcagc tgctggatct gcaggccgag cacagcattg cccattcgcg cacgctgctg     18900
     ggcatggagg tcgatcagtt ctcggacgac tcgctgaacc ggcgcccgcc ggtgcagcac     18960
     agcctggtgc gcaccaaccc gcgcacgggc cggcgctcgc tctatttgtc cggccacgcc     19020
     tcccacatca tagggtggcc ggtggagcag gggcgcgcac tgctgcagca actgaccgaa     19080
     catgccacgc aacggcagtt cgtctacgcg catgcatggc agatggacga tctggtcatg     19140
     tggaacaacg ccgcaagcat gcaccgcgcc ctgccttaca cgggcaccga gccgcgcctg     19200
     ttgcgctggt cgggcgttac cgagctggaa ccggtctgag cgccggggcg gcggcgcccg     19260
     catggaccgc cgccgtcgcg atttccatga cggtgccgag cagatgcgac tggcggctgc     19320
     gggcgcaagc cagcacgtaa tcgaagccgg gcggcgagat gccgtcgaag gccgcaacca     19380
     gggagccgtt ctggcagtgc gcctggctga ggtgatcggt aatgagcccg atgccgccat     19440
     gcgccagcag gatgtccacg gtcgccggca tgttgccgct ggtgctgaga cggcggatct     19500
     tcccgccatg ggaagcaatg gattcgattg cctggtcgaa gtagaacgcc ggcttgggca     19560
     cacaccatat ctggcaatgg tccagcaggg tctgcaggcc gaaaccgggg gaccttcgtt     19620
     cgaagtccgc gcgcagcgcg ccggacatca gccattgcgt gggctccgtt ccgatgctgg     19680
     tgtgaatgaa cagcttgctg tccagtctgg atggcgtatg gaatacgccg atatcggtgc     19740
     ggcccgcctc gagatcgcgc aggatctccg ccgcgtacat gacctcgaga tcgaagcaga     19800
     tgttgggcag taccttctcg atggccgaca gcatggacga aacccgaccc atgctggagt     19860
     tgcccacggc caggcggatg cggccgctga tggcatgggg ctcgaggaat gtccccatga     19920
     aatccgcgag ccgctgctgc agcggcgccg tggcctcgac gaacctgcgc ccgtccaggg     19980
     ttgtctccac attgcggccg ttgcgcttga acagtatgac gcccagcatc tcttcgactt     20040
     cccgcacccg agcggaaatc gcgctttgcg tcgtatgcag gtaagcggcg gcggccgtga     20100
     aggtcctcaa tctatcgacg gtacagatcg tctcgatctg gacgggggta ggcagtttca     20160
     tgatccgtta tacgacgcat tggtggatgg cgctgtcgcg ccacgtcctg ctttcgcatg     20220
     gatgcgctca tgccaggacg aaattctcaa tccttcagcc cgacgatgtc gatcaccgtc     20280
     ttccagcgct gccgttccgt gtcgaggtag gcgccgaaag ccgccaggct catgggccgg     20340
     gcggtcatgc tgagggagtc cagtctagtg cggatttcgg gactcgacat gaccttgccc     20400
     aaggcattat ccagcttctc ctgtatgggg gcaggcgtgc ctgcgggcgc gaacacgccg     20460
     aaccaggcgc tgagcacaaa atcgttcacg ccggattcct gcatggtggg tacggcgggc     20520
     agggccttga accgctgttc gctggtcacc gcaagcgcct tcaggcgtcc ggcgtcgtac     20580
     agcgccttca tgctgggcat cgacgtcgcc tggacgtcca cttcgccgct ggcgaccgcg     20640
     atcaaggccg ggccggagcc ctggtacggc acgtgcacca tatccacgcc cagacgctgg     20700
     cgcagcattt cggtgaccag ctgcgtgttg ctgccggttc ccgcgctgga aaacgtgtac     20760
     ttgccaggcg actgctgcgc cattttcaga aatgcagcca gatcctgggc ggggaaatcc     20820
     gtgcgcgtgg cgaaaacgta gtttatttcc gcgatcagtt ggatgggcgc gaaatccgcg     20880
     gccgcatcgt agtgcaggtt ggatttgtag ttgggcagca ccgtaatggg atcgggcgag     20940
     gtcagcagca gcgtgtagcc gtccggggcc gcgcgcgcca cggcctgggc gccgatggcg     21000
     ccggccgcgc cgggcttgtt ctcgaccacg acggtggcgc cgagcgtctt gcccagctcc     21060
     tgcgcgacac tgcgtgcgag tacgtcggtc gagccgccgg cggcgatggg gacaatgatg     21120
     cggatcggct ggcttggata ggcttgatcc gagtgggccg gcacggcgag cattccgacg     21180
     atgccggagc acgccaggag gatgtttctg ggtagcacgg tggtctcctt gaagttatag     21240
     agcaggttct gcctggatgc gcggcgcacc ggccgtccgg gcttgctaca gcatcagcgc     21300
     gccgccgttg acatcgacgg tggcgccggt gatgaagccg gcgtgttcgg acgccaggaa     21360
     cgcggccaca tgcgcgacat cggccggcgc gccccagcgc ccgacgggaa tgtccgccag     21420
     gatcgcggcg tgcagggccg gctggacgtt cgagcccatt gccgtctgga tgcgtccggg     21480
     tgcgatgccg ttgacggtga tgccatgcgg cgcgagctgg cgggcgacgg cccgggtcat     21540
     gccctgcatg gccgtcttgg tgacgaggta gggcatgctt gccaatgccg aggtgcctgt     21600
     cggagagcgt ccgacgcgcg agccgatatt gatgatccgt cctcgcccgt ggcttttcat     21660
     ggccggtatg accagctcgg acaggatcag ggccgcggtc aggttcgttt ccacggccgg     21720
     gcgccaatcc agttccagcg cgaccgcggc aaagccgatt ctcgcgccat tgcgcttggg     21780
     cgagatgccc gcgttgttca ccagcacccg gacccgctgc agcggttcgg acaggcgccg     21840
     cgccagcgcc agcacttggg cacggtcgct caggtcgacc tggcagaccc gggcggcatg     21900
     cccggtggcc cgcaaggctt gccagcgagc ctccagcgcg gcctcgtcgc ggtccagcag     21960
     gacgatttca tggccctctt cggcgagccg ccgggaaatg gcccagccga tgccatgggc     22020
     ggcgcccgac acgaccgcga cgggaagtcg atcgttcatg gccatcctcc attgcgcggc     22080
     agcgtggccg gcgccagcag cccgcggtcc agcgccgcca ggctttcgca gccgagaaac     22140
     gccatgcttc gaagcagctc ttcgcgcatc agttccaacg catgcaatgc gccgggttcg     22200
     ccggcgctgg ccacgcccca tagcggcgcg cggcccagca gcacgccgcg cgcgcccagc     22260
     gcaagcgcct tggccacatc gacgccgcgg cgaaaaccgc tgtcgacgaa gacctcggcc     22320
     ttgtctgcga tctcgtcgac gatgcgcggc agcgcctcga tcggcgtggc cgccgcatcg     22380
     aagttgcgcc cgccatggtt ggagacgacg atggcgtcga cgccgcagtc gcgcgccatc     22440
     cgggcatcct ccggatgcag gatgcccttg gcgatcagcg gaccgcgcca atgacggcgc     22500
     agcgcacgca ggctctccca ggtgatcgag tccgtcttgg gcagcgacat gcggcccttg     22560
     cccgacgcgt ccaggcgctg gcggtattcg tccgggtagt tctccagcat cggcacgccg     22620
     ttgcgcaaga ggtagcggaa gaacacgttc cagatccagg ccggccgccg catcacgtcc     22680
     agcgcgttgc ggctggagat ttgcatcggc agggtgaaat ggttcctgac gttgtattcg     22740
     cggttgggcg acaccggcgt gtccagggtc accatgaggg cccggtaacc cgcgttgcgg     22800
     gcgcggtcca tgagccgata ggacgccccc aggtccggca gcatgtaaag ctggaaccac     22860
     agatcgccgc cggcctgggc cacccgttcc atggagacga tggacgccgt ggaaagcacg     22920
     aaggggatgc cggcgcgcgc ggcggccttg gccatcaggt attccccctc gtaggccagc     22980
     aggccggccg cgccggtggg cgcgatgatc atgggcatcg aactcgcctg gccgaagtaa     23040
     tgggtcgagc agttcctgcg cgagacatcg cgcatcaccc tgggcagcag ccgcagttcg     23100
     tccaggctgc ggcggttgcg cgacaacagg aactcgtcct ccgttccgcg gtcgacgaac     23160
     tcgaacaagc ccttgggcag cgccttcctg gcccacgctc tcaggtcgtc gatgcacagc     23220
     gcgcggcgct gcagggcgtc atgggttttc atacatcctc acctttgttg cgccttgccc     23280
     gctcagacga tgcgcgtgcg caaggtgccg atctgcgggc agtgcgcttc gacgatgtcg     23340
     cccggcttca ggaagaaggg cgccgggtcg ggcttgcggg aaatcgcccc cccttccggc     23400
     gtgccggacg cgatgagctc tccggcgccc aggccgatgc gcgaccaatg ggcgatcagt     23460
     tgcgcgaacg tgaagatcat ctccttgcac gagccgtgct gcctgggctc gccgttgacc     23520
     gacagggaaa gctccagctg cgccgggtcg ggcacctcat ccgccgttac gatccacggc     23580
     cccaacggtc cggcgcccgg gaagttcttg cccatcgcga tcatctggtt cttcatttcg     23640
     gcccgcgccc attcgcgcgc cgataggtcg ttgaacagcg tgtagccgaa cacgtgctcg     23700
     agcgcgcgct cgggtggcgt accgagcggg accgggccgc ccagcacggc ggccacttcg     23760
     acttcgtaat cgaacgccag gacgccgcaa ggccgggcga ccgccgagtc gtgcggggtc     23820
     atgacgctcg cgatcttgat gaacccagcc ggcatgtcct ggttcaggcc cgccgccgag     23880
     gcctgcccgt cccagaacgc cttgccttca ttcacatggc tggcgaagtt cctgcccgcc     23940
     gcgacacagc atcccacctc cagcggcagg cgccacgcca ggtcggcggc cggcgtgaac     24000
     cagctggccg cgccttcgcg gctggcccag gccagcgctt cgttgcagcg atccacgccc     24060
     gcgcggccaa gccggatgac ggcttccatc gacgccggca gcgccagttc gggacgcgcg     24120
     gcccgcacgg cggcaaggtc cagcgcgcat tcctggccgt cgcgccgcac gatggcagcc     24180
     aggttgacat gcgcggcggc gcgatggcgg taggagaaac gtcccagctt catggttttc     24240
     ctttcttgga tgcggatttt tgctttgccg aattctaggg atcgaatccg catccaccaa     24300
     tcgatgaatt tcgatggcca gcaatcagaa gtcggcgtga ttggcggccc gcggcctgcc     24360
     atcgaaatcg gcaatgccgg gccattcaaa tttttcgttg gcccgccttt tcggcgccgc     24420
     ctagaatttt cacttttggc aacaggggcg ggcagtggga cgcgtggcat gtatagcggg     24480
     cagcggcacc gaacggggcc gggcgatcgc ggcgcggctg gccgacgagg gctggaaagt     24540
     ggtgcagctc gacggaccgg acggccagga cgcgcgggcc gcgtccccgg ccctcggcat     24600
     cgatctcggc gcggcggccg acattgcgac gatcgcggcg cggctgggcg tcgactacga     24660
     cgaggtgggc gcatacatcc attgcgcctg cgcgccgccg gccggcgtgg cgacggagcc     24720
     gtccgtggcg cttgcgctgc aggcctggga cgcggcgctg gccatccacc tggaggcgcc     24780
     gctgcttatc tcccagttgc tggtccggcc gatgctggcc aaggggtggg gacgcgtgct     24840
     cttcgtcggc gagcatgccg acaatattcc ccacggcgcg caggagacgg ccttcgcttg     24900
     ttcgatgagc ggactgatag ggctggccag gtcgattgcg tcggaaacgg gcccgcacgg     24960
     cgtcaccgcc aacgtcattc ttcccggacc gctgcagccg gagccggacc cgttcggcct     25020
     ggggccccgg tgcacttacg aaacggacgg ttttgccgcc acggtggctt tcctgctatc     25080
     ggatggcgcc cggctggtga acggcgccac gatccatgcc aacggaggac aggccatgcg     25140
     ctaggcatgg ccggccgaca tgaaaggaat cggcatcgat tccgcataac gacgaattgg     25200
     agacagctat gcagagtgtg ggaaccgccc tcgtgaccgg ggccgcggcc gggataggcc     25260
     gtgcgatcgc cgaacgcctg gcgcaggacg ggcacgacct ggtcctgctt gacgtggacg     25320
     cgcccggcct ggaagcaacc aaggccgtcg tcgccgggca tgggcggcgg gccgacgtgc     25380
     attgcatcga cctgggcgat ctgcaggccg tccggcgatt cgctgcggcg cacgaggcgg     25440
     cgcacatctc catactggtc aacaacgcgg ccatttcacc gaagcgggca ggccgccggg     25500
     tgacgttgtc cgaaaccgac ctggaacagg attggctgcg tgtgctgcag gtaaacctga     25560
     ccacgccgct ggtcttggcg cagatggctg cggcaggcat gcagcgcgcg cgctggggcc     25620
     gcatcgtcaa catcagctcg ctggcggccc gctgccccag cgggctggcc agcctgggct     25680
     acacgaccac caagaccggg ctgctggggt tgacccgggc gttggcccag gaactggcgg     25740
     ccgacggcat cacggtcaac agcatcgcgc cgggccgctt cgccaccgcg atgggcgaga     25800
     acctcgaacc cgaagcgcgg cagcggatcg tagcggccat tcccgtggga cgctggggcg     25860
     aaccgccgga gatcgcgggc ctggtttcct atctctgcgg cccgcagacc ggtttcatca     25920
     ccggcgccgt gctcgacatc aacggcggcg ccgtgatgct ctgacacgcc atgcgcatcg     25980
     cagcggccat ttgcaccaaa actacggaga catccatgac gcgcaggatc ccgcggcgct     26040
     tgatcgccgc actggcttcg ttctcgttct tgatacccgg ggccggcagc cacgccgccg     26100
     acctgcccga atcctatccg aaccgtccca tcaagctgct ctatggtttt tccaccggcg     26160
     ggccggccga ctacgtcacg cgactggtcg ggcgccggct ggcgcaggag ctgggccagc     26220
     ccgtcatcgt ggaaagcaag cccggagcca gttcgacgat tgcgacgaac ctcgtggcgc     26280
     aagcgccggg cgatggctac acgatcatga tgggcgcgat gaaccaggcg gtgaatccca     26340
     gcctgttgcc ggacttgccg ttcgaccagc agaaggacct gcgggccatc gccatcgccg     26400
     cgttcacgcc gaatgtgctg gtggtcagcg ccgattcgag cattgcctcg gtcgacgaaa     26460
     tcgtcgcgcg ggccaggcgc gcgcccggca gcatcagcta tggctcgagc ggcgtcggca     26520
     cctccgtgca cctggccggg gcgctgttcg gcaccgccac cggcaccgaa ttgatccacg     26580
     tgccctacaa gggcattgcg ccggccaagc tggatgtcgt ggccggccgg gtgacgatgc     26640
     tgttcgacag cgtcgtttcg gccaagaagc tgatcgacgc gggcaggctg aaggccttcg     26700
     ccgtctccag cgccaaccgg tccgcgctgt tgcccgatgt gccgaccatg gcggaactgg     26760
     gctggcagga cttcgacgta tcgccctggt acgccttttt cgcgccggct tccaccccgg     26820
     acgcgatcgt cgagagactg aacgccatca tcgtggccac gatgagcgac ccgcaggagc     26880
     aggccaacct gcttgcgcaa ggcgtcgagc cgcgtacgtc gacggcccgg gaggccgacg     26940
     cctacgtggc ggcggagatc ggcaaatggg gcgagctggt caagcggctc gagctcaagc     27000
     cggagtaagg ccgccgctca ggcgccggga aaccgcatgg gcatggcctc gatgaccgag     27060
     cgaaagcgca cgatctgcgg atgggcctcg gcgcttttgc gcaggatcag gcagacctgc     27120
     atcggcgcca cccccagcgc gatgtccagt accttcacgc ggccgctgcg cgcgtgcgcc     27180
     atggcggtgt ggcggggcgc cgcggtcagc aggcgggtgg cggcgacgat gtccagcgcc     27240
     tgggtatagg tgggggtttc caccacgggg tggggcagca gtagcccttg gcgcaggaag     27300
     gcctcggtca gcgcctggcg cacgctcgag ctgatccgct gcagcaccca gtcgcactgc     27360
     gccagccggg cgtagcccgg tttcttcagg cgcgccgccg gatggtcggg cccgcacacc     27420
     acgcatacgt catcctcgta caggttgacg aaggtcagcg aggcgatgtc gcggcccagc     27480
     ttggccacgt ccggcggcag gcgccccagc acgcaatcca gttcgccggc cagcagccgc     27540
     gccagcaagt cttgcgcgct gccttccacc gtatgcagat gacagccgcc ggcctgacga     27600
     aagccctcga tggctcgcgg cagcaggacg gtgaacgcct gcggcaccac gccgacccgc     27660
     agcacctcgt gctcgccggt gtccagccgg tccagcatgg cgcccagttc gtcgaagtcg     27720
     ttcatgagga tgcgcagccg cggcgccagc gccagcgttt gcgccgtggg cgccacgccc     27780
     tggcggctgc gcgtgaacag ctgcacgccg agcaggttct cgatgtcgct gagcatggcg     27840
     gtggcggccg gctggctgat gctcagccgc cgcgccgcct tgcgcagcgt gccttcctgc     27900
     agcaggtact ggatgagggc gatgtggcgg aacttcaggt gcgagagcgc cgcgagcgaa     27960
     cgttggacca tggcggagga aggtgaaagg tattggttat cacataagag gattttttga     28020
     atattaactt tgcagcccaa tccctacact caggtctttc gctatgcaga cgaaaagggg     28080
     aagcgcatga aaacagtctt acgtatcctg ctgcttggcg ccggcctgct gggcgccgcg     28140
     gcggccagcg ccgagtggcc ggcggaccag cccatcaaga tcatcgtgcc gcaggcggcc     28200
     ggcggcacca acgatacggt tgcgcgcctg atgggcgtgg agctgggcaa ggccctgggc     28260
     cagaccgtgg tggtggagaa ccggcccggc gcctccggcg ccatcggcat gcagctggcg     28320
     tcgcgctcgc ccgccgacgg ctacaccctg gccattgcgt ccgacacggc ttccatcctc     28380
     agcgccaccc gcaagatgga ctggcggctc gaccatgaca tggctggcgt ggcgatggtg     28440
     ggcgaccagc ccatcggcgt ggccgtctcg atgcgcgcgc cgtacgccag cctggacgag     28500
     ctgctggccg cggcccgcaa ggaaccggga accattgctt tcggcacctc cggcctgggc     28560
     acgtcgcagc atatcgtcgg cgagtggctg acccacctgg ccggcgtgca gatgatccac     28620
     gtgccctaca agggcggggg ccaggcggtc accgacctgg tgtcgggcac caccccggcg     28680
     gcggtgctgg gcttcgcgcc cctgctgggg caggcgcgca gcggcgggat acgcatcgtt     28740
     gccgtcacca ctgccgaacg caaccccgcc atgccggagg tgccgacgct gaccgaactg     28800
     ggctacccgc agatcacgcg ctcgcaatgg gtgggcgtgg tggcgccgcg cgacacgccg     28860
     ccggcgatcg tcaagcgcct gtccgacgcc atggccgcca tcggcgcgca gccggcgata     28920
     caggacaagc tgcgcgagat cggcctgacg cccaagtcga tggatgccgc gcagttcgac     28980
     gccttcatcc acaaggacgt ggccgactgg ggccgcctgg tcacggaact gaacatcaag     29040
     ctggactgat tcggaggtat ttcatgtcgc aagtgacgca acatcccaac gtggtactga     29100
     tcctggccga caaccttggc tggggcgagc tggggtgcta tggcggcggc gccatccgcg     29160
     gggcgcccac gccgcgtatc gatgcgctgg ccgcgcaggg cacgcagttt ctcaacttca     29220
     acgtggaaag cgattgcgtg cccacgcgtt cggcgctcat gaccgggcgc cacccggtgc     29280
     gcaccggcgc catgcagtcg gtgccggccg gcctgccgca gggccttgtt ccctgggagc     29340
     gcaccttggc gcaggccttc tccgagcaag gctacgccac cgccatgtac ggcaaatggc     29400
     acctgggcga caaggagggc cgttacccca aggaccgcgg cttcgacgag tggtacggga     29460
     tcccgcgcac caccaacgaa agcatgttca tggaggcggt gggcttcgac cccgacgtgg     29520
     tggaagtgcc gtacgtcatg gagggccgca agggcagtcc ggccgaaagg cgcgaacgct     29580
     acgacctgga aatgcgccgc cgcatcgacg aggtgctcac gcagcgcagc tgcgagttca     29640
     tcggccgcca cgcgggcaag gccccgttct tcctctacgt gccgctgacg cagctgcatt     29700
     tccccaccat tccgcaccgc gaattcgaag gccgcaccgg caagggcgat tttgccgact     29760
     ccctggtgga gatggacgcg cgcatcgggc agatcctgga tgcggtcgac cagcacggca     29820
     tcgccgacga taccgtcttc atcttcgcca gcgacaacgg accggagtac cgccggccct     29880
     ggcgcggcag cgccggcatg tggaccggca cctatcacac ggcgatggaa ggggcgctgc     29940
     gggtcccgct catcgtgcgc tggcctggca aggtgccggc cggcagacca acgagatcgt     30000
     gcacgtggtg gacctgttcc ccacgctggc cggcatcgcc ggcctgcagg tgtcgcaaga     30060
     ccggcccatc gacggcgtcg accagtccgc cttcctgctg ggccgcgagg agaaatcggc     30120
     gcgcgagggc tttgtctact acatcaagaa cgagctgcgc gcggccaaat ggcgcgactg     30180
     gaaaatgcac gtcgtctggg aggtggagcc caatgtcggg cccaaccacc tggagacgcc     30240
     ttatgtgttc aacctgatgc aggaccccaa ggaagaaacc gacgtcaaca ccatgcaagg     30300
     ctgggtgcgc ggacccatac gccgcatggt caatgcgttc caggcctcgc tcaagtccta     30360
     tccgccgatt ccgcccggcg cgccggacga ttatgcgccg tcctacgaca tgacgccgcc     30420
     ggccgccaag gacggcggcc aggaggcgcc gtgagcgacg cccaggccga atgggccgcg     30480
     catatctgcc cggacgccgg cgctgcattg gcggcgctgc cgccggcgtg ccgcatcgtc     30540
     tacctggccg acggccaggc gccggccctg ggccgcgccg tgcgggcgct tgccgccgat     30600
     ctcgtcgtgg gcctgagcct ggactatccg cccgggctgg acccacgcga gcgcggcgcg     30660
     gcggcgccgg acaccgagct ggaagacgcc ttgctggcgc ggctggccgg gcggcgcggc     30720
     atcgcggtgg cgcatcattg cggcatcgcc gtggtgtggg aagcctgggc gcgcgcgcct     30780
     tcgtccggcg ccgccgatat gtccagtgtg cgtgtcgacc ggtaccggct atgcctggac     30840
     gccggcggcg cagggcaggg cgcgggcacg gccccctagg tgtgaactgt caataggttg     30900
     tattcgtcca ggttgagtct ggagatgggt acagcgcgcc cgatgccttg gtggggtcga     30960
     tgccagttgt agtggtgtag ccaggatttc atggcatcgg ctcggtgttg ggagttctgg     31020
     taggtgtgag cgtaagccca ctcacgcaag gccgactgga tgaagcgttc ggccttgcca     31080
     ttggtctgtg ggcggtaagg tcgggtaaag cggtgcttga tgcccagctc atggcacagc     31140
     gcggcgaagg cgcggctgcg aaaggccgag ccattgtcgg tgagcaagcg ctggatggtc     31200
     acgcccaggc gctggtagta ggccactgcg tccttgagga actggacggc gctggggaag     31260
     cgctcgtcgg ggtggatgtc ggtgaaggcc acgcgggcgt ggtcatcgat ggccacgaag     31320
     acgaagtccc agccggcccc ctcaacggta tcgcgtcggt tgcccgtgac ccggtgacca     31380
     gggcgctgga tacgtcccag cttcttgatg tcgatgtgca gcagatcgcc gggggcctga     31440
     tgctcgtagc gcaccaccgg ctcggccggc tccaggtcgg ccaggtgcga cagaccggcg     31500
     cgggccagga cgcggctgac ggtgctggct gacacgccca gcgcctgggc gatgcgcgct     31560
     tgggtcagcc gcttgcggcg cagctccacg atagccagcg ccttggccgg cgcaatcgct     31620
     cggggcgaga ccgtcgggcg cgaggacgca tcggccaagc ccgcctggcc ctgagccagg     31680
     aagcggccca gccatttgcg cacagtcggc gcggtgaccc cataggcgcg ggccgcttca     31740
     ggcacacaaa cttgatgggc gatcaattgc tggaccattt cgagtcgacg taggaaggtc     31800
     aatcgggcat gcttatgggt gttcatccgg ccgggctcct tgagtgaact gggggatcgg     31860
     cgatttccag tttctcaaat ccggttcgga tgaaccatgc atacaaccta ttgaatcttc     31920
     acagctaggc cgtggtgccg tcgttcgccg cggtggcgcg ccggcgctgg cgcgtcagcc     31980
     tggtgccggt ggcgccgcgc gtggcggtcg attactactg catcatgcgg gccgggcagg     32040
     gggatggcga gcgcatcgac gccttcgcgc aatgcttcgg ctcggtggcg gccgaacaca     32100
     tgggcgccac ggccgcgcgc tagatgcggg cttgcgccgt gcgccgcgac agcgtctcgg     32160
     cggcttcctt gcgctcgctg tagcgatcga ccaggtacgg cgacgcgtcg cgcgtgagca     32220
     aggtgaactt catcagctcc tcggccacgt cgaccacccg gtcatagtaa ggcgaaggct     32280
     gcatgcgtcc cgcctcgtcg aactcctggt aggccttggc caccgacgat tggttcggga     32340
     tggtcagcat gcgcatccag cggcccagca cccgcatctg gttcacggcg ttgaatgact     32400
     gggatccccc cgatacctgc atgaccgcca gcgtcttgcc ctgggtcggg cgcatcgcgc     32460
     ccatcgacag cgggatccag tcgatctgcg tcttcatcag gccgctcatg gcgccgtgcc     32520
     gctccggcga actccagatc atgccttcgg cccaccggac cagctcatgc agctcacgga     32580
     ccttgggatg gtcctcgctg gcgtcgtcga ccagcggcag cccggacggg ttgaacagcc     32640
     gggtctcgcc gcccagcgcc cggcgcagcc gcgcggcttc ctccgcgacc aggcggctat     32700
     aggagcgctc gcgcaacgac ccatacagca gcaggaagcg cggggcatgc gtggcgcgcc     32760
     cgggcgggaa cagctcggcc gcgctcggct gcttgaaccg tgacggatcg atattgggca     32820
     gatcggcgag aacctcagac acggttgccg tccgcatcga tgacgggctg cccgtcctcc     32880
     ttgtcgaagg cgccgcgctg gggccgggac aggagatcca gaacggtttc cgacggccgg     32940
     cacagacgcg ttcccagtgg ggttgtcacg atggggcgat tgatcaggat cgggtactgg     33000
     agcatgaaat cgatcagctg ctcgtctgtc catttcggat ccgacaaacc gagctcgtcg     33060
     taaggcgtgc ccttttgcct gagcaggtcg cgcaccggca tccccatggc gacgatcaac     33120
     gaccgcagcg ttgcggcgtc gggcggcgtc ttcagatatt cgatgatggc cggctactcg     33180
     ccgctgttgc gaatcagccc gagcacattg cgcgatgtcg cgcaggccgg gttgtgatag     33240
     atcgtgatgg aagtcatgac acacctctgt tgatgcaaga ctagggcttg attgggtcgg     33300
     gccgcgcgcg cagcacgagc agcgcggcgc aggctgccag gcctatgccc ccggatagcc     33360
     acaaagcgtt ggcgcgccag gcgtccagcg ccaggccgaa gagaaatggc gccagcgcct     33420
     gcgcgacccg cgccggcatc atcagccagc cttggcgcgc gccatagccc cgggggccga     33480
     acagcgccag cggcaacgtg cctttggcga tggtcaggat gccgttgccc gccccatgca     33540
     ggatggcgaa cagcggggcc agcgccgggc cggcggccaa cagcacggca acgccggccg     33600
     gatgcgtcag ggccgccagg cgcgccgaca gcaaaggatg aacatgccgc agcaagccga     33660
     actcgagcag gcggccggcc acttgcgcgg gaccgatgag cgcgcccacg gccacggcgg     33720
     ccgcgagcgt ggcgcccgtg gcttgcagca tgcgcggcaa gtgggtggcc atcgcggtgc     33780
     tgatgaacca cgtcgccgcg aacacgaagg cgagcagggc ggtggccagc ccctgcggtc     33840
     ccggccgcgc agcagggagg gtcccctcct gcgcggccgg ggcatccggg cttggcgtct     33900
     cggcggcaac ggctttggga agccaggcgt tcaacggcag gccgatcatc aaatgcaagg     33960
     ccgcccagcc caggcatgcg ccgcgccagc cgaacagcgt ctccatccag gcggaaagcg     34020
     gccagccaac ggtgctggcg aaaccggcga tcagcgtgat tccggtgatg gccccgcggg     34080
     cgtgatggcc ataaaggcgt accaggctgg agaaggcggc ctcgtagagg ccggcgccca     34140
     tcgccacgcc catgacgagc caggcggcaa ccatcgtcca caggccctgg gcggcgccga     34200
     gcatgcccag cccgagggca aacaacagac tggtgccggc caggaccata cggccgccgt     34260
     ggcggtcgat cgccagtccc gtccatggcc cgatcaacgc cgatgcgacc agggcggcgg     34320
     agaacgccgc atagaccgtc ggcgtggaca cgcccaggtc gcgagccatc ggatccgcca     34380
     gcatcgccgg cagatagtac gaggaggccc aggccagcgt ctgggcggtt cccaggatcc     34440
     cgacgacgcg aaccggtgcg cctggcatgg atcaggcccg cctggcgccg gcgtcgcaac     34500
     cggctgtgtt ctttcgggaa tcggacacct cgcaggtcgc gccctggcag cagtgtttgg     34560
     tgagatagcc gagcaatgca ttcatccgga agaaatcggc gcggtagatc agattgcggc     34620
     cctgttgctc gacgctgacc aggccggcgt gcgccagctc cttgaggtga aaggacagcg     34680
     cattgcgggc gatgccgagc ccgtcggcca tgacgctggg cgtgagcccc gccgggcccg     34740
     cgacgacaag ggcgcgaaac acgctcaggc gttgcgcatg ggccagggcg ccgagggagg     34800
     aaacggcttg ttctgcattc atgccaaaat aatacaatga ttcttgaatc attgaatagt     34860
     catgatgggc tgcgccgaat tgccggcccg ggcggggcag gtgggcgggc gaacggcctg     34920
     gaggccgcgc cgtggatcgg gaatccttgt cgcagcataa gaaatccttg cttgtcgctc     34980
     gcggggttcg ccggtgtaat tcgtcggggc aggcattgcc gaatccggcc ccaacgcaga     35040
     cgcgcacagg gcagctcaat cgaggaagaa atgcacgacg aacaggcact tgatcttgtc     35100
     atccgcggcg gattgctcat ggacgggcat ggcggcgcgc cccgggtcgc cgacatcggg     35160
     gtgcgcggcg ccctgatcgc cgagatcggc gacatcgcgc cgggcgcggc cgccgagatc     35220
     gacgcgcgcg gcaagatcgt cacgccaggc ttcgtcgaca tccatacgca ctacgacggg     35280
     cagatcatct ggaattcccg cctggctcca tccagctggc acggcgtgac cacggtggtg     35340
     atgggcaact gcggggtcgg gttcgcgccg gtgcgcgcgg ccgatcgcgg caatctgatc     35400
     gagctgatgg aaggcgtgga agacatcccc ggcatcgcgc tgcacgaagg gctggactgg     35460
     gcctgggaga cgtttcccga cttcctgcgc gcgaccgaac ggatcgagca cgacatcgat     35520
     ttctgcgcgc aactgccgca cgcggcgctg cgcgtgtacg tcatgggcga gcgcgcgctg     35580
     cggctcgaga tggccacgcc cgaggacatc gcgcggatgc gcagcctggc ggccgaggcc     35640
     atgcgccatg gcgcgatcgg cttctcgact tcgcgctcga tcaatcaccg ctcggtcacc     35700
     ggcgacccga tgccgtcgct gcgcgcggcc gaggaagagc tgaccggcat cgccatgggg     35760
     ctggccgatg ccggcggcgg cgtgctggag atcatcatcg acttcgacga tccggacatg     35820
     ctggaggccg agttcggcat gatgcgccgc ctggtggaga aatccggccg gccgctgtcg     35880
     ttctcgctga tgcagaagca cggcaacaag gacgggtggc gtcggctgct ggccctgacg     35940
     acgcaggcgg cggccgacgg cctgcccatc cgcgcgcagg tcgcgccgcg cggggtaggc     36000
     gtgctgctgg ggctgcaggg cagccgcaat gtcttctctg actgcgccag ctacaaggcc     36060
     atcgcccagc ttgcgctgga tgagcgggtg cgccgcatgc gggacccggc cttgcgcgcg     36120
     cagctgctgc gcgagagcca ggatacgccg ctgggcaagc gcctgaacga gttcgacaac     36180
     atctttccgc tgggcaaccc gccgtgctac gacccgggcc cggaacgctc gatcgcggcg     36240
     ctggcccggc gcgccggcgc cgatccggcc gagctggcct acgactgcct gctcgaggaa     36300
     gacggcaagg cgctgctgtt ctcgccattc gcgaactatg ccgaccagaa cctggacgcc     36360
     tgcgcgcaaa tgcttgccga cccgaacacg gtcatcggcc tgggcgacgg cggcgcgcac     36420
     gtggcgctga tctccgacgc cagcttcccg accttcctgc tcaagcattg gggggcgggg     36480
     gagcagggcg gccgggcccg cggccgcctg atcgcgccgt cacagcgcgg ccggcgacgg     36540
     cccacgaaca ataaacaagg aggagaagac catgatgaaa ggcatctgtg cagcgtttgc     36600
     gttcgccgcg cttgcggctt cctggcaggg cccggcccag gccgcgtttc ccgaccagcc     36660
     catcaagctg gtggtgccct tcgcgccggg cgccacgatc ggcccgctcg cgcagctggt     36720
     gtccgagcaa ctgtccagcg acctgggtac gccggtgtac accgagttca agaccggcgc     36780
     cggcggcaac atcggcgccg atatcgtggc caagtcgccg ggcgacggct atacgctgct     36840
     gctgggcacg atcagcatcc tgaccatcaa cccgtcgctg tacccggact tgcccttcga     36900
     tccggtcaag gacttcaagc cggtgtcgat gctggtcacc acgcagaaca tcctggtcgt     36960
     caaccccgag agcaagatcc aatcggtggc ggatctggcc gactatgcca ggcaacatcc     37020
     tggccaggcc accttcggct cgtccggcac cggcagcacc atgcacctgg cgggcgaact     37080
     gttcagcacc acggcgcagg tcaagatgac gcacgtcccg taccgcggcg gcggaccggc     37140
     caggtcggac ctgctgggcg ggcggctgac gctgatgttc agcgacctga gcgcggtccc     37200
     catggtgcag gccggcaagc tgcgcgcgct ggccgtgacc gggtcgcagc gcgacggccg     37260
     catccccgat atcccgacca tgcaggaaag cggcatgaaa ggcttcgatg tcgaaccctg     37320
     gtatggcctg gtggcgcccg cgggcacgcc cgacgcggtc atcgccaggc tcaacgccag     37380
     cgtgcgcaag gtgttcgaca agcagaaggt gcgcgatgcg ctgcagaaca tcggcctgcg     37440
     gccggccagc gacctgtcgg tggcgtacat ggccggcaag atcgacagcg acctgggcaa     37500
     gtgggcgccc atcgtcaaat cggtcgacat gaaaaccaac tgatgagcgg cccggcatga     37560
     agacgcaagc aacagccggc gatggcgcgg cggtggtggc catcgcgggc ggaatgggcg     37620
     cgctgggcag ggcgctggcg cagcggttca agcagcgcgg cgaccaggtc gtcgtgctgg     37680
     accaggccac cgacgccgcc ggcctgccgc aggcgggcgc cgacctggcc ttgctcgacg     37740
     tcgatctcaa cgacgtcgcc agcacgcgcc atgccttcga cacgatcgcg cgccggttcg     37800
     gccggctcga cgccctggtc agcgtggccg gcggtttcca tcacgaaacg ctggccgagg     37860
     gcaaggtcaa ggcctgggac cacatgtacg cgctcaatct gcgcaccgcc gtggtggcct     37920
     gccaggccgc gctgccgctg atgctggcgc gcggcgccgg gcatgtcgtg tgcatcggct     37980
     cggacgccat cgggcgcgcg cacgccgggc tcggggcgta tgccgcgtcc aaggcgggcg     38040
     tggccgaact ggtcaggacc ctggccgccg aaacccgcga ccagggcatc gcggccaacg     38100
     cggtgctgcc cggcaccctg gataccccgg gcaatcggcg cgccatgccc gatgccgatt     38160
     tttcccgctg ggtgtcgctc gacgcggcgg cggcgctgat cctgttcctg gcctcgccgc     38220
     tggccgccca gatcaacggc gcctgcattc cgatcgtgaa ccgctgctag agcgctatgc     38280
     ggcggcgctg cagtgggccg ccagcagcct ggagaatacg tggatggacg aggaggccgg     38340
     attggacgcg tcgctcgtgc aatagaaatc gaccgccggc gcgccctgcg gcagcgcaat     38400
     ctggccgacc gtgtcgcgat cgtagaaatc cgccaggaaa gtgggcacga aacccatccc     38460
     catgccggcg ctgatcaagg acgccaccgt ggccacgtgg cagacctcct ggcggcgcag     38520
     ggcatgcgcg ccgacctcca gcaggtaccg gtcgacgacc tgctggaccg cgttggagtc     38580
     cggcagcgcc cacagtacga tatcgtgctg gcgcgcccag tcttccaccc ccgcgatctc     38640
     caggcccggc gggatcagcc tgccgggacc ggccagccgc agcgccatgc cgaagatgta     38700
     ctcgctcttg agccgcgagg cgcggcgcat ataggtgccg taggtcgcgt cgagcctgcc     38760
     ggtctccacc atgtcgtgca gcacttccag ttcggcgtcc acgacctcgc acgaacggcc     38820
     cgtgcattgc tggaactcgc gcatcacggc cggcagcacc gtgctggcga tcaagggcga     38880
     caccccgacg cagatcccgc cttgctggcg gcggttcagc gcggacagct ccagcatgcc     38940
     cttgttgagg ctttcgacgg cctggcgggc atagggcagg aactgcgtgc cggcttgggt     39000
     gagggcggtc gcgcggttcg aacgctcgaa cagccggatt ccgacctgcg tctccagttc     39060
     gttgatcatg gagctcaggc ccgcctgggt gacgtgcagg gcttcggccg cgcgcgtgaa     39120
     gctgcggacc tcggcgacca gcaggaaggc ttggagctgg cgggtggata ctctcatgtc     39180
     ggttgggccc atgcttgtcg gccccgtctt ttatcatggc gtcgatgccg ccggccagcc     39240
     aagcctggga aggacgcggt gtcggtcgga ttcaacattc caacaggagc agtccgcctt     39300
     gtctctctat taccggatca gtttcgtcct gagcgtgctg gcgctcgcgg cctgggcgat     39360
     cgccgtcacg ctctacaagg ccccgcgtca cggcgacggc tacgggccgg acccgctcgg     39420
     ggtcttgctt ttcctggcgc tgtggccggt gggcctgctg ctggcgcatt ccggtctgct     39480
     ggcgtgcctg gtgcgcggcc agcggcccgc gtcgatcctg caaggccggt acggggtcgc     39540
     catccatctc gcgctgggcg cgggtttcct ggcttacgcg ctgtacaggg tctagctgtg     39600
     aagattcaat aggttgtatg catggttcat ccgaaccgga tttgagaaac tggaaatcgc     39660
     caacccccca gttcactcaa ggagcccggc cggatgaaca cccataagca tgcccgattg     39720
     accttcctac gtcgactcga aatggtccag caattgatcg cccatcaagt ttgtgtgcct     39780
     gaagcggccc gcgcctatgg ggtcaccgcg ccgactgtgc gcaaatggct gggccgcttc     39840
     ctggctcagg gccaggcggg cttggccgat gcgtcctcgc gcccgacggt ctcgccccga     39900
     gcgattgcgc cggccaaggc gctggctatc gtggagctgc gccgcaagcg gctgacccaa     39960
     gcgcgcatcg cccaggcgct gggcgtgtca gccagcaccg tcagccgcgt cctggcccgc     40020
     gccggtctgt cgcacctggc cgacctggag ccggccgagc cggtggtgcg ctacgagcat     40080
     caggcccccg gcgatctgct gcacatcgac atcaagaagc tgggacgtat ccagcgccct     40140
     ggccaccggg tcacgggcaa ccgacgcgat accgttgagg gggccggctg ggacttcgtc     40200
     ttcgtggcca tcgatgacca cgcccgcgtg gccttcaccg acatcccccc cgacgagcgc     40260
     ttccccagcg ccgtccagtt cctcaaggac gcagtggcct actaccagcg cctgggcgtg     40320
     accatccagc gcttgctcac cgacaatggc tcggcctttc gcagccgcgc cttcgccgcg     40380
     ctgtgccatg agctgggcat caagcaccgc tttacccgac cttaccgccc acagaccaat     40440
     ggcaaggccg aacgcttcat ccagtcggcc ttgcgtgagt gggcttacgc tcacacctac     40500
     cagaactccc aacaccgagc cgatgccatg aaatcctggc tacaccacta caactggcat     40560
     cgaccccacc aaggcatcgg gcgcgctgta cccatctcca gactcaacct ggacgaatac     40620
     aacctattga cagttcacag gtagccggct tcgccgaagg tcggcacgtc gggcaggacg     40680
     ctgacgcgct tgggcgcggc cacggccagg gcgcgcagct tgccggcctg gatgtgcggg     40740
     atggacgacg gcagattgtc gaactgcgcg ttgacctgcc cggcgatggt gtcgttgagc     40800
     gccggccccg aaccgcgata gggcacgtgg accatgtcgg tgccggtcag cgacttgaac     40860
     agctcgccgt ccaggtgcga gatgctgccg gtgcccgacg aggcatagct gtacttgccc     40920
     gggttggcct tgaccagggc gatgaattcc ttgagcgtct gggccgcgat cttggggttg     40980
     acggtcatga cgttgggcac gctgaccagg ttggtgatgg gcgtgaagtc cttcagcggg     41040
     tcgtacgggg tctgggggtt ggtggccggg ttggtcgcca tcgtgctgac cgtggccacg     41100
     cccagcgtat agccgtccgg ggtggccttg gccagcgcgt cggcgccgat cgcgccgccg     41160
     ccgccgccgc ggttttccac cacgaccggc tgccccagct cgcgtcccag cccctcggcc     41220
     acgatgcggg ccacgatgtc cgtggtgccg ccggcggcaa acggcacgat caggcgcacc     41280
     gcatggttgg ggtagggctg ggcctgggcg gcggcgcctg tgacacaggc gccggccacc     41340
     agcgcgccga gcaggatctt aatggaagcg ggtttgctca aggttgtctc ctggttgttc     41400
     cagaggggct gcatgggcgg ccgttcgtga cggccgcgtc ttggggtgcg ccattgcacc     41460
     gaaaatgcag tcaggcggaa atgcgggtca accccaacat gcgataacct gctttcagct     41520
     ggtagacagc tacgggaaaa ctgtcgcaaa cagcccgctt ttgcatagat ccgtgcgtaa     41580
     cttacaagaa tctgatattt ttcgggtgag attcttggcc ggtcttgcca gaacgctacc     41640
     tgatatttcg attgacagcg cttgttcccc gggcgatctt gccttcgaga agcgcggtag     41700
     tgagttgttg cgacgtgctg ggccagggtt ccgccgatag cccccggcca cgctcgcctt     41760
     tcgccgccgc gagagagagg gccggaccct tcccggagcg ccatgtcgct attactagta     41820
     ctcgccctgc cgtttctcgg cagtctgtgt gccgctttgc tgccggccaa tgcccgcaat     41880
     gcggaagcct ggctggctgg cctgatcgcc ctggcctgca ccttgctggt ggccagcctc     41940
     tatccccaga tcgccgccgg cggcgtgatc cgcgccgacc tgccgtgggc gccggcgctg     42000
     gggctgcagt tcaccctgcg catggacggc tatgcctggc tgttcgcgct gatcgtctcg     42060
     ggcatgggcg cgctggtcgt gctgtatgcg cgctactaca tgtcgccgga agacccggtg     42120
     ccgcgctttt tctcgttctt ccaggcgttc atggccgcca tgctgggcgt ggtgatgtcc     42180
     ggcaacctga tccagctggt catgttctgg gaaatgacca gcctggcctc gttcatgctg     42240
     atcgcctatt ggcaccaccg gctcgacgcc cggcgcggcg cgcgcatggc cctgacggtc     42300
     accggcgccg gcggcctgag cctgctggcc ggcgtgctga tgctcggcca catcgtcggc     42360
     agctacgaca tggaccaggt gctggccgcg ggcgatatcg tgcgcgccga cccctggtat     42420
     ccggcggtgc tggtcctgat cgcgctgggc gcgctgacca agagcgccca gttcccgttc     42480
     cagttctggc tgcccaacgc catggccgcg cccacgccgg tgtcggccta tctgcattcg     42540
     gccaccatgg tcaaggcggg cgttttcctg ctggcgcgct tctggcccat gctggcgggt     42600
     accgacgaat ggttctggat catcggcggc gccggcctgt gctcgctggt gctgggcgcc     42660
     tacgcggcga ttttccagca ggacatgaaa ggggtgctgg cctattcgac catcagccac     42720
     ctggggctga tcacgctcat gctgggcttg aacagctcgc tcggcctggt ggcggcgatc     42780
     ttccacatgg tcaaccacgc caccttcaag gcctcgctct tcatggccgc gggcatcgtc     42840
     gaccatgaaa ccggtacgcg cgacgtcggg cgcctgagcg gcctgtacgg ggccatgccc     42900
     atcacggcca cgctggccat ggtggcggcc gcctcgatgg ccggggtgcc gctgctcaat     42960
     ggcttcatct ccaaggagat gttcttcgcc gagaccacct tcgtcagcgg cgacgtgctg     43020
     gtgcggtggg gcctgccgct gatggcgacg ctggccggcg cgttcagcgt gacctattcg     43080
     ctgcgcttta tcctgcaggt gttcttcggc ccgccggccg aagacctgcc gcgcgcgccg     43140
     cacgagccgc cgcgctggat gctgctgccc agcgccttgc tggtcatggt gtgcctggtg     43200
     gtgggcgtgc tgcccggcgt gacgctgggg ccgatcctgc acctggccgc cagcagcatc     43260
     ctgggcgagc acatgccgca gtacagcctg tcggtgtggc atggcttcaa cctgccgctg     43320
     gccatgagct tcgtcgcgct gactgccggc gtgctgctgt acctggcgct gcgggcgcgc     43380
     cagcgcgccc atccggggct ggtgccgttc atctatcgct tcgacggccg gcgtaccttc     43440
     gagtacctgc tcgatgcctc cagcgtggcg gccgcctggc tgctgcgcta cctggcgtcc     43500
     tcgcgcatgc aggtgcagat gctggtcatc gtgctgggca ccctgtgggt ggcctggctg     43560
     ccgctgcgcg cgggcggctg gctggcgggc caggcgcgcc tgacgccggc cgaccccgcg     43620
     ttcgcgatcc tgtgggtggt cggggcggcc tgcgcgctgg gcgcggccta ccaggccaaa     43680
     taccaccggc tcgcatcgct gacgctgtcc ggcggcgcgg ggctgatcac ctgcctgacc     43740
     ttcgtctggt tctcggcgcc cgacctggcg ctgacccagc tggccgtaga ggtggtgacg     43800
     gtggtgctgc tgctgctggg cctgcgctgg ctgccgcggc gcattcagac cggcggcgac     43860
     gaagaccgtc ccgacctgcg cgcgcgggtg cgccgcctgc gcgacctggg gctggcgggc     43920
     gtggccggcg cctgcatggc cgcgctggcc tacgcggtgc tgacgcgtcc ggtgggcgac     43980
     acgatctcca gcttctttac cgagcgcgcg ctgcccgatg ggggcgggac caacgtggtc     44040
     aacgtgatcc tggtcgattt ccgcggcttc gataccctgg gcgaaatcac cgtgctcggc     44100
     atcgtggcat tgacggtcta cgcgctgctg cgccgcttcc gtccggcgcc cgaaagcgtc     44160
     gagctgccgc atcagcaacg cgagcaggac ggcatgccga cggtcgacga gaccggcgag     44220
     cggccggcgc cggacaccaa gtcgccgttg ccggccgggc cgatgatgat tccggccgtg     44280
     ctggtgcggc tgctgctgcc ggtggcggtg ctggtgtcgg tctacctgct gctgcgcggc     44340
     cacaacctgc ccggcggcgg ctttgtcggc ggcctggtca tggccaccgc gatcatcctg     44400
     cagtacatgg tcggcggcgt gtactgggtc gagtcgcgca gccgcctcaa tccgcagcac     44460
     tgggtcggcc tgggcctgct ggccgccggc ggcgccgcgg tctcggcctg gctggcgctg     44520
     cggccgttcc tgtcggcgct ggcctgggac gtggcgctgc ccgtcgtcgg ccatgtgcat     44580
     ctatccagcg tgctgctgtt cgacctcggc gtctacatgc tggtggtcgg cgccacggtg     44640
     ctggtgctgg tggcgctggc ccaccaatcg ttgcgcgcgc agcgccaggc ggccgtcgag     44700
     gcccaggcgg tcgcgcaaac cgggagtcct gcctgatgga agtcgtttat gccctggcca     44760
     taggcgtgtt ggccggttcg ggagtgtggc tgctgctgcg gccacgcacc ttccaggtca     44820
     tcatgggcct gtcgctgctg tcgtacgcgg tgaacctgtt cattttcggc atggggcgcc     44880
     tgacggtggg caggccgccc gtggtcagcg cctcggcgcc ggtcgacgcc gcggcttatg     44940
     ccgacccctt gccgcaagcc ctggtgctga ccgcgatcgt gatcggtttc gccaccacgg     45000
     cgctttttct cgtggtgctg ttggcctcgc gcgggctgac cggcaccgac cacgtcgacg     45060
     gccgggagcc tgaatcttga tcgactggct gcagcacctg cctatctacc ccattacggt     45120
     gccccttatc gcgggcgcgc tcatgctgtt gctgcccgat acgcagcgca agacccgcgc     45180
     gggtatcggt ttgctgtcct cgctgctgca gctggccagc gccatcgcct tgctgagcct     45240
     ggccgccggc gccggcggca tctggcccga cggcatcggc gtgtacctgc cgggcgattg     45300
     gccggcgccg ttcggcatcg tgctggtggt cgaccgcctg gccgccgtca tgctggcgct     45360
     gaccgccgtg ctgggcctgg ccgcgctgat ctactcgctg gcccgctggg accgcgccgg     45420
     ggtgcatttc cattcgctgt accagttcct gctgatgggg ctgaacggcg ccttcctgac     45480
     cggagacctg ttcaacctgt tcgtgttctt cgaggtgctg ctggcggcgt cctatgggtt     45540
     gatgctgcac ggctcgggca tcgcgcgcgt tacggccggc ctgcaataca tcgcggtcaa     45600
     cctggtggcc tcgttcctgc tgctgatcag catcgcgctg atctacggcg tgaccggcac     45660
     gctcaacctg gccgacctgg ccttgcgcgc cggcacgctg acgggcggcg agcgcagcct     45720
     gttcgaggcc ggcgcggcca tcctgggggt ggccttcctg gtcaaggccg gcgcctggcc     45780
     gctcaacttc tggctggtca agggttacgg ctcggcggcc gcgccggtgg cggcgctgtt     45840
     ttccatcatg accaaggtcg gcatctacgc cttgctgcgc atcggctcgc tgctgctgcc     45900
     caccggcgcg ccggcggctt tcagcctgga ctggatgttc gcggcggggc tggccacgct     45960
     ggtgttcggg ggactgggcc tgctggccaa ccagcagctc gaaaagctga ccggctattg     46020
     cgtcatcgtc tcggccggca cgctgctgac ggccttgggc atgcccggcg tgaccttgac     46080
     cgggccggcg ctgttctacc tgatcagctc ggtgctggcc accggggcgc tgttcatgct     46140
     ggtcgaactg atcgagcgca cccgcagctt cggggccaac gtgctggccg tcaccatgga     46200
     cctgttcgac ctggacgatc cgtccacgcc caaccggtcc gacgacgtcg tgggcgtggc     46260
     gattccggcc gcaatggcct ttctcggcct ggccttcgtg tcctgcgcct tgctggtgac     46320
     ggggctgccg ccgctgtcgg gcttcgtggc caagttctcg ctgctgtcgg cggcggtgac     46380
     ggcggccaat acgccgtccg tggcgctcga tgcctgggtg ctggtggcgc tggtgctgtt     46440
     gtcgggcctg gctgggctga tcgcgctggg ccgcgtcggc atccggatat tctggagctc     46500
     cgacgaccgg gtcacgcccc gcctgcggct gatggaggcc gggccggtcg cggtactgct     46560
     gctgctgtgc gtggtgctgg ccgcgggcgc cgggccggta tcggcctacc tggacgccgc     46620
     cgcccagtcg ctggaccggc ccgctagcta cgtgaacgca gtgctcgcca agcagccggc     46680
     gcgcgcgctg tcggagggcc tgtgatgcgg cgctactacc ttgccttgct gccgctggcc     46740
     atgctggcgc tgtggctaat gctcaaccaa tccgcctcga tcggccagct ggcgctgggc     46800
     gcggcgctgg cgctgtggct gggctgggcg tccagccggt tgcggccgct gcgcggcaag     46860
     ccgcgcagcc tgtggctgct gcccgggctg gccgcgcgcg tgttcgccga catcgtccgc     46920
     tccaacgtcg cggtggcgcg gctggtgtgg cagcggcgcc cggatttctc gcccggcttc     46980
     atcgccattc cgctcgacct gcacgacccg cacggcctgg ccatcctggc ctgcatcgtg     47040
     acctacacgc cgggtacggt gtgggtcgac atcatcgacg gcaagctggt cctgcacgtg     47100
     ctggacctgc agaatgaaga ggcgtggatc gcgctggtca agcagcgcta cgaacgcacc     47160
     ctgatagagg tattcgaatg atgaacatcg tcctgtactg gtcggcgtcg ttcgccttgc     47220
     tgtgctttgc gctggcgatg gcctgcgcgg cgatccggct gctgcgcggg ccgaccgcgc     47280
     aagaccgcgt gctggcgctg gactccctgt acgtcagcgg catgctgacc atgctggtgt     47340
     tcggcatccg cgccggcacg ccggtgtatt tcgatatcgc gctgctgatc gcgctgttcg     47400
     gcttcgtcgg ctcgaccgcc atggcgaagt tcctgctgcg cggcgaggtg atcgagccat     47460
     gagcgacgtc gacattccgc tgtgggccgg catcccggcc gccatcctgc tggtgctggg     47520
     cgggctgctg accctggccg gcgcgctggg catgctgcgc ttcggccatt tctacgcccg     47580
     catccatgcg cccacgctgg gcaacaccat gggggcatgc agcgtgctca ccgcctcgat     47640
     cctggtgttc tccagcctgt ccatgcggcc ggtggtgcac gaattcgtga tcggcatgct     47700
     gctggtgctg acttcccctg tcaccggcat gctgctgatg cgcgcggccg tgtaccgcgc     47760
     gcggcgcgcc gacgacagcg cctgagggca gggcggcgcc gatttacgtg tgccagggtc     47820
     ttgtaacatt ttcgtagcct aggtgtgaag attcaatagg ttgtatgcat ggttcatccg     47880
     aaccggattt gagaaactgg aaatcgccac ccccccagtt cactcaagga gcccggccgg     47940
     atgaacaccc ataagcatgc ccgattgacc ttcctacgtc gactcgaaat ggtccagcaa     48000
     ttgatcgccc atcaagtttg tgtgcctgaa gcggcccgcg cctatggggt caccgcgccg     48060
     actgtgcgca aatggctggg ccgcttcctg gctcagggcc aggcgggctt ggccgatgcg     48120
     tcctcgcgcc cgacggtctc gccccgagcg attgcgccgg ccaaggcgct ggctatcgtg     48180
     gagctgcgcc gcaagcggct gacccaagcg cgcatcgccc aggcgctggg cgtgtcagcc     48240
     agcaccgtca gccgcgtcct ggcccgcgcc ggtctgtcgc acctggccga cctggagccg     48300
     gccgagccgg tggtgcgcta cgagcatcag gcccccggcg atctgctgca catcgacatc     48360
     aagaagctgg gacgtatcca gcgccctggc caccgggtca cgggcaaccg acgcgatacc     48420
     gttgaggggg ccggctggga cttcgtcttc gtggccatcg atgaccacgc ccgcgtggcc     48480
     ttcaccgaca tccaccccga cgagcgcttc cccagcgccg tccagttcct caaggacgca     48540
     gtggcctact accagcgcct gggcgtgacc atccagcgct tgctcaccga caatggctcg     48600
     gcctttcgca gccgcgcctt cgccgcgctg tgccatgagc tgggcatcaa gcaccgcttt     48660
     acccgacctt accgcccaca gaccaatggc aaggccgaac gcttcatcca gtcggccttg     48720
     cgtgagtggg cttacgctca cacctaccag aactcccaac accgagccga tgccatgaaa     48780
     tcctggctac accactacaa ctggcatcga ccccaccaag gcatcgggcg cgctgtaccc     48840
     atctccagac tcaacctgga cgaatacaac ctattgacag ttcacaccta ggcgaccggg     48900
     taatccctta tggtagaaag gtcagcggca ggccatgacg gccgccgcct acttcaagga     48960
     gcgaaacatg tcgaagattc gtatccaacg atggtgcggg gccctggcgc tgggcgcggg     49020
     cagtctgatg gccttcggcg cgcatgcggc cggcacgggc tccggccaga gccagtacca     49080
     gatggacgtg cagcgctgca atagcggcga caccagccag gaccgcgcca cctgcctgcg     49140
     cgaggccggc gccgcgcgcc aggaaagcca gcgcaaccgg ctggacgaca agcaggaggg     49200
     gcgctaccag gacaacgcca tgatgcgctg caagaacctg cccgcctcgc agcaacagga     49260
     ttgcatcacg cagatgacct ccggcaacac caccacgcgc ggcagcgtcg gcggcggggg     49320
     cgtgctgcgt gaaaccgtca tccaggtgcc ggccggcacg ccgggcaggc cgatgcccgg     49380
     cagccagatg cccagcggcc agatgcctgg cgctgctccg ggcgggctgc agccgccgcc     49440
     cgccggcacg gtggcgccgc cgccggtcat gcgctgaacg gacacgcccg gatgcgcgag     49500
     cgggcccggc tagtgccggg cccgctcgca ttcaggcaaa atgtcggctg tccgaccctt     49560
     taagtccttt atccatgtcc gacgtcatcg ccctggtttt cgatttcgac gacacgctgg     49620
     cctccgacag caccaccggc tttctcgaga gcatcggcgt cgatacggcg tcgttctgga     49680
     aagaccaggt cgatccgctg ctctcgcagc aggactggga tccggtgccg gcctacctgt     49740
     accagatgat ccagctgtcc aggcagggca gccacggcct gatcacccgc gagcgcctgc     49800
     gcgaatgggg cgtccggctg gcgttgcacg acggcgtgca gacgctgttc ggccgcttgc     49860
     gcgccgcggt gcgcgccgag cacccgaagg tccagctgga gttctacctg atttccagcg     49920
     gcatcggcga cgtggtgcgc gccacgccga tcgcccacga attcacggaa atctgggcct     49980
     ccgagttcgt ctacggcgaa gacggcggca tcagcttccc gcgccgcatc gtcagcttca     50040
     ccgacaagac gcgctacctg ttccatatcc agaagggcct gatcggccgc gaataccgca     50100
     acaagccgtt cgaggtcaac cgcaaggtgc ccgaagaccg cctgcgcgtg ccattcgacc     50160
     agatggtgtt cgtgggcgac ggctacaccg acatcccgtg cttttcgctg atccgcagcg     50220
     ccggcggctt tgccttcggc gtctgggatc ccaagcaccg cgacaagcgc agccgggcct     50280
     ggggcttcat cgaggaaggg cgcgtgtcca acctcaacca ggcccgctac gacgagcagg     50340
     ccgagctgta ccagtggctg gaagaggccg tcaccagcct ggccgggcgc atcgcgctga     50400
     agtcgcgggt ctatcgtggc tgatgcgttc gtgagcgaga ccgatccctg cgtcgacgac     50460
     cacgcgcgcc tgatggcgct ggcgctggag caggcgcaag aggccgcgcg tctgggcgaa     50520
     gtgccggtcg gcgccgtggt ggtcgatgcc cagggcgagg tgctgggcac gggctacaac     50580
     cgcaccatca tcgaccgcga ccctaccgcg catgccgaga tcgtggcgct gcgcgccgcg     50640
     gcgcgccggc tggacaatta ccgcttgccc ggcgtgtcgc tgtacgtcac gctggagccc     50700
     tgcgtgatgt gcatcggcgc catgctgcac gcgcgcctgg cgcgggtcgt ctacggcgcc     50760
     cgcgatccca agacgggcgc ctgcggcagc gtgctcgacg tgggggccgt cggccaactg     50820
     aaccatcaca cgaccatcac cggcggcgtg ctcgccgagc cctgcggcga attgctgcgt     50880
     ggttttttcc gcgcccgccg cgccaaggaa tccccagtat gaccaagaag aaaaatccgc     50940
     cggcctccca cgggcacgat caccacgagc atcacggcca cgaacctggc catgtctgcg     51000
     acgcgggctg cgcccacgcg ccggcgcagg ccagcggcat ttacctggta tcgccgtcgt     51060
     cggcggtgcg cgatgcggcc gagctggaac tggcctgcca gcggctggcc gccgaggggt     51120
     tccagaccaa ggtcgaccgc gccgcgctgg cggtgcacca gcgcttcgcc ggcaccgaca     51180
     agcagcgcgc ggccggcctg cagcgggcga tcaagcaaaa gcatcccatc gtgatggcca     51240
     cccgcggcgg ctacggcctg atccgcctgc tgcccatgat cgactggcgc gccatggccg     51300
     acagcggcaa gcgtttcgtc ggcatgagcg atttcaccgc cttcaacctg gccttgctgg     51360
     ctcagaccgg cgcggtcagc tacagcggcg cgaccgccgt gcgcgacttc gggctggcga     51420
     aaaccgatga actgaccgtg gcgctgtttg gcgagatcat gcgcggcgag ctggagatcc     51480
     tcagcttcga gacgcgcgac gccgatgcct tcgacggccg cggcgtgctg tggggcggca     51540
     acctggccac gctggtgtcg ctgctgggca cgccgtacat gcccaaggtg cgcggcggca     51600
     tcctgttcct cgaagacgtg gccgagcatc cgtaccgggt cgagcgcatg ctggcccagc     51660
     tatggcaggc cggcgtgctg gagcggcaga aggcgatcgt gctgggcagc ttctccgact     51720
     accggctggc cgcccacgac aatggctacg acatgcacgc ggtggtgggc tggctgcgca     51780
     agacggtgaa ggtgccggtc gtgaccggcc tgccgtacgg ccataccgat accaaggcca     51840
     cgctgcccat cggcaagaag gtgggcctgg ccaccgaacg cggcatggcc cacctcgtca     51900
     tcgacgagca cacccactga acgcaggccc cgctacgtgt cctgccgggg cacccaggcg     51960
     ggctggcgtt tttccaggaa agaggccagg ccctcgcggc cgtcggcgct ggcgcgctgt     52020
     tcggcgatgc gggcggcggt ttcttccagc agggcggcgt cgatcggcgc gcccgccacg     52080
     tcacggatca gccgcttggc ctgcgccacc gcatggggcg aggtcagcat gaagctgccc     52140
     agcaattcgt tgatctggcc gtcgagccgg tccgcctcgc acagttcgtg caccagcccg     52200
     atgcgccagg cctcggtcgc ctcgaagacc tcggcgctca ggaaccagcg gctggcggtg     52260
     cgtgcgccca tggcgcgcag cacatagggc gagatcatcg aggcaatcag ccccaggcgc     52320
     gtttcggtca gggcgaagcg cgcctcgtgc gaggccacgg caatgtcgca ggccgcggcc     52380
     aggcccatgc cgcccgccat gcacgggcca tggatgcgcg cgatggtggg cttggggcag     52440
     gtgtagatcg tgtgcagcat ggtcgccaac gtctgcgcgt cggcgcggtt ctcggcgtcg     52500
     ccggcctgcg cgctgcggcg catccagttg aggtccgcgc cggcgcagaa cgccttgccg     52560
     cgcccggcca ggacgatggc gcgcacctcg ttgtcggcgc ccagcgccat gaaggtctcg     52620
     gtcagctcgg cgatcatccg agggtccagc gcattgcgca catcgggccg gttcaaccag     52680
     accactgcgg tctgcggccc gtaggcaact tccaacgttt gcagcatacg acgacgactc     52740
     catgaaacgg ggaccggcca cgcggggcag ggattctagc ggtacaggac cgtgggcagc     52800
     cacaggccga tgccagggaa catgtacagc aggaagatgg ccagcaactg aatgcccatg     52860
     aacggcatca tacccaggaa aatctggttc agcgtcacgt gcggcggcgc cacgcccttc     52920
     aggtagaagg ccgacatggc caccggcggc gacaggaacg ccgtctgcag gttcagcgcc     52980
     accagcaggc cgaagaacag cgggtcgatg ccgaaggcct tgagcagcgg cacgaagatc     53040
     ggcatgaaga tcacgatgat ctccgtccac tccagcggcc agcccagcag gaagatgatg     53100
     atctgcgcca gcagcatgaa ctggatcggc gtcagcccca gcgatagcac ccattgttcc     53160
     acgatgccct ggccgcccag cagcgcgaag gccgccgaga aaatcgacga gccgacgaac     53220
     agccagcaca ccatggcgct ggtcttggcc gtcaggtaca ccgattccct gagcaccggc     53280
     atggtcaggc gccggtaggc cagcgcgagc agggcgccgc ccagcgcgcc catggcggcc     53340
     gcctcgctgg gcgtggccag gccgaacacg atcgagccca gcaccgccac gatcatcagg     53400
     gccagcggga agaacgagct catcagcagc cggaacactt ccaggcggct ccagttcagc     53460
     agcgcataga agaccgccag cagcgccacg cagaccgcga agaagatcca gaatccgtaa     53520
     ggcgccggca agcgttcggc ggcggcgtcc tcggcggctt cggccgcctc gacctgcgcg     53580
     gccgctgtct cgggcgccgc ggccgcgccg ggcggctcgg cgagcccgcc gtcctcgctg     53640
     ggcggttcgg ccagtccgct gtcgaagctg tcgccgctgc ccagccgcaa ttcatccggg     53700
     atctcgtaga cgaccggcgg ctcggtcaag gtgtcgtagg tggccccggt gatcagcacg     53760
     aaggccgcca gcggcgcgac caccagcatc aggttgcgcg ccaggaagct gccggtcact     53820
     tgcggatcgc ggcgcttgaa cagcccggcc agcagcccgg gcacggcatg gcgatggcct     53880
     tgctggcgca gcacttcggc gccaggctgc aaggggatat ggcgttcctc cttggacagc     53940
     ggcggcgcca tgtccgggcg cagcttggcc acgaccatga cgtacagcac gtacaggccc     54000
     gccagcatga tgcccggaaa gaacgcgccg gcgtacagtt gcaccaccga cacgccggtg     54060
     gtcgcgccgt agacgatcag catgaccgaa ggcgggatca ggatgcccag gcagccgccg     54120
     gccgtgatcg agcccgcggt caggcgcacg ctgtagccgg ccttgagcat ggccggcatg     54180
     gccagcaggc ccatcagcgt gaccaccgcg ccgacgatgc cggtggcggt ggcgaagatg     54240
     gcgcaggtga tcagggtggc cacgcccagc gcgccgggca ggcgcgccag cgccagatgc     54300
     atggagcgga acagccgttc gatcaggttg gctcgctcca ccagatagcc catgaacacg     54360
     aacagcggca ccgagatcag cgagtcgttg gtcatggtgg cgtacgtgcg ctgcaccatc     54420
     aggtccagcg tctggcggac cgcgcgcgcg ccgtcctcgt gctgcatgaa ataggccagg     54480
     aaggtgaaca gcacgcccat gcccatgagc gtgaaggcgg tcggaaagcc cagcatgatg     54540
     gcgacgacga tcagggccag catcagcagc ccgatgtgcc ccgtggccag atggtcccac     54600
     ggggtcagga aagcgatcat caacaacacc agcccgatgc acgacaaacc gaaccacagt     54660
     gctttgtgga ttttcatcgg gtctgctctc ccttttcaac gtattggtcc agctcggcga     54720
     tgtcttcgtc cttgacgtgc accatttcct tgagcttgtc gacgtcgacc tcttccacgt     54780
     cttcggcgcg cgacggccat tggcccttgc gcaggcacag caggcagcgc gcgatctcgg     54840
     ccaggccctg cagcagcagg aacgcgccgg cgatcgggat gaaagccttg aacggataga     54900
     tgggcggccc gttggccatc agcgacgagt gttcgcggat ggcgatcgac tcgccggcgt     54960
     agtaccagcc ggcccacacc atggcgacga cgccgggaat gaaaaacagg atgtacagca     55020
     gcaggtccag tccggcctgc acgcgcggcg gcaggaaacc gtagaggatg tcaccgcgta     55080
     cgtggccgtt cttggccagc gtataggcgc ccgccatcat gaacaggatg ccgtagtaca     55140
     tcagttgcag gtcgaaggcc caggcgctgg gcgtgttgag gatgtagcgc gccgagactt     55200
     cccagcatat gtgcagggta aggacgacaa tgagccaggc aaaggcctgg cccacgaaag     55260
     tggacagcct gtctaccaaa cgtatcaatc gcagcatgag cgcgggcccc gttcatggga     55320
     tgggaggagt aacgcgctgc gcgggcgcgt cgcgacgcgg cacggcttgc gccggcgctg     55380
     cccgccgtcc cacggcgcgc agcgccggcg caagccggtc cggtcaagcg ggttgcttgc     55440
     gggcgaagta gtgattgaac gccatgcgga aattgacgtt ggtatcgttg ctccaacggc     55500
     cggcgcgttc ggcgaactgg cgttgcgaat ccagcacttt cttgaacaac ggattctcgg     55560
     ccgagcgctt ggcgatcatc tcgtcccaga tcttgagctg ctgctgcagt atggcgtcgg     55620
     gcgtcttgta gaacttgacg ttgtggtcct tctgcagctt gatgtagtcc ttggagtagc     55680
     ggtccgcggc cttccacgac atgtcggcgc tggccgcctg cgcggcgtac gccaggatgt     55740
     gcttgaggtg cttgggcagg gcgtcgtact tgttcttgtt gaacaggatc tcgaactgct     55800
     cggcgctctg gtggaagctc tgcagcatgc agatcttgga gacgtcctgg aagcccagcg     55860
     ccaggtcgga cgaggcgttg ttgaattcgg cgccgtcgag caggccgcgg tccagggcgg     55920
     gcacgatttc accgccgggc agggcgttga ccgccgcgcc catggcgctg tacatgtcga     55980
     tggccaggcc cacggtgcgg aatttcgcgc ccttgacgtc gtcggccttg gtgatgggtt     56040
     tcttgaacca gccgaacggc tgggtcggca tggggccgta catcagcgag gtcacgttca     56100
     cgcccatggc cttctggatt tcagtcaaga gctccttgcc gccgccatat tcgtgccagg     56160
     ccagcagcat gttggcgtcc atgccgaacg aggggcccga accccacagc gccaccgccg     56220
     tgttcttgcc ataccagtac gccaccacgc cgtggccgcc gtccagcgtg ccggccgata     56280
     ccgcgtcgag caggtcgaaa gccttgacga ccgcgccggc cggcagcacc tcgatcttga     56340
     gctggccttc ggccatatcg ttgaccttgc gggcgtaatc ctgggcgaac tcgtggaaaa     56400
     tatcgttggc gggccaggtg ctctggaacc gcatgctcac cggggagccc tgggcgcgcg     56460
     tgacggcggg aaatcccagc acggcggtcc ccgcgaccgc tccggcaccg gaaatgaatt     56520
     tgcgacggga ctgcgtaacg tgttgcatgg cgtgttgtct cctgagtgga ctacaaggac     56580
     cagctttttg ttactgcggt aagtcttgcg cgagggatcg cgccgctgcg cgagccgatt     56640
     ggtattgaat actgaagggc actggcagcg ccggacgggg tatgcaaaca tttgcataca     56700
     aaaccgtgtt tctttcagta gcctttcatt atcaatcggc cctgggggat taaaccttgc     56760
     atggcgctgg ctgacaatct gcctaacgtc gggaataacc ctagcacctg tacagatatc     56820
     tccgcagcgg cgcctgcggc gtgtcggcga ggcgagcggc gcaacttggt acactgccag     56880
     atttatctcc attgcgccct tgcggcgcgt caggctcgca catacaccgt gatttccact     56940
     gccaatctca ctatccagtt cggccccaag ccgcttttcg aaaacgtcag cgtcaagttc     57000
     ggggaaggca accggtatgg tctgatcggg gccaacggtt ccggcaagtc gaccttcatg     57060
     aaaatcatcg gcggcgacct cgagccctcg gcgggcaacg tgtcgctcga acccggcgtg     57120
     cggctgggca agctgcgcca ggaccagttc gccttcgagg aggtgcgggt gctggacgtg     57180
     gtcatgatgg gccacaccga gatgtgggcg gccatgtccg agcgcgacgc gatctacgcc     57240
     aaccccgagg ccaccgaaga cgactacatg cgcgcggccg acctggaagc caagttcgcc     57300
     gaatacgacg gctacacggc cgaagcgcgc gccggcgaac tcctgctagg cctggagatc     57360
     gccgtggacc agcacaacct gctcatgcgc gaaatcgcgc ccggctggaa gctgcgcgtg     57420
     ctgctggcgc aggcgctgtt ctccaacccc gacgtgctgc tgctggacga gcccaccaac     57480
     aacctggaca tcaatacgat ccgctggctg gagaacgtgc tcaacggcta ccagagcacg     57540
     atgatcatca tcagccacga ccggcacttc ctgaaccagg tttgcaccca catggcagac     57600
     gtggactatg gcgagatccg cgtctacccc ggcaactacg atgactacat gctggcctcc     57660
     acccaggccc gcgagcgcct gacggccaac aacgccaagg ccaaggagcg catcgtcgaa     57720
     ctgcaggact tcgtgcgccg gttcgcggcc aacaagtcca agtcgcgcca ggccacgtcg     57780
     cgcctgaagc agatcgaccg catcaaggcc gaccaggtcg aggtcaagcc ctcgtcgcgc     57840
     cagaacccgt acatccgctt cgagcagaac aaggtcatgc accgcctggc ggtcacgatc     57900
     gagaagctgt ccaagtcgta cgaccagccg gtcatccgcg atttctccgc catggtcgac     57960
     gccggcgaga aagtcgccat catcggcgcc aacggggtgg gcaagaccac gctgctgcgc     58020
     atgctggcga ccgacctggc gccggattcg ggcaccgtca agtggtccga gaacgccgac     58080
     atcggctaca tggcccagga cgtgtccgac cagttccagc agggcgacat caacctgttc     58140
     gactggatgg ccgagcatcg ccagccgggc gacgacgacc agtcgatccg gtccgcgctg     58200
     ggccggctgc tgttctccgg cgacgatctc cccaaggcgc ccaaggtgct gtccggcggc     58260
     gagaagaacc gcatgacctt cggccgcctg atgttgggcc ggcacaacgt catgctgctc     58320
     gacgagccca ccaaccacct ggacatggaa tccatcgaat cgctgcagtt cgcgctggaa     58380
     aagtacgaag gcgcgctgat tttcgtgtcg cacgaccgcg agttcgtctc ggggctggcc     58440
     acgcgcatca tcgagatcct gcccgacggc gagctggtcg actatcgcgg cggctacgag     58500
     gattacctgg cttcgcgcgg catcgaggcg taagcggggc gcccgcgcgc ggcctggccg     58560
     cgccgcccgc ggcatgctta taacgacagg tagttaaaac attctataaa tatagtttgt     58620
     gttcatataa ccgattgtta gattagggcc tgtcctttcg tttggcgccg cggtgcccga     58680
     gcaagcccat gaatctgact ttcgatcacg tccacaagag cttcggctcg ctcaacgtcg     58740
     tggagggctt ttccagcgaa ttcaagaccg gcgagctggt tgcgctggtc ggtccctcgg     58800
     gctgcggcaa atcgaccctg ctgcatctgg cggccggcct ggagcaggcc tcgcagggcc     58860
     gtgtgctggc cgacggcaag ccggtgcagg ggccgcaccc cagccgcacc ctggtgttcc     58920
     aggagcacgc cctctatccg tggctgacgc tgcgcgacaa cgtggcgctg gcgctggaat     58980
     tccagaacgc gcccaaggcg caggcgcgcc agcaggccgt gcactggctc gagcgcgtcg     59040
     gcctgggcgg tttcgacgcc tactatcccc atcaggtttc cggcggcatg cgtcagcgcg     59100
     ccgccttggc gcgcgccttc atcgcccagc cgcagaccct gctgatggac gagcctttcg     59160
     gcgcgctgga tgccctgacc cggctgagcc tgcaggacgt gctgcgccag ctgatcgagc     59220
     aggagaagcc gtcggtggtg ctggtcaccc acgacgtcga cgaagccctg ttcctggccg     59280
     accgcatcgt cgtgttcagc cagcgcccgg cccgcgtgct gcgcgaattc aacctggccc     59340
     accgcgccaa gagccacgac ctgtccgacc tggccagcga gaagcgggaa atcctgcgtc     59400
     tgctcggcat cgaagtcgac agccatggcc acggccatgg ccccaaggta gcgctggccg     59460
     cctgaggcag gcctcgttcc gtcataccga taccgtgtcg cgggcccgcc ggcccgcggc     59520
     ctatttgccg atccctggag actcgcatca tgaaactgaa gcaatggctg tccctgccgc     59580
     tggccgcggc gctgctggcc gccgccccgg cgatggccgc cgagaaattc cgcgtgggct     59640
     atctgcgcgt gatggacgat gcgcaggcca tcgtcgcgca agaaggcggc tactacaaga     59700
     aggccgggct ggactcggag ctgatcgaat tcaagtcggg caccgacctg atcaaggcca     59760
     tcgtgggcgg ccagctcgac atcggcgtgc tgggtttcac caacgccgtg gcctgggcct     59820
     cgaagggagc cgacctgaaa gtggtgggcg gcgcgcagca gggctaccat tcgctgctgg     59880
     tgcgcgacga ttccgacatc aaggatatcg ccggcctgaa gggcaagacc ctggcctcgc     59940
     aggccgaagg cagcactgcc gacgtggtgc tcaagggcgt ggtgctcaag gaaggcaagc     60000
     tgggcgccga cgacgtcaat gtcatggggg gcagccccgc cgtcgcggtg cagtcgctgg     60060
     tcggcaagcg cgtggacgcc gcgttcctgt tcgagccgta cgaccgcatc gcccagctgg     60120
     tggcgccggt caagcagatc tacgaagtgg ggcaggcctg gccgttcccc tgcatggtgg     60180
     tgatcacttc cggcgatgtg ctggccaagc gcaaggatga cgtctggaag gcgctcgacg     60240
     cgcagaagga agccatcgac ctgctgcaga acaagccggc cgacgcgtcg cgcctgatcg     60300
     cttcctactt catcgccgaa cccactctca agaccctgac ccgcggcgag ctgccgcgcg     60360
     agacggtgat ctccgaggcc atcagcacgc aggtgttcac gcccaagctg accgacaagg     60420
     acaccaaccg cctgcaggag atcgccgata tcctgcaggc ccagggctcg ctcaagacgc     60480
     gcgacggcaa gccgtacgac gtctcgagca tcgtcgacct gtcctggcaa gaggcgcgta     60540
     agctttgagc tcctccaccc gtgtaaccgg cgcacgcaag cacctcgccg gggtgcttgg     60600
     cgtgctattc atcctggcgc tgtggcaggc ggcggcctgg gtcctgcctg atttcctgat     60660
     gccgggcgtg cccaccgtgg cgcagcgcct ggtcgaggac ctcggccagg cttcgttcca     60720
     ccagagcctg ctgggcacgc tgggacgcct gggcgcgggc tatggcctgg cgctggccgc     60780
     cggtatcggc ttcggcctgg tcgccgcggt gctgttcttc ttccgcgaag tgctgcgcag     60840
     cgccatcgtc atcctgcagt cgatcccgtc gatcgcctgg gtgccgctgt tcctcatcgt     60900
     gatgggcttc ggcaacacgc ccatcatcgt ggtggtggcg ctgtcggcgt tctttccggc     60960
     cgcgctcagc gtcatgaacg cgaccgagtc cgtgcagcgc gtgcacgtct cggccgcccg     61020
     cgtgatgggg gcgacgcgct gggggctgat caagcgcgtc tacctgccgg cggtcatgcc     61080
     cgagctgatc accggcgcgc aactggcctt cggcaatgcc tggcgcgcgc tcatctcggc     61140
     cgagatgctg atcggcttcg gcaaggggct gggccgttcg ctggcctact cgggcgagat     61200
     cgccgacatg accggcgtga tgaccaacat cctggtcatt gccgtgctgg ccgcgttgat     61260
     cgaccagttc gtgctggaaa acctcaagca tcgcctgttg cgctaccaat acgtctgaac     61320
     cacgcgcggg cctggcgccc gcgccttcat cgccatgacc gcgccgtcta cctcccatct     61380
     ttcccgcctg tgcctggccg cgctgctggc cgtggcgctg cccgcgctgc ccggcgcggc     61440
     cgcgcagccc ggcgccgcgg ccgacccgct ggcggcggcg tgcgcgcgcg gggtgctggt     61500
     cgtcggcgta ccgttcctgg cggatgcgcc gctggccggc gcgaaggtgc gtacgcccga     61560
     acgcctggac ggcgtggcgg ccgaacggct ggcccggcaa ctgggcctgc cgctgcagtt     61620
     gcgccgcctg gcggccggcg acgccgccgc gcagttggcg tcgggcgcgg tcgacctggt     61680
     gctggccgat cggcgcgatg gcgcgccgct ggccgcgcag gcgcccggca tggcggtggt     61740
     gggaactgga tatgcgaccg cgcccaaggc ggtcatccgc ggcgataccg cattgcggcg     61800
     ctggcaggac gtggccgggc gcagcgtatg catggccgat gccgcgcagg gcgcgcaggc     61860
     gctggcgcaa cgccatggcg cgaccgtgcg cacctatcgc gcgccgtccg atgcgttggt     61920
     ggcggtgcgc gaaggcgcct gcgacctggc gctgatcgac gatgcggtat gggcgccgct     61980
     gatgaagttt cccgagtgga agaaattctc ggccacgttg gcgccgcagg ggccgcgcgc     62040
     cgaactggta tggctggccg ccgcccgccg acgcggcctg gctggccgcg cagatgcagg     62100
     cctggcaccg cgagggcgcc tggacggcca tgacggccaa atgggcgcgc gacgtggcct     62160
     tcgacgtgta cctggaccag gaagtgcccg actgccacgg ctaggtgtga agattcaata     62220
     ggttgtatgc atggttcatc cgaaccggat ttgagaaact ggaaatcgcc acccccccag     62280
     ttcactcaag gagcccggcc ggatgaacac ccataagcat gcccgattga ccttcctacg     62340
     tcgactcgaa atggtccagc aattgatcgc ccatcaagtt tgtgtgcctg aagcgacccg     62400
     cgcctatggg gtcaccgcgc cgactgtgcg caaatggctg ggccgcttcc tggctcaggg     62460
     ccaggcgggc ttggccgatg cgtcctcgcg cccgacggtc tcgccccgag cgattgcgcc     62520
     ggccaaggcg ctggctatcg tggagctgcg ccgcaagcgg ctgacccaag cgcgcatcgc     62580
     ccaggcgctg ggcgtgtcag ccagcaccgt cagccgcgtc ctggcccgcg ccggtctgtc     62640
     gcacctggcc gacctggagc cggccgagcc ggtggtgcgc tacgagcatc aggcccccgg     62700
     cgatctgctg cacatcgaca tcaagaagct gggacgtatc cagcgccctg gccaccgggt     62760
     cacgggcaac cgacgcgata ccgttgaggg ggccggctgg gacttcgtct tcgtggccat     62820
     cgatgaccac gcccgcgtgg ccttcaccga catccacccc gacgagcgct tccccagcgc     62880
     cgtccagttc ctcaaggacg cagtggccta ctaccagcgc ctgggcgtga ccatccagcg     62940
     cttgctcacc gacaatggct cggcctttcg cagccgcgcc ttcgccgcgc tgtgccatga     63000
     gctgggcatc aagcaccgct ttacccgacc ttaccgccca cagaccaatg gcaaggccga     63060
     acgcttcatc cagtcggcct tgcgtgagtg ggcttacgct cacacctacc agaactccca     63120
     acaccgagcc gatgccatga aatcctggct acaccactac aactggcatc gaccccacca     63180
     aggcatcggg cgcgctgtac ccatctccag actcaacctg gacgaataca acctattgac     63240
     agttcacagc tagggggcat ccggcgcgcc gccacgtaca atggcgccgt atgatgcaca     63300
     cgcttgccgc cgcctgccgc caccaggaag aaatcaagaa aagccgcttt gccgcctatg     63360
     ccgcgccggt gggcacgatc gccgaggcca tggcgcattt cgccgcgcac agcgacccgg     63420
     cggccacgca taattgctgg gcctaccgca tcggcaacga ataccgcttc aatgacgacg     63480
     gcgaaccggg cggcacggcc ggacggccca tcctgcaggc catagacggg caggggctgg     63540
     accgcgtggc ggtgctggtg gtgcgctggt tcggcggcat caagctgggc gcgggcgggc     63600
     tggtgcgcgc ctatggcggc tgcgccgcca actgcctgcg cgccggcgag cgcttgccgg     63660
     tcatcgccct ggcgacggtg cgctgccgct gcggcttcgc cgagctgccg ctgctgcagg     63720
     cgcggctggc gcaggcgggc gccagcgtgc gcagcgaaac cttcgacgcc gacggcgcgc     63780
     aactggaatt cgacgtatcg cgcgccgcgc tcgaagagct ggcgcgcacg ttcgccaata     63840
     tcacccgcgg gcgcggcgac tgggacgtgc aggcctgagc caggcccgcg cggcctcagg     63900
     cctgttcgcc ctcgccgttt tcgcgcgcct gcgcgatatc gcggtgcacc tcggccatgt     63960
     cgacttcctt gaccttggtc agcagttcgc cgagctggcc ggccgacagg gcgccgggtt     64020
     gcgagaacag caggaccttc tcgcgaaaca ccatcaaggt cgggatcgag cggatgccca     64080
     gcgcgccggc cagctcctgt tcgacgtcgg tattgacctt ggcgaaggtc acgtcgggat     64140
     gctgctcggc ggcttgctcg aagacggggg cgaagccgcg gcacgggcca caccaggggg     64200
     cccagaaatc gatgatcagg gtgccatccg gcgtgatggc gtcctggaag gtgtccttgg     64260
     tcagttcaac gatgctcatg cgtgtcgtcc ttgccgcccg cgtggggtgg cgtctggggc     64320
     cggtgggccc ggttggcgcg gccggggccg cgtggtggat gttccgtccg tggtcggtgg     64380
     gcgaaacgcg tggcgcgatt gcgcgccgtg ccggtcaggc gttcgcggtg cgggtcgata     64440
     cgcctgcgtc ctgcttgagc gaggcgacga tctcgtacga acgcaaccga tcggaaaagt     64500
     cgtaaaaatc ggaaacgatc atcacctcgt cggcctgggt ctgcgcgacc aggctctcca     64560
     gttcgcgctt gaccgtatcg gggccgccaa cgatggccgc gcccagtctc tgttggaccg     64620
     cggagcgctc ccactcgttc catacgccgt ccatgctttc cacgggcggc tgcagcggca     64680
     ggcggttgcc gcggatcagc gacaggaatt tcagttgctg ggtggtggac aggaaatgcg     64740
     cctgctcgtc ggtgtcggcc gcaaccaccg gcacgcctat catggcatgg gggcgcgcca     64800
     gcgtctgcga cggcttgaac agttgccggt acaggcgcat ggcggccatg ccttcgggcg     64860
     agaagtgccc cgcgaacgag aagggcaggc ccagctcggc ggccagccgt gcgctgaaat     64920
     cgctcgagcc cagcagccag atgggcacgt cggtgccggc gccgggaatc gcgcgcaccg     64980
     gctggcccgg ccgcgccggc gcgagcgcag ctcgtgcagc agctcgggga agtccaggcc     65040
     gctgcgcggc ccgcgccgca gcgcctgctg ggtggcgccg tcgctgccgg gcgcgcggcc     65100
     caggcccagg tcgatgcggc cgggaaacag gctctccagg gtgccgaact gctcggcgat     65160
     gatgagcggc gcgtggttgg gcagcatcac gccgcccgag cccacccgca gcgtggtggt     65220
     atgcgcggcg acgtggccga tcagtaccgc cgtggcgctg ctggccacgc cggtgatgtt     65280
     gtggtgttcg gccagccaga agcggcgata gccccagcct tcgacgtggc gcgccaggtc     65340
     gacggtgttg cgaaacgcct gcgcggccgt gccgccctgc acgatggggg caaggtcgag     65400
     gaccgagaac ggcacgctgg ccaatacact catgcgggtg ctccggttgt gtcgcggcgc     65460
     ggcgcgcccg acgggtcagg aatatatgga gagtgtatcg gcgatttcaa ccgcgcaccc     65520
     gaacaacctt gggcgccatc gggtcgatag cctcgctgta tcgcggcgat tgacgacctc     65580
     gaaagcaggc aggccgcgcg aggcggcctg cttgcggggc gaggcgcgcg gcccggcctt     65640
     attcggggaa gaaggcgtag cggacgatga acaggatcgc caccagccag gtggccgggt     65700
     gcacctcgcg gatgcggccg gtgcaggtct tgagcaccac gtagctgatg aagccgaagg     65760
     ccaggccgtt ggcgatggag tacgtgaacg gcatgaccag ggcggtcagc gcggccggcg     65820
     tggcctcgga cacgtcgttc cagtcgatgt cgatcagctc gcgcatcatc agcccggcga     65880
     catacagcag cgcgggcgcg gtggcgtagg cgggcaccga gccggccagc ggcgcgatga     65940
     acagcgcggc caggaacagc agcgccacga ccagcgccgt caggccggtg cgtccgcccg     66000
     cctgtacgcc cgaggcgctt tccacatagg cggtggtgct gctggtgccc agcatcgagc     66060
     cggccacgat ggcggtgctg tcggcaaaca gcgcgcgtcc caggcggttg gggcggtctt     66120
     ccggcaccag gccggcgcgc ttggcgatgc ccatcagcgt gccggtggcg tcgaacacct     66180
     cgaccagcac gaacaccagg atcacgtgca cgaagcccgt gtgcagggcg cccaggatgt     66240
     ccagttgcat gaacgtcggg gccaggctgg gcggcgagga gaagatgccg ttgaactggt     66300
     tgtagcccag cagcatggac agcacggtca ccgacaggat gccgatcagg atcgcgccgc     66360
     gcacgcgcag cgcatccagc gccgcgatga tgaaaaagcc caggatggcg aacagcgggc     66420
     cgggctcgcg caggtcgccc agcgtcacct tggtggcggg gtgcgcgacg acgatgttgg     66480
     cgttggacag cgcgatgatg gccaggaaca gcccgatacc cgcggcgatg gcgctgcgca     66540
     gcgagtgcgg gatgccgcgg atgagccagg cgcggatgcc cgagatggtc aggaacagga     66600
     agatgacgcc cgagatgaac acggcgccca gcgcctgctc ccaggtgtag cccatggtct     66660
     tgaccacggt gaacgcgaag aacgcgttca ggcccatgcc cggcgccatg ccgatcggcc     66720
     agttggccac cagcgccatg atcagcgaac ccagggcggc ggccaggcag gtcgccacga     66780
     acacggcatt gcgatccatg ccggtgctcg acaggatgtc ggggttcagg aagatgatgt     66840
     acgacatggt gaggaatgtc gtcagcccag ccacgatctc cgtgcgtacg gtcgtggcgt     66900
     ggtcacgcag ttggaatagc ttctccagca tggaagtccc cgggggtttg agagcggttg     66960
     ttgtgtgctt gcgccggcgc cgcctgccgc gcaggcgata atgtaagcgc aaaacccgta     67020
     tttttgcacc cgggcccgcg gaccctggtt gtaaactctg cgcccatgat cattctcggc     67080
     tttgaaagct cgtgcgacga aaccggcgtg gccgccgtct gcaccgagcg cggcctgctt     67140
     gcgcacgccc tgcataccca gatcgccatg caccaggaat atggtggcgt ggtgcccgaa     67200
     ctcgcctcgc gcgaccatat ccggcgcgtg gtgccgctga cccgccaggt gctggccgag     67260
     gccggcctga cgctggctga cgtgggcgcg gtggcctaca ccgccgggcc gggcctggcc     67320
     ggcgccttgc tggtgggcgc cagcgtggcc caggcgctgg cctggtcgcg cgcgctgccg     67380
     gccatcggca tccatcacct ggaaggacat ctgctgtcgc cgctgctggc cgagccgcgt     67440
     cccgagtttc cgttcgtggc cttgctggtc tcgggcgggc atacccagct gatgctggtc     67500
     gacggcgtgg gccgctacga actgctgggc gagacgctgg acgacgccgc cggcgaggcc     67560
     ttcgacaaat cggccaaact gatgggcctg ggctatccgg gcggccccgc gctggcgcgc     67620
     ctggccgagc agggcgacgc cagccgctac gacctgccgc gccccatgct gcacagcggc     67680
     gacctggatt tcagcttcag cggattgaag accgcggtcc tgacccgtgt gaaagcggcc     67740
     acgcgcgatg gcggcgaact gggcgaacag gaccgcgccg acctggcggc ggcaacgcag     67800
     gccgccatcg tcgaggtgct ggcggccaag gccatccgcg ccttgaagca gacgggcctg     67860
     cgccgcctgg tggtggccgg cggggtaggc gccaacgcgc tgctgcgcgc gcatctggcg     67920
     cgcgcgctca agcccttgcg ggccgaagcc tattttccgc cgctgtcgct gtgcaccgac     67980
     aatggcgcca tgatcgcgtt cgcggcggcc gagcgggtca aggccggact ggccgacctg     68040
     cgcgagggcg accacgcctt cacggtgcgg ccgcgctggg atctggcgga catccaggcc     68100
     gggtaggccg acggggtgcc tgtccccgcg gaggtgtcgc cgcccatgcg ggttggcagt     68160
     cggcaggagc ctgtccccgc ggggacagat accgtcttgg cagtcaaccg ttcatggcgt     68220
     aattgggctg gtaggggatg cggtttttga ggaccccgaa gcacagatgc accagttttc     68280
     tcatggccgc gcccagcgcg gcctttttgc tttttcctgc tttgagcagg cgctggtaaa     68340
     gggcgcggat gtgggggttg tggcgggtcc caaccagggc cgccatgtat aacgtggcgc     68400
     gcacctggga ggggccggct ttggacaggc gtgcgcagct gttcagactg ctgccggatt     68460
     ggcgctgcac agggaccacc ccgagatagg cggccaggct ctgggcggag tcgatatgcc     68520
     gattgtgcat gacggccagg atggcgttgc cggcctgagg cccgatggcg gggatggagt     68580
     tcagcagctc gcagtcttgc ttgaggtcgg ggtggttgtc gatgtgctga tcgatcgccc     68640
     gctcgatttg tttgatctgt tcgcgcaaga acgcgatggc cttgtcgatg gaaccatcga     68700
     ccaagggcgc cgaggggctg aactggctct tctctttgcg attgagctca cgcaacagat     68760
     ccttgctcag cgcctcgcgt cgcgtcaaca aggcgcgcag ttgacgcgca tgcaagggcg     68820
     ccgggtgcca cagcgccggg ctcagcgtct gtccatagcg agccagcacg tagctgtcga     68880
     gcgcatcatt tttggagcgc agcgccaagg ccttggcaaa gtcccgggcc tgggcgggat     68940
     tgaccaaaga gacccggacc tggggcagcg ccgtggccgc ttgctcgtga tacagacccg     69000
     taggctccag gatggcgtgc aactgcgccg gctgtgcgcc gtgtttggcg caccacgcca     69060
     gcagggcttg tacgcccgcg gcggtgttga ccaccacctt ggtcttacgc ttgtcagcct     69120
     cagccgtcag caacgtgcaa tccagcttgg cctttgatac atcaatacct atgaaaacat     69180
     ggacttggcc tcctgcagat aacaaactgc tgtcagccac tgcgcccact tgccttgtac     69240
     atacagggtc ctcgccctac gataccgtcc agtgtctcgc cggcccagca gtgcgctgcc     69300
     gagccgctat ctgtcccaca aagtcctcgc tttgggcacc aactcgcggt catcggcgcg     69360
     cggtggtgat agctaatcac caccggagga aagatacaag gctcctgagt gggttacttc     69420
     tgcccccgcc gggacaggct cctgagtggg ttgcttctgt ccccgccggg acaggctcct     69480
     gagcgggtta cttcttcttc ccgatgcggc tttcggtgcc cttgagcagc cgcgcgatgt     69540
     tggcgcggtg gcggtagaac agcagggcgc tgatgacggc gatggccagg ccgacttcca     69600
     gccgcgcatg ccaggcggcg cccgagccga atacgtagta gacgggcgcg aaaaatgcgg     69660
     cgaccagggc cgccagggac gaatagcgcg agaacacggc cacgatcagc caggttgcga     69720
     tggtggccac ggccagccat ggttcgatgg ccatcagtac gcccagcgcc gtggcgacgc     69780
     ccttgccgcc cttgaagcgc aggaacaggg ggtagaggtg gcccaggaac accgccagcg     69840
     ccaccagcgc gtaggcgccc caggagagtt cggggaccag cgcgcgggcc agccacagcg     69900
     cgaaccagcc cttggccgcg tcgcccagca gggtcagcgc ggcggcagtc ttgttgccgg     69960
     tgcgcagcac attggtggcg cccggattgc cggagccgta actgcgcgga tcctgcagcc     70020
     ccatcagctt gctgaccacg acggcaaagg ggatggagcc gatcagatag gccaggacaa     70080
     tcagtgccga actggacagg agcgaagggg cggtcaggac catggtggca ggcattccgt     70140
     tacggttgcg tcgtttggct gcggattcta cctcgggcgg cgattctgac gcgatgatgc     70200
     cgcttcatga cggtacaatc ggtcgcggtt tgtggcgatc cccacgattc aggaagattg     70260
     atgcgtattc tggtttcaaa cgacgatggt tacaacgccc ccgggctgga agcgctggtc     70320
     gaggcgctgt ccgggctggg cgaactgacc gtggtcgcgc cggagacgaa tcacagcggc     70380
     gcctcgaact ccctgaccct gaaccggccg ctgacggtgc gcaccgctgc caacggcttc     70440
     atctacgtca acggcacgcc gtccgattgc gtgcacgtcg ccctgaccgg cctgatggat     70500
     gcgcgtcccg acctggtggt gtccggcatc aacaacggcg ccaacatggg cgacgacacg     70560
     ctttattccg gcacggtggc cgcggccagc gagggctacc tgttcggcat cccctcgatc     70620
     gccttctcgc tgatcgaaaa aggctggcag cacatcgaat cggccgcgcg cgccgcccgc     70680
     caggtggtcg agcgccagat cgcgcagccg ctggccgcgc cggtcctgct caacgtcaat     70740
     atccccaatc gccgctacga ggacatgaaa ggctacgccg tcacgcggct gggcaagcgc     70800
     catccgtccg agccggtggt gcgtaccacc acgccttatg gcgacacggt gtactgggtc     70860
     ggcccggtcg gcctggccgc cgacgccacg ccggggacgg acttccacgc cacggcgcag     70920
     gggcaggtct cggtgacgcc gctgcgcctg gacctgaccc agcacagcca gcttgacgat     70980
     gtgcgcaact gggcggagcc gctatgcgta aacgcgtaga cccgccggcc ggcggccgcc     71040
     tcgcgcccgg catcacgccg gccaacagca acacccgcat ttcggcgggc gccttgccgc     71100
     gcgcgcctgc gcagcccgcg ccgctggcca gcggcaacct gggcttgaac tccgaccggc     71160
     tgcgccaggc gatggtgcag cggttgcgcg cgcagggcat cgccgacgaa cgggtgctca     71220
     acgccatggc ggcggtgccg cgccatctgt tcgtcgacga agcgctggcc agccgtgcct     71280
     acgaagacgc ggcgctgccc atcgggcact cgcagaccat ttcgcagccg tgggtggtgg     71340
     cccgcatgat cgccgctgtc tgcgaggacc gtgctccggc gcgggtgctc gaggttggcg     71400
     ccggctgcgg ctaccaggcg gcggtactgg cccagatcgt gcgcgaggtg catgccatcg     71460
     agcgtatccg cggcctgtac gagctggcgc gcggccatct gcgggcgctg cgcctggcca     71520
     cccgggtgcg cctgatccat ggcgacggca tgctgggcgt gcccggcgtg gcgccgttcg     71580
     atgctattgt tgtggctgcg gcgggcctgg ccattccgca ggccttgctg gatcagcttg     71640
     cgccgggcgg gcggctgatc gcgcccgaag ggtccaccca ccagcggctg gtgctgatcg     71700
     aacgcaccgg ggccaccgcg tggagccgaa aagaactcga agctgtacgt tttgtgcccc     71760
     tcagggccgg aatacaatct tgagcaaaca ggagaatcgt atgctcaacg ggcagttgca     71820
     actgaccgaa tcccaatccg tggctggcgc atccgccgcc gccgcttccc gccccgttct     71880
     ctgggcgggc gtgctggcca tcgccttgct ggccggctgc gcctcgaagg gcccgcgcgc     71940
     gcctgtggtc gacctcaccg gacagcccgg cgcctccggc ccgaccgacg gcagctatgt     72000
     cgtcaagcct ggcgatacgc tctacaagat cgcgcgcgcc aacaatgtcg atatcgaaaa     72060
     cctcaagcgc tggaacaacc tcaccgatcc caaccagatc agtgtcggcc aggtgctgcg     72120
     cctgtcgagc tcgggcgccg gcggcgcgca gaccacgccg gtgacctcct ccaagccgca     72180
     acccaagccg ctggaccagg gaagcgccga aacgccggcc ggcggcatgg aagccggcgc     72240
     cggcggcgaa accggcgggg ccaccacccc gcccgcggca acggtgcccg atcccaagcc     72300
     cgcgcgcgcg gccgatgccg ccgtcatcaa ctggggctgg ccggccaatg gcgccatcct     72360
     gcagaccttc aacagcaaca ccaagggcat cgacctggcc ggctcgctgg gcgatccggt     72420
     gatcgcggcg gccgatggca aggtgatgta cagcggcaat ggcgtgcgcg gcctgggcaa     72480
     cctgatcatc atcaatcacc agaacggctt catcacggcc tacgcgcaca accgcgcgct     72540
     gctggtcaag accggccaga acgtcaagcg cggggccaag atcgccgaga tcggcgagac     72600
     cgacaccacg tcgccgcggc tgcatttcga gatccgccgc cagggcacgc cggtcgaccc     72660
     gatgcagtat ctgccgccgc gatgacgccc acgctcgttt tcgacctgga gaccatcccc     72720
     gacgtggccg gcctgcgccg gctcaacgac tggggcggcg aggtgtccga cctggaagtg     72780
     gtcgagcgcg ccttcgccgc gcgccgcgaa gcggtggggc acgacttcct gcccctgcac     72840
     ctgcaccagg tcgcggtggt cggatgcgtg tttcgcgacg accagggttt ccgcgtcaag     72900
     acgctgggcc agcccgacga ccccgaggcg gcgctgctgt cgggtttttt caagaccatc     72960
     gagcgctaca cgccgcggct ggtcagctgg aacgggtccg gtttcgacct gccggtgctg     73020
     cactaccgca gcctgatcca cggcgtgccg gcgccgcgct attgggatac gggcgacgaa     73080
     gaccgcgatt tcaagttcaa caactacatc agccgctacc acaaccgtca catcgacctg     73140
     atggacttgc tggccaagta caacggccgc gccaatgcgc cgctggacga actggccaag     73200
     ctgtgcggct ttcccggcaa gctgggcatg gacggcagca aggtctggga agcctggaac     73260
     cagggcaagg ccgacgaggt gcgcgcgtac tgcgagaccg acgtggtcaa tacctggctg     73320
     gtgtactgcc gcttccgctt cctgcgcggc gagctcgacc gcgtcgccta cgacgccgag     73380
     gtcgccctgg tgcgcgacac gctggcggcc agcgacgcgc cgcactggaa agaatacctg     73440
     gcggcctggg acgcggcata aggcgcgtcg gcaatcgact gaaacagatg ggccgggtgc     73500
     gaaacccggt tgaaaccgcg tcgcccgcac aatggcagcg cgtttcaacc tttcaggaga     73560
     tcaccatgtc ccgacacgct atccgttcca ctctggcagg cctgaccctg gcgctttcgg     73620
     cgggcgtcgt ggcggctccc gcccttgcgg ccacccagga aggcccggcg gccggccata     73680
     tgaaagagca gggccgtcac caccacaaga aaatgatgcg cgacggcgtc tggctgccgg     73740
     gcgtcggccc gctgtccaag gcgcagatcg agtcgctcaa gctggacgcc aagcagcagg     73800
     ggctggtcga ccaggctcgc caggcgcaac gcgatgtgca caagagccgc cgcgacgcgg     73860
     gcgccacggg ccgcgacgcg ctgaaagcgc aactcgacag cggcaagctg gatccgcgcg     73920
     cgctgttggc cgaatcggac aagcggcacg agcagttccg cgcccaggcc acccaggtac     73980
     gcgacaaatg gctggcggtc tgggatagcc tgaacgaggc ccagcgcggc caggtcaccg     74040
     agatcgccaa ggccaaccag gcccgcatga gcgaacgcca cgcccgcatg caggaacgca     74100
     tgcagaagcg gcacgccgaa ggcggccagt ccgccgcgcc ggccggcgcc gccacggcga     74160
     actgatccac gccgatccgc aggaatgacg ccccggggct gcaacgcccc gggacgtttg     74220
     cgttggcgcg cgagccagcc tggcgcgcca tgcgccgaaa caaggcggcg ccgggtcggg     74280
     gtgcaccgct gcggtgcgcc gcggcgccgt gcgcgcacgc tatgccggcg cgggcgggct     74340
     ggcatggaat gtgcttttca tggggtaagc cgtcagggga ggggacttgc cccgcggctg     74400
     ggaggacggc tgcatgccgc gtccttattc caatcgatca ggaaccgcac atcatgaaaa     74460
     agcccttgtt cgccttgccc ctggtactgg ccgtctgcgc cgccgccggc gcgcgtgccg     74520
     agccgaccga cctgggggcg ggattttcgc tgagcggcaa cgccgccatg gtcagcgact     74580
     accttttccg gggttactcg cagaccgatt tccggcctgc catccagctg gggttcgacc     74640
     tcacgcacac ttccggcctc tacctgggca actggaattc gaacgtctcc gactttgtct     74700
     tcaccgacgg caatctcgaa atggacttct atggcggctg gaagggcgag gcgggcggcg     74760
     gcgtcggcct ggacgtgggc gtgctgcact actactaccc ggggtccagt tcgcccaagg     74820
     gcggcaacta caacaacacc gacctgtacc tgggcgtgag ctatgcgaac tactcgctga     74880
     agtactcgta cacgcccggc gatttcttca gcacgcccga taccaagggc acctggtacc     74940
     tggacggcac ggcgacgttc gacctgggcg atggctgggg gctggtcggc cacctgggct     75000
     accagaagct gaagaaggcg caggacatgg acggcgacgc gctgggccac tacgtggact     75060
     acaagctggg cgtgaccaag gacctgagcg gctgggtgct gggcctggcc gcggtgggcg     75120
     cgacccgcga caattggctg cccaccaaga acgggcatcc gtcggggagg ctgggagcgg     75180
     tgctttcggt ggcgcggacc ttctgaggcg ctgccgggga cgtcccgtcc ggtgggggac     75240
     ggggcgtccg ctcggacagc cgtttccggc atggcccgag ctcttttaca atgccggcct     75300
     gcctgtgtat ctggactgtg cgagatggtc gacgttttga atattgagtc cctggacctc     75360
     gaggcccggg ggatagccca ccgtgacggc aaagtgctgt tcgtggaagg cgccttgccc     75420
     ggcgagcggg tcacggtgca gacggtgcgc cgcaagccgt cctacgagat tgccaaggtc     75480
     gaggaggtcc tgcgcccgtc ctcgcagcgc gtggcgccgc gctgcccgca tttcggcgtt     75540
     tgcggcggct gtgccatgca gcacctggcg cccgcggccc aggtcgcgat caagcagcgc     75600
     gcgctcgaag acactttctg gcacgtgggc aagctcaagc cggcgcgcat cctgccgccg     75660
     ctctatggcc cgacctgggg ctaccgctat cgcgcccgcc tgtcggtgcg cgtcgtgccc     75720
     aagaagggcg gggtgctggt gggctttcat gaacgcaaga gcagctacgt ggccgacatg     75780
     cgcgaatgcc atgtgctgcc gccggcggtc agccgcctgc tgctgcccct gcgcgccatg     75840
     atagcggcca tgtcggcgcc ggaccgcatg ccccagatcg aggtcgcatt gggcgacgag     75900
     acgatcgtgc tggtgttgcg ccacctgctg ccgctgaccg acggcgatat cgccgtgctg     75960
     cgcgcgtttg ccgccgagca cggggtgcag tggtggctgc agtccaaggg cccggatacc     76020
     gtgcatccgc tagagcgcga gcatgccgac gcgctggcct ataccctgcc cgagttcggg     76080
     ctgcgcatgc cttaccggcc gacggatttc acccaggtca accacgccat caaccgcgct     76140
     atggtgtcgc gcgccctgaa gctgctggat gtgcagccgc aggaccgcgt ggcggacctg     76200
     ttctgcggcc tgggcaattt cacgttgccg ctggccaccc aggggcgcga ggcggtgggg     76260
     gtggagggca gcaaggcgct gaccgaccgc gcgcacgagg cggcggcgcg tcatgggctg     76320
     ggcgagcgca cccgtttcgc cacgctcaac ctgttcgagg tcgatgtgca atggctgcgc     76380
     gggctgggct acttcgaccg catgctgatc gacccgccgc gggaaggcgc gcaggctgtc     76440
     gcgcaggcgc tgtcgctgct ggctccgggc gagcggccgc gccgcatcgt gtacgtctcc     76500
     tgtagtccag gcaccctggc gcgcgacgcc gccatcatgg tgcacgaagg cggctatgcg     76560
     ctgcgcagcg ctggcgtcat caacatgttc ccgcataccg gccatgtcga atcgatcgca     76620
     gtgttcgagt cgctcgacga ggcgacggtg ctgcaagcgc aggcccaggc gcggcagaag     76680
     gcgcgcgagg aggccgagcg ccttgccgag gcggccgctg cctgaggcgg cccgccgggc     76740
     ggcggcgttc agcgccgccc ggtgttgctc agttcttcga tgatcgggca gtcgggtcgg     76800
     gtgtcgccat ggcaatggtg cgccaggtgc ttcagcgtgt cggccatctg gcgcaattcg     76860
     tccgccttgc gctccagcgt ggcgacatgc tcgagcgcaa tgcgcttgac gtcggcgctg     76920
     gcgcggctgc ggtcgcgcca cagcgccagc agttcgttca tctgttcgac cgagaaaccg     76980
     agatcgcgcg cgcgccgcac gaaacgcagc gtatgcagtt ccgcatcgcc atagacgcga     77040
     tagccggatt cggtgcgcgc ggcagggccg atcagtccga tgctttcgta gtagcggatc     77100
     atcttggccg aaatgcccga ggcctgggcg gcgtctccga tattcatggg cagtgtccct     77160
     ggcccgccga cggctggccg gttgcgcgcc ttccggcatg gaaggcgtcg cttccattct     77220
     acgcttgacc ttcacatcat gggaaggttt aagctctctc caacgttcga aaaccggacg     77280
     ctgtccgccg gcacaaggcc ggccctcatc caggagaaaa ccatgactat cgcctttcac     77340
     gttcccgaca tgacctgcgg ccactgcgtc aagagcatca cgcaggcggt gcagcaggcc     77400
     gtgccccagg cgctggtcca gatcgacctg gcggcgcgcc gcgtgacggt ggaaggcgcg     77460
     gcagcggccg agccggtcgc ccaggcgatc cgcgccgccg gctatgccgt gcaagcagct     77520
     taatcagcgt ttagcgatcg attgcttgag actatcaatt aattagattt attaaatttt     77580
     attaattgat agctaacaat tatcatctct tcatggtggt tgttccacag aatgtcgcaa     77640
     agctaatcca aggagatatg aatgctgcaa aatcgcgaag gtcaacgtgt accgagcgtg     77700
     acgtttcccg tccgtgaaaa caatgcctgg aagcaggtga cgaccgacga cgtcttcaag     77760
     aacaagaccg tcgtggtgtt ctcgctgccc ggcgccttca cgccgacctg ctcgtccacg     77820
     cacctgccgc gctacaacga gctggctccc accttcttcg ccgccggcgt cgacagcatt     77880
     gtctgcgttt ccgtcaacga caccttcgtc atgaacgagc gggcgaaaga ccaggagtcc     77940
     gccaatgtga cgctgttgcc cgacggcaac ggcgagttca ccgatggcat gggcatgctg     78000
     gtcgacaaga aggacctggg cttcggcaag cgcagctggc gctatgccat gctggtcaag     78060
     gatggcgtgg tcgagaagat gttcatcgag cccgagaagg aaggcgatcc gttcgaggtc     78120
     tcggatgccg acacgatgct cgcctacgtc gcgccccagg ccaggaagcc cgaccaggtc     78180
     gtggtgttct caaagccggg ctgcccgttc tgcgtcgacg ccaaggccct gctcaagggc     78240
     aagggcttcg acccgatcga gatcccgctg gacaacaagg tgcgcggccg tgtgatcggc     78300
     gccgtctcgg gtggcgatac cgcgccccag gtgttcatca acggcaagct gatcggcggt     78360
     ttcgacgccc tcaaggccta cctggcctga tgcctggccg gcggcgctgc cgccgccggc     78420
     ttttcccttc cttcgtgccg acgctggccg cttcgcagcg gccagcgcgt ctgcctgtcc     78480
     gcgcgccgcc tgggcggctc gcccgcactc atgaggataa tcgatgaaaa ccttgcacac     78540
     tgacgtggcc atcataggcg ccggcacggc cggcctggcg gcccatcgcg ccgcgcgcgc     78600
     cgccggcaag cgcgccttgc tgatcgaagg cggccagtac ggcacgactt gcgcgcgcgt     78660
     gggttgcatg ccgtccaagc tgttgatcgc ggccgccgag gcggcccatg cggcggcgca     78720
     cggcgggccc ttcggcgtgc atatcgatgg cgcggtgcgg atcgacgggg cgcaggtcat     78780
     ggcgcgcgtc aagagcgagc gcgaccgctt cgtcggcttc gtgctcgagg gcgtggagaa     78840
     catcccggcc gaggacaagc tgcgcggcat ggcgcgcttt gtcgaagaca cggtgctgcg     78900
     cgtggatgga cacaccgagg tgcgcgccgg cagcgtggtc atcgccagcg gctcgcggcc     78960
     cgcggtgccc ccgccgttcc tggcgctggg cgaccgcctg gtggtcaacg acgacgtctt     79020
     tgcctgggac acgctgccgg cgcgcgtcgc ggtgttcggg cccggcgtga tcgggctgga     79080
     actgggccag gcgctggcgc gcctgggcgt gcaggtgcgc gttttcggcg tgagcggcag     79140
     cctgggcggc atcaccgacc cgcgcgtgcg ccagagcgcc cgcaaggcct tccagcagga     79200
     gttctacctg gatccggacg cgcgcgtgct ggaaaccaag cgcgtcggcg acgaggtcga     79260
     agtgcgctac gtggcgctgg acaataccga gcgcaccgag cgcttcgact acgccctggt     79320
     ggcgaccggc cggcgtccca atgtcgatgg cctcgatctg cacaacacca gcctggcgct     79380
     cgatgcgcgc ggcgtgccgc atttcgaccg ccataccatg caggcgggcc aggcgccggt     79440
     gttcatcgcc ggcgacgcca acgccgacgc gccgctgctg catgaagcgg ccgacgaagg     79500
     gcgcatcgcc ggcgagaacg ccgcgcgcta tccggacgtc gcgccgggcc tgcgccgggc     79560
     ggcgctgggc gtggtgttct ccgatccgca gatcgcgctg gtgggcacgc cgttcgcgcg     79620
     gctggaaagc ggcaccttcg tggccggcga agtcgatttc ggcgaccagg gccgttcgcg     79680
     cgtcatgctg cgcaatcgcg gcatgctgcg cgtctatgcc gacatcgagt cggggcgttt     79740
     cgtgggcgcg gaaatggtcg gccccagcgc cgagcacatc ggccacctgc tggcctgggc     79800
     ggcgcaacag tcgctgacgg tggcgcagat gctggaaatg ccgttttacc accccgtggt     79860
     ggaagagggg ctgcgcaccg ccttgcgcga tgccgcggcg cgcctggcgc aggcccgccc     79920
     gcagcgcctg gcggcctgag cctcaggggt tctcgcggta ctgcagcgtg aaaccggccc     79980
     ggtcgtcctg ggccagttcg cgcgccagca gcggcatggc cggcttgagc gcgtcgtgca     80040
     gcgtccaggg cgggttgacc aggaacatgc cgctgccgtg cagcccgaag ccgtcggcgg     80100
     cgggtttgcg cacggtcagc gtggcgtgca gccagctctt gaccggcagc cgctccagct     80160
     ggcgcgccat ctccgatgcc tcgcggcgct gcaccagcgg ataccagacg acaaaggtgc     80220
     cggtggcgaa gcgcttgacg ccttcgcgca cggcagtcag cgtgcgccga taatcctgct     80280
     tgtcctcgta ggaaggatcg atgagcacca agccgcggcg cgtcggcggc ggcagcagcg     80340
     ccttgacgcc ctcgaagccg tccgcggcga agaccgtggt ctggcgcagg gcggtgcgct     80400
     cgttgcgccg ttccaggttc ctgaccagca cgtccgactc gctcgggtgc atctcgaaca     80460
     ggcgcaggcg gtcgcgctcg cgcagcacgt ccagggtcag ccagggcgag cccgggtaat     80520
     ggcgcaggac gccgtccgtg ttgtagtcgc ggatgcgggc gacatagtcg gccagcagcg     80580
     gaggcaggcc ggagagctcc cacaggcgcg ccacgccgtc ggcatgctcg gcgttcttgc     80640
     tggcccagtc gctgccgagc gcgtacaggc cggcgccggc gtgcgtgtcc accacccaat     80700
     agggcgcttc cttgcgattc atgtagtcca gcacgtggac cagaatggcg tgcttgagga     80760
     cgtcggcatg gttgccggcg tgaaaggcgt gtcggtaact gaacaaggcg gctccgcgtc     80820
     agacggcggg ccggatggtg gccagctcgt cggtgaaaat ggcgtccatg ccccaatcca     80880
     gcagcagccg ggcgcgggcc gggtcgttga cggtccaggc ggcgatgcgg tagccggcct     80940
     ggtgcacggc gtcgaccagc tcgcggctgg cgtcgcgctg attgatgttc agcgcgatgc     81000
     aatcgtattt gcgcagccgt tcgagccagt cggccggcac gcgatccacc agcagcgcgc     81060
     ggggcagctg cggggcggcg ccgcgggccg cgtgcagcgc gggctcggca aacgaggaca     81120
     gcagcggggc gggcagggca tcctgccaca gcgcggcggc cgcgcgcgcc acggccgcgc     81180
     cggtctcggc ctcgcggccc gggcagggtt tgatctcgac attgcaggcg atgccgttgg     81240
     ccagcgcata gcgcgccact gccgaaaaag tggggacggg ttcacctgcg tactgcggcg     81300
     cataccagct gccggcgtcc agctgggcca gctcggcgta cgtcttggac gccgccgggc     81360
     cgtggccatt gctggtgcgg tccacgtcgt catcgtgcag caacacctcg acattgtcgc     81420
     ggctgagctt gacgtcgaat tcgaacatgg tgaacccatg ggccgcgccg acgcgcatgg     81480
     cggccagggt gttttcgggc gccaggcggc cgccgccgcg gtgcgcgata tagggagaat     81540
     agggccaggc gggaaggggt gcggtcatga tgctcggtta cgggaaatgg ggctgcgcac     81600
     agccgcgctc aagcctgcaa gcataccccg aacgccgcct tcttccgtgc acggcggggg     81660
     tggttcgccg gcctgttggt ggtaaactcc ggcggctgat ccggtacagt ttccggcacg     81720
     gagtaaggcg aatcgggttc gccttttttt atgcgttttc ttgcggcttg gcgcggcgaa     81780
     ggttcgcgca agcgcggcaa caggggttcc atgtttgaaa taattcgcac ccatcgacgc     81840
     tggatgcaac tcatcctgct gctattgatc gtgccgtcgt tcatgctggt tggcgtccaa     81900
     ggttacgaca gtttcatcaa tcgtgaaccc gaactggcca ccgtggccgg gcagcccgtc     81960
     acccgctccg agttcgacca ggcccaccgc aaccagctcg agcagctgcg ccagcggctg     82020
     ggctctcagt tcgacccggc catgatcgat accccggcga tgcgcgagca gttgctcaac     82080
     cagctgatcg accagcgcct gctggccgtg gtcgccgccg acaatggctt ctcggtgtcg     82140
     gacggcacgc tgcgcaacac gatcgccgcc atcccgcagg tccaggacaa cggccgcttc     82200
     tcgcccgagc gctaccgcca ggtgctggcc gcgcaaggca tgtccccgac ctcgttcgaa     82260
     gccgggctgc ggcgcgacct cgcggtggcg cgcgtgctcg acccgatcag ccagtcggcc     82320
     agcgtgccgg ccgaagtggc caggtcggtc gaagccgccc tgacgcagcg gcgcacggtg     82380
     cagctgcgcc agttcgccgc ctccgacttc cgcgccaagg tcaccgtgtc cccgcaggac     82440
     atccaggcct ggtacgacgc caaccaggag cagttgcgcg tgcccgagca ggtccaggcc     82500
     cagtacctgg tgctcgacga ggcggccgcc accgaaggcg tgcaggtcaa ggacgaggac     82560
     atcgccagct attacgagca gaacaagtcg cgtttcggcc agcccgagcg gcggcgcgtc     82620
     agccacatca tgatttccat cccgcccggc gcctcggagg aggcgcgcaa ggccgccgcg     82680
     gccaaggcgc aggaaatcgc tgcccaggcg gccgccgatc cggccgggtt cgccgagctg     82740
     gcgcgcaaga actcgcagga cacgggttcg gccgggcagg gcggcgatct gggctgggcg     82800
     cccctgccgg cgccgctgca gcaggccgcg caggccctcg ccaaggacca ggtctcgggc     82860
     gtggtggaca cccccaccgc cttccacatc ctcaaggtca ccgacttcca gccgggctcg     82920
     gtcaagcccc tggccgaggt caaggacgag gtcgtgggcg agatccgcaa gcaattggcc     82980
     tcggcccgct tcgccgacat ggccacggac atgaccaggc tggtctatga ccagcgcgac     83040
     agcctgcagc ccaccgccga caagctgggc ctgaagctgc gtaccgccgg cggcatcacc     83100
     cgcaccggcc tgctgccggc cgagcaggcc ggcgccggct ccgccgccgg tggcgacgat     83160
     gcgcaactgc tggacaaccc gcgcgtgcgc caggtgctgt tctcgcccga cgtgctgcgc     83220
     gagaaactca attccggcgt gatcgagctg acgcccgata cgatgctggc cgtgcgcgtg     83280
     gcggcggtcg agccctcgca cattccgccg ctcgagcagg tccgcgccag catcgaagac     83340
     cgcctgttcg gagagcgcgc cgcccaggcc gcgcgccagg ccggcgaggc cgcgctcaag     83400
     agcgtgcagg ccgacgcttc ggcaacgccg gaggggttcg cgccggccat cgtggtctcg     83460
     cgccaggacg cgcagaacct gccgcgccgc gtgctcgacg ccgtcatgcg ccaggcgccg     83520
     tcgccgctgc ccgcctacac cggggtggag ctgggcgccg actacgtcgt ggcgcgcatc     83580
     gagaaggttg aggcgggcca gagcaccgag caggacctcg acctgctcaa gacgcagctc     83640
     tcgggcgcct ggggccaggc cgaggacgcg gcggtgctca ggcagctgcg cgaccagtac     83700
     aaggtgcaga tcctgccgga ggccgccgag gccatcaagg gcgacgctca gtcggccgca     83760
     ggctgagcca gcatcggctc gagcaagggc cagacattgt caagcagcgc cggctgggcg     83820
     ttctcgttgg gatggatgcc gtcggcctgg aacatggccc ggttggtggc gattccttcc     83880
     atgaggaacg gcaccagccg ggctttttcc tgttcggcca cggctggaaa gacctgcgcg     83940
     aagcgctggg tgtagtcgcg gccgtagttc ggcgggatct gcatgccgac caccagcacc     84000
     gatgcgccgg cctggcgcga cgcctgcgcc atggcgcgca gattgcgctc ggtcatgtcc     84060
     agcgccaggc cgcgcagggc atcgttggac cccagttcca gcacgacgac ggccggcgcg     84120
     tgctggcgca gcagcgccgg caggcgcgcc agcccgccgc tggtcgtatc gccgctgatg     84180
     ctggcattga cgacgcggta gttgggggat tgttgcgaaa cccgctgggc cagcatcggc     84240
     acccagccgg acccgcgccg caggccgtat tcggccgaca ggctgtcgcc gaccaccagg     84300
     acggcgtgcg gtgcggaacc tgtgggcgcg gacgcggtct gagcctgggc cggcaaggtg     84360
     gcggcgagcg cgatggcggc aaggcaaggt gcgagcaaac ggaaaacaat gcgcatggat     84420
     aacggcaact cgattgaagt gaaagggctg ggcaagcgtg tggccgacgc cggcggtgaa     84480
     ctgtcgatcc tcgatggcat cgattttacg gtccgggccg gcagcgccgt ggccatcacc     84540
     ggcagttccg gctcgggcaa gtccaccttg ctcggactgc tggcgggcct ggatgttccc     84600
     tcatcgggca gcgtgcacct ggccggccag gatcttttcg ccctcgacga ggatggccgg     84660
     gcgcgcctgc gcgccagcca tgtgggcttc gtattccagt ctttccagct gctgcccaac     84720
     ctcacggcgc tggaaaacgt catgctgccg ctggagctgg ccggccagcc ggcgcgcgag     84780
     gcggcgcagg cgatgctgcg gcgggtgggc ctgggcgagc ggctgcacca ctacccgcgt     84840
     acgttgtccg ggggcgagca gcagcgggtg tcgctggcgc gcgccttcgt ggttcagccc     84900
     gacctgctgt tcgccgacga ggaactggcc cgcggcgagc tgcgcctgct caacgtgcag     84960
     gccgacccgc tgcccgacct gagtttcacc gccagctggg tgcagggacc ggacagccac     85020
     gccgcgcgcg ccatcgcgct gctggcgcag cgcaccgcgg ccgagcacgg cggcgccatc     85080
     ggcgccggct agctgtgaag attcaatagg ttgtatgcat ggttcatccg aaccggattt     85140
     gagaaactgg aaatcgccaa ccccccagtt cactcaagga gcccggccgg atgaacaccc     85200
     ataagcatgc ccgattgacc ttcctacgtc gactcgaaat ggtccagcaa ttgatcgccc     85260
     atcaagtttg tgtgcctgaa gcggcccgcg cctatggggt caccgcgccg actgtgcgca     85320
     aatggctggg ccgcttcctg gctcagggcc aggcgggctt ggccgatgcg tcctcgcgcc     85380
     cgacggtctc gccccgagcg attgcgccgg ccaaggcgct ggctatcgtg gagctgcgcc     85440
     gcaagcggct gacccaagcg cgcatcgccc aggcgctggg cgtgtcagcc agcaccgtca     85500
     gccgcgtcct ggcccgcgcc ggtctgtcgc acctggccga cctggagccg gccgagccgg     85560
     tggtgcgcta cgagcatcag gcccccggcg atctgctgca catcgacatc aagaagctgg     85620
     gacgtatcca gcgccctggc caccgggtca cgggcaaccg acgcgatacc gttgaggggg     85680
     ccggctggga cttcgtcttc gtggccatcg atgaccacgc ccgcgtggcc ttcaccgaca     85740
     tccaccccga cgagcgcttc cccagcgccg tccagttcct caaggacgca gtggcctact     85800
     accagcgcct gggcgtgacc atccagcgct tgctcaccga caatggctcg gcctttcgca     85860
     gccgcgcctt cgccgcgctg tgccatgagc tgggcatcaa gcaccgcttt acccgacctt     85920
     accgcccaca gaccaatggc aaggccgaac gcttcatcca gtcggccttg cgtgagtggg     85980
     cttacgctca cacctaccag aactcccaac accgagccga tgccatgaaa tcctggctac     86040
     accactacaa ctggcatcga ccccaccaag gcatcgggcg cgctgtaccc atctccagac     86100
     tcaacctgga cgaatacaac ctattgacag ttcacagcta ggccgcggcg gacgcggcag     86160
     gagccggttc cgtcccgatg cacgggtgcc tgtccccgcc gggacaggca ccaaaaaaaa     86220
     gccttcgggc gaacccgaag gcggtacacg tacggcgcgc cggaccaccc ggcggccccg     86280
     cgtcatgact tatttcgcgg ccttggccgg atcgaccttg atgttgttca tgacctgctt     86340
     gaccccttcg acgtcacgcg ccacggtcgc tgcttgatcc gcctcggtgg cggtgccgac     86400
     cgtgccggtc agcgtcacca cgccattgtt cgtttcgacc gcgatgtcca gcgcgctcag     86460
     ggacttgtcg gcgacgaagg cggccttgac cttggtggtg accgtggcat cggaggcgta     86520
     ctcgcccacc gattgcttgg gcttgtcttc gcccgcggcg tgggccagcg aaccgatggc     86580
     ggcggtggcg ccgatgagag tggcaacgaa cagtttgcga acttgcatgg ttattctcct     86640
     ttatcgatga agcccaggat caggagcggg tactggcgca gcccgtcatt tcctgaagac     86700
     gccgcccagg atggacagca gcgccagcac caggaacacg aagaacagga tcttggcgat     86760
     gccggccgcg ccggcggcga tgccgccgaa gcccagtacg gctgcaatga tggcaatgac     86820
     gaaaaacacg accgcgtagt gcagcatgat gtttctcctt ggttcacgaa gcagtcagtc     86880
     agggattgcg gtcgaagaac tcgcgcacct cccgttgggc ctgttccttg gtcttgccgt     86940
     aacgctcctg gatcaggcca gccagccgtt cggcattgcc ttcggtgcga gtgagctcgt     87000
     cgtcggtcag ctcgccccag gccgccttgg ccttgcccgt caattgcttc cacttgcctg     87060
     caacaatatc gttgttcatg gttgtcctct tctaggtcgt tgcggcgcgg gatccgtgcc     87120
     tgccgaatgc cttgccgcga gtgagtgtgg acactgatca gcgtacggtt ctaccgtaag     87180
     agggggcggt ggcggtgtca aaccggcgtg tggggaaatg taaatggccc ggcgtggctg     87240
     gcgatacgtt ttgcgcaggg agaaaaaagg ccggcttgcg ccggcccaag ttacatttga     87300
     gcaaagaatt gagccgcttt gacgggctca ggtaaccacg cttgtcatgg ctgcccggtg     87360
     acgcggctgg cgatgtgggc cagggcttct tccacctggt ccaccaggat caggcacagg     87420
     tcgccagggg ccagccgctc cagcgcggcg tcgatggcga cgaactcgcc ctggatttcg     87480
     tcgatgtggc gcgtgcgcgg cgcctgttgc aggccctggc gcagcaaggc caccacttcg     87540
     ccgtcggcgc ggccgcgctg gcattggtcc tggtacagga tcacgtcgtc gaaggcgccg     87600
     cccaggatct ctgtctgctg gcgcaagtct tcgtcgcgcc gatcgcccgc gccgctgatg     87660
     accacgctgc ggcggcgcgc cggcatggtg tcgatggccc gcaccagcgc ctggatggcg     87720
     tcggggttgt ggccataatc ggcgatcagg gtcgcgccgc ggaaatcgaa gacgttgaag     87780
     cgtcccgggg ccgtctgcgc gtcgttgacg aagatggcca gcgcgtgccg gatggtgtcc     87840
     cagtcgatgc ccagcgccca ggccgccgcc agcgccgcca tggtgttctc cacctggaag     87900
     gcgatcgcgc cgccgcgcgt cagcggaatg tccgccagcg cgaaggcgac ttcggcgccg     87960
     ccttgcgcgg cgacgagact gtcgccgtcg cgatagacca cgcgatggcc ctgggcgcga     88020
     tgggtggcca tgacgggatg gttgcggtct tcggcgaaat atgtgatcga gccggggcag     88080
     gcgctggcca tctcggccac catgggatcg gcggcgttga gcacggccat gccgtcaggc     88140
     tgcacgtatt ggacgatcac gcgcttgacg accgccaggt cctcgacggt gctgatatag     88200
     cccagcccga agtggtcgcc catgccgatg ttggtgacga tggcgacgtt gcagcgatcg     88260
     aaggccaggc cctcgcgcag cacgccgccg cgcgcggtct ccagcaccgc ggcatccacg     88320
     tcgggatgca gcagcaggcg gcgggcgctg cgcgggccgc tgcagtcgcc ggtgtcgatg     88380
     cgctgcttgc ccacatagac gccgtccgag ttggtcatgc cgacgcggtg gcccgcgcag     88440
     tccaggatat gcgccgtcag gcgcaccgtg gtggtcttgc cattggtgcc ggccaccgcc     88500
     acgaccggaa tgcggccgtc gtcgcgctcg gcgaacatgt gggagatgat ggcttcgccc     88560
     accgcgcggc ccttgccgaa cgaggggttc aggtgcatgc gcaggccggg cgccgcgttg     88620
     acctcgacca cgccgccgtg ctggtcctcc agcggcaggt gcacggtctc ggcgacgacg     88680
     tcgacgccgc agatatccag gcctatcatg cgcgcggccg tgacggcgcg cgcggcgagt     88740
     tcgggatgga cttcgtcggt gacgtcggtg gccgcgccgc cggtgctgag attggcgttg     88800
     ttgcgcagca cgaccagggc gcccgcggcc gcgacggagt cggcctcgta gccctgcttg     88860
     cgcagggtgg cgatggcgat gtcgtcgaag cggatcttgg tcagcgacgt ggcatggcca     88920
     tcgccgcgca gcgggtccgc attgacctgg gccaccagct cggcgatggt gtgcgtgccg     88980
     tcgccggtga cctgcggcgg atcgcggcgc gccgccgcca ccagggtgtc gcccaccacc     89040
     agcagacgga agtcatggcc gggaatgtag cgttcgacga tggcctccga gctgatttcc     89100
     gcggcggcct cgaaggcgct ttcgatacgg tcgcgcgtct cgatattgac tgccacgccg     89160
     cggccctggc tgccgtcgcg gggcttgacc acgacggagc cgccgagcgc ctgcgcggcc     89220
     tgccaggccg ccgcggcgct gtcgaccgag ctgcccatcg gcaccgggac gcccgcggcg     89280
     tccagcagca tcttggtcag gtccttgtcc tgggcgatcg actccgagat cgcgctggtc     89340
     atgtcggttt cggcggcctg gatgcggcgc tgtttgctgc cccagccgaa ttgcaccatg     89400
     ctgccctggg tcagccggtg gtaggggata ctgcgtgcca cggcggcgtt gacgatggag     89460
     ccggtgctcg ggcccaggcg ggtgtcctcg tcgaggtcgc gcaggcgttg cagggcctgg     89520
     ggcaggtcga aaggcgtgtc gtcctgggcc gagcggatga gggcttcggc cagttcgaac     89580
     gccagccgcc cgacgtcttc ctcgctgtac tcgaccacga cctggaacac gccgggttcg     89640
     atggtggggg acgtgcgtcc gaaggtgacc gggcagcccg catgcgcctg caggccgagc     89700
     gcggtcgcct gcagcacgtg ggccatcgag atggcgtcgc gctggccttc cggctgcagc     89760
     acgcccaatt gcgggaaccg ggcgcgcagg cgcgcctcga agtccggcat gccgttgatc     89820
     gcgcattcgg catcggagca ggcggcgatg gcctcgatgg cggtgttgcg gctccagaga     89880
     ttggggccgc gcagggcgcg gattcgggaa acttccatgg cagggattcc tgtcgtcgaa     89940
     gaagcgccgc cgttcgggcg gcgcggcaag aggggcgaag tcgcgggttc agccttgttg     90000
     tatccagcgc cgcaccaggt ctatggtggg gccggagaat gcctcatcgg attgcagcag     90060
     cgcgaagtcg ccctcgcgca ggtcgtcgag cacgcgggcg atggcgcgcg cgtggtcggc     90120
     ctcgtcggca atggcggtgg cgcgcgccga ttgctccaac ccctgccgca gcaggctgcg     90180
     cgcctgcccg gcgggacgct tgctggcaac cgtggcgtcg tcgtagagca cgacctggtc     90240
     gaacgtcgtg cccagcaggc ggccctgttc gaccagggca tcgtcgttgc ggtcggcgcc     90300
     ggccgagtac acggcggcgc gccgcctggc ggggaactgc tcgatggcgg ccagcagcgc     90360
     gcgcagcgcc gaagggttgt gcacgtcgtc gaccaccacg caggcgccgt tgcgctcgaa     90420
     cagcgtgaac tgccacggcg cgtcggcctg gtcgatgtcg aaggtttcga tgccggcgcg     90480
     tatcagctcg accggaatgt ccagcgccca ggcggccgcg accgcggcca gcacgttctc     90540
     gatctggaac gcgacgcggc cgccgtgcgt cagcggaacc gcggcgatgt cggccaaggc     90600
     ttcttcgtcg cggccacgcg ccagcacgat gcgtccggcg cgcaggtaga cggcgcgctt     90660
     gccttcggcc agatgggcgg ccagcgtcgg cagggcgggg tccaggccga agtacagcac     90720
     ctcgccgtcg cacagctcgg ccatgcggac cacgcgcggg tcgcgtgcat tgagcacggc     90780
     agcgccgccg ggcagcacga cgtcgatctg ggtgcggaac acgtcgacca ggcggtcggt     90840
     ttcgttgata tcgaaatcgc ccaggtgatc gccgtcgtcg atgttggtga ccacgccgac     90900
     caggcagcgg tcataggcca gcccctggcc caggatgacg ccgctgtcgt tctcgatcac     90960
     cgccgcatcg accgagcggt tcatcagcac gcgccgcccc gcggcccaat tggcgcaatc     91020
     gcctttctgc accaggcgcg ccaccaggcg cgcgaccacg gtcttgccgt tggtgccggt     91080
     cacgcccacg atggggatgc ggccgtcgtc gtcggccggg aacaggtggt cgacgatgga     91140
     gcggcccacc gggcgcggcg ggcagtcggc cggtttcagg tgcatgagca gccccggccc     91200
     ggcgttgact tcgacgatgg cgccgcgcgt ttggtccagc ggacgcgaga tgtcgtcggt     91260
     gacgaggtcg acgccggcga cgtccaggcc gaccacgcgg gcggccagcg ccaccgtggc     91320
     cgccacgctg ggatgcacgc ggtcggtgac gtcgaacgcc acgctgccgc tgcgctggat     91380
     cagcacattg cggcccgcgg cgggcacgct ggtggccgtc atgccctggc gggcgatctc     91440
     caggcgcgcg gccgagtcca gccgcaccgg attgagcgga tggttttcgg tgcggccgcg     91500
     ccgcgggtcg gtattgatct ggctgccgat caggtcttcg atggtggata cgccgtcgcc     91560
     ggtgacccag gcgggttcgc ccgccgccgc cgccaccatg cggtctccca ccaccagcag     91620
     gcggtgttcg ttgccggtga tgaagcgctc gacgatgacg ccgctgcctt catccaccgc     91680
     cacggcatag gccgattcga tttcgtcgcg cgtcagcagg ttggtgaaga cgccgcgtcc     91740
     atggttgccg tcgtagggct tgacgaccac cggcaggccg atgtcctgcg cggcctccca     91800
     ggcgtcggcc gcgctttgca ccagccgtcc ttcggggacc ggcacgccgc aggtcgacag     91860
     cagttccttg gtcaggtcct tgtcgcgcga tatgccttcg gcgatggcgc tggtgcggtc     91920
     tgtttcggcg gtccagatgc ggcgttgccg cgatccgtag ccgaactgca ccaggttgcc     91980
     ctcgaacagc cggatatagg gaatgtcgcg gtcgtcggcc gcgtccacga tgcaggcggt     92040
     gctgggcccc aggcacagcg agtcgaccag ggcgcgcagc cgcgcgacgg ccgccggcac     92100
     gttgaacggg cgatcctcga tggccgccat cacgaggtcg cgtccctcct gcagggcggc     92160
     gcgcgtgacc tgttcgtgcc aggcgcgcac caccaccttg tagacgccgc gccgcgaggt     92220
     ctcgcgcgcc ttgccaaacc cgcccggcag gccggccagg ttctgcagtt cgagcgtgac     92280
     gtgctcgagg atgtggcccg gccaggtccc ttcgcgcagg cgctgcagga agccgccgcg     92340
     cacgccgggg ctgcagcggt gctcgatcag cgtgggcagc cagccggaca ggcgctcgta     92400
     gaagccgggt atcgtgttgg aggggaaatc ctccaattcg ccgatgtcca cccacgcttc     92460
     cagcaccgga cggtacgtcc agatgttggg gccgcgcaaa gtcacgacat cgagaaattc     92520
     aatgtctttc tttttcatgg ttatggagga gtgattgcgc attggcaggc cgaagtcacc     92580
     ccgtgcaaag tcgaggggcg aagggccggt tgggaagtgc caacacgtgg atgggcggaa     92640
     gaattcctaa gtatggaaat tgtgaaaatc ggctgctact atacgccgcc tttttgccca     92700
     tataaactcg cgctgttgta aggaacggac aggcttcagg tccgaggccg gaagccggag     92760
     aatcgccttt ttgggccggg ctgtggctcg aaacgcgttc taatgaaaaa accacaaaat     92820
     ctagctggcg cgggccggcg cgaggtgccg gccgagtgga gggatgcgat tcattcgcat     92880
     cttgacgcag gcgaaaccgt gctggcctgg ctggaaaccg atcttgacgc gcggctgcgc     92940
     ttcgagacgg gcatggtgtt ggcaaccgac cggcgcatcc tggcctgcgc gccgggccgc     93000
     cgcgagtggt ccagctgacc gtattcccct gatctgcgcc tggccctgca cgaccacgcc     93060
     gggcgccgcc agcctggagc tcgatgccgg cgcgcggcgc ctggcaagct ggcggttcac     93120
     cctgggccgc aatccggcgg ccctgcgcct gctggaacag ttcgagagtc tccaggccct     93180
     gcgcctggcc ggcgcggccc cgacggctgg cgaatctccc cggccatgcc cgacctgcca     93240
     ggcgccgatc cccgccgacc gggaagactg cccggagtgc agccaggagc ccgccgcccc     93300
     gccggcgacc tgggcgctgt tgcggctgtg gcggttcgcg cggccctatc gcggcgcgct     93360
     gctggccgga ttcctgctga cgctgctggg taccgccgcc acgctggtcc cgccctacct     93420
     gaccatgccg ctgatggacg acgtactgat tccgttccag aacggtgcgt ctatcgacta     93480
     cgccaaggtc aggctgtacc tggcaggcct gctggcctcg gccgtgctgg cctggggact     93540
     gggctgggcg cgtacctata tcctggcctg ggtcagcgaa cgcatcgggg cggatctgcg     93600
     caccaccacc tacgaacatt tgcagcagct ttcgctggag tacttcggcg gcaagcggac     93660
     cggcgacctg atggcgcgca tcggcagcga aaccgaccgc atctgcgtat tcctgtcgct     93720
     gcatctgctg gacttcgcca ccgacgtgct gatgatcgcc atgaccgccg cgatcctggt     93780
     gtcgatcaac ccgtggctgg cgttggccac cctggtgccg ctgccgttca tcatgtggat     93840
     gatccacgtg gtgcgcgacc ggctgcgcca cggtttcgag aaggtcgatc ggatctggtc     93900
     ggagatcatc aatgtgctgg cagacaccat accgggcatc cgcgtggtca aggcgtttgc     93960
     ccaggagcgg cgcgaagtgc agcgctttcg cgaagccaac aaccgcaacc tggaggtcaa     94020
     cgaccgcgtc aataccgtgt ggtcgctgtt ctcgccgacg gtgacgctgc tgacggagat     94080
     cggcctgctc atcgtgtgga tcttcggcat ctggcaggtg tcgcagaagc acatcacggt     94140
     tggcgtgctg gcggcgttcc tggcgtatat cggccgcttt tacacgcgcc tggattcgat     94200
     gagccgcatc gtgtcggtga cgcagaaggc ggccgccggc gccaagcgca ttttcgacat     94260
     tctcgaccac gtctccagcg tgcccgagcc gcacaagccg gtgcacctgc cgcgcgtgaa     94320
     cggccacatc gagctgcgcg acgtggggtt ccgctacggc aaccgttcgg tgatacgcgg     94380
     gctggacctg tcgatcgcgc cgggcgaaat gataggcctg gtcgggcata gcggctcggg     94440
     caagagcacc ctgatcaacc tgatctgccg cttctacgac gtatcggaag gcgcggtgct     94500
     ggtcgacggc gtggacatcc gctcgctgcg catcgccgat taccggcgca acatcggact     94560
     ggtgctgcag gagcctttcc tcttcttcgg caccatcgcc gacaacatct cgtacggcaa     94620
     gccggacgcc acgcgcgcgg agatcatcgc cgccgcgcgc gccgcgcatg cccatgagtt     94680
     catcctgcgc ctgccgcatg gctatgactc gctggtgggc gaacgcggcc aggcgctgtc     94740
     cggcggcgag cgccaacgca tctcgattgc ccgggcgctg ctgatcgacc cgcgcattct     94800
     catcatggac gaggcgacct cgtcggtgga caccacgacc gagaaggaaa tccagaaggc     94860
     gctcgacaac ctcgtgcgcg ggcgcaccac catcgccatc gcgcatcgcc tcagcacgct     94920
     gcggcgggcc gaccggctgg tcgtgctgga ccgcgggcag atcgtcgagg agggcgcgca     94980
     cgaggccttg atggcgcgcg aaggcgccta ctatcggctg taccaggcgc aacagacgcg     95040
     ccaggccgaa ggcggcgacg acgacagcga cgccatcgcc gccatcgcat gagagcgcag     95100
     cccgccatga acgactccgc attccagctg catcgcaacc aggccggccg gctggttttc     95160
     accggcgccg acggccgggc gcatgaaggc gtggtgccgg tgcgcgcgtt tccgatcagc     95220
     gctccggcca gcggcctgtc tttggtcagc gccgacgggc atgaactggc ctggctggac     95280
     gacgtggcgc agttgccgcc cgcgcagcgg ccactggtcg aagcagagct ggccagccgc     95340
     gaattcatgc ccgagatccg gcgcattgtc tcggtgtcca cattcgccac gccatcgtcc     95400
     tggcaggtcg agaccgaccg cggcaacgcc accttcgtat tgcgcggtga agaagacatc     95460
     cgccggctgg ccggccatac cttgctgatc accgacatgc acggaatttt cttcctgatc     95520
     cgcgatgcgc tggcgctgga ccgccatagc cgcaagctgc tggatcggtt cctgtagcgc     95580
     agggggccgg gtgcccgagt gcccgggtgc ctgtcccagc ggggacaggc accaggattc     95640
     ctgcggggac aggcaccgga gggttgggtc aggtttttcg aaacgggctg tgggtggcca     95700
     gttcgtcgcg atattcgtcg atggcgtggg tttcgtggcc gaggaaatcg tcgatggccg     95760
     cggcaaagcg cgtgtcggcg atccagtggg ccgaccaggt cggcgtgggc agcaggccgc     95820
     gcgccatctt gtgttcgccc tgcgcgccgc cttcgaagct ggcctggccg tgcgcgatgc     95880
     agtattcgat ggactgcagg tagcaggttt cgaaatgcag gccggggatg tagcgccggg     95940
     cgccccagta gcggccgtac agcacgccgt cggcctgcag gttcagcgcc gccgccaccg     96000
     gctggccgtc ctgttcggcc aggatcagca ccagcgcgtc cggcatctcg gcatgcagct     96060
     gccggaagaa ctccaggttc agatagggcg ggttgccatg cgccaggtag gtgtggcgat     96120
     agcactggta gaagaaatcc agcgccgcgg catcgatgtc ggcgccgcgc agccagcgaa     96180
     acgaaacgcg ttcggcggcg accttcttgc ggtcctggcg gattttcttg cgcttgtcgt     96240
     ggctgaacgc ggccaggaag tcgtcgaatc cggcatagcc cgcgttgcgc cagtggaatt     96300
     gcacgccggc gcggatcagg tagccggcct cgcgcagggc gagcaggtcg tcatcgctcg     96360
     ggaacaggac atgcagcgac gatacctcga actgccgggc cagctggatc aggccacgcg     96420
     ccagcagcag ccggtcggca tgcgtgtgcg ccagcaggcg cgccccgccg accggcgtga     96480
     acggcacggc cgacagcagc ttgggatagt agggcaggcc gttgcgcgcg taggcgtcgg     96540
     cccaggcata gtcgaacaca tactcgccgc gcgagtggct tttggcatag agcggcaccg     96600
     cgccggccag caggcccgcg cggcgcaggg ccaggaagca gggcgtccag ccggtgcctg     96660
     ggctggcgca tccggtatcg tgcagcgccc gcaggaaggc atggcgcacg aacggctgcg     96720
     ggccggccag cgcatcccat tgggccgcat cgaagtgctc caggccggct tgcaccgaga     96780
     gttcgacaga ggagggcatg gccaatgata aagtcgccat gtggccatgc cgcggcgcca     96840
     caggcccggc atgcctttcg caacgagaag acaatggaag cagcaagcat agcagtgcct     96900
     ggtgccggag ccggcgccag tctgcgcgcc caggcgctgg acgccctgat gacgcctgcc     96960
     tgggccgaca agctggcggc cgtggcggcc atcgacgctg gcgcgccggt gggcgcgcaa     97020
     caggacctcg ccgagccagc cggcctgccg gggcggccgc ccgccccgca gctggtgccg     97080
     ccgtcccagg tgcggcagcg ctcggtgcaa tcgcccgaag ggcgcgccgc cttgctgcac     97140
     gccctggcgc atatcgagtt caacgccatc aacctggcgc tggatgccgt gtggcggtac     97200
     ggcggcctgc cggacgccta ctatctcgac tggctgaagg tggcgcgcga ggaggcctac     97260
     cacttcgacc tgctcaaccg tcatctgtcc gggttgggcc atgcctatgg cgactttccg     97320
     gcccacaatg gcctgtggga gatggccgag aaaacgcgcg ccgacctgct ggcccgcctg     97380
     gcgctggtgc cgcgcacgct ggaggcgcgc ggcctggatg cctcgccgct gatccgcgac     97440
     aagctggcgg cggccggcga cgccgatggc gccgccattc tggagatcat cctgcgcgac     97500
     gagatcggcc atgtggccat cggtaaccac tggtacaagg cgttgtgcgc gcagcgcggc     97560
     ctcgatccgg tggcgcagta cgcgcagctc gcctcccggt acggggcgcc gcgcctgcgt     97620
     ggcccgttca acctcgaggc ccgccgcgcc gccggtttcg acgaggacga actgcgggcc     97680
     ttgttgcagg cgtaacggcg cgggcatgtc tgcgggcggc cgcccgaatt agaatggtgc     97740
     acatgaacaa agcctaccta cgcctgttgt gcgccacggc cttcgccgcg gcggccattc     97800
     ccgcgctggc cgcgcccgcc gccgccaccc ccgccgacct cgatgcgtat cgcgcctgcc     97860
     tgaagcagtt gcgcggcgac gccatcaaga gcggcgtgca ggcagccacc tacgacgcgc     97920
     agaccgcgtc gctggcgccg gacatggacg tgctgggctt cctggacgtg cagcccgaat     97980
     tcaagacgcc catctgggac tacatggcgg gcctggtcga cgaggaacgc atcgaggacg     98040
     gccgccaggc cctggcccgg catgccgacg tgctggcgcg ggcgcaggcc gaatatggcg     98100
     tcgatcccgc gaccgtggtg gccgtctggg gagtcgaaag caatttcggc aagaacctgg     98160
     gcggacgccc cttgctgacg tcgctttcga cgctgtcgtg cttcgggcgc cggcaaagct     98220
     atttccgagg cgaattcttc gccaccctca agatcatcca ggacgagcac atgcagcccg     98280
     agcgcctggc cggctcatgg gccggcgcct tcggccagac gcagttcatg ccgtcgacct     98340
     acctgcgcct ggcggtcgac ttcgatggcg acgggcggcg cgacctggtc gacagcgtgc     98400
     ccgacgccct gggctccacc gcgaacttcc tgcgccgcgc cggctggcaa accgggcagc     98460
     cctggggctt cgaggtcaag ctgccggccg gcatggacct ggccggcacc ggacgccgca     98520
     acaagcagcc gatgagcgcc tggcaggcgc gcggcatcaa gcgcgtggac ggcggcgcgc     98580
     tgccggcggg cgatacgccc gcggcgctgc tggcgccggc cggggcgcaa ggcccggtgt     98640
     tcctggtgtt gcgcaatttc gatgcgctgt attcgtacaa cgcggccgag agctacgcgc     98700
     tggccattgc ccatttgtcg gaccgcctgc gcggcgactt gccgttcgcg cgcgcctggc     98760
     ccaccgacga tcccggcctg tcgcgcgccg aacgccgcga attgcaagag ctgctgctgg     98820
     cccgcggatt cgatatcggc aagccggatg gcgtgatcgg cgtgcgtacg cgccaggcgc     98880
     tgcagaccgt gcagggccag ctgggcctgc cggccgacgg gcgcgccggc cagaagacgc     98940
     tcaaggccct gcgcacgccg tagcgccggc cgggttcggc gcgccgccga gggcggcgcg     99000
     gaaatggttg caatttctgc gccgcgcggg cacggccgcg taggacggat gcgctagact     99060
     ggcttcccct tctttctctt gggagcctgt catgggtctt ctcgattctc tgacgtcgat     99120
     cgccggcggc gccctgggtg gcggcgacga gcgctcggcc aacggcggca tggcagcgtt     99180
     gctgcccgtc ctggtcgcgc aattgaacaa ttaccccggc ggcctgacgg ccttgatcca     99240
     gcgcttccag gaaggcggcc tgggcgaggt gatcgcctcg tgggtgagcg ccgggcccaa     99300
     ccagcccgtg acgccggcgc agctggactc ggtgctggag ccgggcatgg tcgaccagat     99360
     ggcgcagcag tccggccagg accgcggcga cgtgctggcc aacctgagcc gcttgctgcc     99420
     gggcctggtg gataccgcca cgccgggcgg ccaggccgag tcgggccaat ccttcgatgc     99480
     cggcagcctg ctggcttcgc tgtcggggct gctcgacggc aagcgcggct aacgcgccgt     99540
     ctagctgtga agattcaata ggttgtatgc atggttcatc cgaaccggat ttgagaaact     99600
     ggaaatcgcc aacctcccag ttcactcaag gagcccggcc ggatgaacac ccataagcat     99660
     gcccgattga ccttcctacg tcgactcgaa atggtccagc aattgatcgc ccatcaagtt     99720
     tgtgtgcctg aagcggcccg cgcctatggg gtcaccgcgc cgactgtgcg caaatggctg     99780
     ggccgcttcc tggctcaggg ccaggcgggc ttggccgatg cgtcctcgcg cccgacggtc     99840
     tcgccccgag cgattgcgcc ggccaaggcg ctggctatcg tggagctgcg ccgcaagcgg     99900
     ctgacccaag cgcgcatcgc ccaggcgctg ggcgtgtcag ccagcaccgt cagccgcgtc     99960
     ctggcccgcg ccggtctgtc gcacctggcc gacctggagc cggccgagcc ggtggtgcgc    100020
     tacgagcatc aggcccccgg cgatctgctg cacatcgaca tcaagaagct gggacgtatc    100080
     cagcgccctg gccaccgggt cacgggcaac cgacgcgata ccgttgaggg ggccggctgg    100140
     gacttcgtct tcgtggccat cgatgaccac gcccgcgtgg ccttcaccga catccacccc    100200
     gacgagcgct tccccagcgc cgtccagttc ctcaaggacg cagtggccta ctaccagcgc    100260
     ctgggcgtga ccatccagcg cttgctcacc gacaatggct cggcctttcg cagccgcgcc    100320
     ttcgccgcgc tgtgccatga gctgggcatc aagcaccgct ttacccgacc ttaccgccca    100380
     cagaccaatg gcaaggccga acgcttcatc cagtcggcct tgcgtgagtg ggcttacgct    100440
     cacacctacc agaactccca acaccgagcc gatgccatga aatcctggct acaccactac    100500
     aactggcatc gaccccacca aggcatcggg cgcgctgtac ccatctccag actcaacctg    100560
     gacgaataca acctattgac agttcacaac tagcgcggcg ccgcgggcac ggcgaccacg    100620
     ggctcgtcct tgacggtctg catcacgatg tgggtgtaga acgcctgcac gttgtcgtcc    100680
     tggtcgaaca ggcggtcggc gaacgccagg tattcgtcca tgtcgcgcat gtgcacgatc    100740
     agtacgcacg agacctcgcc ggtgaccata tagcattggg tgacggcggg ctcgagcgcg    100800
     acctgctcca tgaaggtgcg gcggtattcc gagccatggc gggcgaattc cagggtgacg    100860
     atggccgaaa gcgggcgctc gacgcgggcc gggtccagca cggcgacgat acggcggatg    100920
     acgccgtttt ccttcagccg ggccacgcgc cgcaggcacg ccgaggccga cagcccgacg    100980
     cgctcggcga gcacggcgtt ggagatatcg gcgtcgcgct gcaaaatccc aataatgcgg    101040
     tggtctatgg catcaagttg catggttatg caattttatt ctgctgttgt ccatatgatc    101100
     gttgattcgg ctgcttgcag gcaataaatc gctgcctcat tgtgtcgcat ccgggctatg    101160
     ctgtcagctg tcatttccgt tcattcagcc ctgttcattc atcgtgccat atctgtcggg    101220
     tctcatgcgg cgcagcggcc gcctgttctt aactttggtc aaggtcatgc tgcctgtcat    101280
     gatcgccgtc caggcagcgc aggcgtgggg ctggatcgat atcctgggcc aggcgttcgc    101340
     tccggccatg ggtttgctga atctgcccgc cgaggccggc atggtatgga tgacgggcgc    101400
     gttcgtgggg atctacggcg ccatcgcggc gctgatcagc ttggcgccgg cgctggagct    101460
     gaccggcggc cagttcagcg ccctgtgttc catgctgctg ttcgcccatg ctctgccggt    101520
     ggagcaggcc atcgtgcggc gcgccggcgc cagtttctgg gccacggcgg cgctgcgcgt    101580
     gggggcggcg ctgggctacg gcgcggcggt ctcgtggttc tgccacgcca ccggatggct    101640
     cgatgagccg gtgtcgctgc aatggctgca gtcaaccgcg ctggccggcg agcaggccgg    101700
     cggcatatgg gcctgggtgc gcggcaccgc cgtgtcgctg tcgttcacct acctcatcat    101760
     cctggcgctg ctggtggcgc tggacgtcat ggaacgcacc ggcattaccc gcgccatcac    101820
     ggtggcgctc acgccggtgc tgcgcgtttc gggcctggac ccgcgcgtca cgccggtcac    101880
     catactgggc gtgctgctgg ggctgtccta cggcggcgcg ctcatcatcg aagaggcgga    101940
     gaaacagcaa ctggaagccc ggccgcgctt tctggcgctg gcctggctgt cgctgtcgca    102000
     ttcgctgatc gaggatacgg tgctcttgat ggcgctgggc gccaacggct ggatcgtgct    102060
     ggtcggccgc ctgctggtga cgctggtggt cgtggccatc ctggcgcgga tgctgggcgg    102120
     gggcggcgcg gcgcgccggc ccctgggcgc gccggcaggc tgactcaggg cctggccggg    102180
     gcgggcaggc gcgcggcgat ctcggcgatc aggcgccgcg ccgcatccag cttggccgcg    102240
     gcgggcaggg ggtgcacccc gtgctcgtcg aacagcacca gctcggtggt gtcggcgtcc    102300
     atgaccttgt gcgccaggtt gcccaccaag agcggaatgc ccttgcgcag gcgcttggct    102360
     tccgcatgct cggccagctt ttcggtttcg gccgcaaaac ccacgcacca gggcccgctc    102420
     gccagcttgg cgacctcggc caggatgtcc gggttgggtt cgaattccag cgccggcgcg    102480
     ccgccgcctt cggtggtctt cttcagcttc tgctcgctga cgttcttgac gcgccagtcg    102540
     gccacggccg ccacggcgac gaagatgtcg gcgtcgttgg cgttggccat gaccgcgtcg    102600
     tgcatctgcc gcgccgtggt cacgtgcagc gccgtgacgc cgcgcggaat ggccagcgcg    102660
     gtggcgccgg tgatcaaggt gacccgggcc cccgcttcgt gggcggcgcg cgccagggcg    102720
     tagccggtct tgccggacga gcggttgctc agcacgcgca ccggatcgac gggttcggag    102780
     gtggggccgg ccgtcagcag catgtggcgg tccgccagca ccttgggctg gaacgaagcg    102840
     atcaggtcgg cgagcagttc gtgggcttcc agcatgcggc cggtgccggt ttcgccacag    102900
     gcctgttcgc cggcggccgg gcccagcacg gtaatgccgt cggcgcgcaa ctgcgccgca    102960
     ttgcgctggg tagccgggtt ggcccacatt tcacggttca tggcgggcgc caccagcaag    103020
     gggcaggcgc gcgccaggca cagcgtcgag agcaggtcgt cggccaggcc gtgcgccagc    103080
     ttggccatga agtcggcgct ggcgggggcg atcagcacgg cgtcggcgcc gcgcgtcagg    103140
     tcgatgtgcg ccatgttgtt gtcgacgcgg gcatcccagg cgtcgacgaa aaccggccgg    103200
     ccggatagcg cctgcatggt gaccggcgta atgaagtgcg tggcggcctc ggtcatgacg    103260
     acatcgacga ccgcaccctg ttcggtcatg cggcgcacca gttcggcgat tttgtagcag    103320
     gcgatgccgc cggtcaggcc gaggacaatg cgtttgcggg cgagatcgag catggcggga    103380
     aaagggcgcg gcggcgccgc ctgtcaaagt ggtggaggaa agggcggttg gaccgatttt    103440
     atgcgctttg ccgcggcgac ggggccggac gccccggtca gtcctgcgcg gtcggccgct    103500
     tgcgcgcccg cagcagctcg tcgacgacca gcagcacggc gccgcaggtg atggccacgt    103560
     cggccaggtt gaatgcggga tagtgccagt cgcgccagta gaacagcagg aagtccacga    103620
     catggccgta ggccacgcgg tcgatcacat tgcccagcgc gccgcccatg atcagcgtca    103680
     gggccaggct gaagcgcggc tggccggcgg tgcggcgcag cagccagacg atgacgatcg    103740
     aggcgcccac gcccagcgcg gtgaagaacc agcgttgcca gccttcctcg gaagcgagaa    103800
     agctgaatac cgcgccccgg ttgtacagca gcgtgaagtc gaagaacggc agtacgttga    103860
     ggcgttcgcc gtactggaag gcgccgtcga agtacagctt ggtcgcctgg tccagcacga    103920
     tgatgagggc ggccgcggcc agccaggggg ccagtcgcgg cgcggcggcg cgggcctgcg    103980
     tcatggtcag gcccgcgtgc gcggctcgcc ggcgccgaac aggttgctca cgcagcggcc    104040
     gcagatctcg ggatggtcgg cgtcctggcc gacgtccggg cgccagtgcc agcagcgctc    104100
     gcactttttg tgccccgacg cggcgatctc gatgcgcaag tcgtcggcgt cggcatgcac    104160
     ggtggcgcgc gagacgatca gcacgaaacg caggtcatcg cccaggctgg ccaggatgtc    104220
     gtggtcggcc gcgttggcgt acaggtccac ttcggcctgc agcgacgagc cgatggcgcc    104280
     ggccgaacgc acctcttcca gcttgcgctg cacctccgcg cggatggcgc gcaggcgcgt    104340
     ccacttggcg gtcagggcct cgccgtcggc aaatggcggc aacgcgtgat agacctcggt    104400
     gaagatggtg acgcgcgggg cgtcggcctg cttggccagc gccgagccgg ccaggatctt    104460
     ccaggcttcc tcggcggtga acgagaggat gggcgccatc agcttgagca gcgtctgggt    104520
     gatgtcgagc aacgcggtct gcgccgaacg gcgcgcggcg ctgccggcag ccgtcgtgta    104580
     caggcggtct ttcaggatgt ccaggtagaa cgcgccgagg tcttccgagc agaacgtctg    104640
     caggcgggag acggcgggat ggaaatcgta gcgttcgtag tggccctgga cttcggcctg    104700
     catctgcgcg gtcatcgcca gcgcgtagcg gtcgatttcg aacagctcgc catacggcac    104760
     ggcctggccg accgcgtcga agtcggccac gttggccagc aggaagcgca gcgtgttgcg    104820
     gatgcggcga tagctttcga ccacgcgctt gaggatctcg tcggagatcg acagctcgcc    104880
     cgagtagtcg gtggaggcga cccacaggcg caggatctcg gcgccgagcg aatcggacac    104940
     tttctgcggc gcgatgacgt tgccgaccga cttgctcatc ttgcggccct ggccgtcgac    105000
     cacgaagccg tgcgtgagca ggcccttgta ggggggatgg ccgtacagca tgcaaccggt    105060
     cagcagcgac gagtggaacc agccgcggtg ctggtccgaa ccttcgaggt agaggtcggc    105120
     gggccaggcc agttcggcgc cgtgcgagcc gcccagcacg ccgtccttgc cgcccagcac    105180
     cgtggcatgg gtcgagcccg agtcgaacca cacgtccagc gtgtcgcggt tcttttcgta    105240
     cagctcggct tcgtcgccca gcagttcgcg cggatcgagc gattgccagg cctcgatgcc    105300
     gcctttctcg acgcgctgcg cgatttgctc cagcagctcg acggtgcgcg ggtgcagctc    105360
     gccggtttcc ttgtgcacga aaaaggccat cggcacgccc cattggcgct gccgcgacag    105420
     cgtccagtcg gggcggttgg cgatcatcgc atgcaggcgc gcgcggcccc aggcggggta    105480
     gaaggcggtg gcgtcgatgc cggccagggc gctttcgcgc aggctcgggc cgccgtcgcg    105540
     cggcttgacg tccatgccgg caaaccattg gctggtggcg cggtagatga ccggcgtctt    105600
     gtggcgccag caatgcatgt agctgtgcga cagtttctgg accagcatca gcgagtcggc    105660
     cagcttgagc gcttcgacga tcctgggatt ggcgtcccag atcgacaggc cgccgaacag    105720
     cggcaggctg tcgacgaact tgccgtcgcc catgaccggg ccgaggatgt cgctgtccgc    105780
     caggccgtgt gccttgcacg acacgaagtc ttcgataccg taggcgggcg ccgagtgcac    105840
     gacgccggtg ccggtgtcca gggtgacgta gtcgcccagg tagatgggcg aggtgcggtc    105900
     gtacccttgg gcggcggcgg ccagcggatg gcgaaagcgc aggccttcga gggcctcgcc    105960
     cttggcggtg gcgatgatct cgccttccag cccccacgcc ttcaggctgg gttcgacgcg    106020
     ttcctgcgcc agcagcagca gcggaccgtg caccggcgcg ggcgtgacgc gcaccaacgc    106080
     gtagtcgatc tcggggtgca cgttgagcgc ctggttcgac ggaatggtcc agggagtggt    106140
     ggtccagatg acaatggcgc cggcgtcgac ctcgtccagg ccgaaggcgc gcgccagcgc    106200
     gccgcggtcg gtgaacggaa aggccacatc gatggccgga tcgacccggt cggcgtactc    106260
     gacctcggcc tcggccaacg ccgagccaca gtcgaaacac cagttgaccg gtttcaggcc    106320
     gcggaacaca tagccttttt ccagaatgcg gccgagcacg cggatctcgt cggcctcatt    106380
     gctgaagttc atcgtcaggt aagggttgtg ccagtcgccc agcacgccca ggcgcttgaa    106440
     gtccttgcgc tggcgatcga tctgttcgag ggcgtaggcg cgcgccttgg actggacctc    106500
     ggtgactggc aggtgcttgc cgtatttctt ttcgatctgg atctcgatcg gcatgccgtg    106560
     gcagtcccag cccggcacgt agtgcgcgtc atagcccgcc atgttgcggc tcttgacgat    106620
     gatgtccttg aggatcttgt tgacggcgtg gccgatgtgg atgtcgccgt tggcataggg    106680
     cgggccgtca tgcagcacga agcgcggacg gccgcggctg gcggcgcgga tggcctggta    106740
     gacctgggtt tcttcccatt cggcaaccca gccaggctcg cgcttggcca ggtcgccccg    106800
     catcgggaag ggagtgtcgg gcagattgag ggatttttta tagtccatga acggcaaaat    106860
     aggcgcgcgc gttttgcgcg tcttgggcga tggcggcagt cagggagggg agatcggcga    106920
     atttttcttc gtcccgcagc ttgtgcagga actcgactcg cacgagttta ccgtatgcgt    106980
     cgaggctctc gtcgagcagg tgggcttcga gcagcacccg gccgcggtct tcgaccgtcg    107040
     gacgcacgcc caggctggcc accgccggca agggccggtc ctgcaggccg agcacgcgca    107100
     ccacgtaaat gcccgagcgg gtggcgcagc gcggcgccac ccgcaggttc atggtcggga    107160
     agcccagttc gcggcccagt ttctggccat ggatgacatg gccgctgata tggaacggct    107220
     ggcccagcag ttgcgcggcg cggtccaggt cgcccaccgc cagggcggtg cgcacctcgg    107280
     agctggaaat gcggtggccc tggcggtcgg tgatgtcggc cagggtacag acttcgaaac    107340
     cgtgcgtcag gcccgcttcg cgcagcaggt cgatgtcgcc gctgcgcttg tggccatagc    107400
     ggaaatcctc gccgaccagc agccagcggg tctgcaggcc ggccaccagc aggtcttcga    107460
     tgaaggcgtt ggccgacatt tcggccagcc gggcgtcgaa gcgctcgacc acgacctgtt    107520
     cgatgccggc ggccgccagc gcctgcagct tgtcgcgcag cccggaaatg cgggtgggcg    107580
     ccagttcggg gcggcggttc agggtggcga agtactcgcg cgggtgcggc tcgaaggtca    107640
     tgacggcggg caccaggccg cgcgcgcggg cctcctggcg cacgcgcgcc aggatggcct    107700
     gatggccgag atggacgccg tcgaaattgc cgatcgtcag ggcgcacggc gtgcgttgcg    107760
     agggcggggg cgggtagcgg tagatgcgca gcgatggttt cacgaccgag agtttacaat    107820
     tttgggttga cccgcttttg gaaagttttc atcttgccgc aaatgtccaa tcccaagcgc    107880
     cgcctcgtca tcctgatttc cgggcgcggc agcaacatgc aggccctggt gcaggcgtgc    107940
     cgcgggcagt cctggccggc cgaagtggcc gccgtgatcg ccagccgccc ggacgccgcc    108000
     ggcctggatt gggcgcgcca gcaaggcatc gccaccgcgg ccctctacca caaggactac    108060
     cccagccgcg aggcgttcga cgccgcgctg gcccaggaga tcgaccgcca cgcgcccgat    108120
     tacgtgctgc tggccggatt catgcgggtg ctcacgccgg gcttcgtcaa tcactacgcg    108180
     ggccggctgg tcaatatcca tccttcgctg ctgccggcgt ttcccggcct gcatacgcat    108240
     acgcatacgc atgcgcaggc cctggccacc ggcgtgcgcg cgcatggttg cacggtgcat    108300
     ttcgtgacgc ccgtgctcga ccacggcccc atcatcgcgc agggctgcgt gccggtgctg    108360
     gcgggcgata cgcccgaggc gctggccggg cgcgtgctcg aggtcgaaca ccaggtctat    108420
     ccggcggcgg cgcgctggct ggccgaagga agggtcagcc tgaccgccga ccagcgcgcc    108480
     gatcgcggcg cgccggcgcg cgccgaccgg cctcgcaccc cgattgcggt cattcgtatc    108540
     gaccaggtcc agcgcgtgct tggcgaggtg ctgcagtgga cctatcccgc cgacgccgtg    108600
     ctgtcgcact ggctgcgcgc gtaccctggc atgggcgggc gcgaccgcgc cgaactggcc    108660
     caggcggtct acgacgtgct gcgccacctg cgtcgctatc ggcagttcgc cgagagcggg    108720
     gtcgggcccg cgacgcgccg gctggccatc ctgggcctgg cggccacgat gaaccccgac    108780
     gtcctggccg aggggctggg cgccgaccag gcggcgtggc tgcagcgcat ccggcacatc    108840
     gatgtggcga ccttgccgcg cgcggtgcgc gccagcgtgc cggactggct cgacgagcgg    108900
     ctggcgcagt tggacgattc cgaggccctg ctggacgcct tgaaccggcc cgccaacctg    108960
     gatatccggg tcaacccgct caaagccgag cgcgacccca tgctgaccgt gttgcgcgcc    109020
     ggcccggccg gacgcttcga cccccagccc atgccttatt cgccgtgggg cattcgcctg    109080
     gcggggcacc catcggtcaa tcgctggccc cagttcgagg acggcagcat cgaggtgcag    109140
     gacgagggca gccagttgct ggccctgcta atggggccgc ggcgcggcga gatgatcatc    109200
     gatttctgcg ccggggcggg cggcaagacc ctgctgttgg gcgccctgat gcgctcgacc    109260
     ggccgtcttt acgcattcga cgtctcggcg gcgcggctgg cgcgcgccaa accgcgcttc    109320
     gcccgcagcg gcctgtccaa cgtggtgccg gtggcgatcg acagcgagaa cgacacgcgg    109380
     gtcaaacggc tggccggcaa ggcgcagcgc gtgctggtgg acgcgccgtg cagcggcatc    109440
     ggcaccctgc ggcgcaatcc cgacctgaag tggcgccagc accctcagtc catcgccgaa    109500
     atgtgcgagc tgcagcaccg tatcctcaag agcgcggcgc gctgcgtggc acccggcggg    109560
     cggctggtct acgcgacctg cagcctgctg gccgaggaaa acgccgagca ggccgaacgc    109620
     ttccttgccg aacacccgga tttcgaacgc ctggacgctg cgcaattatt ggccaatcgt    109680
     tgcgcaaatc tgacattgag cggcccctac gtgcagctgc ggccggatgt gcatggcacc    109740
     gacggctttt tcgccgcggt gttcgagcgc cgcaagccat ccgcggcggc cacgcaggag    109800
     cctgcggacg tggcggccga aaccgggccc ggcgagccgg aagacgcggc cggctagttg    109860
     tgaagattca ataggttgta tgcatggttc atccgaaccg gatttgagaa actggaaatc    109920
     gccacccccc cagttcactc aaggagcccg gccggatgaa cacccataag catgcccgat    109980
     tgaccttcct acgtcgactc gaaatggtcc agcaattgat cgcccatcaa gtttgtgtgc    110040
     ctgaagcggc ccgcgcctat ggggtcaccg cgccgactgt gcgcaaatgg ctgggccgct    110100
     tcctggctca gggccaggcg ggcttggccg atgcgtcctc gcgcccgacg gtctcgcccc    110160
     gagcgattgc gccggccaag gcgctggcta tcgtggagct gcgccgcaag cggctgaccc    110220
     aagcgcgcat cgcccaggcg ctgggcgtgt cagccagcac cgtcagccgc gtcctggccc    110280
     gcgccggtct gtcgcacctg gccgacctgg agccggccga gccggtggtg cgctacgagc    110340
     atcaggcccc cggcgatctg ctgcacatcg acatcaagaa gctgggacgt atccagcgcc    110400
     ctggccaccg ggtcacgggc aaccgacgcg ataccgttga gggggccggc tgggacttcg    110460
     tcttcgtggc catcgatgac cacgcccgcg tggccttcac cgacatccac cccgacgagc    110520
     gcttccccag cgccgtccag ttcctcaagg acgcagtggc ctactaccag cgcctgggcg    110580
     tgaccatcca gcgcttgctc accgacaatg gctcggcctt tcgcagccgc gccttcgccg    110640
     cgctgtgcca tgagctgggc atcaagcacc gctttacccg accttaccgc ccacagacca    110700
     atggcaaggc cgaacgcttc atccagtcgg ccttgcgtga gtgggcttac gctcacacct    110760
     accagaactc ccaacaccga gccgatgcca tgaaatcctg gctacaccac tacaactggc    110820
     atcgacccca ccaaggcatc gggcgcgctg tacccatctc cagactcaac ctggacgaat    110880
     acaacctatt gacagttcac agctagttgc gcggcaccac cacgatggcg gcgctgtcgc    110940
     gccgggacgc gggctggcgg ggttgatggg tgacctccca gaccaccgtg tcctggcccg    111000
     gttgcgtgcc ccggtacacg atctgcgtca cgggcaccgc cgtgtgcgcg cagcgcccgc    111060
     ccgggccgct gttgccctgg gactgcacga cggtggcagt gcccaggcgc ggcggttgca    111120
     cgatgcgcac cagcggcggg cgcagcgacg cgcaatcggc gccgcggatc tggtaatacg    111180
     atgccagcgt cacgttgtcg cccacctgca cggtggggcc ggcggcccag gcggcgggca    111240
     cggcgagggc gagaagggcg ggtaataggc gtaacatcga gaatggccgg tgcggatcag    111300
     ggtgtcagca tacaggtagc cggttctttg tagcaaaatg tattattgct atggtgctgg    111360
     cggccctgca ccctcatcta cagggtgggc cagtgggcgg caggggctgc gcgcaacccg    111420
     accagatgca gcttagtgct tgatttccct caaaaactat tttgaaacca cgctgtcata    111480
     agggcatcag gtagactaaa ctttcagcca ctttacaagt gaggctccaa aaagctttat    111540
     ggattccatc ctttctttca tttccggcgg tctgacccaa gccacttggt ggcagatcgt    111600
     gctgttcacc ctggtcgtga cgcacatcac cattgtgtcg gtcacggtgt tcctgcaccg    111660
     cagccaggcg caccgcggcc tggacctgca tccggcagtg atgcatttct tccgcttctg    111720
     gctctggatg accaccggca tggtcaccaa ggagtgggtc gccatccacc gcaagcacca    111780
     tgccaagtgc gagaaggaag gcgatcccca ttcgccgatg ctgttcggca tctggaaggt    111840
     gctgttccgc ggcgccgagc tgtatcgcga ggagtccgcc aacaaggaaa ccatggccaa    111900
     gttcggccac ggcacgcccg atgactggct cgaacgcaac atctattcca agcacagcct    111960
     ggccggcgtg ctcaccatgc tggccatcga cctggccctg ttcggggccg tcggcctgac    112020
     ggtctgggcg gtgcagatgg cctggatccc gttctgggcg gccggcgtgg tcaatggcat    112080
     cggtcattac tggggctacc gcaactacaa cagcccggac accagcacca acgtgttccc    112140
     gtggggcatc atcatcggcg gcgaagagct gcacaacaac caccacgcgc acggcacctc    112200
     ggccaagttc tcggccaagt ggtacgagct ggacatcggc tggggctata tcagcatcct    112260
     gaagttcttc ggcctggcca aggtcaagaa ggttgcgccc aagctgaagc tggaatcggg    112320
     cagcaagggc atcgacctga gcacgctgca aggcgtgatc acgcaccgct acgaagtcat    112380
     ggcccgctac ggcgacctgg tcaagcgcgc cgcgcgtgaa gagctgagca agctgaagtc    112440
     ctcgcgccag caggacgccg ccaattgccg ctggaccacg ctgcgccgcg tgcgccgctg    112500
     gctgcaccgc aacgaggaag tcctgcagcc cgagcagcgc gccgaagtcg accaggccat    112560
     cgcccagaac cagtcgctgt cgacgctggt gcagatgcgc cgcgaactcg gccgtctctg    112620
     ggaaagctcc agcgccagca gcgagcagct gttgcatgac ctgcaggcct ggtgccagcg    112680
     cgcccagcaa agcggcatcg ccgggctcga gcaatttgct ctgcatctgc gccgctacgc    112740
     ggcatgatgc tggaaaagct caatcctgaa caacgcgctg cagtaacgct cgaaccgcaa    112800
     cacgccctgg ttctcgccgg ggcgggcagc ggcaagaccc gcgtactgac gacccggatg    112860
     gcctggctga ttcaaaccgg ccaggccagt ccatttgcgc tgttggcagt cacctttacc    112920
     aacaaggcgg cgcgtgaaat gctcacgcgc atgtcgaccc tgttgccgat cgacacgcgt    112980
     ggcctgtgga tcggtacctt ccacggcctg tgcaaccgca tgctgcgcgc gcaccatcgc    113040
     gacgcgggct tgccgcaggc attccagatt ctcgatacca ccgaccagct ggccgccatc    113100
     aagcgcctgc tcaaggcggg caatatcgac gacgagaagt acccgccgcg cgatgtgcag    113160
     cgtttcatca acggcgccaa ggaagagggg ctgcgtcccg gcgacgtcga ggcctacgat    113220
     ccgcaccggc gcaagctgat cgagatctac cagctgtacg aggcgcagtg ccagcgcgag    113280
     ggcgtggtcg atttcgccga gctgctgctg cgcgcgtacg agctgctgtc gcgcaacgcg    113340
     ccggtgcgag agcattacca gcggcgcttc cgccatatcc tggtcgatga gttccaggac    113400
     accaacacgc tgcagtacaa gtggctgcgt ctgctggcgg gcaccggggc ggcgattttc    113460
     gcggtcggcg acgacgatca gtccatctat gcgtttcgcg gcgccaacgt cggcaacatg    113520
     gccgacttcg aacgcgatta cgcacatggc cgtgtcatcc gcctggaaca gaactaccgc    113580
     tcgtacggcc acatcctgga ttcggccaat gccctcatcg ggcacaacac cggacgcctg    113640
     ggcaagaacc tctggaccga acagggcgag ggcgagccgg tgcgcgtcat cgagcagccc    113700
     tccgacggca tggaggcgca atggctggtc gacgagatcc gcgcgttgat caacgacggc    113760
     cgcatgcgca gcgaaatcgc cgtgctctac cgcagcaacg cgcaatcgcg cgtgctcgag    113820
     catgcgctgt tctcggtggg catcccctac aaggtgtacg gtggcctgcg cttcttcgag    113880
     cgccaggaaa tcaagcacgc gctggcctat ctgcgcctga tcgccaatcc gaacgacgac    113940
     acctcctgga tgcgggtggt caactttccg acccgcggca tcggggcgcg cacgctcgag    114000
     cagctcagcg acgcggcgcg cgcgcacgac accagcctgt tcggcgcggt ggcccgcgtc    114060
     ggcggcaagg gcggctcgaa tctggcgcaa ttcgcgcagc tgatcggaca gatggcgcac    114120
     gacacgcgcg agctgccgct gccagaactg gtggaccatg tcatcgaggc cagcggcctg    114180
     aaggcccact accagaccga acgcgaaggc gccgagcgcc tggagaacct caacgaactg    114240
     atcaccgctg ccacggtgtt cgcggccgag gaaaacttcg aaggcttgcc ggccggcgtc    114300
     gtgcccgatc acgatgtgag cggcgccctg atgccgggcg tcgtcgatgc cccgcaaccc    114360
     gatacgctgg gcggcctgac accgttggcg gctttcctgt cgcatgcggc gctggaagcc    114420
     ggcgacaatc aggcgcaggt gggccaggac gcggtgcagc tgatgaccgt gcacgccgcc    114480
     aagggccttg agttcgacgc cgtgttcatc accggcctgg aggaagggct gttcccgcac    114540
     gagaacagca tcatggagcc cgccggcctc gaggaagagc ggcgcctgat gtacgtggcg    114600
     atcacccggg cccgggaaag gctgtatctc agcctggcgc aaagccgcat gctgcacggc    114660
     cagacgcgtt acgccatgcg ttcgcgtttt ctcgaagaaa ttcccgagca gcatctgaag    114720
     tggctgagcc cgcgcgccgg cctgcatcag ggcggcggct tcggcggcgc ggcgccggcc    114780
     tggagcagtc gcggcgacgc ctttggccgc aagcctaccg gcactgccgc acctcggcag    114840
     ccgcgtggca tggccagcgg cgtcaccgtg ggcgagcagc agttccgggt ggggcagggc    114900
     gtgcgccacg cgcgctttgg cgacggcacc atcataggcc tcagcggttc ggggcaggac    114960
     gcccaggccc agatccagtt tcgcgacgtg ggcgccaaga cgctggcgct gggcatcgcc    115020
     aagctggaca tcatcacggc ctgagcttcg cgtcttgcgc ccgcatcggc tggcgcaaga    115080
     cgcggcaggg ccattctcaa tagcggtatc ccacctgcag ccagatctcg cgtccggtgc    115140
     gatagcgccg cgcatcgatc aggctgtcgc gcgggttggt cgtcagcgcc gcgatgcggt    115200
     tgagcacatt gagcacgtcc aatgccaggg tgacctggcg cgcgaacggg ggttgccaga    115260
     taaggcgggt gtcccagctc cagtacgaag gggcggaaag cgattcgtac atgtcgaggt    115320
     actcgggggc gggccctgtg tccacgaacg cgatttcctt gcgccgcccg tgccagttca    115380
     cggtgttgct ccacgtcagt ccgtggcgcg gccaatggcc ggtgagatcc agcgagacct    115440
     tgtgcggcag gttgaagttg ctcggcggca agttcgctgc cgggatccgc ttgccgttgt    115500
     agtacacata atcggcccgt tccacaggcg atgattcata gccctcggcc aggttcaggt    115560
     tgcgcttgtt gcgctggtag ccccagctgg cctgggcatg ccacagcgtt tcgcccagcc    115620
     gccacgcctc ttcgttggcc agggtgagat tccagccgtc ggtacgcgag ttgccttcgt    115680
     tggtatagcg atagcccacg cgcgaatcgc cgcggcgcgt gacctggtcg cggccgttgc    115740
     ggtgcacgaa cgtcagcacg ccgcgtatgc cgtaggcgcg ctgcgccagc gagaaggccc    115800
     attcgtcgtc gtaggggctg cgcaggccgt cgtagttcac gcgcgtgatt ttgcgtccat    115860
     tgggcacggg atcgccgtgg tggtccagca cttgctcgct caggcggctg aactcttcct    115920
     gcatggcgat cttgaggaca tgcccgccgt agtagcgtga ccaacccgcg ctcaggacgg    115980
     tgtcgtcgct gcccagcaca tcccagtcca ggcgcgcccg gggcgcgagc gtgcggtggt    116040
     gcaggaagtt gtccctgtca tagcgcaggc cggcgttcaa ggtccagcgc cgccacgtga    116100
     gttcatccga cgcatacagc cccagcctgg tgtagtcgag cgtaaccgag cccggcaggt    116160
     ggcggacctt gctgaagtgt ttttcggtgc cgtcctcccg gtgcacggcc cggtacgagt    116220
     acgactggtt gtagcgcttg aagcgcgcgc cggtgtgctc gacctgcaag cccacatagg    116280
     aggcatggct gaccgggccg gtctggatgg gcgccaggtc gagccgcgtg gccagcgtca    116340
     ggttgcgctg gcccttttcg tccttgccat atccgccgct ggcgaatccg ggccgaccgt    116400
     cgacgaagtc gtgctgcacg aattcggtat gggcagagtt gcggtggctg tcgaaccggt    116460
     cccatcccaa ttgcgccgac agcttgccgc cgcgcaaggt atgttcgata ttccagaccg    116520
     cgccctgcgc gccgtgccga ttgcgccagt ccgtatcgcg gaagaaattg ctcaccagat    116580
     gttcgcgccg atcggcgtac ttcaggctca ggtccgtgat cgtgtcggca tccaggcgca    116640
     ggctgaactt gcccagcagg ttgtcgacgc ggtccaggga gtcgtcgcgc tcgggacggt    116700
     ccaggtggcc caccgcgccc aggcgccagc gttcgatccg ggaaatgcgc cgtgacaggc    116760
     ccagcaccag gccggcgcgt tcgccgagcg cgatgtcggc ggacgcggta tggaagcgct    116820
     tgcgccagga cggcgtgaaa tccggggtgc cctgcagcca gtcttcggcg ttgccgggcg    116880
     cgatcttctg ccgtgtcagg ttcgagccgt tccagcgata gtccagcttc acgtggtttt    116940
     cgcccgacgg ccggcgcagg cgcgcatcca ccacgccgcc gttgaatgcg ccatactcga    117000
     ccggaatgct gttgtcgaag acgcgcactt cgcccagcag cgcagtgtcc agaaaatagg    117060
     cttgcgggtt gctgggaacg tcggtgaagt tgcggctctt gttggccggg tcgacccggc    117120
     tggtggcgcc gacgccgtcg atgagaaaca ggttctggta ggggctggcg ccgtggatgg    117180
     agatgtcctc cacgttcagc gttccccggt tggcgccgtc ctcggcggtg ccgctttcgc    117240
     gtatggcggg atgcgtggcg atcagcgcgc tgaggtctcg gttggaggcc ggcgtggcgg    117300
     cgatctcctg ctcggtatag acgcgctcgc gcgttgcgtc gccgtacacg cgcaccggtt    117360
     cgagcggcca cgccgcggcc gcgtcggcgg cgcgcacgac ggcatagcgg ttcgcgcccg    117420
     cggcgcgcca tgtcaggccg gagccgcgca gcaggtgttg cagcgcggcc tgcgcagtca    117480
     tcgtggcgcg cagcgccggc gcctgtttac gcgcggcctc gcgagcatcg aacgagagcg    117540
     ccacgccggc ttgccgggcg tatgcccgca gggccgcgtc caggggttgg gcgggaagat    117600
     cgaaggcgag ggcgggggat tgcgtcgccg cgtgggtcgc cgcggcggtg cagagcagca    117660
     gcgcggccag agttgtgcgt tggcgcttct tgaggatggg tttcgacatg cgtgccttcc    117720
     ggactgagtg aaatacagtc gtgcaagagc atgcatatcg gacgcgagga cgataccggg    117780
     cgcggggggc aaggtggccg tgtatccggg ctcatggggc gttcaggaaa tccagcagtg    117840
     cctcaatctc gccggggctc gggtccggcg ggcgcagcca gccgcccatc ggcgcgccgc    117900
     ggtagcggcg gtgccgtgat gctgggggga tacgtccgtg tgcgaagaca tggcgccggc    117960
     gcggtactgc gcggtcagag tcgaattcgc ggcggagtat aggagataat gcgtctcgct    118020
     ggttttacgc tgcgcggatt cctacgccaa ggtgcgcggg cgccgcgctc aggcggcgtt    118080
     gtcctgctcg atctcttcga gtgcctgctg gatctccagc cattgctcct cgaggtcatt    118140
     gaggcgcttg ccggattcgc cgtgttcggt catcacttgc tggcgttcgg tgcgtcgcgc    118200
     gtcggaatag agatcggcgt cggcgatcac ggcatccagt tcctgcaggc gggcgcgggc    118260
     gcgctccatg tcggcctcga ccttcgccag tttggcggcc agcggcttgc gcagcgtggc    118320
     caggcgttgc cgctgctcgg cttcgagccg gcgctgggcc ttgcgatcga cggccacgcc    118380
     cggctcgccg gcggcggcct cgcgcgcggc ggcgcgttcg ccggcgttgc gggcggccag    118440
     ccagtcccga tagtcttcga gatcgccgtc gaactcgcgc acgccgccgt cggccacgat    118500
     ccagaagctg tcgaccgtgg tgcgcagcag gtgccggtcg tgcgatacca gcagcatgct    118560
     gccggagaat tccgcgagcg ccgtggccag cgcctcgcgc gtctccacgt ccaggtggtt    118620
     gctgggttcg tcgagcagca gcaggttggg tttttgccag acgatcagcg acagggcgag    118680
     acgggctttc tcgccgccgg acatggggcc gaccttgctc agcacggtgt cgccggaaaa    118740
     gccgaagccg cccaggtagt tgcgcagctc ctgctcgcgc acttccggag ccagccgcgc    118800
     gaggtgcgcg agcggcgtgc tgtcgaggtc cagcatgtcg agctggtgct ggtggaaata    118860
     gccgatcgcc agcccgcgcg acgcgcgccg cgtgccggca tgcggggcca gctcgtcggc    118920
     cagcgtcttg atcagggtgc tcttgcccgc gccattggcg cccagcacgc cgatacggct    118980
     gccggctcgc accatcagcg tgacgtcgcg cagaatgggc tcggcgccgc cgtagccggc    119040
     atccatgtgt tccatggcca gcagcgggtc gggcatgtgg tcgggcgagg ggatgcggat    119100
     atcgatgccc gattcggcat ggataggcgc cagcgcttcc atgcgcgcga gcgccttgac    119160
     gcggctttgc gcctgcttgg ccttggaagc cttggccttg aaacgatcga tgaagccttg    119220
     caggcgcgcg gcttcgcgcg tctggcgttc gtaggcgata ttggcttggc gcaggcgttc    119280
     ggcgcgctgc agcaggaagt cctggtagcc gccgcgatag cgctgcagct tggcctggtc    119340
     gaagtgcagg atggcgcgcg ccaccgcgtc caggaattcc gtgtcgtgcg aaatcagcag    119400
     aaccgtaccg ggataggcgg tcagccattt ctccagccac agcatggcgt caaggtccag    119460
     gtggttggtt ggctcgtcca gcagcaacag ctccgacggc gccatcagcg cgcgcgccag    119520
     caccagccgc atgcgccagc cgccggaaaa gctgcgcacc ggctgcatcc attcggatgg    119580
     cttgaatccc aggcccgcga gcaactgctc ggcgcgcgag gccgcgctcc aggcgcccgc    119640
     ctcgatcagc gccgcttcgg tttcggcgat ctgcgtgccc tggtcgtcgg tcagcgcggc    119700
     gcgctgggcc tgcagtgcgc gcaggtgggt gtcgccgtcg atgacgaatt cgcgcgccgc    119760
     ttgcgcgtcg gcggcaatct cctgctgcac gctggcgatg cgccagcccg cgggcaggtc    119820
     caggttgccg gcgtcggggt ccagcgcgcc ggtcagcagc gcgaacagcg acgatttgcc    119880
     cgcgccgttc ttgccgacga tgccgacgcg ttcgccggga tgcacaacga aatcggcgcc    119940
     gtcgagcagc actttggtgc cgcggcgcag ggtcaagcca gaagcgcgta tcacgtgttc    120000
     aattgttcgc gggtaagcag cagaatctgg tccgaggatt ccgcggtgtc cagccatacc    120060
     ggctgcagat cagggaaggc cgcctcgaaa tgatcgcgct cgtggccgat ttccagcacc    120120
     agcacgccgt cggcggacag gtagccgggg gccgcggcca ggatgcggcg caccagatcc    120180
     atgccatcgg cgccgccggc cagcgccagc gccggctcgt ggcggtattc ctggggcagg    120240
     gcgcccatcg aggcctggtt gacgtagggc gggttgcaga cgatgacgtc ataggcggcg    120300
     gccggcaggg cctcgaacag attgccctgg cgcaaggtca ggcggtcctg cagaccgtac    120360
     tcggcaacgt tgcgcgcggc gacttccagc gcatcggacg aaacgtcgac ggcgtcgact    120420
     tgcgcaacgg gaaaagccag cgcggccagg atggccaggc agcccgaccc ggtgcacatg    120480
     tccagggcgc gctcgacctg cagcggatcc cgcacccaag gcgccagccc ctcgtcgagc    120540
     agttcggcga tcggcgagcg gggcacgatc acacggcggt cgacatggaa ccgatggccg    120600
     cgcagccagg cctcgccggt caggtaggcg gccggcaggc gctcggtgac gcgccggtct    120660
     atcaggtcga gcacgcggct gcgttcgctc ggcaggacgc gcgcatccag gaacggatcg    120720
     agcgtatcgg gcggcagatg caggccgtgc agcaccaggt agaccgcttc gtcccaggcg    120780
     ttgtcggagc cgtggcccag cgcgacacgg gccgcgttca ggcgcgacac cgcgtagcgg    120840
     atcaggtcgc gcagggtctg cagctcttgg cgattattgt tttgcatgga ggatcagtcg    120900
     gccagcagca ggttttccag cgtgcggcgg taaatgttct tcaagggcgc gaggctggac    120960
     agttcgatgc gctcgttgac cttgtggatc gtggcgttgc aggggccgaa ctcgatgacc    121020
     tgcgggcaga tcctggcgat gaagcggcca tcggatgtgc cgccggtggt cgagagttcg    121080
     gcctgcaatc cggtttcggc ctggattgcc gacaccagcg catcggtcag cgagccgcgc    121140
     ggcgtcagga aaggttcgcc gcccagctcc cagtcgagct ggtactccag gccgtggcgg    121200
     tccagcacct catgcacgcg cgccttgagc tggccgggcg tgctggcggt ggaaaagcgg    121260
     aaattgaaca gcgccaccgc ctcgcccggc acgacgttgg tcgcgcccgt gccggcgtgc    121320
     aggttggaga cctggaacgt ggtgggcggg aagtactcgt tgccctggtc ccattcgatg    121380
     gcgaccagtt cggtcagcgc cggcgccagt tgatggaccg ggttgcgcgc caggtggggg    121440
     tacgcgacat ggccttgcac gcccttgacc agcaggcgtc cggacagcga accgcggcgt    121500
     ccgttcttgc atacgtcgcc caacgcctcg gtggaggtcg gttcgccgac gatgcagtag    121560
     tcgagctgtt cgccgcgctg gcgcagctcg tcgcagacga tcaccgttcc gtcgactgcc    121620
     ggcccctctt cgtcggaggt gatcagcagg gcgatcgaac ccgggtgttc ggggtgcacc    121680
     gccacgaact cctcggccgc caccacgaag gcggcgatcg agcttttcat gtcggcggca    121740
     cccctgccgt acaggaaccc gtcgcgctcg gtcggcacga aggggtcgct gtcccacttg    121800
     tcgcgcggac cgggcggcac cacgtcggta tggccggcga acaccgtcag gggcgcgccg    121860
     gcgccgcgtc gcgcccacag gttggtcacg ccgccgcgcg caatcgtttc gcattggaaa    121920
     ccgatgcgct ccaggcgctg cgccagcagc atctggcaat ccacatcgtc gggcgtgacc    121980
     gagggacggg cgatcagatc cttgaccaga tccagtacgg cagatgcggt catcaggccc    122040
     tcagcaggtc attgatgctg gtcttggcgc gggtctgcgc gtcgacgcgc ttgacgatca    122100
     ccgcgcaggc caggctgtgc gagccatcct cggacggcag cgagccggga accacgaccg    122160
     agcccgacgg cacgcggccg tacgaaacct tgccggtggc gcgatcgtag atcttggtgc    122220
     tttgcgacag gaacacgccc atcgccagca ccgagttctc ctcgaccacc acgccctcga    122280
     cgacttccga gcgcgcgccg atgaagcagt tgtcctcgat gatggtgggg ttggcctgca    122340
     gcggttcgag cacgccgccg atgcccacgc cgccggacag gtgcacgttc ttgccgatct    122400
     gcgcgcacga gcccacggtg gcccaggtat cgaccatggt gccttcatcg acataggcgc    122460
     cgatgttgac gtaggagggc atcagcacca cgttgcgggc gatgaaagcg ccgcggcgcg    122520
     ccacggccgg cggcaccacg cggtagccgc cggccttgaa cgcggcttcg ccgtagccgg    122580
     cgaacttggt cggcaccttg tcgtagaact gcagcgggcc ctggcccatg acggcattgt    122640
     cgtgcagccg gaacgacagc agcacggcct tcttgatcca ttggtgcacg atccattgat    122700
     cgtcgatttt ttcggccacg cgcaggcggc ccagatccaa tccgtcgatc gtgtgttcga    122760
     cggcatcgcg cacttcggcg ctcgcgtcga cgggcgacag gttggcccgg ttttcccagg    122820
     cttgttcgat ggtggtctgc aggtcgagag tcatgacggc tcagctattc cagggttgat    122880
     caaatggagg ttcttgcaaa atgggcgatg cgctcggcgg cctgtacgca ttggtccagt    122940
     ggcgccacca gcgcgatccg tatgcggcct tggccggggt tggcattgtg cgcttcgcgc    123000
     gccagcaggc tgcccggcag caccgtgacg ccggtacggc catagagctc gcgcgcaaac    123060
     gccgtatccg agccgggcgt gcccgcccac aggtagaacg aagcctgtgg cgcgcgcaca    123120
     tccagtacgt tctgcaggat gggcagcacg gcttcgaact tggcgcgata ctggcgccgg    123180
     ttttcctgca catgcgtctc atcggaccac gcagcgatgc tggcggccga aacaaccggg    123240
     ctcatggcgc tgccatggta ggtgcggtac agcaggaagc gcgccagcag cgcggcgtcg    123300
     ccggccacga accccgaacg catgccgggc acgttcgaac gcttggacag gctggagaac    123360
     gccaccaggt tcgtgtagcg atcgcgcccc aggcggcgcg ccgcctgcag gctgcccagc    123420
     gggggggtat cctcgtccag atagatttcc gagtagcact cgtacgcggc gatcacgaaa    123480
     ccatggcgat cggacagctc gaacagggtg cgccattctt ccaggctcat cacgttgccg    123540
     gcgggattgc ccggcgaaca cacgaacacc agttgggtcc tgcgccagac ctcgtcgggc    123600
     acgcgcccag tcgcagccga aatcgcgtgc cgggtcggcg ttgacgtaat agggggtggc    123660
     gccggccagc agggccgcgc cctcgtagat ctggtagaac ggattgggac acaccaccag    123720
     cgcgccggcc gagggatcga tgacggtctg ggcgaaggcg aacaacgcct cgcgcgagcc    123780
     cagcaccggc agcacttcgc tctcgggatc gggcgcggga atgctgtagc ggcgcgacag    123840
     ccattgcgag atcgcctggc gcagggccgg ctcgcccttg gtcgacggat agaccgacag    123900
     gcccgccagg ttggcggcaa tggcctggcc tacacaggcc ggagccgcgt gcttgggctc    123960
     gccgatcgac aggttgatgg gaggcaggtc gtgcgtcggc ttaccagcgt ccgctagcaa    124020
     ggcccgcaat ttttcaaaag gataaggatg caaggcatcg aggcgcggat tcatggggca    124080
     tgattttaac aagcaagcta caatagcggg cttggctttg cgaaggtggc gaaattggta    124140
     gacgcaccag gtttaggtcc tgacgccgta acaggtgtgc gggttcgagt cccgcccttc    124200
     gcaccaactc attgacaccc gttgatcgct attatcaatt ctttttgaat caacgggttg    124260
     gccggcacct tcccctgcct ttctggccgc gcggcgcgct tgcccggtgt cgcatccatc    124320
     gccgcttccc ccatccgtaa aaagaactgc cgtcatccct tgtggggatg gcggcagttc    124380
     gactgcgcac gcgaacgccg gccggggggg gggccggccg atgctcagtt gcggggcggg    124440
     tagtcgagtt cgccgaaggt gtattggccg ctggccttgg cctgggccag ttctgccttg    124500
     acctggtcgc ggctcggggc ggcggtgctg ccggtctgcg cggcgggata ttccagctcg    124560
     ccaaacgtgt attggccgtt ggccttggct tgcgccagtt cggcctgcac ctgggcgcgg    124620
     gtcggcgcat tggcgtcggt ctggccgtag acgccctggt agggcaggtt gttgggttcg    124680
     gcgttgggcg cggcctgggc gcctgcgctc agcgggccga gcgacagcat cagggcggta    124740
     gcaagggttt tcatggcaat tcctccggtt cacttggatg tgggactccg gacacggcgg    124800
     gctttctgtt ccgtcgtagt tcgttgtttc gtttcccaat ggccgaattg tgcgcgctcg    124860
     tgacatccgg ataaaccctg gtttttggta aagattattc catttttagg cctaatttct    124920
     tggaataaac cagatcattg catgaatgta atgatcgact agggcaggac gacgacttgc    124980
     ggggagcggg cgagccacgg ccacgggcag gcgatttcgc gatctgggcc ggaattgccc    125040
     tggtttccgt ccctttggcg gctggcttac tttttaaaat tcgattttgt attttatatc    125100
     gaaaatattt cgagttttga caaggcggca cctgcaatga aaccgacttc catcctggca    125160
     cgtttgcccc gctatctcgg cgcctgcgcg ctggccgcgc tggccgcgct ggctgtcgcg    125220
     ccgctcgcgc cggcgcaggc acagactccg ctgcccgcgg gactcggcgc cgccgaggtg    125280
     cggcagtatt tgtccggcct gccgtccgat gccctgcgcc agcaggcgtc gtggctggcg    125340
     ccggcgctgt tgcgccccta tctgtcaggc ctgacggatg cgcaattgcg gcaatatgtg    125400
     caggcgctga cacccgggca gatcacgcag gggctggcgg cgttgacgcc tgcgcagcgt    125460
     gcgcggctgc agcgcgaatt cgaacggcag gcgcgccggc aggtgcagca ggcggtacgg    125520
     gccgaggtcg ccgcgcgcag cgcgcgggcg gtggcgatgg ggcagagcgc atcgatgctg    125580
     ctgctcgacg ccgagatggg aaccctggcg caacgccagg gcgatctgcg ccgcggccac    125640
     gacgagggcg ccttctgggc gcgcggcagc gcgaaccgct tcaaggtcga tacgccggac    125700
     acaccggcgt tcgacctgcg cgtggagtac ctgacgctgg gcgccgacca tggctggcgc    125760
     ctggacacgg ggcggctcta tctgggcgcc tacgccggcg tctcgcgcgc ccgcatggat    125820
     gacaacgaca tcatgcacgg ccggatcgaa agccggttcc tgggcacgta cctgacttat    125880
     gtggacaacg gcgggttcta cgtcgatgcg gtcagcaagc tggggcgtat cgacgagtcc    125940
     gtgtcgttcg acctgccgct ggggctgggc gactacgacg acgatatatc gcatacaacg    126000
     tatacgggca gtgccgaggc cggctatcac ttcaagttgc cgcaacgctg gttcgtcgag    126060
     ccgcaggcgc aggtgatcta ctcgcgcagc agccagacgt cggtgcaggg gcgggccggc    126120
     gtgcgcgccg gccgggattt caccctggcc ggcggcgcga ccttgcgtcc ttatgtcagc    126180
     gcctcgtacc tgcacgagtt ctcgcacgac gactcggtcg atttcggcgg caagtcgtac    126240
     gatgccgaac tgcccggcag ccgctggcag ctgggtgccg gcgcggcgct ggacgtgggg    126300
     gcgcatcgcg cctacgcgga tctgcgctat gggcacggcg ccaacatcag ccaggacctg    126360
     tcgctgaaca tcggctacgc gtaccgcttc tagcgcgccg ggccgcgccg cggggccgcc    126420
     tataatggcg gcccgttggt cttcccaggc gtccgccttt cgatctcatg gtctacgagg    126480
     attttttctg gttcatggcc gcgctggtgg cgttggccct ggtcggtggc gcgctgttcg    126540
     gacgcctggg ccggcttgcc cacagcgtca tcgcgatgct gggcctggcg atcgcggtcg    126600
     gcgtggcggt gctgctgggc gcgcgaggcg aggacgtggg cccctacgcg cccctgctgg    126660
     cgatcgccgc gttcatgttc tgcctgatga tcggcggcgc ggcaacactg gttacgcgcc    126720
     gcgtaaggcg gcgccatctg acgcactgag cgcgccatcg ggcgcgccgg ctttttcttg    126780
     gacaatcatc atggatattt ccagccacct gcttgccgaa ctcgccaatg gcgtttgcct    126840
     ggaaacccgc gtggatggcc agaccatcgg cacctatgtg gtgctggggc ctgccgatct    126900
     ggacgccatc gcggacatcg tgccgcgcca gcgcgtggag gagggggccg acattcacgc    126960
     ggcggcggtc gacagcgtcg acggggcgca aatggagatc gatcaggtca tcgagaatat    127020
     gaatcccggc gacgtcgcgg tgttcttctg cgccgacggc gactgctatg gcgccgcgct    127080
     ggacctgctg ggcttgccgg tcgacgagta gccgccgcag gcgggccgag ggtcatgcgc    127140
     acaccttata agcacattac cgagacgcaa atatttgcgc aaaaaataag catcgtggca    127200
     cggcagttgc tctttgttgc aatattggca cgcgtttttt aggattatgt tgacttgtga    127260
     ggggaacctg acgatagtgt cggcacacac gaaatcaagc gttgcaatgt ttgttcagtg    127320
     ccgtgccttc tccggcgtcc gcgttattgt tctactgccc ctccttgatt gattcgtggt    127380
     cccgggtctc ggcccattaa tttctaggaa atacagtatg gaaaccggcg tcgttaagtg    127440
     gttcaacgcg gaaaaaggtt atggcttcat caccccggaa gcgggcggca aggatttgtt    127500
     cgcgcacttc tcggaaatcc aggccaatgg cttcaagtcg ttggaagaga atcagcgcgt    127560
     cagcttcgtg acggcgatgg gcccgaaggg tcctcaggcg acgaagatcc agattctgta    127620
     agaatctgag cgcgtccata aaagcccccg ccagggggct ttttcattgc ttggcccaag    127680
     cggccaattc cgcaggagca cgacatgtcc gattcgatgg ccggcccggc agccttgccc    127740
     gatgcggcga ccgttctcgc gttctggcgc gaggcgggac ccgcccgctg gtatgccaag    127800
     gacgagcaat tcgaccgtac gttcaccatg cgtttcgaag ccgcgcacat ggcggcggcg    127860
     cgcggggaat tgatggcctg gtccgccagc gccgagggga tgctggcatt gctgattctg    127920
     ctggatcaat tcccgcgtaa cgcctatcgc ggtaccggcc atatgtttgc caccgacggg    127980
     ctggcgcggc agatctgcga gcaggcgatc gcggccgggc tggaccggca ggggccggaa    128040
     gatttgcggc agttctatta catgccgctc gaacatgccg aagatttggc ggcccaggaa    128100
     cagtgtgtaa gcctgatggc gccgctgcac gccgaaacct tgcgttgggc ggaaatccac    128160
     cgcgatatta ttgctcgctt tgggcgtttc ccgcatcgaa atactgtctt gggccgcgcc    128220
     acgaccgccg aggaacagca gtttctggac cagggcggat tttccggctg agggcttcgc    128280
     atattcagtc gtgatgctga aaaaccgcgt tttctggccg agttccccca attttgtatg    128340
     ctgttgtaac gtcgctttct ggcgtggaat tttccgcttt cggcgggctt gccgggctgg    128400
     ccgcaagcgc acgttcatgc gcgcggggaa ggccgcgatc cggtgcgtaa ggccgattga    128460
     cctgtcgggg catcactcct acactgaact ggcgagatct tcaagcgacg cggtgtcttg    128520
     tgttctggtc gccgtagctc cgtttagcgg ggtcaatgcc atccttgatt atctggcgcc    128580
     ccgagcaacc gctctaaaca ggttcaagga catttcatgg caaccggtat cgtcaagtgg    128640
     ttcaatgccg aaaagggcta tggattcatc atgcccgatg acggcagtaa agatcttttt    128700
     gcacattatt ccgagatctg cagcgagggc tacaaatcgc tgcaggagaa tcagcgcgta    128760
     tccttcgagg tgggacaagg gcccaagggc ccaaggggcc aagcgccaag aacataaaag    128820
     tcatcgcctg acggccccgt tgtcgccgcg gccggcgcag ttccggcggg ccgcatgaaa    128880
     aaagccccat tgcctcgcgg cagtggggct ttttgttgcg cgccgtattc agtgcgacgg    128940
     atgggcgccg tgcccgacgg actggctggt caggcggtcg acatacgcga tgccgatcgc    129000
     cgacaggatg aagaccacgt ggatgatggt ctgccacatc acgccggttt cggtgaagcg    129060
     ggaattgggc gagcccaggt tgctcgcctc gatgaaggtg cgcagcaggt ggatcgacga    129120
     gatgccgatg atggccatgg ccagcttgac cttgagcacg ctggcgttga cgtggctgag    129180
     ccattccggc tggtcggggt ggtcttccag gcgcaggcgc gagacgaagg tttcgtagcc    129240
     gccgacgatg accatcacga gcaggttgga gatcatgacc acgtcgatca ggcccagcac    129300
     gatgagcatg atttcctgct cgccgaagga cagggtgtgg gtgaccaggt gccacaactc    129360
     cttcaggaag agcaggacgt atacgccctg ggcgacgatc aggcccaggt agagcggcag    129420
     ttgcagccag cgcgaactga agatcagcgc gggcagcggg ccgaggcggg gttcttggat    129480
     gggatgcatg ggaggtttgc gagccatggt tgtgtggaga attcgggcgg gcgaaattct    129540
     accgtccccg gatgcgccgt gcgcggcccg tcgcggctgc tcgccgggcg cttcccgggg    129600
     cgctccggtc cccggcgagt ttccggtaaa atgacctgtt tatccgctat atcatctccc    129660
     tctttctcgg aaaataggtc tcttaatgca gcctgtggtt gaaaccctct ccggcctgga    129720
     gcgccgtgtt gatctggccg tctcggtcgc cgaagtcgaa aaggaagtcc aggcgcaatt    129780
     gaagcgcgtg ggccgcacgg ccaaggtcgc cggctttcgt cccggcaagg cgccgctggc    129840
     gatgctcgag cgcagccatg gccccggcat ccgctacgac gtgatcaaca gtctggtcgg    129900
     ccgcgctttc gaacaagccg tcgacggcgc caagctgcgc gtcgccggtt cgcccaccct    129960
     cactcccaag accgaaggcg tcgccgagga cacgctggcg ttcaccgcca cgttcgaggt    130020
     gtacccggaa gtcaccgtgc cggacctgtc ggcgctggcc gtcacccgtt acgacacccc    130080
     ggtcaccgac gccgaagtca accagacgct cgacgtgctg cgcaagcaac gcgccaagtt    130140
     cgaaatccgc gaaggccgcg cctcgcagga cggcgaccgc gtcgtgctgg actttgccgg    130200
     cacgatcgac ggcgtgccct tcgaaggcgg caaggccgag gacttcccgt tcgtgctggg    130260
     ccagggccgc atgctgcccg aattcgagga agccgcgctc ggcctgaagg ccggcgagag    130320
     caaggtgttc ccgctcaagt tccctgacga ctaccagggc aaggaagtcg ccggcaagac    130380
     ggccgagttc accatcaccg tcaaggaagt cgccgaaggc gtgctgcccg aggtcgatgc    130440
     cgaattcgcc aagtcgctcg gccaggccga aggcgatgtc gaaaagctga aggccgacat    130500
     ccggaccaac atcgaacgcg aagtcaaggc gcgcctgcaa ggccgcacca agggcagcgt    130560
     gatggatgcg ctggtcgagg ccggcaagtt cgacgtgccc aaggcgctgg tcgacagcga    130620
     cgtggaaggc cgtatcgccg ctgcccgcga agagctcaag cagcgcggcg tgcccaatgc    130680
     cgattccgtg ccgatgccgg ccgaggtgtt ctcgaccgag tccgagcgcc gtgtgcgcct    130740
     ggggctgctg gtctccgaac tggtcaagca ggcccagctg caggccaagc ccgagcaggt    130800
     gcgcgcgcgc atcgaggagt tcgcgcagaa ttacgaacag ccggcccagg tcgtcagcta    130860
     ctacctggcc gaccgccagc gccgcgctga aatcgaggcg atcgtgctcg aggataacgt    130920
     ggtcgcccac gtgctcgaga acgccaaggt cgccgacgag aaggtgcctt ttgatcagtt    130980
     gatggggatg gcataaccat gcagcgtttc accgatttct atgcggcaat gcacggcggg    131040
     tcgtcggtga cgcccaccgg cctgggctac atcccgatgg tcatcgagca atcgggccgg    131100
     ggcgagcgtg cctatgacat ttactcgcgg ctgttgcgtg agcgcctgat cttcctggtc    131160
     gggccggtca acgacaacac ggccaacctg gtcgtggccc agttgctgtt cctggaatcg    131220
     gagaaccccg acaaggacat ctcgttctac atcaactcgc ccggcgggtc ggtgtacgcg    131280
     ggcatggcca tctacgacac catgcagttc atcaagcccg atgtgtcgac gctgtgcacc    131340
     gggctggccg ccagcatggg cgcattcctg ctggcggcgg ggaagaaggg caagcggttc    131400
     acgctgccca attcccgcat catgattcac cagccctcgg gcggcgccca ggggcaggcc    131460
     agcgatatcc agatccaggc gcgcgaaatc ctggatctgc gcgagcgcct gaaccgcatc    131520
     ctggccgaga ataccggcca gccggtcgag cgcatcgcgg tagacaccga gcgtgacaac    131580
     ttcatgtccg ccgaagatgc ggtatcgtat ggtctggtgg acaaggttct gacctctcgc    131640
     gcgcagacct gatcggcgcg cttgcaggac cctggcactg ccgtcatgtt cgataagcgt    131700
     tgatcgcgcc ggccctcatc cggctggcgc gtcttcacca gagatacgaa acacttatgc    131760
     ctgaaaaaaa gggatcggca gacgcaaaag tgctgcattg ctcgttttgc aacaagagcc    131820
     agcacgaagt ccgcaagctg attgcaggtc cttcggtatt catctgtgat gagtgcatag    131880
     acctttgcaa cgacatcatc cgcgaggaag cgcaggctac cgcgcgcgct gccattcgct    131940
     ccgagctgcc caccccggcc gaaatcaaga cctttctcga ccagtacgtg attggccaga    132000
     ccagccccaa gcgcatgctg gcggtggcgg tctacaacca ctacaagcgt atccgccacg    132060
     gcgagatcaa gggcgacgaa gtcgagctct ccaagagcaa catcatgctg atcggcccga    132120
     ccgggtcggg caagacgctg ctggcgcaga cgctggcgcg catgctcaac gtgccgttcg    132180
     tcatggccga tgccacgacc ctgaccgagg ccggctacgt cggcgaggac gtcgagaaca    132240
     tcatccagaa gctgttgcag aactgcaact acgatgtcga gaaggcgcag cgcgccatca    132300
     tctacattga tgagatcgac aagatttcgc gcaagtccga caacccgtcg atcacccgcg    132360
     acgtatcggg cgagggcgtg cagcaggcgc tgctcaagct gatcgaaggc acggtcgctt    132420
     cggtgccccc gcagggcggc cgcaagcatc ccaaccagga cttcgtccag gtcgacacca    132480
     ccaacatcct gttcatcgtc ggcggcgcct tcgacggcct ggaaaaggtc atccgcgacc    132540
     gcaccgagaa atcgggcatc gggttttcgg cggcggtgcg cgccaagtcc gagcgcggcg    132600
     tgggtgagct cttcagcgag gccgagcccg aggacttgat caagttcggc ctgatccccg    132660
     aactggtcgg ccgcctgccc gtggtcgcca cgctggacga gctggacgag gccgtgctgg    132720
     tgcagatcct gaccgaaccc aagaacgcgc tggtcaagca gttccagaag ctgttcgcca    132780
     tggaaggcgc ggaactcgac gtgcgcccgg atgcgctgaa ggcgatctcc cgcaaggcgc    132840
     tcaagcgcaa gacgggggcg cgcggcctgc gctccatcct ggagggcgcg ctgctggaca    132900
     ccatgtatga cctgccgtcg caaggcaacg tcagccgcgt ggtgctcgag gccaatgccg    132960
     tcgagggcgt cggcaagccc ctgttgatct acgccgacga atccgaagcc gcctctggcg    133020
     agaaggccgg gcgtggcgag gtccgtgacg cggcggcttg atcttcgatc ccggccgcca    133080
     ttgcaagaaa acccgtttgt aacgggtttt tttgcatctt cccgctatct ggatgccgag    133140
     cgcttgaatt ttcggctatt gttcccatat cagacgtaac cgacgtggag acctgggtct    133200
     gcccttgccc cgtcccccat tacgccgagt cataccgagg aaccccccta tgtctgccag    133260
     tcagaccctg tcttccgacc cgattgacct gccgttgttg ccgctgcgcg atgttgtcgt    133320
     gtttccgcac atggttattc cgctgtttgt cggccgcccg cgctcgatcc gcgcgctgga    133380
     ggtggcgatg gaagcgggca agagcatcat gctggtggcg cagaagtccg ccggcaagga    133440
     tgacccgact cccgaggacg tctatgagat cggctgcgtg gcgagcatcc tgcagatgct    133500
     caagctgccc gacggcaccg tcaaggtgct ggtcgagggc acccagcgcg cccgcatcga    133560
     cagcatcgaa gacgtcgatt cgcatttcac ctgccaggtg acgccgatcg agcccgatac    133620
     cctgcagggt tcggagaccg aggcgctgcg ccgcgccatc gtcgcgcagt tcgagcagta    133680
     tgtgaagctg aacaagaaga ttccgcccga gatcctgacc tcgctggccg gtatcgacga    133740
     cgccggccgc ctggccgaca ccatcgccgc gcatctgccg ctcaagctgg agcagaaaca    133800
     gaagatgctc gaggtcgtcg tgaccgccga gcgcctggaa gggctgctga cccagctgga    133860
     aaccgagatc gacatcctgc aggtcgagaa gcggatccgc gggcgcgtca aaaagcagat    133920
     ggagaaaagc cagcgcgact actacttgaa tgagcaggtc aaggccattc agaaggagtt    133980
     gggcgaaggc gaggaaggcg ccgacatcga agagctcgag aagaagatca tcgccgcgca    134040
     tatgcccaag gaggcgcgca agaaggccga tggcgagctc aagaaactga agctgatgtc    134100
     gcccatgtcg gcggaagcga cggtggtgcg caactacatc gatacgctga tcaacctgcc    134160
     ctggaagaga aagagcaaga tcaacaactc gatcggcaat gccgagcggg tgctcgacga    134220
     cgaccactac gggctggaaa aggtcaagga acgcattctc gagtaccttg ccgtgcaaca    134280
     gcgcgtggac aaggtcaagg cgccgatcct gtgcctggtg ggccccccgg gcgtgggcaa    134340
     gacctcgctc ggccagtcga tcgccaaggc gaccaaccgc aagttcgtgc gcatggcgct    134400
     gggcggcgtg cgcgacgagg ccgagatccg tggccaccgc cgtacctata tcggttcgat    134460
     gccgggcaag atcctgcaga acatgtccaa ggtcggcgtg cgcaatccgt tgttcctgct    134520
     ggacgagatc gacaagctgg gcatggactt ctgtggcgat ccgtcgtcgg cgctgctcga    134580
     ggtgctggat ccggagcaga accacacgtt ccaggaccac tacatcgagg tcgacttcga    134640
     cctgtccgat gtgatgttcg tggccaccag caataccttg aacatcccgc cggccctgct    134700
     ggaccggatg gaagtgatcc gcctgtctgg ctacaccgag gaagagaaga tccacattgc    134760
     tcgcgaccac ttgctgccga agctgatgaa gaacaacggc gtcaaggaca acgagctgac    134820
     ggtggacgat tccgcgctgc gcgatatcgt gcgctactac acccgcgagg cgggcgtgcg    134880
     ggcgctggag cgcgaggtcg gcaagatctg tcgcaaggtc gtcaagcaac tgctgatcaa    134940
     gagcgatgaa gccaaggcgg ccgggaacaa gaccgccgag gcgcaaacgg tgctggtcaa    135000
     cggcgacaac ctcaacgatt tcctgggcgt gcgccgctat accttcggca tggccgaaaa    135060
     ggaaaaccag atcggccagg tgaccggcct tgcatggacc gaagtgggcg gcgatctgct    135120
     caccatcgaa gtcgcggaca tgcccggcaa gggcaatatc cagcgcaccg gttcgctggg    135180
     cgacgtcatg aaggagtcgg tcgaggccgc acgcaccgtg gtgcgttcgc gggcgcgccg    135240
     gctggggttc gccgacagcg tgttcgagaa gcacgacatg cacgtccacg tgcccgaggg    135300
     cgccacgccc aaggacggcc cgtcggcggg tatcgccatc accaccgcca tggtgtcggc    135360
     gctgtcgcgc attccggtgc gcgccgacgt cgccatgacg ggcgagatca cgctgcgcgg    135420
     cgaggtgttg cccatcggcg gcctgaagga aaagctgttg gccgcgcatc gtggcggtat    135480
     caagacggtg ctgattcccg aggagaacgt caaggatctg gccgagattc cggataacgt    135540
     gaagaacttc ctggagatcg ttccggtgcg ctggatcgac aaggtgctgg agcttgcgct    135600
     ggagcgcatg cccgagccgc tgtccgagga agaagccgtc aaggaagcca tcgtggccaa    135660
     gcccgcggag gccggcgccg ccgatccggt catgaagcac tgagccgacg ccggctcagg    135720
     ccagcgaccc gcaaaaccgg gcccggatca tccgggcccg gtttttttcg gctatccgcg    135780
     ggttcggcgg ttccagcctg gcaatgcgtg gccggcgggg gcgggttcag tcgtcgccga    135840
     agcaatgcag cgcgacttcg cgaaagcgct gcgccgcggc gctggatggc tcgggcagca    135900
     gcagggccag gccgatttcg gccgccggcg agacgtcggc gatggcccgg taggccacgc    135960
     gcgggctggg gttgtattgc atgaccgccg gcaccagcgc cacgcccagg ccgctttcga    136020
     ccagcgacag cacggtctgc acctgcgtgg cctcttgcgt gacccggggc aggaagccgg    136080
     cccgttggca ggccagcatg gccgtggcgt gcaggccggc ggcgtcttcg cgggaataga    136140
     acacgaacga ttcggtcgcc agttcttcca tcctgatgtc ggccttctgc gccagcggat    136200
     tgcccagcgg cagggccgcg acgaaatctt cggccagcag cggcgccagg tgcgagcgcg    136260
     acggcgtcaa cagcggcgtg cgcaccagcc cgacgtcgag atcgccgctg tcgacgcgct    136320
     cggcgatgcg caccgaggtg ccttccttca gcaccagctc gacgccagga tactcgacgc    136380
     ggaacagtcg cacgatgcgc tgcagcacgc cgttggtcgt ggagcccacg aagcccactt    136440
     tcagggcgcc gccggtgccc gaggaggcgg cgcgcgccgc cgccagcaac tgggcgttat    136500
     gaaacagcag ccggcgcgcc tcggccaggg ccgcatgccc gcctggggtg agcgagacgc    136560
     cgcccgagcc cccgcgctcg aacaggcggg tgccgagctc ggcctcgagt ttctggatgg    136620
     ccacggtcag cggcggctgg gtcatgtgca gccggtcggc ggcgcgccgg aaattcagcg    136680
     tctcgcccag ggtcacgaat tggcgtaccc gccgcaagtc cagcatgggg tcggcgggcg    136740
     cgtcgcccgc gccggccggt atggtcggat cggtcatggg agccccttcg gggtgggcga    136800
     tgcgtactca atatcacttt ggctgagttg atacctggat ggcatgcgag tagttcccgt    136860
     gatcagcaga aatcagcgga tagaagtgta gatcaccaga tatttgatat gcaacgtata    136920
     tcaaatttga ttgaaataat attagacttg gatgggatgc cgttcctaag atgagcgcca    136980
     acgaatcatg gaggcgacac agacatggac acggcgctcg gacacatcaa ggtcctggac    137040
     ttgacccgca tcctggccgg cccctgggcg acccagacgc tggcggacat gggcgcggag    137100
     gtggtcaagg tcgaacgccc gcgggtgggc gatgacaccc gcgcctgggg gccgccgttc    137160
     ctgaaggaca gcgaggggaa cgagaccgcc gattcgtcgt atttcctggc cgccaaccgc    137220
     ggcaagaaat ccatcacggt ggacctggcg cacccggacg gccaggccct gatccgcgac    137280
     ctggccgcca cggccgacgt ggtggtggaa aactacaagg tcgggaccct ggcgcgctac    137340
     ggcctggact acgaaagcct gaaagcgatc aacccccggc tggtgtattg ctcgattacg    137400
     ggcttcggcc aggacggtcc ctacgcctcg ctgccggact atgacttcgt cttccagggc    137460
     atgggcgggt tgatgagcat taccggccag ccggaaggca cgccgggcga cgagcccatg    137520
     aaggtcggca ttgccatcag cgacttgctg acgggcatgt atgccacgac cgccatcctg    137580
     gccgcgctgg agcgccggca cgtcagcggg acggggcagc atgtcgatat gtccttgctc    137640
     gattgcgtgg tcagcatcag ctcgtatcag gccatcaacc acttcctgtc gggcaagatt    137700
     ccgcggcgca tgggcaatgc ccactcgaac atggtgccgt accaggtatt ccgctgcaaa    137760
     gagggcgatg tcatcgtggc ggtgggcaac gatggccagt accgcgccct gtgcaagctg    137820
     atcgagcgcg acgacctggc cacggacgag cgctacgcca cgcccggaca gcgcaaccgc    137880
     aaccgcgaca cgctcattcc cgaaattgcc caggccatgc tggcgcgcac catgcaggag    137940
     tgggtcgcgc tcatggaagc cgccaatgtg ccttgcggcc ccatctacaa catgcagcag    138000
     atgttcgaag acccgcacgt gcagcatcgc ggcatgcgtt tgtcgttgcc gcacagcgcc    138060
     ggcgtgcagg cgcctgcggt ggccagcccc atacgcctgt ccgacacccc gatccagtac    138120
     ggccgctccg ccccgttgct gggcgagcac accgacagtg tgctggccca gcggcttggc    138180
     ctggcgccgg cgcgcattgc cgaattgcgg gcgcggggcg cgatctgagc ccgcgcgcca    138240
     tcgccgcgat ccggcggttt tcccgtgttt caccaaagaa aaaaggagac agtatgctgc    138300
     gacacacctt catccgcgcg gccctggcgg ccgcgttggc ggtctgcgcc gcgggcgcgc    138360
     acgcccaggc caaaccctcg tcgatccggc tggtggtgcc ttacccggcg ggcggcgccg    138420
     ccgatcagat tgcccggctg gtggccaacg atgccggcgc catcctgggc acgcccatcg    138480
     tcatcgagaa caagggcggc gcgggcggaa tgatcgccgc cgaatccgtc ctgcaggcgg    138540
     cgccggacgg cgcgaccttc ttcgtgggct ccaacgcacc catcgtcatc aatcaggcca    138600
     tctatgaaaa gatgtcctat gaccccgcca aggatttcgt tcccgtcgcc ggcatgggca    138660
     aggcgccgct cctgctggtg acgcgcaagg acctgggcac cgccgacgtg aaggccctgg    138720
     ccgagctggg caagcgcgag gccggcaagc tgaccatggg ctcggccagc agcggcaaca    138780
     tcacccacct ggcgggcgag tacgccgcca gccagatggg cttcaaggtg acgcacgtgc    138840
     cgttcaaggg cagcgcgccc gccatcacca gcctgatggg cgggaacatc gacatcatgt    138900
     tcgacgcctt gccgtcgtgc atggcccagg ccgagtcggg ccgcatcgtg ccgctggcga    138960
     tcctggacga tcagcgcttt ccgcagctgc gcgacgtgcc caccgcgaag gaactgggtt    139020
     attccggcct ggaggccgcg gcgtggttcg gcgtgatggc gtgcgccggc acgcccgatt    139080
     cgtccatcgg cgcgatgaac aaggcgatca accaggcact gcaaaagcag gaactgatcg    139140
     acaagctgcg ccgcatcggt gcgcagccca tgccgggctc gcagcaggat ttcgcccgct    139200
     tcatcgatgc cgagcgcaaa cagtgggtgc cgttggccaa gtcgctcggc gtacgggcgg    139260
     attgatgcca tgaaaaaatc agcttcgatt ccatcgcggc cctcaaggcc tttgccggac    139320
     agccggcggc cgtgggccag cccatcgtcg tcgatcagtc cgccatcgat acgttcggcg    139380
     acgtcgtgca cgacaggcag tggatccatg tggacccggt ccgggccgcc gccgagtcgc    139440
     cgttcggcac caccattgcc cacggcttgc tcacgctttc gttgatcacg gggtggtacc    139500
     accagctgtt cgagtttccc ggccgcaagc tggcgctgaa ctacggcttc gacaaggtgc    139560
     ggtttcccgc gccggtgccc agcggttcgg ccctggtcgg cagcttccgg ttggcgcggg    139620
     tcgacgagct ggggccggac gaagcgcggt gcctgtggga ggtcgacgtg cgcgtggcgg    139680
     gcgccgagcg gccggcgatg gtggccgagt ggctgatgca actgcgttat tgagcgcgcg    139740
     gcgggagtga tcatgtctgt actggaaatt tcccgcgtcg gcgcctgcgc cgtgctgacc    139800
     ttgaaccggc cggccgcgcg caacgcgctc gacatggatt tgcgcaacgc cctggccaag    139860
     gcgctgcccg agatccgcga cgatgcgacg gtgcgcgcgg tggtgctgac cggcgccggc    139920
     gggcattttt gcgccggcgg cgatatccgc gcgattgcgg ccgggcaggg caatgccgac    139980
     gtcttcgaag gccgcaaccg catcctgagc atgcagcgct ggttcgacgg cctggtggac    140040
     ctggagaaac cggtcattgc cgccgtcgac ggcgtggcct tcggcgcggg cctgtcgttg    140100
     gcgctggccg ccgatttcgt cctggcctcg ccacgcgcga ccttctgcgc cgtgttcgcg    140160
     cgtctggggt atgtgccgga cctgggcggc atgtatttgc tgccacgggc ggtgggcctg    140220
     gcgcgcgcca aggcgctggc attttcggcc cgggtggtgg gcgcgcccga ggcgctggag    140280
     atgggtatcg cgcaccagtt ggtcgacgac cggccggtgc tcgatgccgc cctcgagctg    140340
     gccgggcgct tcgagcaggc gccggcgggc gcgctgggca tcgtcaagtc ggtgatgaac    140400
     cacgcgttcg agtccgaccg ccgtaccgtt tacatgcagg aagcgctggc gcaggcgctg    140460
     tgccgcgaaa gcgcttttca tcaagaggcg gcgcgtcgtt tcctcgacaa gcaggcgccg    140520
     ctgtaccaat ggccccagga gcaacaatga ccgagcatcc ccaagccgca tccgcgctgc    140580
     tgccgcagca ggagtatttc gcgcatctgg ccgacggccg cttcatgatc cagcgttcgc    140640
     gcagcagcgg cgaatacgtg ttctacccgc gcgtggccgc gccgcgcacc ggcgcgcagg    140700
     acctggagtg ggtggcggcc tcgggccggg gcacggtcta tgccaccacg gtcatgcggg    140760
     tgcgcccgcc ggccgcgcct tacaacgtct gcctggtcga actcgaggaa ggcccgcgca    140820
     tgatgagccg cgtcgagggc atcgggcccg aggacgtgca ggtcgggatg gcggtgcgcg    140880
     cgcgcatcat ccgcgacgac gccggcgagc cgctggtggt attcgaaccg gccggcccgt    140940
     ccgatgccgg catcggccag gggagggcgg cacaatgatc caggagcgct ttccgcgcgg    141000
     caagaccgcg atcgtggctt gcgccaccta tggcatcggc gagtcgccgg gtctgtcgtc    141060
     gctggacctg gcggtgcgcg ccagcgtgca ggcgctcgac agcgtgggct tgacgcccgc    141120
     cgatgtcgat ggcctgttca tcggcctgcc cgacgatttc gtgtcgggcc tgagtttcac    141180
     ggagtacctc ggcatctcgc cgcgcctgac cgacaacaac cgcaccggcg gttcgtcctt    141240
     cctgacccac gcgattcacg ccgccctggc gctggaggcg ggcctgtgcg acgtggcgct    141300
     catcgcgtac ggcagcaacc agcgcagcgg ggcgggcaag ctggtcagct cgatgcgtcc    141360
     atctccctac gagggggcat acaagctggc gcgcccggtg ggggcatacg cgctggcggc    141420
     gtcgcgctac gcggcccagt atggactgca gaaagagcag ctgggcgccg tggcgctggc    141480
     ggcgcggcag tgggcgcaga agaatcccga ggcctacatg cgcgccccgc tgaccatgga    141540
     cgaatgcctg gcgtcgcgcc tggtatgcga cccgttctcg gtgcgcgact gctgcctggt    141600
     caccgatggc gccgccgccg tggtgatggt gcgcgccgat cgcgcccggg acctggcggc    141660
     gcggccggcc tatctgctgg gcggggccgc cgcggcctgg cacaaggaca tcaccaacat    141720
     gccggacctg acggtgaccg ccgcctcgct cagcggcccg cgcgccatgg cgcaggcggg    141780
     cgtgacgccg gccgacatcg acgtgctgga gctctacgac gccttcaccc tgaacaccat    141840
     cctgtttctc gaagacctgg gcttctgcgc caagggcgag ggcggcgcct tcgtcgagga    141900
     cggccgcatc gcgcccggag gggcgctgcc cgtcaatacc aacggcggcg ggctgtcgtg    141960
     cgtgcatccc ggcatgtatg gcctgttcac gatggtggag gcggcccagc agttggccgg    142020
     cgcggccggc gaacgccagg ttgcgcaggc ccggctggcg ctggcgcacg gcaacggcgg    142080
     cgagctctcc agccaggcca cgctgatact gggcaccgag gaaacgatct gagcactcat    142140
     gaagtagaca gccatgcagg acaaactttt gacgctggag aaccgccagg tcatcgtgac    142200
     cggggcgggg cagggcatcg gacgggcgct tgccagcgcc atcgcgggac tgggtggtcg    142260
     cgtcgtggcg gtcgacctga acgccgacgc gctggctgcc ctgcgcgagg cgctgggcca    142320
     cgaacgctgc gtcacggtgg ccggcaacgt ggccgatcca tcgctggcgc agcaggcggt    142380
     ggatgcgggc gtgacggcct ttggcggcgt caacgggctg gtcaacaacg ccggcgtgac    142440
     ccgtaccgcc atgatcgaca agatgtcgat cagcgactgg cagcaggtca tcgacgtgca    142500
     tctgtccggg tcgttctatt tcctgcaggc gctgggcagg catttgctgg gccgcgccaa    142560
     ggcgggcggc gatggcgcgg gggcgatcgt gaacatttct tccgacgccg gccggcgcgg    142620
     caccatcgga cagatcaact acggcgccgc caaggccggg gtgctgggcc tgaccatgtg    142680
     cgcggcgcgc gaatgggccc ggtacggcat ccggaccaat accgtcggtt tcggcgtcgt    142740
     cgagacgccc atgaccgaga ccatacgcgg cgagaaattt cgcgacacgt atctcagcca    142800
     gattccgttg ggccgttggg gcgaggccga tgaggtggtg cgccccgtgt gcttcctgct    142860
     ttcggacgcg gattcctacg tgaccggaca gcacctgtcg gtcaacggcg gctacaccat    142920
     cggactgtga tcgtgagcgc actgatagac cgattcgaac tcgccgaact gccggcgcgg    142980
     gcgcaggcgt ttcgccagga cgtccaggcc tttctcaagg ccgaattgcc gccgctgccg    143040
     gccgaccggc gcgcgcgttc gtggatgggc tttgacgccg gcttcagccg caagctggcg    143100
     gcgcgcggct gggtcggcgt gacgttgccg cgcgcgtatg gcggcgccga gatggacgcg    143160
     ttctcgcgct tcgtcctgat cgaggagctg ctgtgcgccg gggcgccggt gtcggcccac    143220
     tggatcgccg atcggcaaag cggtccccag atccgcaagt tcggcagcga ggcgcagcgc    143280
     agcttctatc tgccgcgcat ttgccgcggc gaagccttct tctgcatcgg catgagcgaa    143340
     ccgaattccg gctcggacct ggccagcgtg gggacgcggg ccacgcgccg tgcagacggc    143400
     ggctggacgc tttcggggcg caagatctgg accaccaacg cccagcattg ccattacatg    143460
     atcgcgctgg tgcgcacctc cggcacgccg caggaccgca atcagggcct gtcgcaattc    143520
     attgtcgatc tgtcgttgcc cggtgtcacg gtacggccga tctccgacct ggcgggcgac    143580
     gcgcattttt cggaagtgtt tttcgacgat gtgcagctgt ccgacgaggc gctcattggc    143640
     caggagggca gtggctggga acaggtcacc gccgagctgg cattcgagcg cagcggcccc    143700
     gagcgcattt attccagcat ggtgctgctg gacgggtgga tccaatggct gcgcggccgt    143760
     ggcgacgtct cgcagacggc ggcggtcggc cgttacgcca cccacctggc ggcgttgcgc    143820
     aatttgtcgc tgtcggtggc ttgccgccgg cgagagcccg gtcgtggagg ccgccctggt    143880
     caaggaactg ggcaccacct tcgaacagga aataccggct gccatcgagg cggcgctggg    143940
     ctcggatccg ggcgccgata tcgacgccga attgctgcgc acctgcgcct atgtgaacca    144000
     ggtgtgtccc acttactcgc tgcggggcgg cacgcgcgag atcctgcgcg gcatgatcgc    144060
     gcgcggcctg ggcctgcgtt gaaggcgatg gagcagaacc gcaatgtata gcgacgcttt    144120
     tgaagatttg ctgaagggcc ggtgcgagcc ggcggtggtg cgcgccatcg aggccggcgg    144180
     cgatgtccag gccctgtgga atgccatcgt gcaatcaggt ttcctggatc tcatggcgcc    144240
     cgagcaggcc ggcggcgccg cggccgatct ggccgacgcc ttgcccttgt tcacggcgct    144300
     gggcgcttat gcggtgccgc ttccggtgga ccaggcgatt gcgctgcgca cgctgctgcc    144360
     ggccagcatg gaggtgcccg gcggactgcc cagcttcgcg cccgttttgc gtaccgggcc    144420
     ggacggagcg ctgcgcgcgc cgcgcgtgcc ctacggcatg ctggcggggc cggtgctggg    144480
     cgagctggat ggcgcgctgt gcctgctgga tgcgcgggcg gcgcagcggc gcgactgcgg    144540
     cctgcatggc gagccgaccg ccgacctgag ctgggacgcc ggcgtgcgcc aggatgccgt    144600
     gcgccggctc gatgacgcgg gcggcgcgcc tggccgtctg gcggcctggg ggcggcgctg    144660
     catgccgcgc tgctgacggg cgcgatgact cgctgcttcg agatgagcct gcagtatggc    144720
     aacgaccgca cgcagttcgg ccgctccatc ggcaagttcc aggccgttca gcatcagttg    144780
     gcggtcatgg ccgagcatgt cgccgccgcg cgtatcgcca cggcagccgc gtttcgcgcc    144840
     ggcctggcgc aaccggccct gctgccggcg gccatcgcca aggcgcgcgc cagcgaagcc    144900
     gcggccctgg cggcgaacac cgcgcatgcc gtgcacggcg ccatcggcgt aaccgaggaa    144960
     tacgacctgc agctctacac gcgccggctg catggctggc ggctggcgca cggctcggaa    145020
     gcctattggc accaagtggt cggcgcggca ttgatgggta gcggggacgg ggcggtgcag    145080
     ttcgtgcgcg ggctatgacc gccggcacat caacgcattt caaccaggta aacggggtag    145140
     gcatgctcaa caagacctgc gagtccgccg acgaggcggt cagtgtcgtg gaaagtggcg    145200
     caacaatcct gatcagcggc ttcggggaca tcggcttgcc gttcgaactg ttgcatgcgc    145260
     tggcgcgcac ctcggtcaag gatctcacca tcgtctccaa caatgccggg acgggcgaac    145320
     tggggttgtc gcggctgttc aggaaccgcc aggtttcgcg cctgatcgct tcttttccgt    145380
     cgcagccgga ttcgcaccat tatttcgccg cgtaccagga aggactggtg gacctggagc    145440
     tggtgccgca gggcacgctg gccgaacgca tccgcgcggc gggcgccggc ctggccgggt    145500
     tcttcacgcc caccggctac ggcaccgagc tggcgcaggg caaggagtgc cggatgttca    145560
     agggcaaggg atatgtcttc gaggaagccc tgccaggcga tttcgccttc atcaaggcgc    145620
     acgtcgccga tgcctacggc aacttccggt atcgccgcgc cagccggact ttcaatccca    145680
     tcatggccat ggcggcgcgc acgaccatcg ccgaggccaa gcagatggtt cccgtcggca    145740
     gtatcgatcc cgacgacgtc catacgcccg gcgtattcgt cgaccggata gtggaggtgc    145800
     gagatgagta agggttggtc gaatgatgag atcgccgccc ggatagcggt ggatttgccc    145860
     gaacatgcca tcgtcaacct gggaatcggc ttgcccatcc tggttgccaa ccatataccg    145920
     gaaggcaaga ccattttctt ccactcggag aacggcatca tcggcctcgg tccggtgccc    145980
     gcgcccgggc aggaagaccc ggacatcgtc aatgccgcca agaagcacgc cacgctcatc    146040
     gcgggcgctt ccatcgtgca ccatgcggac tcgttttcgc tgatccgcgg cgggcggctg    146100
     gactactccg tccttggcgg gctgcaggtg tcctcgggcg gggacatcgc caactggaag    146160
     gtgccggggc aaaagggcgg cggtggcgtg ggcggggcaa tggatctggc ggtgggggcc    146220
     aggaatgtcc tggtcatgat gcgccaccag gacaagacag gcgcctcgaa gctggtcaag    146280
     tcgtgcacgt ttccgctgac ggccgtcagc gccgtcacgc gcgtctatac ggaactgggg    146340
     atattcgaat gcgcgggcga tgccttcatc gtacgcgaat cggcgccagg gatcggcaag    146400
     gacgaactgc tgcggaaaac ggaagccgcg ctgacgtttc cgtagtggcg gacaaacagg    146460
     ataacaagga ggataagccg tgaagaccaa gatcaaaatc gtgacgctgg ccctgtgtgc    146520
     attttcctcg gcggtgttcg cgtcgtcgtt tcccagcaag ccgatcaacc tgatcgttcc    146580
     ctacccgccg ggcggcgccg tcgatcccat cgcgcgtctt tacgccgaga agatttccca    146640
     gagctggggc gtcccggtga tcgtcctgaa tcgcccgggc gccggcacga cgatcggcct    146700
     gaaccaggcc gccagggccg agccggatgg ctataccgtc gtcctcggca cggccagcat    146760
     taccagcaac gcgccgctgt accgttcgct gccctacgac acgctcaagg atttcaccta    146820
     cctcagcatg gcgggaatga ttccgctggc gatcacggcc aaccctcgca cggccgtcaa    146880
     cagcatggac gagctcgtcg gtcagctcaa gaagaagccg ggctcgctga cctattcgtc    146940
     gtcgggcaac ggaacgatca tccacctggg cggcgagctg ttcaaatcgc tcgcgggcgt    147000
     cgacatggtg catgtgccct acaagggcag cggcccctcg gtcatggccg gcgtggcggg    147060
     cgaggtcgac ctgacgttcg actccgtctt cctgatggac ccgcaggtca aggcgggcaa    147120
     gctgaagtac atcgcggtgg caagcgagaa acggctgaag tcgctacccg aggtgcctgc    147180
     catcggtgaa agtatcctgg ttatttcgtg acgtcgtggg tcgggttcat gggaccggcc    147240
     ggcattcccg cggatatcac ggcggcctgg gccaaggaaa tcgcccgcgt ggctgccttg    147300
     ccggatgtca gcgaaaaact ggctaccctg ggcgtcgaat cggtatccag cacgccgcag    147360
     cagttctccg ctttcgtcga gagtgaaatc aggaagtggg agaaggtggt gcaggacgcg    147420
     cacattcccc cggtacagta agcgcgcgag ccttcagcgc ggcgtggccg gcggccacgt    147480
     tgtattgccc caccgatctt cgggattggt actacatcat gtagttgttg gtggatagga    147540
     aaaatcaaca tcagggagat ctgaccactg gctttcaggg gatgtggcgt tggcgagact    147600
     acgcccacgc cgcactgttc ggccgggtgg cggcgagatc gtgatgcacc cggcgcatag    147660
     caatcctgcg gcggctgcgc ttcttgccgg cggtgctgca tggatgtcac cccccttcta    147720
     cccatgctct cagactcatc tatctcatgc aaatcccgat cccgatcaat ggctctggca    147780
     cggcggcgcc tggcttggcc cggcgtatgc ggcgcattgt cgctggcggc ctggctggcg    147840
     ccggcgcagg cccagagtgc catggctgcg tccgggccgc aggatgcgcc cgccgtcagc    147900
     atacccgtgt tagatgtgaa gattcaatag gttgtatgca tggttcatcc gaaccggatt    147960
     tgagaaactg gaaatcgcca cccccccagt tcactcaagg agcccggccg gatgaacacc    148020
     cataagcatg cccgattgac cttcctacgt cgactcgaaa tggtccagca attgatcgcc    148080
     catcaagttt gtgtgcctga agcggcccgc gcctatgggg tcaccgcgcc gactgtgcgc    148140
     aaatggctgg gccgcttcct ggctcagggc caggcgggct tggccgatgc gtcctcgcgc    148200
     ccgacggtct cgccccgagc gattgcgccg gccaaggcgc tggctatcgt ggagctgcgc    148260
     cgcaagcggc tgacccaagc gcgcatcgcc caggcgctgg gcgtgtcagc cagcaccgtc    148320
     agccgcgtcc tggcccgcgc cggtctgtcg cacctggccg acctggagcc ggccgagccg    148380
     gtggtgcgct acgagcatca ggcccccggc gatctgctgc acatcgacat caagaagctg    148440
     ggacgtatcc agcgccctgg ccaccgggtc acgggcaacc gacgcgatac cgttgagggg    148500
     gccggctggg acttcgtctt cgtggccatc gatgaccacg cccgcgtggc cttcaccgac    148560
     atccaccccg acgagcgctt ccccagcgcc gtccagttcc tcaaggacgc agtggcctac    148620
     taccagcgcc tgggcgtgac catccagcgc ttgctcaccg acaatggctc ggcctttcgc    148680
     agccgcgcct tcgccgcgct gtgccatgag ctgggcatca agcaccgctt tacccgacct    148740
     taccgcccac agaccaatgg caaggccgaa cgcttcatcc agtcggcctt gcgtgagtgg    148800
     gcttacgctc acacctacca gaactcccaa caccgagccg atgccatgaa atcctggcta    148860
     caccactaca actggcatcg accccaccaa ggcatcgggc gcgctgtacc catctccaga    148920
     ctcaacctgg acgaatacaa cctattgaca gttcacagtt agatggctgg cccgtcgacg    148980
     atgaaaacgg ctggacaacg atagatctcg atggcacggc catcgacgat ggctggaccc    149040
     acatcgatat tccgcgtccc gagctggacg gcgctcccgt cgatagcgag gacggccggt    149100
     tgccttcgcc gcccgaagag gcgcctcagg cggggcccga cgcgtccaag cagcggccgg    149160
     agggcctgcc cgcgcccgat gccaatcccc aacccgatgc aaagcccgga gctgagatga    149220
     aaccccggcc tggggtggaa cccggacctg aggcggaacc tggtccgcag gggcagcctg    149280
     gcccccagcc tggagcccgg ccgcaggacg agccgcacgc gcagccgctg ccgcccgccg    149340
     gcaaccccgg cgctgggatt tacatgcccc gcagcggcat cttgaccgca ccggttctgg    149400
     ccgtgctggg cacggccagt gcgccgcaag gtatctggca ggcagagatg aacgccctga    149460
     gcaagcgcat gggtgaattg cggcttacgc cggcagccgg cggcgtgtgg gcacgctcgt    149520
     tcgcgcaacg ccaacgcctg gacaatcagg tggtggacag gttcacccag accgtgggcg    149580
     ggatcgagat tggcgccgac acggccttgc cggcggccga ggggcgctgg catgtaggcg    149640
     cggtggccgg ctacagccgt gcgcgccgca agctggcgca cagcgcccgt ggcaacagcg    149700
     acagcctgca tgtgggcgcc tatgcgacgt atatcggcga cggcggcttc tacctcgacg    149760
     ggattgtgcg ggtgaaccgc tacgagcacg atttcagggc tgacggccag cgcggcgcgc    149820
     gcgtgacggg caagtatcgc gccaatggca tcgggctgtc gctggagacc ggcaggcgtt    149880
     tcacatgggc cggcgactgg ttcgtggaac cgcaggtcga agtggcgttg ttccgttcgg    149940
     gcggggcaga ctacacggcc agcaatggcg tgcgcgtcga cgtggcaagc accaagtcgt    150000
     tgctgggccg ggcaggcctg caggtgggac gcaagctgga tctgggcaac ggcaaactgg    150060
     tgcagccgta cgccaagctg agctggttgc aggagttcga tggcgtgggc aaggtgcgca    150120
     ccaacgatat cggccatgac gtcaaactgc ggggcgggcg cgccgaactc gacttgggcg    150180
     tggccgcggc gcttggcagg cacagcagcc tgtttgcttc gtacgagtac agcaagggca    150240
     gccgcttgac cattccgtgg agctttcacg tcggctatcg atacgcctgg taagccaaac    150300
     gcgtcgtgcc accgcgcgcc ggaacacccg gcgcgcggtt ttttttgccg ccgggccgcc    150360
     ccaaggcaaa aaagccccct cggggggcag caagcccgca tagcgggcgc agcgtggggg    150420
     cactactttg ccgctgggcc gccccaaggc aaaaagcccc ctcggggggc agcaagcccg    150480
     cgtagcgggc gcagcgcggg ggcttctttc tccgttggct cagtgcaggg gctgggtgcg    150540
     gatcaggccg accgcgatgc cttcgagcgc gaattcgtcg gtgttggcca cgacgatggg    150600
     agcaaagtcg gggttctcgg gcaggagctc gatgcggccg ttctggcgct gcaggcgctt    150660
     gaccgtgacc tcgtcgccca gacgggccac cacgatctgg ccgttgcggg cctcggcggc    150720
     gcgcttgacg gcgagcaagt cgccttcgag gatgccggcg tcgcgcatgc tcatgccgcg    150780
     caccttcagc aggtagtcgg gcgtctgggc aaacagcccg ggatcgacgc cgacctcgcg    150840
     ctcgacgtgc tcgctggcca ggatggggct gcctgccgcc acgcggccca ccagcggcag    150900
     cacgagctgc gccagcagcg gatgcgtaag ctgggccgag ggcgttgcgc tgtccggcac    150960
     cttgagacgg atgccgcggg aggcgccagc ggtcagttcg atcgcgccct tgcgcgccag    151020
     cgccttgaga tggtcttcgg cggcgttggg cgaccggaag ccaagcgcct gggcgatttc    151080
     ggcccgggtg ggcggaaagc cggtgcgcgc cacggtctgg cggatgagat cgaggatttc    151140
     ctgctggcgt tccgtgagtt tggtggccat ggcgatgacc cgcttttgcg gactgtatgg    151200
     atatacagcg ccattctgga ggacccacgg gaaaaaagca agccgcaaaa gaaaagcgga    151260
     gccatgggct ccgcttctcg atgccggccg tgccgtgcct acttcagcac cgcggcgatg    151320
     ccggccgcga ccgcgtcgat gttgcggctg ttgagcgcgg ccacgcagat gcggccgctg    151380
     gagaccgcgt agatgccgtg ctcttcgcgc aggcgatcga cctgggcggc ggtcaggccc    151440
     gagtacgaga acatgccgcg ctgcgccagc acgaagctga agtcctgcgc cacgccctgg    151500
     gtcttgatct tctcgaccag ctccttgcgc atcaggcgga tgcggtcgcg catgccggcc    151560
     agttcatttt cccagagcgc gaacagctcg ggtgtgttca ggaccgtgga caccacggtg    151620
     ccgccgtggg tgggcgggtt ggagtagttg gtgcggatca cgcgcttgag ctggctgagc    151680
     acgcgggcgg cctcgtcctt gctgccggcc accacggtca gggccccgac ccgctcgcca    151740
     tacagcgaga aggacttgga gaacgacgag ctgatgaaca tggtcaggtc gagcgcggcg    151800
     aacatgcgca ccacggcggc gtcctgctcc aggccttcgc cgaagccctg gtaggcgatg    151860
     tcgaggaacg gcaccaggtt gcgcgccttg accacggcgg cgatctgttc ccactgttgc    151920
     ggcgtgggat cgacgccggt cgggttgtgg cagcaggcgt gcagcaccac gatggtctgt    151980
     tcgggcgcgg cctgcagggc ggccagcatg gcttcgaagt tcaggccatg ggtggcggca    152040
     tcgtaataag cgtaggtctc gaccgggaag ccggcgcgct cgaacagggc gcggtggttt    152100
     tcccagctgg ggtcgctgat gaggaccttg gactgcggca gcagctggcg caggaagtcg    152160
     gcgccgatct tcagcgcgcc ggtgccgccc agggcctgcg cggtcagcac gcggccttcg    152220
     gcggccagcg gcgagtcggc gcccagcagc agcgcctgcg cacccttgtt gtaccccgcg    152280
     atgccttcga tcggcagata gccgcgggcg gcggcggctt cgatgcgggc cacctcggcc    152340
     ttgcgcacgg cctgaagcag cgggatgcgg ccttcgtcgt cgtagtacac gcccacgccc    152400
     aggttcactt tgccgggacg ggtatcggcg ttgtactgtt cgttcaggcc aagaatgggg    152460
     tcgcgcggcg cgagttcgac ggaagcgaaa agagtgctca tgggtgtagg gaagggtggg    152520
     tggacgcggt aggaagggct gtggataatg gggggtttac cctgagagac agtctatcat    152580
     gaccgctcct ggattcgtcg aattccccga tagcccgttt cacctctatc agccgtaccc    152640
     tcccgcgggc gaccagccgg gagcgatcga cgcgttgacc gagggcgtct cggacggcct    152700
     gatgttccag acgctgctgg gcgtgacggg ctcgggcaag acctacacca tggccaacat    152760
     gatcgcccgc ctgggccgtc cggccctggt gcttgcgccc aacaagaccc tggccgccca    152820
     gctgtacgcc gaaatgcgcg aattcttccc ccgcaacgcg gtggagtatt tcgtgtcgta    152880
     ctacgactat taccagcccg aagcctacgt gccgacccgc gacctcttca tcgagaagga    152940
     ttcgtcgatc aacgagcaca tcgagcagat gcgcctgtcg gccaccaaga gcctgctgga    153000
     gcgccgcgat acggtcatcg tgggcaccgt ctcgtgcatc tacggtatcg gcaatccggg    153060
     cgactaccat gccatggtcc tgatcctgcg caccggcgac cggatttccc ggcgcgaggt    153120
     gctggcgcgg ctggtggcca tgcagtacac ccgcaacgac gcggacttca cgcgcggcgt    153180
     cttccgggtg cgctgcgaga ccatcgacat cttcccggcg gaaagccccg agctcgcgct    153240
     gcgcctgacg ctgttcgacg acgaaatcga gtcgctggag ctgttcgatc ccctgaccgg    153300
     gcgcgtgagg cagaagctgc cgcgctttac ggtatacccg ggctcgcact acgtgacgcc    153360
     gcgcgaaacc gtgctgcgcg cgatcgagac catcaaggaa gaactgcgcg agcggctggc    153420
     ccagctgatc gccgacggca agctggtgga ggcgcagcgg ctcgaacagc gcacccgctt    153480
     cgatctggaa atgctgcagg agctgggctt ttgcaagggc atcgagaact attcgcggca    153540
     cttgtccggc gcggcgccgg gcgagccgcc gcccaccctg atcgattacc tgccggccga    153600
     cgcgctgatg ttcatcgacg aaagccacgt caccatcggg cagctcggcg gcatgtaccg    153660
     tggcgaccgt tcgcgcaagg aaaccctggt gcagtatggc ttccggctgc cgtcggcgct    153720
     ggacaaccgg cccctgcgcc tggaggagtt cgaggcgcgc atgcgccagt gcgtgttcgt    153780
     gtcggccacg ccggccgcct acgagcagga gcacgccgat aacgtggtcg agcaggtggt    153840
     gcggccgacc gggctggtcg atccgatcgt cgaggtgcgt ccggcgcaca cccaggtcga    153900
     cgacctgctg ggcgagatcc acaagcgggc ggcgctgcag gagcgcgtgc tggtcacgac    153960
     gctgaccaag cgcatggccg aggacctgac cgacttcctg tccgagcacg gagtgcgggt    154020
     gcgctacctg cattcggaca tcgataccgt cgaacgggtg gaaatcatcc gcgacctgcg    154080
     gctgggcgtc ttcgacgtgc tggtgggcat caacctgctg cgcgagggcc tggatatccc    154140
     cgaggtgtcg ctggtggcca tcctggatgc cgacaaggaa ggcttcctgc gatccgagcg    154200
     cagcctgata cagacgatag gccgggccgc ccgcaacctg aatggccggg ccattctcta    154260
     cgccgaccgc ataaccgact cgatgcggcg tgccatcgac gagaccgagc ggcgcagggc    154320
     caagcagatc cagcacaaca ccgaccacgg catcaccgcg cgcggggtca gcaaggccgt    154380
     gcgcgaactg atcgatgggg tggtggcgcc ggccggccat gacgcgctgg aatccgccgt    154440
     gcccgccgag gtgctgaccg acgagaaagc catggcgcgc gagatccggc gcctggaaaa    154500
     gctgatgatg gatcacgccc gcaacctgga attcgagcag gccgccgcgg cacgcgatgc    154560
     gctcaacgct ctcaagagtc ggttgctgct tgatggcgta ggttggtctg gttaaacgtg    154620
     tgaaagacgg aaattagcgg agaaaattcg ctcgttacaa acaggctggc gcgttcttgc    154680
     ggcatagcgg caaaagcgtt acacactcgt cgtgaaaagg cgctctaaaa cctcatgtat    154740
     tttcttgaaa atcaaattaa ttgcatgatt taaaagggaa aaattatttt tccgcggcac    154800
     tgctccggaa tggtgaaact gcaaaaaata cttgctatat tccgggtttt cccgcacact    154860
     tacacccatg atgaccaagg tacttttcgt ttgcatgggc aatatctgtc gctcgccgag    154920
     cgcagaaggt gtcttccgct atctggtgaa tgatgccggg atgggcgatg tcgtgcgggt    154980
     cgattccgcg ggcacgcatg ccttccacat tggcgaggcg cctgacgccc gggcccaggc    155040
     cgccgcccgc aagcgcggct acgatctcac gcactgcgca gcgcgtcagg tgacggcgga    155100
     cgatttccgc gaattcgacc tgatcctggc catggattgg gacaacctgg ctgccctgca    155160
     gcagcagtgc cccaaggcct atcagcacaa gctgatgctg ctgatgcggt ttgccaacga    155220
     gttcgaggaa gccacggtgc ccgaccccta ttatggcggc cccgagggtt tcggcaaggt    155280
     gctcgactat ctggaagacg cctgtcaggg cgtgctggaa ctggtgcgca agcgcgccac    155340
     gcaataccag gcggcctgat ccgtcgccgt ccgcggcgct ggggcaagtg gggggatccg    155400
     caatgggtcc gtaccccaaa atgagaaaac cgcgcgactg cgcggttttt tccgaccgag    155460
     atacttagcg ttttactcgg gaatttgcta tacttgaccc aattactcgg gtattgatgc    155520
     ccggtccagc gcccgatgcg tcgggttttc ttccggattc acaggaaaca caccatgcgg    155580
     ttaactacca aagggcgttt cgccgtgacg gccatgatcg atttggcgat gcggcagcat    155640
     agcggcccgg tcactctcgc ggcgatcagc cagcgccaga atatctcgct ctcctacctc    155700
     gaacagctgt tcggcaagtt gcgccgccac gagctggtcg acagcgtgcg cgggcccggc    155760
     ggcggctatt cgctggcgcg cctggcgcgc aatgtcacgg tagccgacat cattttcgcg    155820
     gtcgacgaac ccctggacgc caccagctgt ggcggcaagc gcgattgcac cagcggcaac    155880
     gacggcaagc cgggcaagtg catgacccac gaactgtgga ccacgctgaa tcgcaagatg    155940
     gtcgactacc tggactcggt ctcgctgcag gatctcgtcg atcagcagcg cgtgcgccag    156000
     ttgcaggaag cggccaacca ggcgcagggc tgttcggccg tgcgcgtgaa ccggtcgacg    156060
     cccgtcgccg ccaacgccac cgcataagtt aggagcagta caacatgagc aatcgcccca    156120
     tctacctgga ctactcggct accacgccgg tcgacccgag cgtggtcgag aaaatgattc    156180
     cctggttgta cgagagtttc ggcaatccgg cctcgcgcag ccacgccttt ggctgggaag    156240
     ccgaggacgc ggtcgagaag gcccgcgagg aagttgccaa gctggtcaac gccgatccgc    156300
     gcgagatcgt ctggacttcc ggcgctaccg agtcggacaa cctggccatc aagggcgcgg    156360
     cgaatttcta cgccgagcgc ggcaagcaca tcattaccgt caagaccgaa cacaaggcgg    156420
     tgctggatac ctgtcgggag ctcgaacgcc agggctttga agtgacctac ctggatgtcc    156480
     aggacgatgg tctgctcagc ctcgatgcgt tcaaggctgc gctgcgcccg gataccatcc    156540
     tggtgtcggt gatgatggtc aacaacgaga tcggcgtcat ccaggacatc gccgcgctgg    156600
     gcgagatctg ccgcgagaag ggcatcatct tccacgtgga cgcggcccag gccaccggca    156660
     aggtcgagat cgacctgcag aagctgaagg tggacctgat gtcgttctcg gcgcacaaga    156720
     cgtacggccc caagggcatc ggcgcgctgt atgtgcggcg caagccgcgc gtgcgcatcg    156780
     aggcgcagat gcacggcggc ggccacgaac ggggcttccg gtcgggcacg ctggccacgc    156840
     accagatcgt cggcatgggc gaggcgttcc gcctggcgcg cgaggaaatg ggcaccgaga    156900
     acgagcgcgt gcgcatgctg cgcgaccgcc tgctggccgg cctgacgcag atcgaggaag    156960
     tgtatgtgaa cggcagcatg gagcaccgcg tgccgcacaa cctgaacatc agcttcaact    157020
     atgtcgaggg cgagtctctg atcatggcga tcaaggagct ggccgtttcc agcggttcgg    157080
     cctgcacgtc ggccagcctg gagccgtcct atgtgctgcg cgcgctgggc cgcaacgacg    157140
     agctggcgca cagctccatc cgctttaccc tgggccgctt cacgaccgaa caggaaatcg    157200
     acttcacgat cgaactgatc aagagtcgtg tcggcaagct gcgcgatatg tcgccgttgt    157260
     gggaaatggc ccaggaaggc attgatctga attccgtgca gtgggccgcg cactgagcgc    157320
     ccgcgccgac cgaccaaata gtggagaaac atcatggctt acagcagcaa agttctggat    157380
     cactacgaaa acccccgcaa cgtcggctcg ttcgacaagg gtgacgactc ggtcggcacc    157440
     ggcatggtcg gcgcgcccgc ctgtggcgac gtgatgaagc tgcagatcaa ggtcaacgag    157500
     gccggcgtca tcgaggacgc gcgcttcaag acctacggct gcggctcggc gatcgcctcc    157560
     agctcgctgg tgacggagtg ggtcaagggc aagacgctgg acgaggcgat gaacatccgc    157620
     aacacccaga tcgccgaaga actggccctg ccgcccgtga agatccactg ctcgatcctc    157680
     gccgaggacg cgatcaaggc tgccgtgcag gactacaaga ccaagcacgg ggccgagacg    157740
     cccgaggccg tcgcggcgaa ctgacatggc ggttacgctg actcaatcgg ccgccaacca    157800
     cgtcggccgc tacctgcaaa agcgcggcaa gggcatcggc ctgcgcctgg gcgtgcgcac    157860
     gaccggctgc tcgggcatgg cctacaagct ggagtacgtc gacgagcagg ccgctgacga    157920
     cgtggtgttc gacagcttcg gggtcaaggt tttcatcgac cccaagagcc tggcgtacct    157980
     ggacggcacc gagctggatt acgcgcgcga gggcctgaac gaagggttca ggttcagcaa    158040
     ccccaacgag aaggcgacct gcggctgcgg cgagtcgttc acggtgtagt cttggcggca    158100
     gacgaccatt tcagcctgtt cggcttgccg acccggtttg cgttggatcc ggtccagctc    158160
     gaacaggcct ggcgcgccgt ggcggcgcgc gtgcatcccg atcgttatgc cacggccagc    158220
     gccgccgagc gccgggtcgc catgcagtgg gcggcgcgcg ccaacgaggc ctaccggcag    158280
     ttgcgcgacc ccatgctgcg cgcccgctac ctgtgcgagc aggcgggcgt ggacctgcag    158340
     accgaaagca ataccgcgat ggatccggct ttcctgatgc agcagatgga atggcgcgaa    158400
     atgctcgacg atgcgcgccg cgatccggcc gctttcgcgg ccctgcgcgc cgagctggaa    158460
     caggcgcggc tgcggatgca gcagacgctg tcggagctga tcgacgagcg cggcgactac    158520
     cagcaggccg gcaccaaggt gcgcgaatgg atgttcgtgg aaaaactggc gcaggagctg    158580
     agcgcggcgc aacccatgca atagccctgg ctcggggcgg cggcgcgtgg cgcgtccacg    158640
     cggcggcggc cggcccgatg cgcggcaacc gatgacccgc ttgtgcggtg ccgcgtccgg    158700
     catcgccagg caccagagat tctcaagcac aacatggctt tattgcagat ttccgagccg    158760
     ggcgattcgc ccgccccgca ccagcgcaag ctggccgtgg gtatagacct gggcacgacc    158820
     aattcgctgg tggccgcggt gcgcagcagc gtgcccgaag tgctggccga cgcgcaaggg    158880
     caggtcctgc tgccgtcggc cgtgcgctac ctggacggcg gcgcggtgcg aatcggccgc    158940
     gaggccctgc tggagcaggc gcgcgatccg ctgaacacca tcgtctcggt caagcgcttc    159000
     atgggccgca gcgcggccga cgccgcggcc agcggcgcgc cgtacgagtt cgtcgacgcg    159060
     cccggcatgg tacgcctgcg cacggtccag ggcgatctca gcccggtcga agtctcggcg    159120
     cagatcctgg ccgtgctgcg ccagcgcgcc gaagacgtgc tgggcgacga cctggtgggc    159180
     gcggtgatca ccgtgccggc gtatttcgac gacgcgcagc gccaggccac gcgcgatgcc    159240
     gcgcggctgg ccggcctgaa tgtgctgcgc ctgctcaacg agccgaccgc ggcggccatc    159300
     gcctatgggc tggaccaggc cgccgaaggc atttacgcgg tgtatgacct gggcggcggc    159360
     acgttcgata tttccattct gcgcctgacc cagggcgtgt tcgaagtgat tgccacgggt    159420
     ggcgatacgg cgctgggcgg ggacgatttc gacagcgcca tcgtggccca tgcctgcgcc    159480
     ggcgaggacg tggcggcatt gccggtggcc gaccggcgcg cgttgctggt ggccgctcgc    159540
     gccgcgcgcg aggcgctgac cgaccaggcg caggcgccgt tcgaggtgac gttgcgagac    159600
     ggtcgcgcca tccaggcgac gctgacccgc gcgcagttcg agcagctggc cgagccgctg    159660
     gtcggacgca cgctggacag cgcgcggcgc gccctgcgcg atgccggact ggcggtcggc    159720
     gacgtgcgcg gcgtggtgat ggtgggcggg gcgacccgca tgccggtggt gcgccagcag    159780
     gtcggcgcgc tgttcggcac cgagccgctg accaacctgg accccgacca ggtggtggcg    159840
     ctgggcgccg ccctgcaggc caacctgctg gcgggcaacc gcgcgctggg cgaggactgg    159900
     ctgctgctgg atgtcattcc gctgtcgctg ggcctggaaa ccatgggcgg gctggtcgag    159960
     cgcatcattc cgcgcaacag caccatcccc gtggcgcgcg cgcaggaatt caccaccttc    160020
     aaggatggcc agaccgccat gagcgtgcat gtggtgcagg gcgagcgcga tctggtgtcc    160080
     gattgccgct cgctggcgcg cttcgagctg cgcggcattc cgcccatggt ggcgggcgcg    160140
     gcgcgcatcc gcgtcacgtt ccaggtcgat gccgatggcc tgttgagcgt gacggcgcgt    160200
     gagcagagca ccggggtcga ggcggcggta gcggtcaagc cctcgtacgg cctgtccgat    160260
     gacgagattg cccgcatgct ggccgatagc gtcacccagg ccgacagcga cgcgcgcgcg    160320
     cgcatgctgc gcgagcagca ggtcgaggcg cgccagctgg tggagtcggt gggcgcggcg    160380
     ctggccgccg atggcgacct gctggatccg gccgagcgcg ccaccgtgga ccagcgcctg    160440
     caggcggcgg cgcaggcgca gtcgctcgac gacgtcgaag ccgttcgggc cgcggtgcag    160500
     gcgctttcgg atgccacaga agaattcgcc gcgcggcgca tggaccgcag catccgctcc    160560
     gcgctggccg gccgtaaact cgatgaactc gcctgactgg acaccatgcc gaaactaact    160620
     gtattgcctc accccgacgt ctgcccggag ggtgccgtca tcgaggacgc gcccaagggc    160680
     gtgtcgatct gccgggtgat gctggataac catatcgaaa tcgaacacgc ttgcgagctg    160740
     tcctgtgcct gcaccacctg ccacgtggtc gtgcgccagg gtttcaattc gctcgaggac    160800
     gcgaccgacg acgaagagga cctgctggac aaggcctggg gcctgacctc gacgtcgcgc    160860
     ctgtcgtgcc aggcgctgat cggcgaggaa gacctgaccg tggaaatccc gaaatacacg    160920
     atcaaccacg ccaaggagca gcactgatga agtggaccga catctacgag attgccgccg    160980
     ccctggccga tacgcacccc gacgcggatc cgcagaccgt gcgcttcacg cagttgcgcg    161040
     agtgggtgct gggcctgccg ggttttgccg atgatcccgc gcattgcggc gagaagatcc    161100
     tcgaggccat ccagatggcc tggatcgagg aaatggactg agccgccggc cggcgcgccg    161160
     cccggacaag ggccccgtca tggacggggc ccttgtcgtt tcggggccgc gcggccgggg    161220
     tatcatcggt cctggcattt tgctttcaac cggaccgatc gccccatgac gactgcttcc    161280
     ctgcgcttcg gccttgccgc caatcgcctg caccacgaaa cgcccgacgc ggccctgttt    161340
     acctggctgc gcgcctgctc ggccacgatc cgcgagatgg gcatccagtt gcatacggtg    161400
     ggccgcacgc acgatgcgat cgtgcgcgag ggcatgctgc agggctacag cggactggtg    161460
     cgctatccgt atgggcgcga gggcggcctg atgaagctgg tggcgcgcgt gaccgagggc    161520
     cgcgatggcg acgccccgtt cgatggcgcc atctacctga tcgacccggt ggacccgtcg    161580
     tcgatctttc ccgaggcgct ggcactcaag cgccagtgca tcacgcacgg ccggccgttc    161640
     atctcgacgc tggcgggcgc catcgagtgg atcgaggtcg agcgggtgct ggccggcctg    161700
     gcgccggacg ccaccgcggc gcggctgttc gatttcaccg gccagaccct ggccttgatt    161760
     tcccacgatg cgctcaagga agatatggtg gcgtttgccg ccgagcattt cgacctgctg    161820
     tcgcagttcg cgcggcgcgt ggccaccggc acgaccggcg gtctgctcaa tgacctggcc    161880
     tggtcgcgcg gctggcccaa ggatcgcccg tgggtacacc gctacctgag cgggcccttg    161940
     ggcggcgacg cgcagatcgc cgaactggtg ctggagcatc agtgccagcg cgtgatcttc    162000
     ttcgaggacc cgcacgtggc gcgccagcac gaggccgata tccagttgct ggagcgggcc    162060
     gtgcgcgtgg tgaccgcctc ggccacctgc gctacctcgc cgtcggtggc gcgccgctgg    162120
     gcccaggcgg tacagcgccg gcaggccggc cgcgcctagg tgtgaactgt caataggttg    162180
     tattcgtcca ggttgagtct ggagatgggt acagcgcgcc cgatgccttg gtggggtcga    162240
     tgccagttgt agtggtgtag ccaggatttc atggcatcgg ctcggtgttg ggagttctgg    162300
     taggtgtgag cgtaagccca ctcacgcaag gccgactgga tgaagcgttc ggccttgcca    162360
     ttggtctgtg ggcggtaagg tcgggtaaag cggtgcttga tgcccagctc atggcacagc    162420
     gcggcgaagg cgcggctgcg aaaggccgag ccattgtcgg tgagcaagcg ctggatggtc    162480
     acgcccaggc gctggtagta ggccactgcg tccttgagga actggacggc gctggggaag    162540
     cgctcgtcgg ggtggatgtc ggtgaaggcc acgcgggcgt ggtcatcgat ggccacgaag    162600
     acgaagtccc agccggcccc ctcaacggta tcgcgtcggt tgcccgtgac ccggtggcca    162660
     gggcgctgga tacgtcccag cttcttgatg tcgatgtgca gcagatcgcc gggggcctga    162720
     tgctcgtagc gcaccaccgg ctcggccggc tccaggtcgg ccaggtgcga cagaccggcg    162780
     cgggccagga cgcggctgac ggtgctggct gacacgccca gcgcctgagc gatgcgcgct    162840
     tgggtcagcc gcttgcggcg cagctccacg atagccagcg ccttggccgg cgcaatcgct    162900
     cggggcgaga ccgtcgggcg cgaggacgca tcggccaagc ccgcctggcc ctgagccagg    162960
     aagcggccca gccatttgcg cacagtcggc gcggtgaccc cataggcgcg ggccgcttca    163020
     ggcacacaaa cttgatgggc gatcaattgc tggaccattt cgagtcgacg taggaaggtc    163080
     aatcgggcat gcttatgggt gttcatccgg ccgggctcct tgagtgaact gggggggtgg    163140
     cgatttccag tttctcaaat ccggttcgga tgaaccatgc atacaaccta ttgaatcttc    163200
     acacctaggt cgcgcgcggc ccggacggcc tcaggcgccg gtgaagcggg gcgggcgttt    163260
     ggccaggaag gcctgcacgc cttcggcgaa gtcggcgcgt ccggccgccg ccaggaaggc    163320
     ggcggcttca tcctcgagct gctgttccag cgatgtggct ggcgcctggc gcagcaggcg    163380
     cttggcggcg gccacgtcgt gcggcgcatg ggcggccagt tcgcgcgcat aggccagcgc    163440
     ctggtcggcc cgctcggctg ccggcgccac gcgatcgacc aatccccact gcagcgcctg    163500
     cgcggcgtcg atgggttcgg cgcgcagcag cagcgccagc gcgcggcggc ggcccagcag    163560
     atgggccagc gcatgggtca tgccggcatc gggcgtggcg cccagtttca ggtaggccgt    163620
     gaccagccgc gcgtcgtcgg cggcgatcgc caggtcgcag gccagcgcca gggacaggcc    163680
     cgcgccggcg gccacgccgt gcacatcggc cagccacagc tggtccatgg cggcgatgcg    163740
     cgccacgcaa tcgttgagcg gcgtgaacag cgcccgcagg ctggcgcgga tctcctcggg    163800
     cgggccctgg aacagggcga tgtcgccgcc ggcgcaaaag gccttgccgg cgccgcgcag    163860
     cagcaccacg cgcagcgccg cgcggtcttg cagccagcgg gccgcggcct gcaggtcgcg    163920
     cgccatggcg atgtcgatgg cattgagcgc ggcggggcgg tccagggtaa ggatggcgag    163980
     cgcgccatcg gtctgcaagg tcagggtgcc atagcgcggc ggctggtcgg cggcggacat    164040
     ggttcggtct ccgtatgggg taaataccaa ttcttgattc aaaaaccgcg atgctatgtt    164100
     gcgaaccaag cgcttgctcg gttgggagat cgacccggct aggtgtgaag attcaatagg    164160
     ttgtatgcat ggttcatccg aaccggattt gagaaactgg aaatcgccac ccccccagtt    164220
     cactcaagga gcccggccgg atgaacaccc ataagcatgc ccgattgacc ttcctacgtc    164280
     gactcgaaat ggtccagcaa ttgatcgccc atcaagtttg tgtgcctgaa gcggcccgcg    164340
     cctatggggt caccgcgccg actgtgcgca aatggctggg ccgcttcctg gctcagggcc    164400
     aggcgggctt ggccgatgcg tcctcgcgcc cgacggtctc gccccgagcg attgcgccgg    164460
     ccaaggcgct ggctatcgtg gagctgcgcc gcaagcggct gacccaagcg cgcatcgccc    164520
     aggcgctggg cgtgtcagcc agcaccgtca gccgcgtcct ggcccgcgcc ggtctgtcgc    164580
     acctggccga cctggagccg gccgagccgg tggtgcgcta cgagcatcag gcccccggcg    164640
     atctgctgca catcgacatc aagaagctgg gacgtatcca gcgccctggt caccgggtca    164700
     cgggcaaccg acgcgatacc gttgaggggg ccggctggga cttcgtcttc gtggccatcg    164760
     atgaccacgc ccgcgtggcc ttcaccgaca tccaccccga cgagcgcttc cccagcgccg    164820
     tccagttcct caaggacgca gtggcctact accagcgcct gggcgtgacc atccagcgct    164880
     tgctcaccga caatggctcg gcctttcgca gccgcgcctt cgccgcgctg tgccatgagc    164940
     tgggcatcaa gcaccgcttt acccgacctt accgcccaca gaccaatggc aaggccgaac    165000
     gcttcatcca gtcggccttg cgtgagtggg cttacgctca cacctaccag aactcccaac    165060
     accgagccga tgccatgaaa tcctggctac accactacaa ctggcatcga ccccaccaag    165120
     gcatcgggcg cgctgtaccc atctccagac tcaacctgga cgaatacaac ctattgacag    165180
     ttcacagcta ggtgtgaaga ttcaataggt tgtatgcatg gttcatccga accggatttg    165240
     agaaactgga aatcgccgat cccccagttc actcaaggag cccggccgga tgaacaccca    165300
     taagcatgcc cgattgacct tcctacgtcg actcgaaatg gtccagcaat tgatcgccca    165360
     tcaagtttgt gtgtctgaag cggcccgcgc ctatggggtc accgcgccga ctgtgcgcaa    165420
     atggctgggc cgcttcctgg ctcagggcca ggcgggcttg gccgatgcgt cctcgcgccc    165480
     gacggtctcg ccccgagcga ttgcgccggc caaggcgctg gctatcgtgg agctgcgccg    165540
     caagcggctg acccaagcgc gcatcgccca ggcgctgggc gtgtcagcca gcaccgtcag    165600
     ccgcgtcctg gcccgcgccg gtctgtcgca cctggccgac ctggagccgg ccgagccggt    165660
     ggtgcgctac gagcatcagg cccccggcga tctgctgcac atcgacatca agaagctggg    165720
     acgtatccag cgccctggcc accgggtcac gggcaaccga cgcgataccg ttgagggggc    165780
     cggctgggac ttcgtcttcg tggccatcga tgaccacgcc cgcgtggcct tcaccgacat    165840
     ccaccccgac gagcgcttcc ccagcgccgt ccagttcctc aaggacgcag tggcctacta    165900
     ccagcgcctg ggcgtgacca tccagcgctt gctcaccgac aatggctcgg cctttcgcag    165960
     ccgcgccttc gccgcgctgt gccatgagct gggcatcaag caccgcttta cccgacctta    166020
     ccgcccacag accaatggca aggccgaacg cttcatccag tcggccttgc gtgagtgggc    166080
     ttacgctcac acctaccaga actcccaaca ccgagccgat gccatgaaat cctggctaca    166140
     ccactacaac tggcatcgac cccaccaagg catcgggcgc gctgtaccca tctccagact    166200
     caacctggac aaatacaacc tattgacagt tcacagctag gcgcggcgcg gccttcgggc    166260
     cggcctgcgt ttggcttgag ccccgcgaac ccccgcgggg tttttttatg gcccgctcag    166320
     accgcgcccg tgcgcgccgt ggcccgggat cgagaaaaaa cggtgacaaa tcagtgtgtt    166380
     gcagatttgt acgtacaggt tgtacgtata ggattagaat ggcgcttttc ccagcagctg    166440
     tgttccctct gatgcataag caaagcaaat cctacggaga caacctgtca tgactaccga    166500
     agtttcccgc gtaccgttct acacaaccat gatgaaagtg ccgggcggcc tcatgctgct    166560
     gccgctgatc ctcggatcgc tgctgggtac gttcgcgccg gacgcgctgg ccatcggcgg    166620
     ctttaccacc gcactgttca agaacagcgc gctgccgctg atcgcgctgc tgatcttcgc    166680
     caccggcacg caggtcaaca tgcgcaccgg cggtccgatc ctggccacgg ccggcaccat    166740
     cctgctgatg aagacgctgg tgccggccac gctgatcatc ctgctgggcc atttcgtcgg    166800
     cctggacggc gtgctgggca tttccatcct ggccatgctg gccgccttcg acaacagcaa    166860
     cggcggcctg tggctcgcct acaccgggca atacggcgac agccgcgatc gcggcgccta    166920
     cgtcgccagc gcggtcaacg acggcccgtt cttcagcctg ctgttcctgg gcgcctcggg    166980
     cctggcggat atcccgacca tcgcactggt ggcggcgctg gtgccgttcc tgctgggcgt    167040
     ggtggtgggc aaccttggac atcgaatggc gcaacgtgct caagccggtg cccaacatcg    167100
     tgatcccgtt cttcgccttt gcgctgggca ccggcatcaa cctgggcgcg gtgatctcgg    167160
     gcggcatgag cggcctggtc ttgggcctgc tgatcagccc gatcaccggc gcgctggtgt    167220
     acttcggcta ccgctacatc ctgcgccgcg gcggcaagag cggcctgggc tttgccgccg    167280
     gtaccaccgc cggcaacgcc atcgccacgc cggccgtggt ggccgccgcc gatccgtcgt    167340
     tccagcccta tgtcgcgacc gcgaccgccc aggtggccgc gtgcgtgctg atcagctcca    167400
     ttcttgcgcc ggtgctggcg tcgtacttcc tcaagcgcgc cggcgaactc aagccggtgg    167460
     agcaggagcc gcaggacgag cgcaccggcc agcccgccga agtgagcctc tgaatgggcg    167520
     ggccgtacat aggcatcgtg gccgacgatc tgaccgggtc gggcgacacc gcggtgcagt    167580
     tcgtgcgggc cggctgggcg acccagctgt cggtgggcgg cgccgagcag gcgctggccg    167640
     atccggccgt gcgccaggcc gaggtgctgg cggtcacgac gcacagccgc cccttggcgg    167700
     cggcggatgc cgccgccgtg gtgcgcggcg aggtcgagag gctgcgcgcc gccggcgtgc    167760
     agcgcctgta caagaaggtc gattcgacct tgcgcggcgc cttcaaggcc gagatcgacg    167820
     ccgcgcggct ggcttggggc gagggtgcca tcgcggtggt ctgcccggcg tttcccgtca    167880
     ccggccgcac ggtgcgccag ggcgtgctgt acgtgagcga tcggccggtc accgagacct    167940
     cggccgccac cgaccccgtg acgccggtga ccgagtcgca cattcccacc ctcttgggct    168000
     gtgcccagct ggcggcgcag gcgggggaaa ccccggccga actggcgcgg cgcatcgccg    168060
     ccgccgctcc ggtggtcgtg gtcgatgccc tggacgacgc cgatgtgcag cggctggcgc    168120
     gcgccatcgg cgtgctgggc cagcgcgccg tgcccgtcgg ctcgggcggg ctggccgcgc    168180
     cgctggcgtg ggtatgggcc ggcgggcagg cggccggccc ggtgctggtg gtcgtgactt    168240
     cgcagcacag cgcggcgcgc cagcaggccg ccgcgctgca gcaggccggc gcgcgcacct    168300
     gggcgccgac gctggcgcaa ctggccgatg accgcaactg ggcggcctgg accgccgagg    168360
     tcgaggcggc cgagcacggc atgccggcgg tcgacgccct gatgctgctg gcgcccgaag    168420
     ggcgcctggc cgggctggac gcagacagcg tcgcgcgcag gctgggcgag ctggccgcgc    168480
     gcctggtgct ggcgcacggc gcggccggcg tggtggccac cggcggcgac ggcgccagcg    168540
     ccgtgctggc ggcattgcag gccagcggta ttgcgctggt cgacgaagtc accggcggcg    168600
     taccgctggg caccctgacc ggtggccagg cggcagggct gccggtcgtg accaaggccg    168660
     gcggctttgg cgagcaggat gtattgatcc gggccgcgca ggcgatccgg gaacggagat    168720
     tcacgaaatg acgcaagacg ctaccccctc ccgcattccc accctggcgg tgacgctggg    168780
     cgacgtggcg ggcataggcc cggaaatcac cgccaagatg ctgctcggcc acgacgagct    168840
     gcgccagcgc gcccggctgc tggtggtcgg cgacgccgcc gtgctggccc aggccgtgca    168900
     ggccgtgggg ggcgatccgg cgcgggtacg cgtcatcgcg acgccggccg aggccaccaa    168960
     ccagcccggc agcatcgaag tgatccaggc cggcccgtcg ctggcgcacg tgccgccggg    169020
     ccagttgagc gccgaggctg gcgacggctc ggtgcgctac gtcaccacgg cctgcgcgct    169080
     ggcgcgcgac ggcttgatcg acggtatcgt caccgcgccg ctgaacaagg ccgccatgca    169140
     catggccggc cacaaatggc cgggccatac cgaactgctg gcgcacgagt tcggcgtcaa    169200
     gaccttctcg ctggtgctgt cggccggcga cctgtatatc ttccacgcca ccacccatgt    169260
     gtcgctgcgc caggccatcg aggatgtgaa tccgcagcgc atgcgcgcgg tgctgcgcct    169320
     ggccggctcg ttcgcgcgcg cgctgggccg cgccgaccat ccggtggcgg tcgcgggcct    169380
     gaacccgcat gccggcgaga acggcatctt cggcaccgag gacgccgaga tcctggcgcc    169440
     ggcggtgacg caggccaaca atgccgaggg catcctggcg gccggcccga ttccggccga    169500
     cgcgctgttt ccgcaggccg tgcgcggcaa gtggaaattc gtcatcgcct gctaccacga    169560
     ccagggctat gcgccgttca agtcggtcta tggcgacgac ggcgtcaaca tcacggtggc    169620
     ctgccggtgg tgcgcgtgtc ggtcgaccac ggcaccgcgt tcgacatcgc cggcaagggc    169680
     atcgcgcgag gacagcctgg tgctggccgc cgagcgcgcg gcgcagctgg cgccgggttg    169740
     gcatcaagta tgggaaactg cgcgctccac gactggaggc tgatcgcatg gcgttgtccg    169800
     ccattgaacc ctttgcgctg gaccgttccg gcgcaacgcc cctgcatgcg caggtggcgg    169860
     acgcaatccg caaccatatc cgcgatcacc ggctgaccgc cggtaccgtg ctgcccagcg    169920
     aagcggcgct gtgccacagc ttcggcgtgg cgcgcagcgt ggtgcggcag gccctgggcg    169980
     ccctggtggc cgaagggctg atccgtcgcg acccgggccg cgcgccggtg gtggcgccgc    170040
     cgcgcgaaca ccggcgcatg gtgcagcgct cggccggcct gtacgagcag ttcgccggcc    170100
     tgggcgtggc gctgcgcacg cgcgtgctgg cctgccggcc cgccgagccg ccgcccgagg    170160
     tggcggcctt cttcggcacg accgagacgc tgctgctgga gcgtttgcgc agcgtcgacg    170220
     cccagccgct ggcctacgtg cgcacctggc tgccgcgcgc ggccatcgcc gggttggcgg    170280
     cggaccacct gcaggacgcc tcgctgcacc gcgtgctggc gcagcgcttc ggcctgcgcc    170340
     cgggacgcgg ccgcaaccgc atccgggccg tggccgccga agcggcgctg gcgcaggcgc    170400
     tggacgtggc gccaggcagc ccgctgctga tgctggaagg gcaggggctg gaccaggacg    170460
     gccatccgct ggagtggttc accacctggc atcgccccga gaacctggtg ttcgacgtgg    170520
     acgtggggca ggagcgggaa agcgtgcagc ccgcgctcac ctgcggcacg gccgccgtgg    170580
     cgccgccggc ggtggccgcg ccgccgtccg gcgcgctgga cgccgtcgaa cagtcgctgc    170640
     tgcaggcgct gcaggccgtg cggcgggccc gcgaggacca gcaggagtag ggcgggcgcg    170700
     cgccatttcg tgccggccgg cgtcaactgc tattcttgac gccttctcct gccaggtcgc    170760
     ctcgccatgt ccacccgcat ccgcagtctg catatctatc ccgtcaagtc ctgcgccggc    170820
     atcgacctgg ccgaatcgat cgtcgatcgc gccggcctgg cgcacgatcg ccgctggatg    170880
     gtgacgacgg ccgccggcca gttcatgacc cagcgccagt acccgcagat ggcgcgcatc    170940
     cgcaccgcgc tcgaggacgg catgctggtg ctgcgcgccc cgggcatgga agacttgcgc    171000
     ataccggccg atggttcgga gctggccgag cgcacccagc ccgtgggcgt gtggcgcgat    171060
     acggtgatcg cccgcgccga gcatccgcgc agcgccgagt ggctgagccg cttcctgggg    171120
     ctgccgtgcc gcctgctcaa gatcgacctg cgggcggacc gcacggccaa tcccgaatgg    171180
     gtcgatacct ggctggagcg ccaccccgag tgggccgagg atttcgcggg cgaccatttc    171240
     ttcggctttg ccgacggatt tccgctgctg gtggccaacc agtcgtcgct ggacgagctg    171300
     aacgaacgcc tggcggcgcg cggccaggcg ccggtgccga tgaaccgctt tcgcgccaat    171360
     atcgtggtcg agggcgactg gccggccttc gaggaggacc agaccgcctg catcgtggcc    171420
     ggcggcgtgc gcatggcgtt cgtcaagccg tgcacgcgct gtcccatgtc caatgtggac    171480
     caggtcaccg ccgaggtata cgacgagctc ggcctgacgc tgacgacctt ccgctcgctg    171540
     gagatcggcg tggtgttcgg ccagaacgcc atcgtcgacc gtaccgcccc ggcgcccttg    171600
     cgcgtgggcg acgcggtcga gatcgaactg gatttctagc cccgcgcgcc gcggcgcgcg    171660
     cgtcggcggc ggcaaaaaat atagaatgtg ggtttgcgcg ggcacagccg gatgccgggc    171720
     gcattcgagc acgcttgcgc ggtccggccc gcgcgccagg aaatttgcta tgcaacgcat    171780
     catgctgcgg gcgaagctgc accgcgttac ggtcaccgag gccgatctgc actacgaggg    171840
     atcgtgcggc atcgacgaag acctgctgga cgccgccggc atgcgcgagt tcgaacggat    171900
     cgagctctac aacgtcacca acggcgaacg cttcgacacc tacatcatca aggcggcccg    171960
     cggcagcggc gcgatctcgc tcaacggtgc cgcggcgcgg cgcgcgcagg tcggcgacct    172020
     gctgatcatc tgcacctacg gcccgatgtc ggaagagcag tcggccgcgc acaagccgca    172080
     ggtcgtgctg gtcgacgacg ccaaccgcgt caaggaaatc cgtaaattcc cggcctgacg    172140
     gccgttgcgc gcgcgcccgg caagggcgcc gcggtcactt ccgattcgta tcgctatgag    172200
     tttccaggtc actatcgaac ccagcaagca ccagttccag gccgaggccg gccagacggt    172260
     cctggatgcg gccctggcgg ccggcattgt gctgccctat agctgccgta ccggcgcgtg    172320
     ttcgacctgc aagggcaagg ttgtcgccgg cgaggtggat gcggggccct atccggccca    172380
     gatcctgtcg cccgaggacc tcgcgcaggg ctacacgctg ttctgtcagg ccaagccgca    172440
     aagcgacctg gtggtcgagt ccaccgaagt gcggctggcc agcgacatcc agatccgcaa    172500
     gctgccttcg cgggtgcaga cgatagagcg cgtcgcgccc gacgtcgcgg tgctgaagct    172560
     gcaattgccg gcttccgagc agttccgcta ctacgccggc cagtacatcg aagtcatcct    172620
     caaggacggc aagcgccgca gctactcgat ggccggcgcg ccgcataccg gcagcccgct    172680
     cgaactgcat atccgccaca tgccgggcgg gctgttcacc gaccacgtat tcggcgcggg    172740
     cgatacccag atgaaagagc gcgagatcct gcgcctggag gggccgttcg gctcgttctt    172800
     cctgcgcgag gacagcgaca agcccatcgt gctgctggcc agcggcaccg ggttcgcgcc    172860
     ggtcaaggcc atcgtcgagc acatgatcca caaccagatc cagcggcctg tcgtgctgta    172920
     ctggggcgga cggcgcccgc gcgacctcta ccacgacgcc ttggcgcaat cgtgggccgg    172980
     gagactgccg ggctttcgct atgtgccggt ggtttccgac gcgctggacg aggacggctg    173040
     gagcggccgc accggctacg tgcacgaagc ggtcatgcag gacctgcccg acctctctgg    173100
     ttacgaagtg tatgcatgcg gcacgccgct gatggtcgac gcggcgcggc gcgaattcag    173160
     cgcgcagtgc ggcctgcccg ccgaggcgtt ctatgctgac gccttcacct cggaagccga    173220
     tctggccaag gccacgccct gagggcgggc cggcgcggga acccggggcg gcatcctcac    173280
     acgcggcgcg tgcaaatgga taccgccctt tttttaatgt cataggcgcg cctggcgcgc    173340
     cggagtaaac tgccggccag catattgacc ggtcatgcgg ccgcggtgcg caggtcgggc    173400
     ccgccgatcc gacccgcacc cagggagcga ttcaggaatg aaagtagcgg tattgggcag    173460
     tggcatcata ggagtctcga gcgcctggtg gctgagccag gcaggccacg atgtcgtggt    173520
     cgtcgatcga tgcaccggcg cggcgcagga aaccagcctg gccaacggcg cgcagatatc    173580
     cgtgtcgtac gccgagccct gggccaaccc gcaggcgccg ttcaagctgc tgaagtggat    173640
     gttccaggac gacgcgccgc tgctgttccg gccgcagctc gattggcgcc aatggcaatg    173700
     gggcctggcc ttcctgcgcg aatgcctgcc gtcgcggctg gcgcccaata tccgcgccat    173760
     ggtgcgcatg gccgaataca gccgcgccac gctgcagggc atgcgggccg aactgggcat    173820
     ccagtacgac catctcgagc gcggcattct caatttctac cgcgaccagc gcgagttcga    173880
     gacctcgcag cgcgccgccg gcctgatgcg cgacttcggc gtcgagcggc gggtgatcaa    173940
     cgccgacgag gtggtggcca tcgagccggc cctggccccg catctccaga ccatcgtcgg    174000
     cggcgactat acgcccgagg acgaaagcgg cgacgtgcat ctgtttaccg ccgcgctggc    174060
     ccgacgctgc gaggccgccg gcgtcgagtt ccgtttctcg acccgggtga cgcgcctgct    174120
     gggcgaaggc gggcgcgtgc agggcgtgga gctgatcgaa cccgacggcc gctacggccg    174180
     gctcgatgcc gacgccttcg tggtggccat gggcagcttc agcgcgcaac tggtgcgtcc    174240
     gctgggcgtg ccctgcatgg tgtatccggc caagggctat tcggcgacct tcccggtgcg    174300
     cccgggcgcg ctggcgccgg tggtcagcct gaccgacagc agccacaaag tggtgttctc    174360
     gcgcctgggc gagcgcctgc gcatggctgg cacggccgaa ctgtcgggct attcgcgcgg    174420
     cctgaatacc ggccgctgcg aagccatgac gcgcctggcg cgcgaactgt ttcccgatgc    174480
     gctcgatttc gagcgcgtca gctactggtc gggcctgcgc ccgtccacac cttccaacgt    174540
     gcccctgatc ggccgtacca gcgtatccaa cctgtacctc aataccggac atggtacgct    174600
     gggctggacg atgggggtgg gctctggccg ggccctggcc gacctgctca gcgggcggcg    174660
     gccggaaccg gaatttccct ttcttggtct gtgaacctat gaagaaactg caaatgacgg    174720
     gctttgcccg cgcgatgcgc gccagccggc gcgcttgtgt gctgggcttg gcgatggccg    174780
     cgatgggcgt ggcgcaggcc gccgactcgg tcgaaatcca ggtctggcat acgctgtcgg    174840
     gtcccaacaa ggccgaattc gagaaactgg ccaagcaatt caacaaggag cagggcgacg    174900
     tcgtcgtcaa gctgcgcgat ttcggcaacc aggacgacct gaagaaggag gccgtttcgg    174960
     ccgtcaagtc caagaaggga ccgaacctgg tgcaactggc ggacaaccac tcgccggaag    175020
     tggtcgccga gcacaagtcc atcctgccgc tgcatcaact gctggccaag tacccggtca    175080
     aggacctgaa ctggttcctg ccgtccacca ccagcttcac gcgcgacggc aagggccgcc    175140
     tgctggcctt cccgtggatg gccgaagtgc cggtgatgtt ctacaacacc gcgtactaca    175200
     agaaggcggg cctcgacccc aacaagccgg cgcgtacctg ggccgacctg caggccgagc    175260
     tgctcaagct gcgcgacgtg gccaacatcg attgcccgta tgccaccagc gaccaggtca    175320
     cggtgcacct ggagaacctg gcgccggtca acaaccagtt gtacgccacc ctgaacaacg    175380
     gtctggacgt cgccaagaag ggctcgccgt ccatgcagtt cgacacgctg tacatgcgcc    175440
     acgtctcgct gatggtgagc tggaagcgtt cgctgctgtt gaccgcgtat tcggacgaca    175500
     acaagagcga ccagttgttc gccaagggcg agtgcgccgt gcttaccacc agctcgagcg    175560
     cgctcggcca gttcctcaac acccgttcgc tgtcgttcgg cgtggcgccg ctgccgtact    175620
     acgaccaggt caccaagacc ggcggccggc cgttcgtcag cggctcggcg ctgtgggcca    175680
     tggaaggcca tccgcaggcc gaggaaaagg ccaccgccaa attcctggcc tggctctcca    175740
     agcccgtgat cgccgccgaa tggcaccagc gcaccggcta cctgccgctg accgaggcgg    175800
     ccttccgcgc ttcggatgtg tcgttctaca acaaggtgcc cggcgcccag caactggtcg    175860
     agctcatgcg caacccgccg gccgccacca gccggggctt tcgcatcgcc aactacgagc    175920
     gcatcgaacc ggtgctcaac acccagctga ccgcagcctt cgacggcaag accccgccgg    175980
     tcgcggcgct gaacaatgcc gcctcgcagg cgcgctcgct cgccgcgcaa cgctgagcgt    176040
     tcaggcgacg caacagaccc gggccgctgg cccgggtttt ttttggcgta cggcgcggtg    176100
     cctgtgcccg cagagggagc gacacccgcg gccagggtgc cccgccggag gcactccgtc    176160
     atggcgccgt gaatgcgcct ggcgttcaat cgcgcttctc ggtgcgccgc cgccgcggcc    176220
     tggccgggga agccgccggc gtgcccagtt tcgcgaccac caggtcgtac agcgcctgcg    176280
     cggcgatcga cagcctttcc tcctgccggc ggacgatgta gatctggcgc gtcaggccgg    176340
     gcagcgagat ggggcggatg agcaggccgg gtcgttcgaa ctggtacagc gtgaaggtcg    176400
     gcacgacgct gatgcccagc ccggcttcga tcatgcccgc cacggtcgcg agctgcgcga    176460
     cctccagtat cgttttcgcg acctgcgggc gcagcgccgc ttccaccgtc tggcgtacgc    176520
     tgctgttgcg cgtgagatgg atgaaaggcc acggcgccag gtgcttgagg gtaaggcgcg    176580
     gctcgcgcgc cagcggatgg tccttgcggc agatcaggtg gaacgtgtcg ctgcacagct    176640
     cgcgcgcatg caggaccgcg gggtccgagg cgcggatgcc gcgcgaggca agcgcgaaat    176700
     cggcctggcc gctgcgcacc agttcgatgc actcgtcgga caggacatcc gagagcatga    176760
     gttcgatgtc ggggtgctcg gcgtggaact catgcaggac tttcggcagc catcccgccg    176820
     ccagggaggg aagggcggcg acatggacgc gcccgcgccg caactcgacg aagctggcga    176880
     tgtgcgtcat ggcgtggcca aggtcggcca gcagcctgcg cgccaggggc tcgaacagct    176940
     cgccttcctg cgtcagcacc acccgccgcg tactgcgatc gaacagctgc atggccagcg    177000
     tcgcctccag ggactggatc agtgcgctga atgcgggctg ggacaaatgg catgcctgcg    177060
     cggccttggt gaagtggcgc aggtcggcaa gcatgacgaa ggcgcgcaat tggcgggtgg    177120
     acagatcggc ctgtggtctc attgatttga gatatctatt aatcaatcca aaaaatcgat    177180
     ttttcttatc gtactgccga ttctaaactg gctgccatcg tcacttcgtg atttcgcaat    177240
     gcgttcactc ccttccctgt tgatcggctg cgccgcaggc ttctcgggcg accgtgtcga    177300
     cgccgccggc ccggtggtcg atacgctgat cgcccgcctg ggcggcgttt ccgccaacgg    177360
     ccgagccttc ctgattttcg agaccctggc cgaacgcacc ctggcgcttg cgcaactgcg    177420
     caagcgcgcc gatgcccagg cggggtacga gccgcggctt gcgcaagccc agccgcgcgg    177480
     ccatgcgcag gatatggcgc gccgcgcctt ccggattggc ggccccgaag ttgctgacga    177540
     tgcgtatgcc gtgcgccagg cagcgcgcca gcaccggtcc gagcatgtcc tcgagccgcg    177600
     catcgcggtg gtcaagggcg acgatgtctc cggcgcgcag catgccggca tgctggccga    177660
     gtacctgggc gagcaatacg atccctccag catcgtcagc gccaatgcct atctgggaag    177720
     cgaacagatt cgcgacgcgc tggaccatgg cgcggaaatc gtggtgtgcg gccgcgtggc    177780
     ggacccgtcg ctgacggtgg gccccgcgat gtcctatttc ggctggcaag ccgacgactg    177840
     ggaccgcatc gggcgcgcca ccatggccgg gcatctgctc gaatgcggcg cgcaggtctg    177900
     cggcggctac tacgccgacc ccggctacaa ggacgtgccc gggctggagc aggtcggctt    177960
     cccggtcgcc gagatcgacg aggacggcca ttgcatcatc ggcaaatccg atggcacggg    178020
     cggcctggtc gacgaggcca ccgtcatcga gcagttgctc tacgaagtcc atgatcctgc    178080
     cggctacctg acgcccgacg tggttgccga catttcgcag gccgaggtcc ggcgcgtggc    178140
     ggacaaccag gtccggctca ccggcgtgcg cggccacccc cggccggcgg cgtacaaggt    178200
     caacgtgtgc ctggaaggcg gctggctggc cgagggcgag atttcatacg cgggcccgcg    178260
     cgccgaggcg cgcgcgcctg gccgccgagg tcgtgtgcaa gcggctggcc gacctgcgca    178320
     tccgtaccga cctgatcggc cgcgtgagca ttttcggcga cgacgccgga cgcctgctgg    178380
     ccggcgcgcc ggcgggcgat ggcgaggacg tgcgcttgcg cctggcggcg cacgccgtca    178440
     cgcgccagga cgccatgcgc ctgacgcgcg aagtgaccgc gctttactgt tgcggcccgg    178500
     ccggcggcgg cggtgtgcgc accacgctga cgccgcggct cgacatggtt tcatgcctgc    178560
     tgccgcgcga cctggtgcgc gccggattcg aaatggtgga tgccgatgtc tgatgtgctt    178620
     gttcccctgt ttcgcgtcgc gcacgcgcgc accggcgaca aaggcgatcg ctcgaacatc    178680
     agcgtgatcg cccgggatcg cgccttgtat cccttgctgg tcgagcagct gacgcccgag    178740
     gtggtgctgg cgcaattcgc gcatcggcgg ccggccgggg cgcagcgcta cctgctgccc    178800
     aagctgggcg ccatgaactt cgtgctggac gccgtgctcg acggcggcgt caatggcgcg    178860
     ctcaacctcg acgcgcacgg caaggcgctg tcctatttga tcctgaagac ggaaatcgcc    178920
     gttccgtccg acctggtctg ccgcctggcc ggttcgcccg gctgaaagcg gtcagtccgc    178980
     ttataacaac tcaactgata aggggccccc tgatgcgata cctgaaaagt acctatgcag    179040
     ccgtcctgct ggctatcggc acggccgtgc cgcacgcgac caccctggcg caggaagtca    179100
     aggttgcggc cgaggcgcca ttgaggctgc tggacccggt gggcacgact gcgtatatca    179160
     cgcgcaacca cgcctacatg gtctatgaca cgctgtttgc gctggatgcg cagctcaagc    179220
     cgcagccaca gatggtaagc acctggagcg tgagccccga caagctggtt taccgcttca    179280
     ccttgcgcga cgggctgaag ttccatgacg gcagtccggt caccgcggcc gactgcgtcg    179340
     cgtcgatcaa gcgctgggcg caacgcgacc tgaccggctt gcgcatgatg gccgcagcca    179400
     aggaaatcac cgccaaggac gacaagacgt tcgagatcgt gctggagcaa cccttcggcg    179460
     ccgtcatcga aggcctgagc aaggccagtt cgctgccggc cttcatcatg cccaagcgca    179520
     tcgccgatgc gccggccagc caggcgatca ccgaggtgat cgggtccggg ccgtttcgct    179580
     tcgtggcgtc ggagtaccgg cccggcctgc aggtcgtcta cgagcgcaac accgactatg    179640
     ttccgcgcag cgagcccccc agcggcctgg ccggcggcaa ggtcgtgaac gtggaccgcg    179700
     tcgtctggct gtcgctgccc gacatccaga ccgaggccaa tgcgctggcc aagggcgagg    179760
     tggactatgt gcagaccgtg tatcccgacg tggtgcagac gctggaggcc agcaaggatg    179820
     tcgtcatcca gaaactggcc agcacgacca cgccgaccct gcgcctgaac tggctgcagc    179880
     cgccgttcaa caaccagaag gtgaggcagg cgctgctgca tgccgtgagc cagcgcgact    179940
     acatggatgc gcaggtcggc gaccccaagg cctatcgcgt gtgctgggcc atgttcggct    180000
     gcgactcgcc gctggccagc acggcgggcg tggtgtccca ggacgacgag gccgatctca    180060
     acgccgccaa ggccttgctc aaggaaagcg gctacaagaa cgagaaggcg gtcgtgctgc    180120
     acgccaccga ctatccgccc acctcggcca tctcgccttt cacggcgcag atcctgcgct    180180
     ccatcggcat gaaggcggaa gtccagtcca tggattgggc gaccttcctt acccggcgcg    180240
     gcaagcagga cccggtggag aagggcggct ggagcgtggc ctacggcagc tggaacaccc    180300
     tggacctgat gtcgcccatc gccaacctca acctcgatgg ccgcggcaag gagggatacg    180360
     cgggctggac cgagagcgcc gagatggagt cgctgcgcac gcagtacgcg caggccactg    180420
     agcccgccag ccgccagcag atcgccgcga agatacagca gctggcctat gaccaggtct    180480
     tctatattcc gctgggtacc tacagcaatt acgccgcccg ccgcagcaac gtgacgccgc    180540
     tgctggacgc gcccgtgacg gtattctggg gaatatccaa gaactgagtc gccgcgcggc    180600
     gccgccatgg cgccgcgcag cacgtaggag atcgttttcg tgcaaattct gaggttgctg    180660
     ttcctgcgcc tggccagcgc cattcccgtg gtgctcgtgg tggtgacggt ggttttcctg    180720
     ctggtcaggc tgaccggcga tcccgccacg attctcgccg gcgacatggc cagccccgag    180780
     gtggtcgcca gcgtgcgcgc cgacctgggg ctggaccgcc ccttgctggg ccagtatgcc    180840
     caatggctgt gggatctgtt gcagggcaac ctcggcacat ccatcgtcac caagcagccc    180900
     gtggcgacgc tgatcggcga gcgcctcgaa tcgaccctgg tgctgtcgct cagcgcgctg    180960
     gtggtcacgg tgctgctggc ggtgccgctg ggcgtgctgg cggcctggcg ccacaacacg    181020
     ctggtggacc gggtcgtgat gatctacgcg gtcatcggct tctcgctgcc cagcttcgtg    181080
     gtggggtacc tgttgatact catgttctcg gtctggctgg gctggctgcc ggtgcaggga    181140
     tacgtcagca tcaccgacga tatctggctg gccgcgcagc acctggtatt gcccaccctg    181200
     gcgctggcga tcttctacat gtcgctgatt tcgcgggtga cgcgcgccag cgtgctggaa    181260
     gtcctgaacg aggatttcgt gcgcaccgcc aaggccaagg gggtgccgcc gctgcgcatc    181320
     ctgtcgcagc acgtgctgcg caacgccgcg attcccatcg tcaccgtcat cggcatcggg    181380
     ctggccttcc tgatcagcgg ggtggtgatc accgagagcg tgttcaacct gcccgggctg    181440
     ggccgcctga ccatcgacgc cgtgctgtcg cgggactacc ccgtggtcca gggcgtcatc    181500
     ctctttttcg cctgcgtcta catcctggtg aacctgttga tcgacatgct gtacgtggtc    181560
     atcgatccac ggatccgcta ctgacgatcc ggagacgagg catgacatcc attcttcgcc    181620
     acaacagact ggcgctgctg ggaggcggcg tgctgctgct gatggtcgcc atcagcgtcg    181680
     cggcttcctg gatcgccagc acggaccctg cgatgatgca gccgcgcatg cgcctgacgc    181740
     cgccgggaga ggccttcctg ctgggcaccg atgcgctcgg gcgcgacgtg tactcccgcg    181800
     tcgtgcatgg cagccgcatg tccctggcca tcggcgcgct ggtggtcctc atcacgattg    181860
     cgatcggcac cctcatcggc ctggtggccg gggcctcgcg catcatggac cgcgtcctca    181920
     tgcggatcat ggacggcgtc atggccattc ccggcatcct gctggcggtg gccctggtat    181980
     cgctgttcgg cgccagcctg gcttcggtcg tgatcgcgat cgccgtgccc gagattccgc    182040
     gcgtggtgcg cctggtgcgc agcgtggtgc tctcggtgcg cgaagagccc tacgtcgagg    182100
     ccgcggtcgg gctcggggtg ccgtatccca aggtcgtctg gcggcacatc ctgcccaatt    182160
     gcttcgtgcc gctgatcgtg caggccagct acgtgttcgc cgcagcgatc ctgctcgagg    182220
     ccgtgctggg ctttctgggc gtgggcttcc cgcccgagat ccccaccttc ggcaacatcc    182280
     tagccgaggc gcggccggtc ttccagcgcg cgccgtgggc caccgtggcg cccggcctgc    182340
     tgctggccgt caccgtgctg gcggtgaacc tgctgggcga tggactgcgc gacagcctgg    182400
     acccgaaact cgcgaggcgc gcaaatgact gagaacacac cgaagcaacg ggtgctggag    182460
     gtgtccggcc tggccatccg cgccggcgcg cggacactgg tgcaggacgt cacgctgagc    182520
     ctggcccagg gagaaatcct gtgcctggtg ggcgaatcgg ggtcgggcaa gtcgctgacg    182580
     gcgtcggccg tcatggggct gctgccgggc aacctgggcg tgggcgccgg cagcatccgg    182640
     ctcgatggcg aagacctgac cgcggcgtcg ccggcgcgca tgcaggcgct gcgcggcgac    182700
     cgcatggcca tggtgttcca ggaacccatg acctcgctca atccgctgat gcgcgtggga    182760
     cgccagatcg cggaggtgtt gcaggtgcac cggccggacc tgggcgccgg gcaagtgcgg    182820
     gcacgggtgc tggagctgat gggcgatgtg cacctgccca cccccgaggc gctcatggac    182880
     gccttcccgc atcagttgtc gggcgggcag cgccagcgca tcatgatcgc gatggcgctg    182940
     gcgctggagc ctgcgctgat catcgccgac gaacccacca cggcgctcga cgtcacgacc    183000
     caggtgcagg tgctcaagct gtttcgccag ttgctggcca agcattcgag cgcggtgctg    183060
     ttcatcacgc atgacttcga tgtggtgcgc gatatcgccg accacgtggc cgtgatgcag    183120
     ctgggccgca tcgtcgaaca ggggccggcc gggcaggtgc tggacgcgcc ccgccacgac    183180
     tacacccgca agctgctggc cgcggtgccg agcggcgtgc ccaagacgca gcagaacgcg    183240
     tcgtccgatg aactgctgtc ggtaagcggc ctgaacctgg tctacgagtc gcgcggcctg    183300
     ctgggcccgg cgcggcgcac gcatgccgtc gccgatgtcg gcttcacgct gaaaaagggc    183360
     gagaccctgg gcgttgtcgg cgagtcgggc tcgggcaagt ccaccctggg gcgctgcatc    183420
     acgcgggcgc atgcccccac gtcgggccgg atcgtcttcg acggcgtgga catcgcgggg    183480
     ctgtcgggca aggcgctgcg ggcggtgcgc cgccgcgtgc agatggtgtt ccaggatccc    183540
     taccggtcgc tgaacccgcg ccgcaggatt ctgcatgcct tgatcgaagg cccgatcgaa    183600
     agcggggtgg accgcaagac ggcctgcgcg cgcgcggccg agctgatggc cctggtgggc    183660
     ttgccggccg acggcctgca gcgttatccg caccagttct cgggcgggca gcggcaacgc    183720
     atctgcattg cgcgcgccct ggcgatggag cccgacctga tcgtcgcgga cgaggccgtg    183780
     tcggcgctgg acgtgtcggt gcaggcgcag gtgctggagc tgttcgaaga cctccagaag    183840
     cggctgggat tcgccatgat cttcattacc cacgacttgc gcgtggccgc gcaggtctgc    183900
     gaccgcatcg gcgtgatgca gaaaggacgc ctgctcgagc tgggcccggt gcggcaggtc    183960
     atccatgcgc cccagcaccc ctatacccgc cacttgttcg attcgctgcc cggccgcgtg    184020
     ggccagacgg cggaacccgc catggagcta caggcatgac cagtactgac cagcatatcg    184080
     cccgggccgg cgtcgccgag ctcgccaggg ggatcgcccg gggcgcgttc acgcccaccg    184140
     aggtgaccga cgtcttcctg cgccgcatcc aggacctgaa tcccgcgatc ggggcgttcg    184200
     tggccgtcta cgaggacgag gcccggcacg cggcccgcca ggccacgcag gcgctggcgc    184260
     aaggacagcg cctgagtccg ttgcacggca ttccgttcgc cgtgaaggac atcgtcgacg    184320
     tggccggcaa attcacgacc tacggctcgc gcaccggcgc ggggcggcag gccggcgcca    184380
     ccgctgagta cgtgcgtgcg ctgctcgatg ccgggatgat cctgctgggc aagacgcaca    184440
     ccgtggaatt cgcattcggc ggctggggca ccaaccagcg catgggaacg ccgcgcaatc    184500
     cgctgcgcgc ggacgtgccc tgcgcgacgg gcggatcgag cagcggatcg ggggccgcgg    184560
     tcggcgcgca gatggtgccc ttcgcggtag gcacggacac cggcggctcg atccgcattc    184620
     cttcggcgtt ctgcgggctg accggcatgc ggcccagcat gggacgccac agcggcgcgg    184680
     gcgtcatgtc gctcagccac accctggaca ccatcggacc gctggcgcgc accgtcgaag    184740
     acgtgcagat gctcgacgac ctgttgaccg gcaagaccgc cacggacacc gcgcagccgg    184800
     gttcgcaggc cgtggcgcgc gtgcgcgacg cgcgtatcgg cgtgctcggc gcgcaatggc    184860
     tgggcgccat cgagcccgag gtggcgcacg cctatgcgca aagcctgcgg gccttcgagg    184920
     cgatgggcgc gatgctggtc gagctggcgc tgccgttcga ccgggaggcg ttcgcccagt    184980
     tgacctcgac gctgatcgcc tgcgaaggcc tgcagttcgc cgggaagtac gcccacgacc    185040
     cactgtccgg catggacgag gacgtgcgcg cgcgcttcct ggtgggcgac cagtacgatg    185100
     ccgaggccta tgccggattg ctggggcgcc gcagcgcgat gatcgatacg ttcacgcagg    185160
     cgatggccgg cgtcaaggcc ttgctgatgc ccacgacgcc gtgcgtggcg cagccgcttg    185220
     cggggctgga gcagtcgccg tacaacccgg cggtgtacac gcgcctgccg gcgtggctcg    185280
     gctgctgcgc gttggcggtg cccaacggca cgggggcgca cggcttgccg acctccctgc    185340
     agatcgtcgg cctgcccgaa tcggaccggc tggtgatgtc gctggggcgc gcctaccagg    185400
     aatacgcgta gggcgcgacg cgctgcgggc cggccgctgg ccggcctttt ttatggccat    185460
     gcagatcgcc tggcaaggca tggtgcccga ttgatccatg cgtacatgtc ggtctaggcg    185520
     cgccccgccg gctgcgtcac catgcctggc atcccgcggc cgtcgcgccg ccttgccagg    185580
     aaagtcgcat ggttcgatcg ctgtccatag tgtgcctgct ggccgtcttg caggcctgcg    185640
     cgggctcgcg cccggccgcc gtcgcggccg cctgggacga ggcgccggcc ggccagtacc    185700
     gcttcgactg gcagctgtcg ggcgacccgg cggtggcgcc gttgcaggtg ttcgacgatg    185760
     cgcggcgcat ctggctgcag ttcgcgccgg gccagccgat accggccatc ttcgcgcacg    185820
     gcgccggcgg cgaacgcccg gtgccgtacc tgcgccgcga cccctacatc gtcgtggacg    185880
     gcgcctggcc cgcgctcagc ctgcgcggcg gccgctatgt cgcgcgcata cagcgcagcg    185940
     gcgcgccgac ggcggcgggc gcgccggccg tccgcgccga ggcgccggcc ccggccacgc    186000
     cagccgccgt cgcggcctcc gccgccgcgc tttcgggccg cgccgcccga cctgaccttg    186060
     cgggccgtgc tggcgcgctg ggcgcgcgcc gcgggctgga cgttcgaggc cgaacactgg    186120
     gccctcgacg tcgacattcc gctggcgggc aaggccgaac tgccgggtga tttcaagacc    186180
     gccgtgcgcg cgctgctggc cgccaccgaa ttgtccgagc ggccggcgca gccgtgcttc    186240
     tacgccaacc gggtactgcg cgtcgtgccg ctggcgcaag cctgcgaccg cacgcgcgcc    186300
     gccgcgccgg ggctgacatg aaggcgcggc gcctggccat ggcgggtctg tcgctggcgc    186360
     tcggcggctg ctcgctgtcg cagcagatgc aggccatgcg cgacgccgcg acgtccctgc    186420
     gcgcacgcct gctcgaaggg cagcaggccg tgggccgggc cggcgagcgg ccggcgcgcg    186480
     aagccgccca ggacgtcgcg cggccctggc tggccgggcg cgcccagccg ctggcacgcg    186540
     aggtgctgct gccgccggcg ctgcgcgccg atgtcgatac gaccctgctg ttcgcgggca    186600
     aggccacgct gcccgtgctg gccgagcgcc tgcatcgcgc caccggcatc gccgtgcgcg    186660
     tgcatcccga cgcgctgctg ccgcgcgccg ccttcctgcc gcgcctggcg gggcaggccg    186720
     agctggcggc cgagcctccc gcccaggccg aactgcgggc cgggccgcgt ccgctggccg    186780
     acacgctcga cgcgctggcc gcgcagctgt acgtgcactg gcgctaccat cgcggcgcca    186840
     tcgagttcta ccgcaccgaa acgcgggtct tcgatgtgcg cacgctggcg ctggccgcca    186900
     gcgcgcaggc tcggctgggc cgcgccggca gcggcgagac gggcagtttc gaccatgcct    186960
     cgagcacggt gctcagcgcc gacgccggca aggcgctgca ggccgtgcgg gaccgcgtcg    187020
     ccgctttcct gacgcgcgcc ggcgtcatcg ccgagatcga ggcgggcgga agcacgctcg    187080
     cggtcacgga tacgccggag gcgctcgcgc gcatcgaaaa atacctgcaa ggcgagaacc    187140
     gcgccctgac gcgccgggta cgcctggtgt tcgaagagct cacggtgcgc accacggccg    187200
     ccgccgaagg cggcatcgat tggcaggcgg tctacgccag cgcgcgcgcc gcggcgtcgt    187260
     acgccatgcc cggcggggcc ggcgcggcag gcgcgctcgg ggcccgcgtg ctggccgggc    187320
     cctggcgcga cgcgcgcgcc ctgatcgccg cgctgagcac catgggagcg gtactgcgcc    187380
     atcgcagcat acccatgctg acgctgaacc ggcgcgccgt cacccacgcc gtgcgcacca    187440
     cgttttccta cgtggaccag gtgcagcgcc tgagcccgac cgcggcggcg cccggtgggc    187500
     gcgatgccgt gcccgggctg gcggtgcagc agaagcgcga gacggtgggc acgttcctca    187560
     cgctgttgcc cgaggcgcgc gatgacggcc gcatcctgct ctccatttcc tatgacaaca    187620
     ccattgccca gccgctgcgc accctgacct tcggcgaggg cggccagcaa gtgtcgctgc    187680
     agcagatcgc catcgacggc agcggcatcg tgcagcaggt cgagctgctg cccggccagc    187740
     ccgtcatcct gtcgggcttc gaccacagcg aagaccaata cgaacgccac cgcctgtttc    187800
     ccgatgcgcc gctcgcggcc ggcgggcacg accgcacggc gcgcgagcgg gtcacgaccg    187860
     tggtcatggt caccgcgcag atcgacgagg gttgagccat gcgcgccgcc acgcatccgc    187920
     cgctggtgct gcagcagacg cagggcgggc ccatgctggc cttcgggctg acatggttcg    187980
     ccgtgctggg cagtcacgcc gcgctgcagg ggcgggcccg cgcccgcgcc ttgcgcgcca    188040
     cgcactacgt ggtgggcggc cggcacgcgg ttgccgcggg ttgcgcgcgc ctgcctcgcc    188100
     gctatggcgc gatggcgatc cacagcgcgg cgcaggcgta cgccagtctg catccggatg    188160
     gcgcgcaggc gggcgtggcc agcctgccgg acgggcaggg ctggctgatc gccgtgcagg    188220
     acggcgccgt gcttgccagc gccgaccggc tctttgcgga tgccgcgcag gcgcaggcct    188280
     gcctgcgcac gctattggcg cagcgtcccg acctgcgcga ggtgccggcg caggccgcgc    188340
     tggatacctt gctggccagg ccggatccct ccgcgcgcct ggcgccgctg gcctcgcgct    188400
     ggtcgcgtgc gccggtagcg gcgcgagcgg tcgtgctggc gctggcggtg gccggcggcg    188460
     cctcgctgtg gcgcggcctg ggccaggcgc cgccgcccgc cgcgcccgat ccgcgggccg    188520
     tctggcgcgc cgcccaagcg gagttcctgc gcggctggcc ggtgcatacc agcagcgagc    188580
     tggcgcgggt gctcgatacc ttgcaggcct tgccgttgca ggtcgccggc tgggcgctgc    188640
     ggcaggcgca atgcgtgccg ggcccggcgt ggcactgcga cgccgactac caccgcgtcg    188700
     atgcggcggc caccagcctg gcgtttgccg ccgcggttcc gcccggctgg cggatgcggc    188760
     tgcatacgct ggagcatacg cgcgtggcct ggacgctggc cggcgaccag cacgggctgg    188820
     atcgcaccgc gccggcctcg ccggccgaca cgctggcgct ggccgccacg ctgcagcgtg    188880
     ccagcgccgc cttcacgcat gtctcggtgg gcgccgcgca agcgctggcc ggcccggcct    188940
     gggatggtcc gcccgagctc gcgccgcctg ccgcgcccga gcttcaccgg cgcgaggtcg    189000
     tgctcgacgg gccgctgcgt tcgctggcgc tggtgtggcc gctgccggcg cccatcggat    189060
     ggaccgcggt gtccctgcgc gtggtcccgg acgcgatcgc gacgctgcgc gccagcgtgc    189120
     tgtcgctgca tcttcaagga tccctctatg agcagacgac ttcccgttcc tagcggggca    189180
     ttcctgccag cgctggtatc ggccctgacg gtccatgccg cgcaggccca gccggccgcg    189240
     ccgcccgagc cctggccgca cgccgatacc gtgcgcgagc tgctgcggcg cgaaaccctg    189300
     gcggccgcgc agccgccgcg accggcagcc ccggcgccgt ggagcgacgc gccagccgcg    189360
     cgcaaggcag cgccgggccc gcgcgccgac cgcatcgtat tgctggccat ctacggcgtc    189420
     ggcgctgcgc tgcgcgcgga ggtctccatc aaccggcgcc attggcgcta cctggcgggc    189480
     cagcgcaggc cgttcggcca ggcgcccgag gcccgctacc agctcgaagc catagccgcg    189540
     ccatgcgtgc acttgcgcag cggcgcggtc cgccgcaccg cctgcctggc tccggccgcg    189600
     agcctggaca acggcgcggc gtccgccgca ggggccgcgc catgagaatc cgatcccaca    189660
     ggccggcctt gcacagccca tgcaccacgc ttgctccctt cgtggccgac cacgaggcgc    189720
     tgggccgcct gcgtccggcg ttcgtgcgtg cgctggcgcg ggagttcgac ctcggcgccc    189780
     tggcgggacg cctgtgcccg gtgctgctcg aaggtagcta cgccgccttg ttcgcgctgg    189840
     ccgactacgt acatggcgac caggccgacg aactcgagcg cctcatgcgc aagcgcggct    189900
     accggctggc ggcgccggcg cgctatgtgt tgccgtcgcc cttgctgctg gccgtggcgc    189960
     gcgaggcggc cggcgccccg ggcctgcatg cggccgacca tcccgcgcaa cggcgcacgg    190020
     cgctgcaggc gctgttcttc gacatggtgc gctggggcgt gcgccacggc gccagcgatc    190080
     tgcacctgca cgccgaccga cgcgccgcca ccgcgcaggt tcgctatacc gtgggcggcg    190140
     cctacgtggc cgcgccatgc ttcaatggcc tgtcgcatgc ctgcctgctc gaaatcctcg    190200
     cggtggcctg gatggacgtg cgcgcgggca acggcgcggt gttcgatccg cgtgccgaac    190260
     agcagggacg catcgcgctg caggtcgacg aggtgccggt cgtgctgcgc tgggcctccc    190320
     tggccacgga tcacggtccg tccgtatgcc tgcgcatcct gcgccaggac ccgccgcaag    190380
     gcggggccag cctggcggaa ctgggctatc tgccggcgca ggtcgccacg ctcgagcgcg    190440
     cctgccagcg cgccggcggg gcggtggtgc tggcgggcac ggtgggggca ggcaagtcca    190500
     ccaccatcgc caccatgctg cgcggcctgc cggccgagcg caagctggtc accctggaag    190560
     acccggccga gtacgccatc gccaacgccc tgcagaacag cgtgagccgt tcgctggacg    190620
     gagaggccgg cgcgccgttc gatgccaagc tgctgaccat caagcgctcg gccatgcacg    190680
     acctgtacct gggcgaggtc cgagatcgcc agaccggacg cgtcttcacc gacctggccg    190740
     gctccggggt cagcctctac accacgacgc acgccggctc cgccttgctg attccggaac    190800
     gcctggcatc cgacttcatc ggtgtgtcgc gcgacttcct ggccacgccc ggcgtgctca    190860
     agctgctggt ctaccagacc ttgctgccgc gcctgtgtcc ggcatgcgcc ttgcccctgg    190920
     ccgtgctgtg gcgccgcggc gccggctggt cccacgcgca gcgcctggcg tggcgttgct    190980
     gggccgcgcg cctgcgccgc gcctgcgccg cgccggcgtg gcgctggcgc aggcgcgcgt    191040
     gcgcaatccc gccggttgcg cggcctgcgc gggcgccggt ttgccggccc tgcgcggcta    191100
     cgcggggcgc accgtggtcg ccgaactgct cgaaccggaa accgacgccg tcctgctcga    191160
     tctcatccgc cggcgcgaca atccggcgct gcgccgcttg ctggggcggc gcgcacgccg    191220
     gcagccgccc gacgcgccgc tgcgggcagt cgattgcgcc tggcgcaagg tcgaagcagg    191280
     cgcggtggat ccgcgcctgg tcgaacgctg tttcgcgctg ccacccgcct tgcgcacgcc    191340
     ggcgggcgcc gaggacggcc atggctgagc acgcggcgct ggcgtcggcg tggcgcgcgg    191400
     ccggcgcgct gggccagcgg ctcgacgcat ggcgcttcgg cgccgagcgg ggcgactact    191460
     acgaatacct ggccgacatg ctggaaggcc tgcaggggcg ccagaccctg cgcgacatct    191520
     tcgagaccga cgcggcgcgc catggcgagg cgagcgtgcg cggccgcttg gcgcgccgct    191580
     ggctgcaccg ctaccaggat tgcggcggcg acctgcgcgc cacctgggcc cgttgcctgc    191640
     ccgaaggcga ttgcacgctg ctggcgctgg cgcaggcggc gggcggcggc gcgctgggca    191700
     tcgtgttgcg cgacctggcg cacctgaccc gcctgacgca gggaatgcgg cgcgagttct    191760
     gcgtgacgat cgccgccggc ttggtcgcca tgacggtggc ctgcgccttg ctggcggccg    191820
     tgccggcctt cagcgcgccg cgcctgcgcc tggtattcca ggccgtgccg ccggattacc    191880
     acggcgcctg gtcggccggc ctgttcgcgc tggccaggta cgtcgaggcg gcctggtccg    191940
     cggcggtggc ggcattgaca gcggcggtgg cgctggtgtg ctggtcactg ccccgctacg    192000
     ccgggcgcgc gcgcgtgttc ctggaccgct ggcagccatg gcgcctgtac cgcgatatgc    192060
     aggcgatccg cttcctggcg ctggccaccg tgctgttgcg ccagcggggc aacatcgaca    192120
     cgcgcctgcg caccgcgctg ctcgtccagg gggccgacgc gccgccgtgg ctggcctggc    192180
     acctcgagcg catgctgctg cgggtcgacg ccggggtggt cgatgccagc gtgttcgata    192240
     ccgggctgtt cgaacccgcg cacgcctggt tcatggccga catggtcgcc gcgcatggcc    192300
     tggccgacgg cttggcacgg gcgcgcacgc gggtcgaggc gcacatgctg ccgcgcctgc    192360
     ggcgccaggc gcagggcctg cgctgggcac tgctgctggg cgcggtcggg gcggtgctgg    192420
     ccctggcgtt gtggcattac gccgccatcg acgatctacg gcacgcattg gtcagtttct    192480
     acgccagcca ataagcctcg gcaggcgttt cttcacgcag gaggattctt catgtcacac    192540
     acgattctgt ccggccgcca agccggcttc tccctggtcg aggtgtccat cgtcacggcc    192600
     atcgtcttgc tggtggccat catcggcatt cccgccatcg gctcgtatgt catcgaaagc    192660
     aaagtgcccc gggtcggaga ggaactgcag cgtttcgtgg cgcggaccaa ggccaatgcg    192720
     caaggcgatg gcgcggcgcc ctatacgggc atcggcacgg cgtcgctggc gcatgcgctg    192780
     cgcgattcca gcgtggtgtc ggtgcgcggc gagggcgcgt cggcgacggt cgcgcacggc    192840
     ctgggcgggc agggggctgg cgcccatggc gtcatcagcg tggcgccggc cgcgccgggc    192900
     ggcgcgccgc ccggttcggc gttcacgctg acgctgacca atgtcaacgg cgcggcctgc    192960
     ccggcgctgg cctcggtcat gcagcgcgta tccgacatca tcgccgtgca gggcaaggcg    193020
     gggccggtgg tggtcaagaa tgcgctggcc gtcccggcgt tgccgtaccg cgcgcaggcc    193080
     gcccaggcgc agtgcgtggc gggcgatcga aataccttcg tgttcacggc gcgatgagat    193140
     ccgcgcacgc ccagggcggc ctggccttgc tggaactggc cgtggccgcc gcgctcgcgg    193200
     ccatggcggc ggtgtgggcc gccaaccggc tggtgcagga tgcgcaggac gcggccgcac    193260
     gcggtgccgg cgtctggctg ggcgaaatcc agcgcggcct cgaccaactg ctgcagcggc    193320
     atttcgacac gctggccgat gggctggcgc cgcgcgatga gcgcgggcgc gcgctgtttc    193380
     gcgatgcctg gcgtccgacg ctgcccgagc tgcaggccgc cggcctgctg gcgcgttccc    193440
     tgccgaggca ctcgcccctg ggcacggggg taatcatgct ggtccggcgc gatccgcatt    193500
     gtccgcgggc gggctgccgg ctggacgcgc tggcctggct ggaccgcccc ttgctggatg    193560
     gccacggcca ggtcgacctg atgcgcatgg cgcccctggt ggccgccacc gccggccgtg    193620
     gcggcttcgc cgtggccggc ggggtgcgcg gcgcggcgtt tcgcttcgcc aatccgccct    193680
     ggccgggcgt ggcgcggctg cccgccggca cgccgctggc ctgggccggc ctggcggcgg    193740
     gcaaggcatc gccggcgttc ggcggcgcct attcggtgaa ctcccacgtg ggctgccgct    193800
     cgtacagcgg ccataccagc cgcaatccgc tcaccggaca gtgttcgtgc ccaccgggtt    193860
     acgcgtcggt catcatggcg caggccatcg accgcgtgga cggcgcgccg gggttcacca    193920
     gcttcgtctg cgtgcgtccg ggcaaggagt agggcggcgg cgctggcatc ggcctgccga    193980
     ccctctataa tcaaaaattc gccaaaatcc cgattcatcc acgatgaaat cctctgagat    194040
     tcgccagaag ttcctgcaat tcttccagtc caagggccac acgatcgttc cgtcgtcgtc    194100
     cctggtgccg gccaacgacc ccacgctgct ctttaccaac tcgggtatgg tgcagttcaa    194160
     ggacgtattc accggcaagg aagcgcgcgc ctacaagcgc gccacgtcgt cgcagcgcag    194220
     cgtgcgcgcc ggcggcaagc acaacgacct cgagaacgtg ggctacaccg cccgccacca    194280
     tacgttcttc gagatgctgg gcaacttcag cttcggcgac tacttcaagc gcgaggccat    194340
     ccagtacgcc tgggagctgc tgacccaggt ctacaagctg ccggccgaga agctgtgggt    194400
     cacggtctac caggaagacg acgaggccta cgacatctgg gccaaggaag tcggcgtgcc    194460
     cgccgagcgc atcatccgga tcggcgacaa caagggcgcc cgctatgcgt ccgacaactt    194520
     ctggcaaatg gcggacaccg gcccctgcgg cccgtgttcg gaaatcttct acgaccatgg    194580
     tccggaaatc tggggcggcc ctccgggctc gcccgaggaa gacggcgatc gctacatcga    194640
     gatctggaac ctggtgttca tgcagttcga gcgcgacgcc gccggcaaca tggaacgcct    194700
     gcccaagccc tgcgtggaca ccggcatggg cctggagcgc atcgcggcgg tgctgcagca    194760
     cgtgcattcc aactacgaga tcgacctgtt ccagaagctg atcgccgccg ccgcgcgcga    194820
     gaccggcgtg aaggatctgg ccgataactc cctgaaggtc atcgccgatc acatccgcgc    194880
     ttgcgccttt ctcatcgtcg acggcatcat tcccagcaac gaaggccgcg gctacgtgct    194940
     gcgccgcatt gtgcgccgcg ccctgcgcca tggctacaag ctgggccaga ccaagtcgtt    195000
     cttccatcgc ctggtgccgg acctggtggc cgagatgggc gaagcctatc ccgagctggc    195060
     ccaggtggcc gagcgcgtgg cgcaggtgct gcgccaggaa gaagaacgct tcggcgaaac    195120
     gctcgaacac ggcatgaaga tcctggacgg cgcgctggcc aaggtcgcca agggcgaccc    195180
     gctcgacggc accacgttgt tcacgctgta cgacacctac ggctttccgg ttgatctcac    195240
     cgccgacatc tgtcgcgagc gcgaggtcga ggtggacatg gccggcttcg aggcggcgat    195300
     gcaacgccag cgcgagcagg cgcgcgccgc gggcaagttc aagatggccg agggcctgag    195360
     ctacgaaggc gccgagacgc gcttcgaagg ctacgagaac ctcgaattga gcggcgtcaa    195420
     ggtgacggcg ctgtatgtcg agggtaccca ggtcgagcag gtgtcggcgg gccaggacgc    195480
     ggtcgtggtg ctcgatgcca ccccgttcta tgccgagtcc ggcggccagg tgggcgacac    195540
     cggcctgctg gaggctggcg gcgtgcggtt cgcggtggcc gacaccctca agatccagcc    195600
     cggcgtgttc ggccatcacg gcacgctcga ggccggcgcg ctgaaggtcg gcgatacctt    195660
     gctggcgcgc gtggatgcgg tgcgtcgcgc ccgcacggtg cgcaaccact cggccacgca    195720
     cctgatgcac aaggccttgc gcgaagtgct gggcgcccac gtgcagcagc gcggctcgct    195780
     ggtcgacccc gacaagaccc gcttcgactt cgcgcacgac gcgcccatga cggccgagca    195840
     gatcgcccgc gtggaagcca tcgtcaatgc cgaggtactg gccaaccagg ccacagaggc    195900
     caaggtcatg gcctacgacg acgccgtcaa gggcggcgcg atggcgctgt tcggcgagaa    195960
     gtacggcgat accgtgcgcg tgctcgacat cggtttttcg cgcgaactgt gcggcggcac    196020
     gcacgtgcgg cgcaccggcg acatcggcct gttcaaggtg gtgtccgaag gcggcgtggc    196080
     ggcgggcgtg cgtcgcatcg aagcgattac cggcgacaac gcgctggcct gggtgcagga    196140
     ccagaacgcg ctgttgcagc gcgccgccgg tgtgctgcgc gccccggcgc acgagcttcc    196200
     cgagcgcatc gcccaggtgc aggaacagct caaggcgctc gagaaagagc tcgagcaggc    196260
     gcgcaccaag ctggccgcca gcgccggcaa cgacctggtc gccacggcca cggtcgaggt    196320
     caagggcatc aaggtgctgg ccgccagcat cggcgatgtg gatcccaagg ccttgcgcgg    196380
     catggtcgac aacctgaaag accgcctcaa gcccgccgtg gtcctgctgg ccgccggctc    196440
     ggccgatggc aagatcagcc tggtgggcgg cgtgacggcc gatctcaccg gccgcatcaa    196500
     ggccggcgat ctggttggct tcgtggccgg ccaggtgggc ggcaagggcg ggggccgtcc    196560
     cgacatggcg atgggcggcg gcaccgatct ggcggctctg ccggctgccg tggccagcgt    196620
     acagaagtgg gtcgatgagc gcctctgata ccggcggcct gccgtcctac cagcacgaag    196680
     tcgatgccag cgggctgacc tgtccgctgc ccatcctgcg cgccaagaag gcgctggcgc    196740
     aaatggaaag cggccaggtg ctgcgggtgg tcaccaccga tcccaacgcc atccgcgatt    196800
     tccaggcctt cgcgcgccag accggcaaca ccttgctggc gcaacgcgag gccgagggcc    196860
     gcggcgagca cttcctgcag cggcgctgag cgcctgccgg caagcaaacg gcccgcgcaa    196920
     gcgggccgtt tgtcttggcg cgagcgtgcg tggggctagc ggctgcgcac ggcggcggcc    196980
     agcgcccgcg tcaccgtgaa gtcgaccagg tcgccttcct tgagggtacg cagtttttcc    197040
     tgcgccgcgg cgctgcgcaa atggaaggtc tcgcggccgc cctgcgggcc ttgcaggatg    197100
     accgtgcggc cgtccttggc gatgtgccag atttcggccg tgatggtcgt gctgcggccc    197160
     accgcgcctt gcggcagggc gccttccttg gcgcgggtgg cgacggtctc gctgcggact    197220
     tccggtacac cgctgccctt ggcgcgcgtg gcgatcgaca cggattcgta gtagtccaca    197280
     cgcatggtgt cgcctacctt gatgcggtcg aaattgcgca cgtcggggcc ggcctgcagg    197340
     ggaacttcgt tgccttgcgg gccgcgcacc gtcaccgtgc gcgtggcggg gtccaccgcg    197400
     gtgatctggc ctgtgaccga aaccagggcg gcgtcgccga cccgggcggc cgccggcagg    197460
     ggcaccgcca ggacggcggc cagggcgccg caggcggcca ggcgggtaag cggggcaaga    197520
     atcgaacaat gcttcatgat ggaaagctcc tgtcgatgcg atgaaacagc gggcggtgta    197580
     tgcttgcata cctgccgggc cggctgcctt tgcaggcagg ccggcgcgcc gcttgcgagg    197640
     ggccttcggg ccgcccgcgt ggccgccccc cgattgcgtc acgcaagcat acgcctgtgg    197700
     cgcgggcggc gttcagcgca gttgggcatt cgtcccattt ttttgtctgt ccatagggga    197760
     aaaacgcaac ttcagttgcc accaggcaac tttaagtgct agaatttccc atttttcaca    197820
     accaattcaa gggattacct atgctggtga ttcgtctggc ccgcggtggc tcgaagaagc    197880
     gtccgtttta caacctggta gctaccgatt cgcgcaatcg tcgcgatggc cgtttcgtcg    197940
     agcgcgttgg cttttacaac ccggttgccg ctgaaggcac cgagaatctg cgcatcgccc    198000
     tggaccgcgt gcaatactgg accggcaacg gcgcgctgct gtcgcccgcc gtcgagcgcc    198060
     tggtcaagga atactcggcc aaggtttcgg ctgctgcctg agcccgctgc cgggtgcggc    198120
     gggtgcgggc gcgcgtaagc gtacccccgg ccgtgccccc gtgcgcgtct ggccggggct    198180
     ttgccatgcc cgccagcgcc tgcatttctt gaaagcgctg cctatgccag cgctttcttt    198240
     gtccgcaact ttgctacaca cgacacatgt ctgaagccgc acattccggc gcggcgcccg    198300
     cggatctggt cgagctgggc cgcattgcat cggcctacgg tgtcaaaggc tgggtaaagg    198360
     tgcagcccca ctcggcgcag gccgaagtgt tgcgcaccgt ctctcactgg tggctgactc    198420
     gccccgcgcc gcaagcggcc cgggacgttg tcgcgtccgt gccgcgcgcc tatcaggtgc    198480
     tgcaggcgcg cgtccatggc ggcgcggtgg tggcccagct ggcaggcatc gacgaccgcg    198540
     atcaggccga ggccttgcgc ggttgcttcg tccaggcggc gcgcagcgcc tttccggcgc    198600
     ccgccgacga cgaatactat tgggtcgacc tgatcggctg cgcgctctac agcgatgcgg    198660
     acggcgagcc ccgcttgctg ggcgtggtcg acgaggtgtt cgacaacggc gcgcacgcgg    198720
     tcctcaaggt cttgcgccag cagatccagc ccggccagcc cgggccggtg ccgctactcg    198780
     accccaaggg ccggccgctc gaagagctgg tgccgttcgt gcgcgcccat atccggcatg    198840
     tcgacttggc cgcgcgccgc atcgacagcg actggccact ggactactga tgcgcttcga    198900
     cgtcgtcacg ctgtttcccg acatgttcgg cctggtgcgc gaccagggcg tgacggggcg    198960
     cgcccatgcg cagggcctgt gggcgctgca cgcctggaac ccgcgcgatt tcacccacga    199020
     cgtgcatcgc acggtcgacg accgccccta cggcggcggc ccaggcatgg tgatgatggc    199080
     cgcgccgctg gaagccgcgg tggcggccgc acaggccgcc cgcgccgcgc agggcctgca    199140
     ggccgcgccg gtgatcctgc tgtcgccggc aggtcggcgc tacgaccagg ccgaagccac    199200
     cacgctggcg gcgggcacgg gcgcgatttt catctgcgga cgctacgaag gcgtggacca    199260
     gcgcttcatc gagcgctgtg tcacgcatga gctgtcattg ggcgatttcg tgctgtcggg    199320
     cggcgaactg gccgccctgg ccatgatgga cgctgcggtg cgcttgctgc ccggcgtgct    199380
     caacgatggc gactccgcgc tgcaggactc cttcaacgcg gcgctcgacg gcctgctcga    199440
     cagcccgcat tacacccgtc cggaagtcta cgaaggcgtg ccggtgccgc agccgttgct    199500
     cagcggccat catgccaaca tcgcgcgctg gcgccgcgag cagtccctgc ggctgaccgc    199560
     cagccgccgc cccgagctga tcgagcgcgc gcgcggcgag ggccggctca gcaaggccga    199620
     cgaacgcttc ctggccagcc tggcgggcga gcgcgaaagc tagggcgcgc ggcgcgccag    199680
     cgcggccagc gcgtcgagca gcgcatcgat ctcggcctcg gtggtcaggt agctgaccga    199740
     agcgcgggcg atttgccgca gcccgcgcgc ctgcatgtcc agcggcgtat aggccacccc    199800
     gttgcagccc agcgcgattc cctggcgcgc cagctcgcgt tgcaccgcgt cggcctgcca    199860
     gcctgccaca tcgaaggcaa tcagcccgga tcgcacccgt ccctggtcca gcagcgtgat    199920
     gccgtcgagc gcggccaggc gcgtgcgcag gcgcgtggcc acggcgtcga tgcgcgcgcg    199980
     gatcgacgcg atgtccagct ccagcgcttc gtgcagcgcg tgggccagtc cgcagcgcag    200040
     cgccacgctg ttttcggccg actcgaaacg ggcggcgtcg ccgcgcacga tggggcagcc    200100
     atcctcgccc agcggcgccg accaggtatc gacccaggcc ggcgccagcc gctccaggaa    200160
     ggcctggcgc acatacagca gcccggtgcc gcgcggtccg cgcaaggcct tgcggcccgc    200220
     gccgctcagg acgtcgcacc cgacctcggc gacatcgatg ggcaattgtc cgacggcctg    200280
     cgcggcatcg acgaaatagg cgataccgtg gcgccgcgca atgcgcccga cggcggcagc    200340
     cggattgacc aatccgccat tggccggcag ccatgtcagc gcgatcaggc gcacccgctc    200400
     gtccagcatg gcctgcaagg cgccggggtc caccgcgccg ctctcgtccg aggcaatggt    200460
     tccgatcgtc gcgccggcgc gctgcgcggc caggcgcatg gccgccaggt tgccgcccca    200520
     ttcgtggcgg gcgaccagga tgcggtcgcc ggcccgccag ggtccgagcg cggcgaaggc    200580
     cgcgccccag cccgccgaat tgcccgtggt cagcgcaacc tcggctggct gggcgttgag    200640
     caggcgcgcg gccagcaggc gtgcgcgctc ggcctgttcg cgcgcctgta cgccggcctc    200700
     catgggcccc tgcgtggcct cgaggcgcag atgcgccttg atggcctgca aggtgccggc    200760
     cgagggcagc gaagcgcccg cgtggttgaa gtggatgaat gcgccttgcg cgcccggtgt    200820
     gcgggcacgc agggcggcga cgagctcatc ggtcagcgtg gcgggcatgg tgcgatcctg    200880
     gcgtcggggc ggctcaggcc tgcgccagcg cgaccacggc ctcgacttcg acggcgacgc    200940
     cgttgggcag cgaggccacg cccaccgcgc tgcgcgcatg gcggccggct tcgccgaaca    201000
     cattgaccat caggtccgac gcgccgttcg cgatggcgct gtggcgattg aagtccggcg    201060
     cggcggccac gaatacgccc aggcgcacga tgcgcgccac gccctgcagg cggtcgccgg    201120
     tggcggcggc cagttgcgcc agcacgccca gcgcggcctg gcgcgcggcc tgcacgcctt    201180
     cttcgtcgct cacgctgtcg ccaaggcggc ccaggtggac gggcttgccg tccacgcgcg    201240
     gcacctgccc cgagatgtac aggaggttgc cgtcgcgcac gaacggcacg taattggcgg    201300
     ccggggcgtt ggccggctcg agagtcaggc cgagttcggc gacgcggacg gagatcgaag    201360
     cagtcattgt cgtacacctg ttcagagagt gagtcctaca tcctagcggt tgcggcgcat    201420
     gctggccaat tcctcatgcg ctagctgtga actgtcaata ggttgtattc gtccaggttg    201480
     agtctggaga tgggtacagc gcgcccgatg ccttggtggg gtcgatgcca gttgtagtgg    201540
     tgtagccagg atttcatggc atcggctcgg tgttgggagt tctggtaggt gtgagcgtaa    201600
     gcccactcac gcaaggccga ctggatgaag cgttcggcct tgccattggt ctgtgggcgg    201660
     taaggtcggg taaagcggtg cttgatgccc agctcatggc acagcgcggc gaaggcgcgg    201720
     ctgcgaaagg ccgagccatt gtcggtgagc aagcgctgga tggtcacgcc caggcgctgg    201780
     tagtaggcca ctgcgtcctt gaggaactgg acggcgctgg ggaagcgctc gtcggggggg    201840
     atgtcggtga aggccacgcg ggcgtggtca tcgatggcca cgaagacgaa gtcccagccg    201900
     gccccctcaa cggtatcgcg tcggttgccc gtgacccggt ggccagggcg ctggatacgt    201960
     cccagcttct tgatgtcgat gtgcagcaga tcgccggggg cctgatgctc gtagcgcacc    202020
     accggctcgg ccggctccag gtcggccagg tgcgacagac cggcgcgggc caggacgcgg    202080
     ctgacggtgc tggctgacac gcccagcgcc tgagcgatgc gcgcttgggt cagccgcttg    202140
     cggcgcagct ccacgatagc cagcgccttg gccggcgcaa tcgctcgggg cgagaccgtc    202200
     gggcgcgagg acgcatcggc caagcccgcc tggccctgag ccaggaagcg gcccagccat    202260
     ttgcgcacag tcggcgcggt gaccccatag gcgcgggccg cttcaggcac acaaacttga    202320
     tgggcgatca attgctggac catttcgagt cgacgtagga aggtcaatcg ggcatgctta    202380
     tgggtgttca tccggccggg ctccttgagt gaactggggg ggtggcgatt tccagtttct    202440
     caaatccggt tcggatgaac catgcataca acctattgaa tcttcacacc tagccggcgg    202500
     cgttgccggc cagttcgtag ggcaggggcg ccagggcgat gcgcgggccc tgcgcgctga    202560
     gcagccgcag gtcgccgtcg ggcaggctgg ccagggtggt ttcgaacagc agcgcgagct    202620
     gcccgtcgct gcgcgcggcg tcgaccacgc gtccgcaggg ttcgtccggc cgcgcgctgt    202680
     cgtagatgtc ctggccggcc aaggggtcgg gcaggtcggc cggggcctcg gcgatcacgc    202740
     catgggccat gcggcgcttg accgtgccgc ggtaatggct gcgcgccacc acctcctggc    202800
     ccggatagca gcccttggtg aagctgacgc cgccgatgag gtcgagattg acggtctgcg    202860
     gaatgaagac gtcctgcgtg gccgcgccga tccagggcag gccggcggcc aggtcggcgg    202920
     cctgccaggc ggactcggac gcgcggccca ggtgcgcggc cagcgcgccg gcccgctcca    202980
     gctgcgcttc ggtggcgatc caccaccagc gcggctgcgc atcggccgag ggcgcgccga    203040
     tccaggtgcc ggtgggcaat tcggcgcgct gccagggcgc ggcgggcagg gcgccgccgg    203100
     cggcgtcctg cagcgcggcc agcgcggcgg gggcgcattg cacgcccgcc gcccacgccg    203160
     gcaccggagc cagccgcgcc ttggcgcgca atacgaacat ggacaggcgc ttgagcaccg    203220
     cctcggcgac gtcggcgcgc accagcgcct gccataccgg ggcgctttcg tcggccgcgg    203280
     cggccagcca catgaccagc gtggccagca ggcggccctt ggcggtgcag tagccggcca    203340
     ggcgggcgtg gtcggcgggc tggccggtga cgtcctgggt cagttgccca tgcaggaaag    203400
     ccagcgcgtc ggcgccggcc gcgccgatga cgcgcaggct ggccagcggc gcgcattgcg    203460
     ccgaaccatc ggcgcgcgcg ggaatcgaat cgtagaaagc gtgcatggcg gaattctaaa    203520
     aggggcggat gacgcgcacg cgcgaaccgg cgtgggccgc gcggcgtcga acaaaccccg    203580
     atgatacccg gggcggcccg cgccggcccc tatgacccgg ctgaccgcgg gggcgtgggc    203640
     gggccagccg ccgcgcccgc gatccattaa acttgcgcac acttatgaga aaacgtattc    203700
     gtttctattt tctgctgctc gtgctggtgg cgctgctcgg cgccgcgctg gcggccggcg    203760
     gcgcctggac ctggatgcac aggccggtgg cgctcaagtc cgaccgcatc gatttcgtgg    203820
     tggatccggg cagcgcgccg cgcgccatcg cgcgcaccct caaccaggcc ggcgtggcgg    203880
     tctgggagcc gggcttcgtc tggatggcgc gcctgtccga gctggacaag cagatcaagg    203940
     ccggcggcta ccaggccatc gacggcgact cgccctggca gttgctgcaa cggctggcgc    204000
     gcggcgacat gagccagcgc cagatcactt tcctggaggg ctggacgttc cggcagatgc    204060
     gccaggcgct gcgcgaacat cccgacgtca agcagaccct gggcgagacc agcgacgagg    204120
     ccctgatgga aaggctgggc tcgacggtga ctcatcccga gggcatgttc tttcccgaca    204180
     cctatgtgtt cactccgggc agcacggatt tcgacatcct gcggcgcgcc taccaggaag    204240
     ggcagcgcat cctggagtcg acctgggcca agcgccagga tgggctgccg gtgggcacgc    204300
     cctacgaagc gctgatcctg gcctccatcg tcgagaagga gaccggccac gggtcggagc    204360
     gcgcgcgcgt ggccggggtg ttcgccaacc ggctgcgcat cggcatgctg ctgcagaccg    204420
     atccgaccgt gatctacggc atgggcgagg cctaccaggg ccgtatccgc aagcgcgacc    204480
     tgcagaccga cacgccatgg aacacctaca cccgtccggg cctgccgccc acgcccatcg    204540
     ccgcgcccgg gcgcgccgcg ctgctggcgg cggtgcagcc cgaacgccac aaatacctgt    204600
     ttttcgtgtc gcgcggcaac ggcaccagcg agttctcggt caacctgaac gaccacaacc    204660
     gcaatgtgtc gcgctacata ttgggacaag ggcaaccgca acaaggatcg cagcaatgac    204720
     cccgcgtgga cgtttcatta cgctggaggg cgtcgatggc gccggcaaga gcacccatac    204780
     cgcatggatg gtgcaggcgc tgcgcgacct gggcctgacg gtgctggcca cccgggagcc    204840
     cggcgggacg ccggtgggcg agaagctgcg cgagctgctg ctgtccgaac ccatggccct    204900
     ggaaaccgag accttgctca tgttcgcggc gcgctgcgag cacgtgcgcg aagtgatcgc    204960
     gccggcgctg gcgcgcggcg agtgggtggt gtgcgaccgc ttcaccgatg cgtcctatgc    205020
     ctatcagggc ggcggacgcc aattgggcgc ggcgcgcgtg gcggcgctgg agcagtgggt    205080
     gcatcccgat ctgcagcccg accgcacctg gctgttcgac gtgccgctgg acgtggcgcg    205140
     cgcccggctg gcgcgctcgc gccagctcga ccgcttcgag cgcgaggagg atgccttctt    205200
     cgaacgcacc cgcgccgcct accacgagcg ggcgcgcagc tcggatggac gtatccgcat    205260
     catcgattcg agccggccgc tcgaggtcgt gcgcgcgcag ctcgacagcg aggtgcgcga    205320
     gctggtggcg caagcggcat gagcctcggt cgcttcctgc cctggcagac ggagatcgcc    205380
     cgctcctggc tgagcgggcg cgaccgcttc gcgcatgcct ggctgatcca tggcaatggc    205440
     ggcatcggca agctggactt tacggcggcc gcggcggcca gcctgctgtg cgagtcgccg    205500
     cgccagggcc tggcgtgcgg cgagtgcgcg gcctgcgcct gggtggccag cggcaaccat    205560
     ccggatctgc ggcgcatccg tccggaggcg gtcgcgctgg aagagggcgc cgaccagacc    205620
     gaaggcgccg aggaggccga ggccggttcc ggtggcgcgg cggccaagcg cgcgccgtcc    205680
     aaggacatcc gcatcgacca gatccgcgcg ctcgaaccgt ggttcaacac cgccacgcac    205740
     cggggcggct ggcgcgtggc gctgctgtat ccggcgcatg cgctgaacgt gatatcggcc    205800
     aacgccttgc tgaaggtgct ggaggagccg cccgcgcata cggtgttcct gctggtggcc    205860
     gatgcgcccg accgcctgct gcccacgctg gtgtcgcgct gccggcgcct gccgctgccc    205920
     acgccgtcgg ccgggcaggc gctgcaatgg ctgggcgagc agggcgtgga gccggcggcc    205980
     gactggctgg ctgccgccgg cggcgcgccg ctggcggcgc agcgcctggc ggcccggggc    206040
     gatgcgccgt gcccggcctg gctggcgcaa ctggtgcagc ccttggccgc gggcaaggcg    206100
     cccgatgtgg gcacgctgac cgaaaacctg gaaaaggtgg cggcggccga gtggatcgac    206160
     gccctgcagc gcctgttcac cgacctgacg ctggccgccc atggcgcggc cagccgctac    206220
     tatcccttgc tggccgagcc ggtgcggcaa gccgccgcgc gcgcgcagcc cgcgcaactg    206280
     gccgagaccg cgcgctggct gagccgccag cgcgggctgg ccacgcatcc gctcaacgcc    206340
     aagctgttcg tgcacgcggc cctgcagcgc gtggtgctat cctgccagtg acgatcgggc    206400
     cacggcccgt ttctcctgtg atccgtattc tgtggtccgt atgtacgtag actcccattg    206460
     tcatctgaat tttcccgaat tggcgcaaga cctgccggcc gtgctggatc gcatggccgc    206520
     caaccaggtc acccatgcgc tggtcgtcag cgtcaacatg cccgactggc cgggcctgat    206580
     gcaattggtc gagccgcacg gcaatctctg ggcgtcggtg ggggtgcacc ccgactatga    206640
     agacacgccc gatcccgagc ccgccgaact cgagcgcctg gccgcgcacc ccaaggtggt    206700
     ggccatcggc gagaccgggc tggactacta ccgcctgagc gagccgctgg actggcagcg    206760
     cgagcgcttt cgccgccata tccgcgcggc gcgctcgacc ggcctgccgc tgatcgtgca    206820
     tacgcgcgcc tcggcgcagg acacggtgcg cctgctgcgc gaagagggcg ccgacgaggt    206880
     cggcggcgtg atgcactgtt ttaccgagtc ctgggagatc gcccagcagg ccgtggcgct    206940
     gaatttccat atctcgcttt cgggcatcgt gacgttcaag aacgcgcagc tcgtgcacga    207000
     ggtggccgcc aatatgccgc tggaccggct gctgatcgag accgactcgc cctacctggc    207060
     gccggtgcca taccgcggca agctgaacga tccgtccaag gtgatccacg tggccgagaa    207120
     gatcgccgag ctcaagggta ttccggtggc cgaggtggcg catgcctcta ccgagaattt    207180
     cttcaaactt ttcaataaga taaaacgata atctaatttg aattatttaa agtgaattct    207240
     agattttggc ggtattccac catgaaaccc ttgcgtaccc gttttctgcg ctggcgcggc    207300
     gccgcggccg gcggcctgct cgccggcgcc ttgctggcca gccccgcctg ggcggccaag    207360
     caggccgact ggtgggtgta tgtccataac gacaaggctc gcgacatcgg cgccttgctg    207420
     gcggcgggcg ccgatcccaa tgtgcgctac gacaatggcc agccggccat catgcgggcg    207480
     gtggtcgaca acgcctggga ggtgttcgat gtgctggccg ccaaccgccg caccgatctc    207540
     aacgccgaga atcccgcggg cgagacgccc ttgatgtacc tggcggtggc ggggcagacc    207600
     gaacgcgcgc aggcgctgat cgcgcgcggc gcgcaggtca accggctggg ctggacgccg    207660
     ctgcactatg cggcctcgaa gggccggctg gagaccgcgc gcatgctgct gggcaagcag    207720
     gcgctggtca atgcgccgtc gcccgacggc accactccgc tgatgatggc cgcgtattcg    207780
     ggcgatcgcc gcatggtgca gttgttgctg gatgccggcg ccgatatcac cacgcgcaac    207840
     ctcaagggca tgagcgcggc cgactgggcc gccttcggca agtccgaggc gctggcgcgc    207900
     gagctcaagc ccatgatcgc ccgcgccgag gccgaacggc aggcccgcca tggcgcagtg    207960
     gccacgtcca agctggcgcc ggccgccgaa acgccgccca cggcacagcc cgcggcagcc    208020
     tctgccgcgg cgtcgcaacc cggcgaaggc cgctccctgt ccggcgtctc gggcgtgcgg    208080
     ctgaattcct acgattaacc cgggtgcctg tccccacagg gacaggcacc cgggcctccc    208140
     tgttcctgct cctccacctg atcacgtgcc gcccaccggg gcggcatttt tttgctcggg    208200
     gttttccctg aaattctcat aaattgagaa tgaattctga aaaaatggga aaaactgaat    208260
     aatctgcgca cgcaatatca aggaacgatc gacatgcaag aacaagccat cgcgggtggc    208320
     gccgagcgcg tgctgtatgt gctggccacc ctggcgcgcg aggaagcccc gctgaccgtg    208380
     gcggcgctgg ccgagcgcac cggcctggcc cagagcacgc tgtaccggca ggtggccctg    208440
     ctcaagcgct gggggttcgt gctggagcag gctggcgcct atacgccggg cccgctgtgc    208500
     gtgcagctgg cgcgcggctt cgaccaatcg tcctatctga tccaggaagc cttgcccgat    208560
     atgacccgcc tggccgccga ttcgggcgag acggtgggct tgctggtggc catgtccgac    208620
     caggcggtct gcctggagat ggtcgaaagc cggcatccgc tgcgctgttc gttcgtcaag    208680
     ggccgcggcc tgccgccgtt ggcgcgcggg gcctcggcca agtcgctgat ggcgttcatg    208740
     gcgccggcgc gcctgcaggg ccggctgcac gagctggccg ggcagggcgt cgacgccgcc    208800
     gcgctggcgc gcgacctgga ggcgatccgc gccgccggct acgcggtcag cgacagcgag    208860
     gtcgacgccg gcgtatgggg ctgcagcgcg ccggtgttcg agcggccgca ccaggcagcc    208920
     ggctcggtca ccctgatggc gccttccacg cgcgtggccg aacgcaccgc gaacctgatc    208980
     aacctgacgc tggcggccgc caaacgcatt tccagccgcc tgcagcattc ctgatgtatc    209040
     cctgtggccg tatccatcca tacggttttc ttcactccaa tgccgcaccc atcaccaaag    209100
     gaagcatcat gacgactcgc cgccaactgc tgaccgccgc cctgaccctg aacctggcct    209160
     ggggcgccgg cgccgcgcat gcccaggaga ccattcgcgc cgtgaccgac gcgacgttcc    209220
     cgcccatgga attcgtcaag gacggcaagc gcaccggttt cgatatcgaa ctggtcgagg    209280
     cgctggccca ggccatgggc aagaaaatcg aatggatcga catcgacttc aagggcctga    209340
     tcccggcgct gcaggccggc cgcgccgaca tcgccgtgtc ggccatctac atcaccgccg    209400
     agcgccagaa agtggtggat ttcaccgacc cgtactatgc gggcggcctg gtggtgctga    209460
     ccaagaagga tggtccggtg aagtcgctca aggacctgga gggccgcaag gtgtcggtgc    209520
     aggtgggcac caagtcggtc aactatctga aggagcactt ccccaaggtg cagcgcgtcg    209580
     aggtggagaa gaaccaggag atgttcaacc tggtgcagat cggccgcgcc gacgcggcgg    209640
     tgaccggcaa gccggcggcc aagctgttcg cgcaaagcac gcagaacctg gccgtgctga    209700
     gcgagcagat caccaccgag gaatacggca tcgccgtgcc gaagtccaag tccggactga    209760
     cccgcgagct caacgaggcg ctcaagaagc tgaaggctga cggtacctac gagcgcatcg    209820
     tcaacaagtg gttcgaggcg caggccaaat gatgctggat ttcgcgcctg tctttgccga    209880
     cttcgacgca ttgctgcgcg gcgcggtcgt caccgtggag gtgacggcct gcgcgctgct    209940
     gctgggctgc gtcatcggcc tgctggtcgg ggtcggccgc ctcaacccgc aacgccgctt    210000
     catctacaac ctgtgcagcg tatacctgct gttctttcgc ggcacgccgc tgctggtgca    210060
     gctgttcatc tggttcttcg ggctgccgca gttcggcatt acgctgccgg cgttcgcctg    210120
     cggcgtgctc ggcctgggca tctattccgg cgcctacgtc tcggagatcg tgcgcggcgc    210180
     catccagtcg gtcgaccgcg gccagatgga agcggcccgc tcgctgggca tgtcctcggc    210240
     gtaggcgatg cgcatcatca tcctgccgca ggccgtggtg cgcatgattc cgccgctggg    210300
     caacgagttc atcgccctga tcaagaattc cgcgctggtt tcgctgctga cgatccacga    210360
     tctgatgcac gaaggccaga agatcatcag cgtgtcgtat cgctcgctgg agacctatct    210420
     ggtggtggcc ctgatttacc tggtgttgac gaccgcgacg acgacgatcc tgcgccggat    210480
     cgagcatcgc ctgcgcgcgg gagggatggt gcaatgagta cgcaagagat gatccgcatc    210540
     cgcggactgc gcaaggccta tggcgagcac gaagtgctgc gcggcatcga tttcaatgtc    210600
     gaggcctcgc aggtggtggt ggtgatcggg cccagcggct cgggcaagag cacgcttttg    210660
     cgctgctgca acggcctgga ggtggcgcag ggcggcacca tcgatatctg cggccacaac    210720
     ctgctcaagg atggccggct gctgcccgag gcggagctca atcgcctgcg catgcaggtc    210780
     ggcatggtgt tccagggttt caacctgttc ccgcaccttt cggtgctgga caacgtgacc    210840
     gtcgggccgc gcacgctgcg cggcatgagc cgggcgcagg ccgaggagct gggcggcgac    210900
     ctgctggcca aggtggggct gcgcgaaaag atggcggcca tgcccggctc gctgtcgggc    210960
     ggccagaagc agcgcgtggc gatcgcccgc gcgctggcga tgcagccgcg cgtgatgctg    211020
     ttcgacgagc ccacgtcggc gctcgacccg gaactggtgg gcgaggtgct gcaggtcatg    211080
     aagctgctgg cccgcgaagg catgaccatg atggtggtca cgcacgaaat gggtttcgcg    211140
     cgcgaagtgg ctgatgtggt ggcggtgatg gacggcggca gcattgtcga gtccggtccg    211200
     cccgagctga ttttcagcca gccgcgcgag gcgcgtaccc gcgccttcct gcaggccgtc    211260
     ctcagcgcat cgcagggggc ggcatgagcg tggccaacga ttccgcgtcc atctggaccg    211320
     cgcgcgacga cagcggcgag cgcggcgata cgcgccgcct ggcccacatc gtcgcgctgg    211380
     ggcaggacgc cggcgccggc gacgccgcgg tgctgggctt tgcctgcgat gccggcgtgg    211440
     cgcgcaacca ggggcggcgc ggcgctggcg ccgcgcgcca tccggcgcat gatggccggc    211500
     ctgccggcgc acaatctgcg tcgcctggtc gacgccggcg acgtggtgtg cgaggacgac    211560
     caactcgagg cggcgcagga tgcgctggcc ggccgcgtgg ccgcgctgct gcaggccggc    211620
     gcgcatccgg tggtgctggg cggcgggcac gagatcgcct ggggcagttt ccagggcttg    211680
     cggcgctggc tggacgcgcg cggcgaccgc gaaccggtgc tggtgctcaa cctcgacgcg    211740
     catttcgacc tgcgcaccgg ccggccgggc agttcgggca cgccgttcga ccagatcgcc    211800
     gagtattgcg cggcgcgcgg ccacgcgctg cagtacgcct gcctgggcgt ctcgccgctg    211860
     ggcaacacgc ccgcgctcta cgcgcgggcg gccgaggtcg gcgccgtctg ggtggaagac    211920
     cgccacatgc aggaggccca tctgggcgag cgcctggccc agctcgatac cttgctggcg    211980
     gcggccggcc acgtctatct cacgatcgac ctggacgtgc tgccggcggc gaccgcgccg    212040
     ggggtctcgg cccccgcgcc ctatggcgtg ccgctggcgg tggtcgagga ggtggcgatg    212100
     catgtgcgcg ccagcggcaa gctgcgcctg gccgacctgg ccgagtgcaa cccggcctac    212160
     gacatcgacc accgcaccgc gcgcgtggcg gcgcgcctgg cgtggcgctt gctgggcggc    212220
     gcggcgcggt agacggcggg cccgccacgg gcttaggatg taggcgttgg ccgcccggat    212280
     cggcccgatc cgggcggcct gcccgaaggt tgttgcaagg cgcgcttttt tgatgcgacc    212340
     ctaataaata tttatctctt tttattgggg ccgcagctgg tttcgtggaa aaataagcgc    212400
     aacctcagcc cggagatcct ccctatgtct caagctcccg cccattcctt gccctcatac    212460
     ctggatgccg agcatctggg cccctggggg atctacctgc agcaagtcga ccgcgtcacg    212520
     ccgtacctgg gtccgctggc ccgctgggtc gagacgctca agcgtcccaa gcgcgcgctg    212580
     atcgtggacg tgccgatcga aatggacaac ggcagcatcg cccacttcga gggctaccgc    212640
     gtccagcaca atacgtcgcg cggcccgggc aagggcggcg tgcgtttcca ccaggacgtg    212700
     accttgtcgg aagtgatggc gctggcggcc tggatgtcga tcaagaatgc cgccgtcaac    212760
     ctgccgtacg gcggcgccaa gggcggcgtg cgggtcgacc cgcgcacgct gtcgcactcc    212820
     gagctcgagc gcatgacgcg ccgctacacc tcggagatcg gcgtcatcat cgggccgtcc    212880
     aaggacatcc cggccccgga cgtgaacacc aacgcccaga ccatggcctg gatgatggac    212940
     acgtactcca tgaacgaagg cgccaccgcc accggcgtgg tgaccggcaa gccgatcgcg    213000
     ctgggcggca gcctgggccg ggtcgaggcc accggccgcg gcgtcttcgt ggtcggctgc    213060
     gaggcggcgc gcgacctgaa cctcgacgta tccaaggccc gcatcgtggt gcagggtttc    213120
     ggcaacgtcg gcggcaccgc ggcgcgcctg ttccatgagg ccggcgccaa ggtgatcgcg    213180
     gtgcaggacc acaccggcac catccacaac gacggcgggc tggacgtgca caagctgctg    213240
     gcgcacgtcg gcaaccaggg cggcgtggcc ggcttcaccg gcgcgcagca actggccgac    213300
     gacgatttct ggggattgga gaccgatttc ctgatccccg ccgctcttga gggacagatc    213360
     aacgaaaaca acgccgccag ggtgcgcgcc aaggtcgtgg tcgagggcgc caacggcccg    213420
     accaccccgg aagccgacga tatcctgcgc gagaacggcg tctacgtggt gcccgacgtg    213480
     ctggccaacg ccggcggcgt gacggtcagc tacttcgagt gggtgcagga cttctccagc    213540
     ttcttctgga gcgaggagga gatcaaccag cggctcgagc gcctgatgcg cgaggcctac    213600
     agcgccgtgt cgcaagtggc caaggagcac aaggtcaccc tgcgtaccgc ggccttcatc    213660
     gtggcgtgca cccgcatcct gcaggcgcgc caggtgcgcg gcctgtatcc ctgaccgctg    213720
     cgcggcgggc cccgcagggc ccgcatcggc gtaccaggca gccggccccg caaggggccg    213780
     gcgccgtttt cagcgcaggc tgatccaggt ggtcttgagg tcgctgtact tgtccatcgc    213840
     gtgcagcgac ttgtcgcgcc cgaagccgga ttgcttgacg ccgccgaagg gcaccgtgat    213900
     gtcgccgtcg gcatagcagt tgacccatac cagcccggcg cgacaggcgg tgcgcgcggc    213960
     cgaggtcggc ggtccacagc ccggccccca gcccatagat ggaatcattg gccagcgcga    214020
     cggcctcgtc ctcgtcggcg aagccttgcg cggccagcac cggcccgaag atttcctcgc    214080
     gcaccagcga gttgtcctgg ccgggacaat cgaagatggt cggttcgatg tagtagccgc    214140
     cgctgtcggt cagcacttgc cggccgccca ggcgcagccg cgcgccttcc tgggcgccgg    214200
     cggcgatgcg ggccatgacc gcctgcgtct gccgttcgtc gaccatggcg cccagcgcgc    214260
     tgtccgggtc cagcggattg ccggggcgca gggtggcggc gaaggcggcc actttttcca    214320
     tgaaggcgtc gtagatgccg tgctgcacgt acaggcgcga accggcgatg cagacctcgc    214380
     cctggttgga gaagatcgcc agcgcggcga cctgggccgc gcggtccagg tcggggcagt    214440
     cggcgaacac gatatggggc gacttgccgc cgcactccag ccagacgcgc ttgagattgg    214500
     attggcccga gtaggtcatg aagcgcttgc cggtcgccgt cgagccggtg aaggcgatgc    214560
     agtcgacgtc cgggtgcagg ccgagcgcct ggccggcctg cgcgcccagg ccgggcacca    214620
     cgctgaacac gccgggcggg atgccggcct gttcggccag ggccgccagc cgcagcgccg    214680
     acagcgaggc ctgctcggca ggcttgagga tgacgctgtt gcccacaacc agcgccgggg    214740
     ccactttcca ggccgccatc atcaaggggt aattccacgg caccacggcg gccaccacgc    214800
     ccagcggctc gcgcgtgatg gtggccagcg cgtcggcgcc ggtaggcgcg atctcgtcgt    214860
     agcgcttgtc gatggcttcg ccgtaccacg catagcagcg ggcggtctcg ggcaggtcga    214920
     aggccagggc gtcgcggatc ggcttgccca tgtccagcgt ttcgagcagc gccagctctt    214980
     cctggtgttt ggtgatcagc gcggccaggc gcagcaggcg gtgcttgcgc tcgcgcgggg    215040
     ccaggccgct ccagacgccg gcctcgaagg cgcggcgcgc ggcggccacc gcgcggtcca    215100
     cgtcggccgc gccgcaggcg gcgacatcgg ccagcttgcg gccgtcgatc gggctgtgcg    215160
     cggcgaaggt ggcgccatcg gcggcgtcgc aataggcgcc gtcgatatag gcgcggcctt    215220
     cgggggcgag ggcggcggct tgcgcgcgcc agtaggcgga atcgtgcagg gtcatgggag    215280
     tcggatgcgg gcaggcccgg cggcgcgccg ccgggcgggg tgaatcagcg cggcgcgttg    215340
     gcgcgcgcca ccatggcgtc gagcagtacg ttgcagccgg cctccaggtg ggcgggctgg    215400
     gcgtcctcga tctcgttgtg gctgatgccg tccttgcagg gcacgaagat catcgccgtg    215460
     ggcgcgaccg cggccatgta caccgcgtcg tggccggcgc cggtcacgat gtccatggcc    215520
     ggcaggccgc ggcgctgcgc gccgtcgcgc accttgccga ccaggtcggg atggaagggc    215580
     gtcggcgcga agtactgcac ctgctcgcac tgcaccgata cggcatgccg cgcggcggtg    215640
     tcggcgcacg cctggcgcca cagcgcgtcc atcgtggcga gcgtggcttc gtcctcgtgg    215700
     cgcaggtcca ccgtgaagcg cacctggccg gggatcacgt tgcgcgaacc ggggtaggcg    215760
     tggatctcgc ccaccgtgtc gcggccgtgc ggctggtgcg cgttggcgat ctcgaccacc    215820
     gcctgcagca gatggctggc cgcgtacagt gcgtccttgc ggatcggcat cggggtgggg    215880
     ccggcatgca tctccatgcc ttgcaccacc acgtcgtacc agcgcacgcc cagcgagccg    215940
     gtcaccacgc cgacgatcct gtcttcgtgt tccaggatgg ggccttgctc gatgtgcgcc    216000
     tcgaagtagg cgtcgaccgc gcgtccgccc accgggtcgg cgccggcata gccgatggcg    216060
     cgcagctcgt cggccaccga cttgccctcg gcgtcgcgcg cggtcagcgc ggtctcgagc    216120
     gggaatttcc cggcgaatac gcccgagccc atcatcacgg gcagaaagcg cgagccttcc    216180
     tcgttggtcc agatcgccac ttccagcggc gcgtcggtct gcacgccgtg gtcatcgagg    216240
     gtgcgcatga cttccagtcc ggccagcacg ccgtagcagc cgtcgaactt gccgccggtg    216300
     ggctgggtgt cgatgtggct gccggtcatg accggcgcgc gcgacggatc gcgtccggcg    216360
     cggcgcgcga agatattgcc gacctggtcc acgcgcacgg tcaggcccgc gtcgcgcatc    216420
     cagccggtga ccaggtcgcg gccctggccg tcgagcgcgg tcagcgccag gcggcaattg    216480
     ccgcccttgg gcgtggcgcc gatgcgcgcc aggtccatca gcgactgcca cagccgctgt    216540
     ccgtcgatgg agatcgggga gttgttgctc atgtctttac ctcattgcac gccggcggcc    216600
     tgggcctggg ccgcctggcg gatttccgtc agggtctggc ccggcgcgat gccgtcggct    216660
     tcgtagcgga tttccaatag cgccggcaat tgctcgcgtt cggcgaaggc gcgcgcgcgc    216720
     tcgaaggccg ggccgaagtc ctcggtgcgc tcgaccgctt cgccgtagcc gccgtaggcg    216780
     cgcacgaatt gggtgaaatc gggattctgg aagtccaggg caatggcgcg gcccgggaat    216840
     tcgcgttcct ggtgggcgcg gatggtaccc cagatgccat tgttgaacac cagcacgacc    216900
     acgccgacgc ggtattgcag cgccacgccg agttcctgca tgttcatctg gaagcagccg    216960
     tcgccggcgt agcagaccac ggtgcgggcg gggttttcca gcttggccga aatggccgcc    217020
     ggcaggccgt agcccatcgc cccgaccgtg ggcgccaggc tggtgcccgg gccgctgaac    217080
     tggcggtagc ggtgcgggta cagggcgtaa ttgcccgcgc ccaccgtgat gcaggcgtcg    217140
     gccgggatgt gctggttgac gtaggcggcg gcgctgtcga ggttgagcgg gccgggcgag    217200
     ggcagcgggg ccagcgtggc caggtattcg tcgtgcgcgg cgcgcacggc ctgcgcgcgg    217260
     ctggcgcggt gtcccggccg cagcgcgtcg agcgcggccg cgaacccggc cgggtcggcc    217320
     acgatgccca gggtcggcgc gaacacccgg cccagttcgt tggggtcggg gtagacgtgc    217380
     accagccgct ggcgcggcag cgggctctcg atcacggtgt agccttcggt ggtggcctcg    217440
     cccatgcgcg tgcccaccgc caggaccagg tccgcgccgg cgatgcgctg gcgcagttcc    217500
     ggcgccatgg cccagccgac gtggccggcg gcattgggat ggcgctggtc gaagcattcc    217560
     aggcggcgcc aggccgtgcc taccggcagc tcgaagcgtt cggcgaacgc ggcggcctgt    217620
     ccgatggcct cggcgctcca gcctgtgccg cccagcagca tgaagggccg cttggcctgg    217680
     tccagcaatt cgaccatgcg cgccaggtcg gccgcgccgg gcaggcagcg cgcgcgccgg    217740
     tagcgcggca tgtcggccac gcgggcgcgg ccccacagcg tgtcctcggg cagcgccagt    217800
     accaccggcc cgggccggcc gctggtggcc accgcgaagg cgcgcgcgat gaattcggga    217860
     atccgctcgg tgcggtcgat ctgcgcgacc cacttggcca tctggccgaa catgcggcgg    217920
     tagtcgattt cctggaacgc ctcgcgctcc atgaagtcgt tgccgacctg gccgatgaac    217980
     agaatcatcg gggtcgagtc ctggtaggcc gtatgcacgc cgatgctggc gttggtggcg    218040
     ccggggccgc gggtgacgaa gcagatcccc ggctcgccgg tcagcttgcc ataggcctcg    218100
     gccatgtagg ccgcgccgct ttcctggcgg cagacaatgg cgtcgatggc gccgcgatgc    218160
     tcgttcaggg cgtcgatgca gggcaggtag ctctcgccgg gaatcatgaa cacgcgccgc    218220
     gcgccgtgca cgcgcagctg ctgcatcagg atctggccgc cgttgcgctc gggcagggct    218280
     ggcgtggtca tgactgctct ccttgggact cgcgggggcg cgccgcgcgg gcggcccatt    218340
     gttcgaattc ggcgtggcgc gccagcaggc ggcgcgcggt gttgtagtcg ggcgggtcga    218400
     cgcgcgcgcc gccggcgtcg cggccgtcgc gttgcgcctc gaagcgggcc gccaggtcgc    218460
     gcgcggccgc cacgcggtcc gcgtccggcg tgaaggcggc gtgaatggcg ggcacctgtt    218520
     cggcgaacac ggcgcacttg gatttcaggc cgatgcggcg cgcccacagc aggtcggcct    218580
     gctgggcggc ggggtcgcgg tagttgaacg ggcagtcgat cggcaggcag ccggccgcga    218640
     cgcaatcgac caggaagcgc gcgcgcaggg cgtgcagctc gatgccgtcg gggccgcgct    218700
     cggcgcccag gctggctgtc aggtcctcgg cggccagcag gcaggccgat acgcgcgggc    218760
     tggccgtcag gatttcgcag gcgcgcgtca cgcccagcgc cgactccagc gtgggcacga    218820
     tctcggtgct gcccggcgcc aggccggcct cggcctcgca ggccgagatg gcgcggtcga    218880
     gcgcggcgat ctgcgccgcg ctttcggcat gcggcaggaa aatcgcgtcc ggcgcgccgg    218940
     ccatgatgcc gcgcaggtcg tccaggccgt cttcttccag cttgttgatg cgcaccgcgc    219000
     cgatcacgcc ggcggcgcgg cattgcgcca gcagcgcgac gatgcggcgg cgcgcggccg    219060
     gacggtcggc cggcgcggtg aactcttcca ggtcggccac cagcgcgtcg gcgccgctgg    219120
     ccaggccggc cgcctgggcc tgctccagca gcccgggaac gaacatccag ctgcggcgca    219180
     ggctggcggg gcggcgttgg ccgcccgggt tggagatggg ggtcattgca cgtgcctcgg    219240
     caggaacagc accagttcgg ggacgaaggt cagcagcagc atgacggcgg tcatggccag    219300
     catcatccag ctcagcgggc gcagggtctg catcatgttg atgccgccga tcttgcaggc    219360
     ggccatcagg tccacgccca ccggcggggt gttcgcgccg atcgccatgt tgatcgacag    219420
     caggatgccg aaatgcaccg ggtcgatgtt gtagtgggcc agcaccggca tgaccaccgg    219480
     cgccacgatg atgatgaccg ggatggcttc catgaaggtg cccagcagca gcagcaccac    219540
     cgtcagcacc agcagtacgg cgatcttgct gtcggtccag tccaccagca ggccggacag    219600
     ggcctgcggc acctgctcgg ccaccagcac ccaggcgaac aggcccgagg cgccgatcag    219660
     cagcaggatg gacgcgctgc cttcgccggt cgacttcagg ctctcccaca gggacttcag    219720
     gctgagcgtg cggtaccaga aaaagcccac cagcagcgca tagacgatgg cgctggaggc    219780
     ggcctccgtg gcggtgaaga tgccgaagcg gatgccgccg atgatcagca cgggcaccat    219840
     cagcgcgggc agggcgtcga tggcggcggc gcgcagctcg ccccacgaga acggctggcc    219900
     gccggcccag ttgtgcttgc gggcctgcca gatcgccacg acgatcagcg aagcgcccag    219960
     caggatgccg gggatgatgc cggccaggaa cagcttgccc accgaagtgt cggtgatagt    220020
     gccgtagaca atcagcacga tgctgggcgg gatgatggtc gaggtggcgc cggcgctgcc    220080
     gatcagcgcg cagctgaacc ccttgtcgta gccgctgcgt gccatggcgg gcagcagcag    220140
     gctgccgatg gcgatcacgt cggccacgcc cgaacccgac agcgcgccga acatcaggca    220200
     ggccagcacg gccaccacgg ccaggccgcc cttgatatcg ccgacgatgg ccgcgcacag    220260
     ccgcacgatg cgctgcgtca ggcccgcgcc gttcatcagc tgggcggcca ggatgaacag    220320
     gggaatggcc agcagcgtga agctgtccag gccgaccacg tattgctggg ccgccaccat    220380
     catcggggcg gcgtcgtaga cggccaggta cgccaggcac gccagcacca gcccgaaggc    220440
     gatcggcatg tcgatcagca ccgtgaccgt gaatacgccc atcaggaaaa gggcaccggt    220500
     agacatcttt taatcctttg ccgcgacggg gtcggccggt tggaacaatt gcgccaggtg    220560
     caccacgatg gtgatggcgc acgccgccgg cagggcgagg tagaccgtgc cggccgatac    220620
     gtcgagcgcg ggcagggtct ggtccatggt cagttcggcc agctgccagc cggcataacc    220680
     cagcgcggcc aggccgacga tgatcaatgc ctgattgacg cggtcggaga tggccagcgc    220740
     gcgcgggttg cgcacgacga agggcagcag cccggccatc aggtgggtgc gttcatggct    220800
     gcaggtgacg ccgccgatga aggccgccca caccagcacc aggcgcggca attcctcggc    220860
     ccagtgcggc gtggtgtgca tcacgaagcg ttcgaacaca acgtaggtga tcagtgcggc    220920
     cagcaaggcc accgccaggg cggcgatggc cttgctcagg ccggacagcg cgtgcgagat    220980
     ccggcccagc atttacttgg cctcgcggta cttctgcagc aggcccatca gctcggggcc    221040
     ataggcggtt tcgtaggtct tccagatcgg cgcgacggcc gcggcgaagg gggccttgtc    221100
     gacttcgttg acctgcatgc ccttttcctt gagctgcgcg acgaactgca ggtcgccttc    221160
     ggtgatcatc tggcgttgcg cgtcgcgcca cttgtcggcg gcggcctgga cgatcttgcg    221220
     gtcgtcggca gagatgcggt tccagatcgg cttggagacg atcaggcttg ccggacccca    221280
     cacatgaccg gtcagcgaca gatacttctg gacctcgaag aacgacgagg tgtagatgat    221340
     cgacagcggg ttttcctgcg cgtcgaacac cttctgctgc agggccgagt agagctcgcc    221400
     gaaggccagc ggcgcggggt tggcgcccag ggcggtgaag gtgtccaggc gcatcttgtc    221460
     gggcgtgacg cgcgtcttca ggccgttcag gtcggccggc gtgttgaccg ggccgcgatt    221520
     gttggtcagg tggcgaaagc cgttttccca ccacgacacg atcaccaggt tcttcttctc    221580
     ggccagcttg gccagcgccg cgcccagttc gccgtcgtag gccttgtagg cctgctgcga    221640
     ggtggtccag gtgtagggca gctcgacgat gccgaacttc ggttcgatcg gctgcagcga    221700
     gcccgagccg atgatggccg cgccctggct gccgatctgc aggccctcga gcatggtctt    221760
     ctcattgccc agctggccgc tggggaacag gatgaggttg acgcggccgg cggtcttttc    221820
     cttgacttcg gcggcgaaac cttcggcggc cttgttccag ctgtggctgg gggccagtac    221880
     gtggcccagc ttgatgtcca gggcgtgggc ggccggggcg actgccagcg ccaggccggc    221940
     ggcggcgaac agggaggtca gggtacgggt cagctgcatg gttttcacct tgaaatgttc    222000
     tggcttgtga aacgtcggga ggaacgaagc cggaaaccgc cggcgcaagc gggcccaggc    222060
     cgacgcgcga gcgtgtcggc ggcaaggcgg gaaatcggca agcagggcgc cagcgtcggg    222120
     cgcgggaggc ggacgggccg ccggaatcaa ttcatcggat ggctccgctg ccaaagtctt    222180
     cgcgcaggcg cgccaggatg ccgaccagat ggtcgtgcat ggcatggcgg gcccggatag    222240
     gatcgcggtc gacgatggcc gcgaggatgc gttcgtgttc gcgctcggcg gcttcccaga    222300
     ccttggtcgt gacgaaatgc tgttcgagcc ggctgaacac cgggctggtg gcgctgaggt    222360
     gccagatatg cgagatggcg gcggccagcg cggcgttgcc gcaggctgcc gcgatggcgc    222420
     cgtggaaggc ctggtcgtgg gcgccgggcg agtcgctcag cgacatcgcc gcgtgcgccg    222480
     acgagatcgc ggcgatctgc gcgggcgagg ccttctgggc cgccagcgac gcgcactcgg    222540
     gctccagcag caggcgcgtg tcgagcaggt cgaacggacc gatgtcggtg tggccgggct    222600
     ggggcgccgg cgcgacgcca tagtcgccat cggcgcgcgg cgccgccacg aacacgcccg    222660
     tgcccacgcg gacttcgaca tagccttcga tttcgagggc gatcagggcc tcgcgcaccg    222720
     aggcgcggct gacctgcagt tgctcggcca gttcgcgctc ggcgggcagg cggccgccgg    222780
     cgggaaaatc gccggcgcgg atgcggccgg cgatctggtc ggcaatcatg cggtacaggc    222840
     gcgtgggggc gacggcttgg aaggatccca tggttggtgg cgtgtccggt tatctggtgg    222900
     cccagtggtc aggccactaa tataccgaag cgcccggcga ataaaaatag cgggcgatgg    222960
     cgaatccggg ctttctaggg aaaaccacta ggtgtgaact gtcaataggt tgtattcgtc    223020
     caggttgagt ctggagatgg gtacagcgcg cccgatgcct tggtggggtc gatgccagtt    223080
     gtagtggtgt agccaggatt tcatggcatc ggctcggtgt tgggagttct ggtaggtgtg    223140
     agcgtaagcc cactcacgca aggccgactg gatgaagcgt tcggccttgc cattggtctg    223200
     tgggcggtaa ggtcgggtaa agcggtgctt gatgcccagc tcatggcaca gcgcggcgaa    223260
     ggcgcggctg cgaaaggccg agccattgtc ggtgagcaag cgctggatgg tcacgcccag    223320
     gcgctggtag taggccactg cgtccttgag gaactggacg gcgctgggga agcgctcgtc    223380
     ggggtggatg tcggtgaagg ccacgcgggc gtggtcatcg atggccacga agacgaagtc    223440
     ccagccggcc ccctcaacgg tatcgcgtcg gttgcccgtg acccggtggc cagggcgctg    223500
     gatacgtccc agcttcttga tgtcgatgtg cagcagatcg ccgggggcct gatgctcgta    223560
     gcgcaccacc ggctcggccg gctccaggtc ggccaggtgc gacagaccgg cgcgggccag    223620
     gacgcggctg acggtgctgg ctgacacgcc cagcgcctgg gcgatgcgcg cttgggtcag    223680
     ccgcttgcgg cgcagctcca cgatagccag cgccttggcc ggcgcaatcg ctcggggcga    223740
     gaccgtcggg cgcgaggacg catcggccaa gcccgcctgg ccctgagcca ggaagcggcc    223800
     cagccatttg cgcacagtcg gcgcggtgac cccataggcg cgggccgctt caggcacaca    223860
     aacttgatgg gcgatcaatt gctggaccat ttcgagtcga cgtaggaagg tcaatcgggc    223920
     atgcttatgg gtgttcatcc ggccgggctc cttgagtgaa ctggggggtt ggcgatttcc    223980
     agtttctcaa atccggttcg gatgaaccat gcatacaacc tattgaatct tcacaactag    224040
     gccgcgccgc gccgcgtccg cccgccgcca gcgccagcag cgcctcgcgc aacaccaccg    224100
     cgttgttgtg ctcggtgtcg cgcgcgccgt agaccagcgt aagcgggccg gccccggcct    224160
     gcgccagcag ggcgcgcagc tgcgcctgat gcgacgggcc gcgcagctcg gccagatagc    224220
     gttcgcgaaa cgccggccag cggggcgtct ggtggccgaa ccactggcgc cgcgccgcgc    224280
     tgggcgccag gtccttgatc cagtcgtcca gcggcagggc gtccttgcgc aggccgcgcg    224340
     gccacagccc gtcgatcagc acccggcgcc cgtcggcggg cgcggcggcc tcataggcgc    224400
     gcttgagatg gatggcgggc ttcatgggcg cgggcgcgtt tgcgcataca ctgggcggcc    224460
     tgatcgaaag cgagttttca tgaggcggtt tcctgggcgg atgctgaagt ggctggtcct    224520
     ggcctgcggc ctggcgacgg cggccgggct gctcgcctgg cggctggcgc cgtcttccga    224580
     ctatatcgcg cctgcggccg ggcaggaccg cctgcgcggc caggccatct accaggcgaa    224640
     ctgcgccgcc tgccatggcg cgcggctcga gggccagccc gactggcgcc agcggccaca    224700
     cctggcacca ccccgacgag cgcttcccca gcgccgtcca gttcctcaag gacgcagtgg    224760
     cctactacca gcgcctgggc gtgaccatcc agcgcttgct caccgacaat ggctcggcct    224820
     ttcgcagccg cgccttcgcc gcgctgtgcc atgagctggg catcaagcac cgctttaccc    224880
     gaccttaccg cccacagacc aatggcaagg ccgaacgctt catccagtcg gccttgcgtg    224940
     agtgggctta cgctcacacc taccagaact cccaacaccg agccgatgcc atgaaatcct    225000
     ggctacacca ctacaactgg catcgacccc accaaggcat cgggcgcgct gtacccatct    225060
     ccagactcaa cctggacgaa tacaacctat tgacagttca cagctaggcg tgctgggcct    225120
     gatcctcgat ccgcttttct cgatgctgcc gctgacgcgc gccatcggcg aggtgacctg    225180
     gagcgccaac aacgaattcc tgctggtcgc catcccgctg ttcatcatgc tgggcgaggt    225240
     gctgctgcgc gccggttttg ccgaacgcat gtatgccgcc atgagcctgt agctgtcctg    225300
     gctgccgggc gggctgatgc acgccaacat cggcgcctcc acgctgttct ccgccacatc    225360
     cggctccagc gtggccaccg ccgccacggt gggcacggta gcgatcccgc agatcaagaa    225420
     gtacggctac aacgagccgc tgttcctcgg cagcctggcc gccggcggca cgctgggcat    225480
     cctcatcccg ccgtccatca acctggtgat ctacggcgtg ctgaccaact cgtcggtacc    225540
     caagctgtac ctggccggca tcatccccgg cttcgcgatg gcggccctgt tcatgatgac    225600
     ggtcgtggtg gcctgcgtcg ccaagccgtc atggggcgga caccgcatcc aggcctcctg    225660
     ggccgagcgc atcgccagcc tggtgcacct cgggccgccc atggggatct tcttcctggt    225720
     ggtcggatcg atctacgccg gcctggccac gccgaccgag gctgccgcgc tcggcgtgct    225780
     gggcgcgctg atcctggccg cctggttccg ccgcctgacc tggaccatgc tgcgcgaggc    225840
     gatcgaaggc accatgcgct cgaccgccat gatcatgctg atcgtgctgg cggccagctt    225900
     cctgaacttc gtcatgtcgg ccaccggcct gaccgatgcg ctggtgcagt ccatcacggg    225960
     gctggggctg tcgccgggct ggatgctgct gatcgtggtg attttctacc tggtgctggg    226020
     ctgcttcatg gaaacgctgt ccatgatgat caccacgatc ccgatcgtgg cgcccatcat    226080
     gatcgcgctg ggctatgacc cgatctggct gggcatcctg atcatcgtgc tggtcgaggc    226140
     cgccctcatc acgccgcccg tcggcctgaa cctgttcgtg gtgcaaagcc tgcgcaagag    226200
     cggttcgatg acggcggtca tcaacggcgc gctgccgttc gtgctggcca tgttcgtcat    226260
     gttggcgctg ctggccttct tccccgacct ggcgctatgg ctgccgcgcg tgttcgggta    226320
     atcgtctagg gacaggcgcg gccatggcgg ccgcgcgctt tactgcaagg tatcaaatga    226380
     aaatcgcatt ccaagtccag gccgatggcg ccacccgcac cgtcgagacc gaaatccgca    226440
     acctggtcgt ggccggctgg gccggacgcg accgcgccgc catcgaacac cacatcgagg    226500
     agctcgcgga actgggcgta ccgcgcccga gcagcgtgcc gctgtattac cgcatcgccg    226560
     agaaccagtt gagccaggcc ggccgcgtgt aggccgtcgg ccccgattcg tcgggcgagg    226620
     ccgaaacctt cgtcttcagc gtcggcggcg aactgtacgt cagcctggcc tccgaccata    226680
     cggaccgcaa gctggaggcc catagcgtcg ccctgtccaa gcaggtctgc gtcaagccgg    226740
     tggccagcga cgcatggcgc catgccgacg tggccgagca ctgggacgaa ctggtgctgc    226800
     gctcgtacat cgtcgagaac ggcgccgagg tgctgtacca ggaagggacg ctggcctcgc    226860
     tgcgcacgcc gcaggacctg atcgccggct acacgcaggg ccaggcatcg ctgcccgagg    226920
     gcacgggcat gacctgcggc acggtggccg ccatcggcgg catccgcgcc tcgaccacgt    226980
     tcatcatgga gctgcacgat ccgcgccgcc agcgcaccct gcgccaccgc tatgatgtgg    227040
     aagtattgcc ggaaatcgcc tgagcggccg gcgggccttt cctcaacccc caaccgccgc    227100
     ggcgcggcac acggattgtt cccatgctac cgacgttgaa acaacaaagc ctggccttgc    227160
     aggaaggccg cgacacttcc agcgggctga cgcaagccgc cctggcgcgc gccgccgatc    227220
     cggccgggga gggcgcgcgc gtctttacgc gcgtgtacgc cgagcaggcc cgcgccgagg    227280
     cccgcgcggc cgatgcgctg cgcgccgccg gcgtcacgcg ctcggccatc gacggcctgc    227340
     ccatctcgat caaggatctg ttcgacgtcg cgggcgaaac caccatggcc ggctcggtcg    227400
     cgcgccaggg cgagccagcc gcggtccgcg acgcggtggt ggtgcggcgc ctgcgcgccg    227460
     ccggcgcggt catcgtcgga cgcaccaaca tgaccgagtt cgcctattcg ggcctgggcc    227520
     tgaacccgca ctacggcacg ccccgcaacc cctgggatcg cgccaccggg cgcattcccg    227580
     gcggctcctc ttcgggcgcg gccgtctcgg tgaccgacgg catggccagc ggggccatcg    227640
     gttcggacac cggcggatcg gtgcgcatcc cggccgcgct gtgcggcctc gcgggtttca    227700
     agcccagcgc gcagcgcgtg tccatgcagg gcgtgttgcc gctgtcggcc aacctcgatt    227760
     cgattggccc gctcgcgccc tcggtgcggt gctgcgccac gctcgacgcc atcctggccg    227820
     gcggcgacga cgcggacatg cccgcgccgg ccgcgctgcg cggcctgcgc ctggcagtac    227880
     cgaccacgct ggcgctcgac ggcctggatg cgcatgtgtc ggccactttt gccgcgacgc    227940
     tggcgaaact ggccgaggcg ggagcgtgta tcgacgaaat cgccgtgccg gagttcgcgc    228000
     aactggccga catcaacagc aagggcggct ttaccgcggc cgaggcctgg gcgtggcacc    228060
     gcgacttgat cgaacgcgcc gccgatcgct acgacccgcg cgtcgtggcg cgtatccgcc    228120
     gcggcgccga catgtccgcg gccgactaca tcgacctgct ggcggcccgg caggcctggc    228180
     gggccggggt cgaggcgcgc atcgccggct acgatgccct ggtcctgccg accgtgccgg    228240
     tcgtcgcgcc cgccatcgcc gacctggaag cctccgatgc cttgttcggc tccaccaacc    228300
     tgctgatcct gcgcaatccc acgctgatca acttcctcga cggcagcgcg ctcagcctgc    228360
     cttgccacga ggccggcacc gccccggtcg gactgatggt cgccgcggcc aatggctcgg    228420
     accggcgcgt gctcgccatc ggcatggcca tcgaagacct gctgggcggg taaccatccg    228480
     gcgggccggc ggtgcgccgg cccgcccctt accatcgagt tgctgccatc atgacgattc    228540
     tttccctggc cggcgcgggc catcaggcgc gcctggacgc gcgcggcggg atgctgaccg    228600
     ggcccacggc caacctcgcg cccggccatg tacaggccaa cctggccatc ctgccgcagg    228660
     ccgtggcggg cgacttcctg cgcttctgcc agcgcaatcc caagccatgc cccttgctgg    228720
     cggtctccga acccggcgac ccgtccttgc ccgagctcgg cctcgatatc gacatccgca    228780
     ccgatgtgcc gcgctaccgc gtctggcgcg acggcaagct ggtggacgag ccgctcgacg    228840
     tgcgcggcct gtggcgcgac gatctggtgg ccttcctcat cggctgctcc ttctcgttcg    228900
     aggaggccat gctcgagaat ggcctgccgg tccgccacat cgagcagggc tgcaacgtgc    228960
     ccatgtaccg taccaacatc gccacgcatc cagccggccc gttctcgggg ccgctggtgg    229020
     tttcgatgcg gccgctgaag gccgcggacg caatccgcgc catccaggtc acgtcgcgct    229080
     ttccgtccgt gcatggcgcg cccgtccatc tgggcgaccc cgcattgatc ggtatcgccg    229140
     acctcggccg tccggactac ggcgacgcgg tcgaaatccg cgccggcgag ataccggttt    229200
     tctgggcctg cggcgttacg ccgcaatcgg tcgtcgcggc cgtgcgtccg gaattctgca    229260
     tcacccatgc gcccggccac atgctggtca ccgatctgct caacagccgg ctggccgcct    229320
     tctaagagat gggcgaacgc gcccacgcag tacgattggg aaaagtacgg cggacatgtg    229380
     agttgtatcc tatggcttgg atggcatcgg tccatttcaa tatgacgttg ttcatttcgc    229440
     caacgtcagt actgctccat gatccactgg accaacagcg ctcgcagcag cttcgaggct    229500
     tccctcagtc cgtcccggcg caccctgcgc gcccggctgg cgcccgtcga agggcccacc    229560
     gtcgcagaac tgcgcgccgc gctcaagcgc gatgaattca ttccagcatt ccagcccgtg    229620
     gtcgatgccg gcacgggcag cctgttcggc gtggccacga cgatacagtg ggcgcaccgg    229680
     cattgggggc tggtgcccga gcactgctac atggccgcct tggtgcgcga caacctgcat    229740
     atcgcgctgg cgcaacagct gctggcgcag gttttcgacc tggccgcggc catgcgccgc    229800
     ggcaaccgcc atgtggggct gttcatccag ccagagccca tatgcctcat gagccgcagc    229860
     tacagcgacg acgtcctgcg caatctggac caccgcggcc tgcccccgtt tgcgctgacg    229920
     ctggccgttt cgcccagcct gctgcagtcg ccctatggcc agcaaagcct gcatagcctg    229980
     cggcggctgc accgggccgg atgcaacctg gtgcttaccg tcagcacgtt cgatgccgag    230040
     tcgccgccgc acctggacgc gctggaaatc tgcggcatcg ccctgatgcc agaactcatg    230100
     tatgccctgc gccagggcgg cagggccggc gaggcgtgcc gtgccatcgc acagcaggcc    230160
     tcggcgcagc ggattcccgt catggccgcc ggcgtggtcg acgaggccat ggcccaggcc    230220
     gccgatctgc tgccatgccg gtatctgctg ggcgaccatg tggccccgcc catgacgggc    230280
     cagcgcttcc tgtattggta ctaccgccgc gagatgccgc ccaattatcc gtaaggtccg    230340
     cgcaagcagg gatgccggtt cgggcgggtt cgtggcttca gggctgatct tgatgcggcc    230400
     gttgctccag ccaggcgcgc agttgcgtct ccagcgcggc ggactgcgcc gcaagcgtac    230460
     gtaccaggcc gtcgatttcg ggtgaggggc cagcctggcc ttgcgctttt ttctccagcg    230520
     ccagcacagt gtctatcatg gccttggcat cgaccacgcg cgcgccgccg gccagcctgt    230580
     gcgccatgtc cgagaccttc ggccaatcgg cctgctggtg cagcttttgc aattggtcga    230640
     cgtccgcccg gttggtgcga atcacttctt cgagcaattg ccggatcagc gcctcatcgt    230700
     tctgcgtcaa ggcaagaatc gactcggccg agaacgccgt cggggtggcg tcgtccgtgg    230760
     ccggcgcggc agcctggggc gaggggggcg tggggagcgc ggcccgtgcc acggcttcgt    230820
     tcaagcgttg ccgcaaggcg tccacgccga tcggcttgaa caggcagtcg tccatgccgg    230880
     cggcgcggca gcgctgcgct tcgtccatct gcgccgaagc cgtgaagccg aacagaatgc    230940
     accgcgtacg tccgtaaccg ggcgcggcct cggcggcgcg tatgcggcgc gccaattcgt    231000
     agccgctgat accgggcatg ttgcaatcgg tgatcacgac gtcgaacgca tgctcgcgcc    231060
     acagggccag ggcggcttcg ccggagtcgg cggcgatgac acgctggccc aggtagtcca    231120
     gctgctggcg cagcagcatc aggttgggtt tgtggtcatc gacgaccagc acgcgcagcg    231180
     atacctgcgg cttggacggc gtggccgcag tggccgcagc gggcggcgcg gcctgcacgg    231240
     atttttcgac catggtcagc ctcaggtcca ccgaaaccgt tgtgcccacc cctggcgcgc    231300
     tgcgcatgac cagcgttccc cccatcaatt cgacgaggcg ccggctgatg gacaggccca    231360
     ggccggtgcc cggcgccggc ccggcctcgg cgctgccacc cacttgcgag aacggtttga    231420
     acagctgccg ttggtcggcc tcgctgatgc cgcagccggt gtcgctcacg ctgaactgca    231480
     cgtgcgcggc gtcgccgtcg gggcgtgcgg tcacggcaag gacaacctgg ccttcggtgg    231540
     tgaacttgat ggcgttgccc accaggttcg agagcacttg cttcatgcgc aaggggtcta    231600
     tcaatacatc gtcgacgccc acgatgtcgg tcttcaatac cagctctatg cctttttggc    231660
     gcgccaatcc gtcgaagacg cggatcgccc cttcgggcag gacgcgcagc gccgtgcgca    231720
     ccggcgccag gtcgaatttt cccgcctcga tcttcgcaat gtccaggatg tcgcctatca    231780
     gctccagcag gctgcgggcc gagtcgtacg cgacctggat ggactggcga tccggctcct    231840
     ggtcggtcgg acggagcagc gccagctcca gcatgccgat gatcgcgttc atcggcgtgc    231900
     ggatctcgtg gctcatcgtt gccaggaacg tggtcttggc ccggttggcg gcgtcggcgc    231960
     tttccttggc gtcgtgcagc ttgcgcagca gctcggcgcg ttcggtgatg tcgatccagc    232020
     cgccgatgat gcccttgagt tcgcccagcg agtcgccgta cggaatcgtc cactggtaga    232080
     catggcgggt gcggccgtgc agcgtgacat cgcggtcctc gaagcgcggc tcgcgctcgg    232140
     cggccacgcg cgtgagcagg aactcgtgca tttcgcgggc cagcgccggg tcgcccacca    232200
     cgttggcttc cggaatggtc ttgcccagta ccgcatcggc agtcacgcca aaggtgtcga    232260
     ggtaggcgtc attgcacaac agcatgcggc cttccttatc gcgcacatag atggggttag    232320
     gcgtgccgtc gatgagcacg cgcatgaatt ccagctggtc gttcagcgcc cgctcggccc    232380
     gcttgcgctg gcggatctgg cgccgcaggt agacgatcca gctcaggaac agcagggccg    232440
     acaacaggcc cagcccgatc agcaggtaga tctcgttgcg gtaggcgtac caggtgcgcg    232500
     gatcgccgtc gctgccgcgc cagcggctga tgatggaggc gagctcgtcg ttcgaaatgc    232560
     tgtagagcgc cttgttcagg atggacatca gttcggtctg gccgcgcgtc gtcgccagcg    232620
     cgatctcggc cgggggcagg tccagcgccg aggcgatgcg cagcttgccg gcgaagtagc    232680
     ggttgacgta atagctggcg ctgatctgcg tctgcacgac ggcgtcggcc tgtccattgg    232740
     ccaccatcag catcgcctcg ctcgggttgt cggcggtcac caccttcgcc tggggatagc    232800
     gccgctgcag caggggaatg gcggcgctgt tgcgcaccaa cgcgaccgtg cggccgtcca    232860
     gatgatcggc gtcgacgggc gcgtcggggt cctggcgcgt gacgatcacc atgccattgc    232920
     gcacatacgg ccggctgaaa ctgaggaagg actcccgcgc gctgttgacg aacagggcgc    232980
     cggccatgtc ggcttcgccc gaacgcagct tggctatcag ttcctcgacc gtgtcgacgc    233040
     cgatgatctc gaagtccagg ccggtgcgca attgcagcag ctgcagcacg gcggcgctga    233100
     tcccgccgaa ctgttcgtcg gtgcggaaca gggtgaaggg cgcgaacaga ttcaggaccg    233160
     ccaccttgac gacggggtgg tctgccatcc attgctgctc gcgcgcggaa tacgcggggt    233220
     gcgcgaaatc gagcgaaatg ctgctgccca gtccccagcg gtagatcagg ctgcggtgtt    233280
     cggaaggcgg aatggcttcg agtacggcgt tgaccacccg cagcaggcgg gtgttgtcgg    233340
     cgcgcacgcc gaaggattct ccgcccgtcg cgatatgggc cggggcgact acgcgaacgt    233400
     cattgaaata gctttgcgat acgaggtgcg aggtggtcag ggcatcgccg atgaatacgt    233460
     cggcctgccc ataggccacc gcggccagcg cctgctcgga tgaggggaag taatgcagcg    233520
     tagcctgcgg gtaggcccgt gcgagcgttt ccttgggcag gtagttgatg tcgaccgcca    233580
     gccgctggcc ggccaggttc gaggctggaa cgtggcgtgc gccgatgggc atgacgatca    233640
     ccgggtggtc ggcggcgtag ggaacgctca gacgcaggct ctgttgccgg ccgtccgtgc    233700
     cattgacggt gccgatgagg tcgatctgcc cgctttccag cgcgctgagg gcttgttcgc    233760
     gcgtggggta tcgcagcact ttcgcctgca tccccaggtt gtgcgcgatg atcgccatgt    233820
     agtcggccgt caggccttcg tagcgttcgc cataggtgac gtcgaacgga ggaatgtccg    233880
     gtgcgtacac acccagcgtc agtacccgct tgcgggccag ccaacgccag tcgtcgccgt    233940
     cgagcgcgac ctcgacgtcg ggaacggcag ccttgccgac cagggtcagc tcctggcttg    234000
     cctgcgcggg cgcccatgcc agcaaagccc atgccaatag cgcctgagcc aggcagatca    234060
     gactgcgggg gtacaggcgg tgcggggcgg gcatgcgcgg cgctaggcga gattgttgcg    234120
     tttggcgagg tctatcagtt ccaccagcga cgtggcgttc agcttctgca gcaggcgcgt    234180
     cttgtaggtg ctgacggtct tgttgctgag gaacatgctg tcagcgatgt ccttgttgga    234240
     catgccttgc gccagcagtt gcaggacggt cagttcgcgg ttggacaaca cgctgatgag    234300
     cgtactgtcg ctcttggcgt tgtcgcccat gcgcatctcg ctgagcgtgg tgctggggaa    234360
     gtaggtgtag ccggccatca ccgccttggc ggcattgatg acctcgtgca ggttctcgtg    234420
     tttgcacacg aagcctgcgg cgccggagtt caggcagcgg cgggcgaaca gcgaaggcgg    234480
     ctggccggtc agcaccagca cgcgtagcgg caaccccagc gattgcagcc gggcgatgac    234540
     ttccagcccg tccagcttgg gaatgccgat gtcgagtacg acgaggttgg gaattttctc    234600
     gcgggcgatc ttgagcccgt caatgccgtt atcggtttcg ccgatgactt cgaatccttc    234660
     cttttccatc aggacccgga cggcgaatct cagtacaggg tgatcgtcaa tgatgaggac    234720
     tttgttgtac atgataagaa gaatatgctt tgagtttcgt ggcgagaaaa aaatcctgca    234780
     acgcgtaatg tcattgatgc gtcaaaggaa tggctgcgaa atttcacatt ctcctatacg    234840
     tcagcaagca acgatacggg catgagtgct gctaaacagt atcctatacc aaaataggaa    234900
     aagtctgaat tcctgcgctg gcacccgcgg cgggccgggg agcgggttgt cggcgcacgc    234960
     ctatacgtgc cggacagggt ttgatggttt gactaagaaa tttcctacaa gtcttgtata    235020
     aatatccatt gatggacggg atcattactg actgacgaag tgctgaggtt tatccagact    235080
     atggcactgg atttcaaaac ctaaaacgag caggccgata acggattctg ccgattactt    235140
     cacttcgctg gtcggaatat gaacacgaac ctgtacaggc tggtcttcag ccatgttcgc    235200
     ggcatgcttg ttcccgtgag cgagcattgc accgtcggaa acaccttctg tgggcgcacg    235260
     cgtggtcaag cgcgaagtgg ggcccgcgcc acgagcctgt ccgtagcgcc caatgcgctg    235320
     gcctgggccc tgatgttggc gtgtacgggt cttccgttag taacgcacgc ccagggcttg    235380
     gttcctcagg ggcagacaca ggtgctgcag ggcgggaaca aggttcccgt tgtcaatatc    235440
     gccgacccaa attccggcgg cgtctcgcac aacaagttcc agcagttcaa cgtcgccaac    235500
     cctggcgtgg tcttcaacaa cggcctgacc gacggcgtgt ccaggatcgg cggggcgctg    235560
     accaagaacc ccaacctgac tcgccaggcc tcggccattc ttgccgaagt cacggacact    235620
     tcgcccagtc gcctggccgg tacgctcgaa gtctatggca agggcgccga cctcatcatc    235680
     gccaacccca acggcatcag cgtcaacggc ctgagcacgc tcaacgccag caacctgacg    235740
     ctcacgacgg ggcgtcccag cgtcaacggc ggccgcatcg gccttgatgt ccaacagggc    235800
     accgtcacga tcgaacgagg cggcgtcaat gccaccggcc tgggctattt cgacgtggtg    235860
     gcgcgcctgg tcaagctgca gggtgccgtg tcgagcaagc agggcaagcc cctggccgac    235920
     atcgcggtgg tcgccggcgc caaccggtac gaccacgcaa cccgccgcgc cacgccgatc    235980
     gccgcaggcg cgcgcggcgc cgccgcgggc gcctacgcga ttgacggcac ggcggcgggc    236040
     gccatgtacg gcaagcacat cacgctggtg tccagcgatt caggcctggg cgtgcgccag    236100
     ctcggcagcc tgtcctcgcc atcggccatc accgtgtcgt cgcagggcga aatcgcgctg    236160
     ggcgacgcca cggtccagcg cggcccgctc agcctcaagg gcgcgggggt cgtgtcggcc    236220
     ggcaaactgg cctccggggg gggggcggtg aacgtcgcgg gcggcggggc ggtgaagatc    236280
     gcgtcggcca gcagcgttgg aaacctcgcg gtgcaaggcg gcggcaaggt acaggccacg    236340
     ctgttgaatg ccggggggac gttgctggtg tcgggccgcc aggccgtcca gcttggcgcg    236400
     gcgagcagcc gtcaggcgct gtccgtgaac gcgggcggcg ccctcaaggc ggacaagctg    236460
     tcggcgacgc gacgggtcga cgtggatggc aagcaggccg tcgcgctggg gtcggccagc    236520
     agcaatgcgc tgtcggtgcg tgccggcggc gccctcaagg cgggcaagct gtcggcgacg    236580
     gggcgactgg acgtggacgg caagcaggcc gtcacgctgg gttcggttgc gagcgacggt    236640
     gcgctgtcgg taagcgctgg cggaaacctg cgggcgaagc aattggtctc cagtgcccaa    236700
     cttgaggtgc gtgggcagcg ggaggtcgcg ctggatgacg cttcgagcgc acgcggcatg    236760
     accgtggttg ccgcaggagc gctggcggcc cgcaacctgc agtccaaggg cgccatcggc    236820
     gtacagggtg gagaggcggt cagcgtggcc aacgcgaaca gcgacgcgga attgcgcgtg    236880
     cgcgggcgcg gccaggtgga tctgcacgac ctgagcgcag cgcgcggcgc ggatatctcc    236940
     ggcgaggggc gcgtcaatat cggccgtgcg cgcagcgata gcgatgtgaa ggtctccgcg    237000
     cacggcgcct tgtcgatcga tagcatgacg gccctcggtg cgatcggcgt ccaggcaggc    237060
     ggcagcgtgt cggccaagga tatgcgcagc cgtggcgccg tcaccgtcag cggcggcggc    237120
     gccgtcaacc tgggcgatgt ccagtcggat gggcaggtcc gcgccaccag cgcgggcgcc    237180
     atgacggtgc gagacgtcgc ggctgccgcc gaccttgcgc tgcaggcggg cgacgcgttg    237240
     caggccgggt tcctgaaatc ggccggtgcc atgaccgtga acggccgcga tgccgtgcga    237300
     ctggatggcg cgcacgcggg cgggcaattg cgggtttcca gcgacgggca ggctgcgttg    237360
     ggcagtctcg cggccaaggg cgagctgacg gtatcggccg cgcgcgcggc gaccgtggcc    237420
     gagttgaagt cgctggacaa catctccgtg acgggcggcg aacgcgtgtc ggttcagagc    237480
     gtcaacagcg cgtccagggt cgccatttcg gcgcacggcg cgctggatgt aggcaaggtt    237540
     tccgccaaga gcggtatcgg gctcgaaggc tggggcgcgg tcggagcgga ctccctcggt    237600
     tccgacggcg cgatcagcgt gtccgggcgc gatgcggtca gggtcgatca agcccgcagt    237660
     cttgccgaca tttcgctggg ggcggaaggc ggcgccacgc tgggcgcggt ggaggccgcc    237720
     ggttcgatcg acgtgcgcgg cggatccacg gtggcggcga actcgctgca cgccaatcgc    237780
     gacgttcggg tcagcggcaa ggatgcggtg cgcgtaacgg ccgccaccag cgggggcggt    237840
     ctgcatgtgt cgagcggccg ccagctcgat ctgggcgccg tgcaggcgcg cggcgcgctg    237900
     gccctggacg gaggcgccgg cgtggcgctg caatcggcca aggctagcgg cacgctgcat    237960
     gtgcagggcg gcgagcacct ggacctgggc acgttggccg ccgtaggggc ggtggacgtc    238020
     aatggcacgg gagacgtgcg cgttgcgaag ctggtgagcg atgcaggcgc cgatctgcaa    238080
     gcggggcgct ccatgacgct gggtatcgtc gacacgaccg gcgatctgca ggcgcgcgcg    238140
     cagcagaagc tggagctcgg gtcggttaag agcgatggcg gccttcaggc cgccgccggc    238200
     ggggccctca gcctggcggc ggcggaagtc gcaggggcgc tggagctctc gggccagggc    238260
     gtcaccgtgg acagagccag cgctagccgg gcacgcatcg acagcaccgg ttcggtcggc    238320
     atcggcgcgc tgaaggcagg cgctgtcgag gccgcctcgc cacggcgggc gcgccgcgcg    238380
     ctgcggcagg atttcttcac gcccggcagc gtggtggtcc gcgcccaggg caatgtcacg    238440
     gtcgggcgcg gcgatccgca tcagggcgtg ctggcccagg gcgacatcat catggatgcg    238500
     aagggcggca ccttgctgtt gcgcaacgat gccttgaccg agaacgggac ggtcaccata    238560
     tcggccgatt cggccgtgct cgagcattcc accatcgaga gcaagatcag ccagagcgtg    238620
     ctggctgcca aaggggacaa gggcaagccg gcggtgtcgg tgaaggtcgc gaagaagctg    238680
     tttctcaatg gtacgttgcg ggccgtcaac gacaacaacg aaaccatgtc cgggcgccag    238740
     atcgacgtcg tggacggacg tccgcagatc accgacgcgg tcacgggcga agcgcgtaag    238800
     gacgaatcgg ttgtgtccga cgccgcgctc gtggccgatg gcggtccgat cgtggtcgag    238860
     gccggcgagc tggtcagcca tgccggcggt atcggcaacg gccgcaacaa ggagaatggc    238920
     gccagcgtca ccgtgcgcac gactggcaac ctggtcaaca agggctacat ctcggccggc    238980
     aagcagggcg tgctcgaggt gggcggcgcc ttgacgaacg agttcctggt cggctcggac    239040
     ggcacccagc gcatcgaggc gcagcgcatc gagaacaggg gcaccttcca gagccaggct    239100
     ccggcgggca cggccggcgc cctggtggtc aaggctgccg aggccatcgt gcacgacggc    239160
     gtcatggcca ccaaaggcga gatgcagatc gccggcaagg gcggcgggtc tccgaccgtc    239220
     accgccggcg caaaggcgac gaccagcgcg aacaagctga gcgtcgacgt ggcaagctgg    239280
     gacaacgcgg gaagcctgga tatcaagaag ggcggcgcgc aggtcacggt ggccgggcgc    239340
     tatgccgagc acggcgaggt ttcgatacag ggcgattaca ccgtctcggc cgacgccatc    239400
     gcgctggcgg cgcaggtcac ccagcgcgga ggcgccgcga acctgacctc gcggcacgac    239460
     acccgtttct ccaacaagat tcgcctgatg gggccgttgc aggtcaacgc cggcggcgcg    239520
     gtgtccaata ccggcaatct gaaagtgcgc gagggcgtga ccgtaacggc ggcgtcgttc    239580
     gacaacgaga ccggggccga ggtcatggcc aagagcgcca cgctgacgac ttccggggcc    239640
     gcgcgcaacg cgggcaagat gcaggtcaag gaggccgcca cgatcgttgc cgccagcgtt    239700
     tccaatcccg gcacgttcac ggccggcaag gatatcactg ttacctcgcg cggaggattc    239760
     gataacgaag gcaagatgga gtccaacaag gacatcgtca tcaagacgga acagttcagc    239820
     aatggcaggg ttctcgacgc caagcatgat ctgacggtca cggcgagcgg gcaggcggac    239880
     aaccggggca gcctgaaggc aggccacgat ttcacggtgc aggcccagcg tatcgacaat    239940
     agcggaacca tggccgccgg ccacgacgcc acgctgaagg cgccgcacct gcgcaatacg    240000
     ggccaggtcg tagccgggca cgacatccat atcatcaaca gcgccaagct ggagaacacc    240060
     gggcgcgtgg atgcgcgcaa cgacatcgct ctggatgtgg cggatttcac caacacggga    240120
     tccctctacg ccgagcatga cgcgacgctg acgcttgcgc aaggcacgca gcgcgatctg    240180
     gtggtggacc aggatcatat cctgccggtg gcggagggga cgttacgcgt caaggccaag    240240
     tcgctgacca ccgaaatcga gaccggcaat cccggcagcc tgatcgccga ggtgcaggaa    240300
     aatatcgaca acaagcaggc catcgtcgtc ggcaaggacc tgacgctgag ttcggcgcac    240360
     ggcaacgtgg ccaacgaagc gaacgcgctg ctgtgggccg ccggggagct gaccgtcaag    240420
     gcgcagaaca tcaccaataa acgggccgcg ctgatcgagg cgggcggcaa cgcccggctg    240480
     acggcggccg ttgccttgct caacaagctg ggccgcattc gcgcgggcga ggacatgcac    240540
     ctggatgcgc cgcgcatcga gaacaccgcg aaactgagcg gcgaggtgca acgcaaaggc    240600
     gtgcaggacg tcgggggagg cgagcacggc cgctggagcg gtatcggcta tgtcaactac    240660
     tggttgcgcg ccggcaatgg gaagaaggcg ggaaccatcg ccgcgccgtg gtatggcggt    240720
     gatctgacgg cggagcagtc gctcatcgag gtcggcaagg atctctatct gaatgccgga    240780
     gcgcgcaagg acgaacatcg ccatctgctc aatgaaggcg tgatccaggc gggcggccat    240840
     ggccacatcg gcggcgacgt ggacaaccgg tcggtggtgc gcaccgtgtc cgccatggag    240900
     tatttcaaga cgcctcttcc ggtgagcctg actgccctgg acaatcgtgc cggcttgtct    240960
     ccggcgacct ggaacttcca gtccacgtat gaactcctgg attatctgct ggaccagaat    241020
     cgctacgagt acatttgggg gctgtatccg acctacaccg aatggtcggt gaatacgctg    241080
     aagaacctcg acctgggcta ccaggccaag ccggctccca ctgcgccgcc gatgcccaag    241140
     gctcccgaac tcgacctgcg tggccatacg ctggagtcgg ccgaaggccg gaagatcttt    241200
     ggcgagtaca agaagctgca aggcgagtac gagaaggcga agatggccgt ccaggccgtg    241260
     gaggcttacg gcgaggctac tcggcgcgtc catgatcagc tgggccaacg ttatggtaag    241320
     gccctgggcg gcatggatgc cgagaccaag gaggtcgacg gcatcatcca ggagttcgcc    241380
     gcggatctgc gaacggtcta tgcgaagcag gccgaccagg cgaccatcga cgcagagacg    241440
     gacaaggtcg cccagcgcta caagtcgcag atcgacgcgg tgcggctgca ggcgatccag    241500
     cctggccggg tcacgctggc caaggcgctg tcggcggcgc tgggcgccga ctggcgcgcg    241560
     ctgggtcact cccaattgat gcagcgctgg aaggatttca aggcgggcaa gcgcggcgcg    241620
     gaaatcgcgt tctatcccaa ggaacaaacc gtgctggccg ccggcgccgg tttgaccctg    241680
     tccaacgggg cgatccacaa cggcgagaac gccgcgcaga atcgcggccg gccggaaggc    241740
     ctgaaaatcg gcgcacattc ggcgacttcg gtgagcggct cgttcgacgc cttgcgcgac    241800
     gtggggctgg aaaagcggct ggatatcgac gatgcgctgg ctgccgtgct cgtgaatccg    241860
     catattttca cgcggatcgg ggcggctcag acatcccttg ccgacggcgc cgccgggccg    241920
     gcgctggcgc gccaggccag gcaagcgccg gagaccgacg gcatggtgga tgcgcgaggg    241980
     ctgggcagcg ccgatgcgct cgcttccctg gccagcttgg acgcggcgca agggctggag    242040
     gtatccggca ggcgcaatgc gcaggtggcc gacgccgggc tcgccgggcc gagcgccgtc    242100
     gcggcgccgg ccgtcggggc ggccgatgtc ggcgtggagc ctgtcacggg ggaccaggtc    242160
     gaccagcctg tcgtggcggt cgggctcgag cagcctgtcg cgacggtccg ggtcgcgccg    242220
     ccagccgtcg cgttgccgcg gccgctgttc gaaacccgca tcaagtttat cgaccagagc    242280
     aaattctacg gctcgcgtta tttcttcgag cagatcggct acaagcccga tcgcgccgcg    242340
     cgggtggcgg gcgacaacta tttcgatacc acgctggtgc gcgagcaggt gcggcgcgcc    242400
     ctgggcggct atgaaagccg cctgcccgtg cgcggtgtcg cgttggtggc caagctgatg    242460
     gattcggccg ggacggtcgg caaggcgctg ggcctgaagg tgggtgtcgc gccgaccgcg    242520
     cagcagctca agcaggccga ccgcgatttc gtctggtacg tggataccgt gatcgacggc    242580
     cagaaggttc tcgctccccg gctgtacctg accgaggcga cgcgccaggg catcacggat    242640
     cagtacgccg gcggcggggc gctgattgcc tccggcggcg acgtaactgt caatacggac    242700
     ggccatgacg tcagttcggt caacgggctg atccagggca ggagcgtcaa ggtggacgcg    242760
     ggcaagggca aggtcgtggt ggccgacagc aagggggcgg gcggcggcat cgaggccgat    242820
     gacgaggtcg acgtctcagg ccgggatatc ggcatcgagg gcggcaagct gcgcggcaag    242880
     gatgtcaggc tcaaggccga cacggtcaag gtcgcgacct cgatgcgtta cgacgacaag    242940
     ggcaggctgg cggcgcgcgg cgacggcgcc ctggatgcgc aaggcggcca gctgcatatc    243000
     gaggccaagc gcctggagac ggccggcgcg acgctcaagg gcggcaaggt gaagctggat    243060
     gtcgatgacg tcaagttggg cggcgtgtac gaggcggggt ccagctacga gaacaagagc    243120
     tcgacgccgc tgggcagcct gttcgccatc ctgtcgtcga cgacggaaac caaccagtcg    243180
     gcacacgcga accattacgg tacgcgcatc gaagccggta cgctggaagg aaagatgcag    243240
     aacctggaga tcgaaggcgg ttcggtcgat gccgcgcata cggacctgtc cgtggcccgc    243300
     gacgcgaggt tcaaggccgc cgcggatttc gcgcacgccg agcatgagaa ggatgtgcgc    243360
     caactgtccc tgggtgccaa ggtgggggcg ggcggctacg aggcgggctt cagcctgggc    243420
     agcgaaagcg gtctggaagc gcacgccggc cgcggtatga ccgcgggcgc tgaagtcaag    243480
     gtaggttatc gggcatcgca cgaacagtcc tcggaaaccg aaaagtccta tcgcaacgcg    243540
     aacctcaatt tcggtggagg ctccgtcgag gctggcaatg tcctggatat cggcggcgcc    243600
     gacatcaacc ggaaccggta cggcggcgcc gcgaagggga acgccgggac cgaggaggcc    243660
     ttgcgcatgc gcgccaagaa ggtcgagtcc accaagtacg tcagcgagca gacgagccag    243720
     agctccggct ggagcgtgga ggtggcatcg acggccagtg cccgttccag cctgctgacg    243780
     gccgccacgc gcctgggcga cagcgtggcg cagaatgtcg aggacggccg cgagatccgc    243840
     ggcgagctga tggctgcgca agtcgccgcg gaggccacgc aactggtaac cgccgacacg    243900
     gcggcggtgg cactgagtgc cggaatcagc gccgacttcg acagcagcca cagccgctcc    243960
     acctcgcaga atacccaata tctgggcgga aacttgtcca tcgaggccac cgagggcgat    244020
     gcgacgctgg tgggcgcgaa gttcggcggt ggcgaccagg tcagcttgaa ggcagcgaag    244080
     agcgtgaacc tcatggcggc cgaatcgacc ttcgaatcgt actcggagag ccacaacttc    244140
     cacgcctccg ccgacgcgaa ccttggcgcc aacgccgtgc agggcgccgt tggcctgggg    244200
     ttgactgcgg gtatggggac gtcgcatcag attaccaacg aaaccggcaa gacctatgcc    244260
     ggaacctcgg tggatgcggc gaacgtgtcg atcgatgcag gcaaggatct gaacctttcc    244320
     gggtcccgcg tgcggggtaa gcatgttgtc ctggatgtcg agggcgatat caatgcgacc    244380
     agcaagcagg atgaacgcaa ctacaactcc agcggtggcg gttgggacgc ctcggcaggg    244440
     gtggcgattc agaaccgcac gttggttgcg cccgtggggt ctgccggctt caatttcaat    244500
     acggaacacg acaattcgcg cctgaccaat gacggggcgg cgggtgtcgt tgccagcgac    244560
     gggttgacgg gccatgtgaa aggcgacgcc aacctgaccg gcgcgaccat tgccgatttg    244620
     tcgggcaagg gcaatctcaa ggtcgacggc gcggtcaacg cgcagaacct gaaagactac    244680
     cgcgacaagg acggcggcag cggcggcctg aacgtgggca tctcgtcgac cacgctggcg    244740
     cccaccgtgg gcgtggcgtt cggcagggtg gccggagagg attatcaggc cgagcagcgc    244800
     gccacgattg acgtcggtca aaccaaggat cccgcgcgcc tgcaggtcgg cggcggcgtc    244860
     aagggtaccc tcaatcagga cgccgcgcag gccacggtcg ttcagcgcaa caagcactgg    244920
     gccggaggcg ggtcggaatt ctcggtggct ggcaagtcac tgaagaagaa gaaccaggtc    244980
     cgcccggtgg agacgccgac gccggatgtc gtggatggac cgcctagccg tcccaccacg    245040
     ccgcccgcgt cgccgcagcc gatccgcgcg acggtcgagg tcagttcgcc gccgccggtg    245100
     tccgtggcca cggtcgaagt cgtgccgcgg ccgaaggtcg aaacggctca gccgcttccg    245160
     cctcggccgg tggcggccca ggtcgtgccg gtgacgcctc ccaaggtgga ggtcgccaag    245220
     gtggaagtcg tgccgcggcc gaaggttgaa acggctcagc cgcttccgcc ccggccggtg    245280
     gtggccgaga aggtgacgac gccggcggtc cagccccagc ttgccaaggt ggagacggtg    245340
     cagccggtga agcccgaaac caccaagccg ttgcccaagc cgctgccggt ggcgaaggtg    245400
     acgaaagcgc cgccgccggt tgtggagacc gcccagccgc tgccgccggt caagccacag    245460
     aaggcgaccc ccggccccgt ggctgaggtg ggcaaggcta cggtcacgac ggtgcaggtg    245520
     cagagtgcgc cgcccaagcc ggccccggtg gccaagcagc ccgcgcctgc accgaagccc    245580
     aagcccaagc ccaagcccaa ggccgagcgt ccgaagccgg gcaaaacgac gcccttgagc    245640
     gggcgccacg tggtgcaaca gcaggtgcag gtcttgcagc ggcaagcgag tgacatcaac    245700
     aacaccaaga gcctgcctgg cgggaagctg cccaagccgg tcaccgtgaa gctgaccgac    245760
     gagaacggca agccgcagac gtatacgatc aaccggcgcg aggatctgat gaagctcaac    245820
     ggcaaggtgc tgtccaccaa gacgacactg ggcctggagc agaccttccg cctgcgggtc    245880
     gaggatatcg gcggcaagaa ctaccgggtc ttctatgaaa ccaacaaata ggtagtcgcg    245940
     gcctgccgcc ggctcggcgc atggggattc gcagggttct catgcgccgg ccaatgccgg    246000
     atagcggtgc aattgccgac catttcgcgc accgcgctca aggacgtagg gtcgacggca    246060
     ggcgggacag tttttgacgt gaaactgacc gagtgtccgc aggcattgaa tggtcagcaa    246120
     gtgggattgt tcttcgaatc tggtggcacg gttgactata cgtcgggaaa cctgtttgcg    246180
     tatcgggccg atagtcaggg cgtcgaacag gtaccgcaga cgaaagccga caacgtgcaa    246240
     gccaatctgg atggttccgc tattcatttg ggccgcaaca agggtgcgca ggctgctcag    246300
     acgtttctgg tatcgcagac ggctgggtcg tcgacgtacg gggcgaccct gcgctatctg    246360
     gcatgctaca tccgttcggg cgctggttcc attgttgcgg ggaatctccg cagtcaggtg    246420
     gggttctccg tgatgtatcc gtagcccgtg aaagaggggt cacccactgc ggggggcccc    246480
     ggtacgggat ggtcggcttg tcacgagatt cttgttttcc atttctttct tttcactcgg    246540
     tcgcagcgcc ggcttgatgc atgcaaagca tcgatagcta cgaacggccg cgattcttga    246600
     atcatgaata catacgcttg tgacggggcg ctcgcgcaga gccggcccca gggatggttt    246660
     acgcctgcat ttacggtaaa gcggcaaggc ggcatggcgc gctggcgccg gcggctgggc    246720
     gtcgcggcgc tgggcgccgc catgctggcg agcctggcgc cggccgcccg ggccagcctc    246780
     gtcatcacgg gtacgcgcgt gatctacaac gcgggctcgc ccgagaccac ggtgaagatg    246840
     agcaacgagg ggcaggcccc cgcgctgatg caggcatgga tcgatgacgg caatgccgag    246900
     gcgaagccgg acgaagtcca ggtgccgttc ttcctgacgc ctccgctggc gcgggtggac    246960
     ccgggcaagg ggcagacctt gcgcattttc ttcaatggct acccggatgg caagacgctg    247020
     ccgtccgacc gcgaatcggt cttctggctg aacgttctcg aagtgccgcc caaggcgacg    247080
     cccgaggaag gccacggggt cctgcagctg accatccgct cgcgcctgaa gctgttctat    247140
     cggcccaagg gcctgtccgg caacccgctg acggccgccg ccgacctgac cttcaagcgc    247200
     aagcccaacg gcgtgctgga ggtgcacaac ccgacgccgt actacgtgaa cctgcaaaag    247260
     ctggaggtgg gcgagaacgg cgcgcacggc agcaagacgc cgtggatgct ggcgccgctt    247320
     tcctcggacg agctgcgcct gaaagggacg ggggccaagt cggtgcagta ctgggccatc    247380
     gacgacttcg gcggcgtgac gccatatcag gcggccatag cggactgaca agacgggggc    247440
     accgggactg gcgcgcgtca tggggacgtt gccgaaaccg acgctgaatc atgaaacaga    247500
     taccactgat tctcgcgatg agccttgcct tcgccgccgc ggcgaagggc gaatccgcgc    247560
     cggatatgca ggcggcggtc aacttcgact cggccatgct gtggggcggc gccaatggcg    247620
     cggatctgag ccgattcaac tacagcaacg cgctgcggcc gggcaactac atcgtcgaca    247680
     tttacgccaa caactatccg ctgatccggc agcaggttcg attcgtcgcg gcgcagacgt    247740
     ccgggcaggg cttgaagacg gcgccggcgg tggcgtgttt cacctatggc cagctggaag    247800
     cgatgcaggt ccggctgcgc gcgctcgatc cggccttggt cgccgacctc aaatccagcg    247860
     ggcgctgcga ggtgctgggc aagctgttcc cggatagccg cgagtcgttc gatttcggcg    247920
     agaaccgcct ggaagtcagc attccgcaag cctatacgat caaccgcttc cggcgcgaca    247980
     tctcgcccga tgagtgggat agcggcatta ctgcgttccg cctgggatac cagtacaact    248040
     atgccgatta catcggcggc ttgcgcgcgg ggcggcggct ggacctgaac ctctacagcg    248100
     ggttcaattt caagggctgg tacctgcgca acagctcgac gctgggatgg ggccagggcc    248160
     gcttcacgcg ccgcagccag cgcaccagcc tgcagacgga tatcccgtcc tggcgggcgc    248220
     gcctggtgtt cggcgacgtg ttctccagcg gcgagtactt cgcgccgtac tcgatgcgcg    248280
     gcatgctggt cggcagcgat accgccatgc tgccgtactc ggagcgcctg taccggccga    248340
     ccatacgcgg cgttgcgcgc actcgggcca acgtcaaggt gtatcaggcc ggcgtgctgg    248400
     ttttccagga cgccgtgcct cccgggccgt tcgcgatcga cgattacagt ccggcctcgt    248460
     atggcggcga cctgcgggtg gtggtgaccg aggcgaatgg cgcggtccag acgttcaccg    248520
     tgccgtacgc cagcgcggtg cgcctgatcc tgccgggcca gacgcagtgg tcgttcagcg    248580
     ccgggcgcta tcgcaactat cgcaacgatg ggcaggaccg tccctgggtg acccagctga    248640
     cgggccgcca tggcgtggcc gacggcgtca acctgtacgg cggcctgctg atcgcccagg    248700
     cgtaccaggc cggcctggcc ggcctgagct ggaacacgcc ctggggggca atggcggcgg    248760
     acgccacgct gtcgcgcagc cagctgtcca ccaccggcaa tgccaacggg tcgagcctgc    248820
     ggttctccta cagcaagacc ttgtccggca ccaacacggc gatccggctg gctacgctgc    248880
     gctactcgtc gagcgggttc tggaatttcg ccgatgcggt caatgccggc ccggtcgaga    248940
     cgaacgggcg caacgggcgg ttcggactct attcgctgct gggccgcgag cggccgcgcg    249000
     gcgatttcag cgtcacgctg agccaaccgc tgggtggata cggcagcctg tacgtgtcgg    249060
     cgctgcggcg gacctactgg ggttcgtcgc gggtcgacca gcagacccag ctgggctatt    249120
     cgacccaggt cggccgcgta ggcgtgaacc tggatgtctc gcgtacggag aatcgtcgca    249180
     gcaccgagca tcaggtcatg ctgaatctgt ccattccgct ttatggcgcg acctccagcg    249240
     gcgtggtgac gggatcgctg gcgcgtaccg gctcggcgcc cgtacagcaa agcgtcaact    249300
     acagcggcat gtcgggcgag cgcgatcagt acacctatgg cctgggcgtg cagcgcgccg    249360
     gcacgagcgc gcagtacgcg ttgaacggct cctggtcagg cacgtacggg gaggtaagcg    249420
     gacagctcac ccatgggcgc agctacagcc agtaccagat caacggcagc ggcggcttgg    249480
     tggcgcacgc gggcggcgtg accttcggcc agtaccaggc gggcaccatc ggcctgatcc    249540
     aggccgaggc ggcggcaggc gcaaaggtcg tcaatacgcg caacgccgcc gtggaccgca    249600
     gcggctatgg gctggtgtcg ctgacgccgt attccctcaa cgaggtcgaa ctgtctccgc    249660
     aggacctgcc cctggacgtt cagctggagt ccacggtgga gcaagtcatc ccgcgggcgg    249720
     gcgccgtcgt ggcgctgcgc tttccgacgc gccatgacgt cgccgccatg ctggttgccg    249780
     aacccggcag cgaaggcgcg ctggtattcg gcaccgaagt gcgcgacggc gccggcaagg    249840
     tggtgggcgt ggccggccag ggcgcaagcg cgctggtcag aggcgtgtcg gcatcgggca    249900
     cgctggaggt gacgcgcgca gacggttcga tatgccgcgc cacgtacgac ttgaaatcgg    249960
     ccgggcaagc cgtgcatggc ctgccgcgca ttgcgctggc gtgcgcgccg caaggcggcg    250020
     gcgaacgtgg tgcgcgggcg gcgggccagg ccgtggcgca gccatcagct atctccattt    250080
     cgggtaaaga tcatgagcca gatattcgct gaccgccggg ccgccgtgcc cgcgcgcgta    250140
     atttccttct gcggggccgc gcttgccgtc tgggcaggcc tggccgtgca gcccgccatg    250200
     gccgtcgatc cgccggtgga ctgcggccgg gcgctaggct tgcatttctg gtcgagcgcc    250260
     tcgctcatct ccgaccagac acccgatggg acgctgatcg gcaagcccgt ggtcgggcgg    250320
     tccctgctgt ccaagagctg caaggtgccg gacgacatca aggaagacct cagcgacaac    250380
     catgacggcg aaccggtcga catcgtgctg gaactgggca gtaactacaa gatccggccg    250440
     cagtcctatg gccatccggg catcgtggtc gacttgccgt tcggctccac ggaggagacc    250500
     ggcatcgcca tctatatcga tttcggcagt tcgccgatgc agaaggtcgg cgaacggcag    250560
     tggctgtatc cccagaaagg cgaagtgctt ttcgacgtgc tcaccatcaa cggcgacaac    250620
     gcggaggttc gctatcaggc gatcaaggtc gggccactca agcggccgcg caagctggtg    250680
     ctgtcgcagt ttccgaacct gttcacctac aagtgggttt tcatgcgcgg gaccagccag    250740
     gagcgcgtgc tggcgcaggg gaccatcgac accgacgtcg ccaccagcac catcgacctg    250800
     aaaacctgcc gctatacctc gcagacggtc agcctgccca tcatccagcg ttccgcgttg    250860
     accggcgtcg gtacgaccct ggggatgacc gatttccaga tgccgttctg gtgctatggc    250920
     tggccaaagg tatcggtgta catgagcgcg acgaagacgc agaccggcgt agacggcgtg    250980
     gcgttgccgg cgaccggcca ggcggccggc atggccagcg gcgtaggcgt ccagttgatc    251040
     aacggcaaga cgcagcagcc ggtcaagctg ggcctgcagg gcaagatcgc cttgcccgag    251100
     gcgcagcaga ctgagtcggc gacgttctcg ctgcccatga aggcgcagta ctaccagacc    251160
     tccacttcaa cctcggcggg caagctgtcc gtcacctacg ccgtgacctt gaactatgac    251220
     tgacgcaacg aaccgtttcc ggccgggcct ggttggtcgg gcgctggtcc gggcaggcct    251280
     gctgttcgcc gtggccgcct gtgcgcaggc gcagctgctg ccgggcgcgc gcgacctcaa    251340
     ccgtatcgac gatcgccagc gcaaggagca gctgcagcgc gatatcgagc gcgccttgac    251400
     gcggcctccg gtggaattga atccgcagtc cgaggccgct gcgccggcgc gcaagccgga    251460
     cgctacgtcc ggccacaccg tgacggtaca tgccgtggac ctggacttcg gcgtcgaggg    251520
     ccggctgttc gaccccgcgc cgctggttca ggactacctg aaccgcccgc tggacaacga    251580
     gcagctgttc ctgctggtca aggcattgag cgcggccctg tacgaccgcg gctacgcgac    251640
     cagcatcgtg acgttcgtgc cgccaggcgt ggtggatggc gtgctcaagc tgaaggtgga    251700
     gtggggccgc atcaagggat ggctgatcga cggcaagccg ctggagggga cacgcgaccg    251760
     catgatggtg ttctcggcca tgccgggctg gcaggacaag gtgctgaacg tattcgatat    251820
     cgaccaggcg atctacaaca tcaacaatgg cggcaagacc ggcaacatca ccatcgttcc    251880
     cgcggacgaa tacggctatt cctatctcga tctgcaattg cagcggcgcg cgctgccccg    251940
     cgtctcgctg ggcatggaca attccggccc cggcacgccc gagaacggcc gctacaagta    252000
     caacgcctcg gtgacggcca acgacctgct gggcctcaac gacacgctgg gcctgtatat    252060
     cggcaaccgc tactatcgcg acgccggcca tgacgccgag cgcaattacg atctgatgta    252120
     cagcgtgccg ctggggcgta cgcgcctgga tcttcagacc ggctacagta cctatcgcaa    252180
     tctgctcaag acccgctacg ggcaatacca gtccgccgga aactcgcgca gtttcggact    252240
     gaaggccacc cgcctgcttt accgcgatac gcggtcgcag ttcagcgtgt atggcggtct    252300
     caagctgcgc cagaacaaga actatctggc cggcacgcgc ctggacgtca gcagcaagca    252360
     ttacagcgac gtcacggtgg ggatgcaata ctccacccag cgaggcgcca acgcctattt    252420
     cggcgacctg tctttcacgc gcggggtagg cgtcaacaac ggcaagtatg ccgcctacga    252480
     tgagcgcggc ccgcagggca atgtgtcgcg gttcaacggc agcctggcct ggacgcgcta    252540
     catggcgttg gccggccagc cgatacagtg ggcgtcgcaa ctggggttcc agtactcgcg    252600
     ccaacagctg ctcaacagct accagatcac cgtgggagac gagtacacgg tgcgcggata    252660
     caacctcagg acgtcgcaaa gcggtgacag cggcgtgtac ctgagcaata cgctgacggt    252720
     gccggtgcag ttcagcctgc tcggcaagca ggcgtcggtg gcgccgttcg tgggcgcgga    252780
     tgtcggagcg ctcaagagca atcatcccga cgcgcgcacg atacgcatgg cgggcctggc    252840
     ggccggcgtg cggttcgacc tgccgtatgc gcggatgtcg ttcacgtact cgaagcccgt    252900
     gggcgcgcag cccggcggcg cgccgcgcgc gccggtctgg ttatacatca acgccggcct    252960
     cagtttctga gcccggcgag aacgcggccg cgacgctaca gcgtcatgtg ctgcggcagc    253020
     caggtggcga tgccgggcac gtagtacagc agcagcacgg ccacgatcat caggatgaac    253080
     atcggcagcg aggcgcgggc gatgtagggc agctcgcgtc cgctcatgcc ggcaagcacg    253140
     aacaggttga agccgacggg cggggtgatc tgcgccatct caaccacgaa cacgatgaag    253200
     atgccgaacc agatcaggtc gatgccggcg gcctgcacgg tgggcagcag cacgcccatg    253260
     gtcaggacga cgatggaaat gccgtccagg aagcagccca gcacgacgaa gaacaccatc    253320
     aaggccatga tcaggccgaa ctgggacagg cccagcccgc cgatccactc ggccagcgcg    253380
     cggggcaggc cgatgtagcc catggccagg gaggaactgg gcgccggcca ggatgagggc    253440
     gatcatgcag tacaggcgcg tggcgcccag cagcgaggtc atgaagctgg tgcgtgtgag    253500
     cgagccctgc agggccgaca ggatcagcgc gccgaccacg cccacggccg ccgcctcggt    253560
     ggcggtggcg atgccggtgt agatggagcc cagcaccgcg ccgatgagca gcagcaccgg    253620
     gatcaggtgg cgggactgct tcagcttctg catgaacgag atgcccggat cggcggcagg    253680
     cacggcgccg gggtgccgga tggcccacca ggcgatatag cccatgaaca gcagcgccag    253740
     caggaggccg gggaaaatgc cggcgatgaa cagcttggcg atggagacgt cggccgccac    253800
     gccgtagacg atcatgatga tggacggagg aatcagcagg cccagggtac cggcgccgga    253860
     cagcgtgccg aggatcttgt cctccggata gccgcgccgc gtcagttcgg ggatggtcat    253920
     cttgcccacc gtggcgcagg tggcggccga cgagccggaa accgcggcga agatggcgca    253980
     gccgatgacg ttggtgtgca gcagccggcc gggcagccgg ttcagccacg gcgcgaggcc    254040
     cttgaacagg tcctcggaca ggcgggtgcg gaacaggatc tcgcccatcc acaggaacag    254100
     cggcagggcg gtcagcgtcc agctcgacga ggcgccccag atcgtgacgg ccatggcgtc    254160
     gccggccggc cggctggaga ggacttccat gccgatccag gccgtgccgg ccagggtgag    254220
     gccaacccag actccgcaac ccagcagcgc gaagatcgag acgaccagca gggtgacgat    254280
     caggatttca ttcatggatt tgctgcgatt ttgcgaagcc ctgcccacgg acgcgccgca    254340
     cgagttcatc gagcagggcg atgaagaaca ggatggtgcc ggcggccatg gtcagctggg    254400
     gaagccagag cggcgtggcg tcgttggcgg tggagatgtc gttgaacagc caggagtcgt    254460
     gggccagctt tacgctgaac caggcgaagg ccgccgccag gatggcgccg acgcaaagcg    254520
     cgaagatgtc gagccggcga tggccgggcg ccgggagcgc gttgagcagc agggtgacgc    254580
     ggatgtgttc gccatgcttg agggtgctgg ccagggccag gaagccggcg gctgccatga    254640
     aatacccggc ataggcgtcg gtgccgggta tgttcaggcc cacttggcgg gcgatgatgg    254700
     ccgccagcac ggaaaccagc acgccgatgg tgcacaggcc ggccagcagg ccggccgcgc    254760
     cgtacaagcg atccaggaaa cggcgcatcg tgctttattg cttccgatag gcgtcgatca    254820
     tggcctgtcc gtcggcgccg gctttcttga gccagtcgtc gagcatgcgc ttgccgacct    254880
     cggtcaggcc gctcttgagt tcggcggtgg gcgcgatgat ggccatgccg ttcttggcca    254940
     gttgctcctt gtaccagctg ttcttctcct gcgacagttt ccagccgcgc tcctcggcct    255000
     gtgcgccggc cttcttgagg gcttgctggg tggcggggtc gagcgcgtcg aaggccttct    255060
     tgttgaccag caccgcgttc ttgggcagcc aggcctcggt gtcgtagaac ttcttgatgt    255120
     actcgtaggt cttggtgtcg aaaccggtcg agccggacga catgtacgag tcgatcacgc    255180
     cggtggccat cgcctgcgcc aattcggcct gctgcaccgt taccggctgc gcgccgacca    255240
     gttcggcgat cttggccgtc accgggctgt aggcgcgcca cttgaggccc ttcatgtcgg    255300
     acacttgctt gatgtcgcgg ttggcgaaaa tgccctgggg cggccaggcg accgaataga    255360
     gcagcatcat gccctgcgag gccagcttct tctcgaggaa gggtttctgc gcctggtaca    255420
     gcttgaacga ggcatcgtag ccggtggcca ggaacggcag gccatccagt tcgtagaccg    255480
     ggtcttcgtt ggcgaagttg gtgagaagga tttcgccgat ctgggcctgg ttgccctgga    255540
     ccgcgcgctt gatttcgggc gccttgtaga gcgacgcatt gttgtgcagc gtgattttca    255600
     gcttgccgcc cgacaggctg tcgacatcct tgacgaactg ggtcaggttc tcgacatgca    255660
     ggttgctggc gggataggcg gtcggcagat cccatttggt ctgggcttgc gcgcccgcgc    255720
     cgaaggcgag aacaatggtg ccggccagca aggagagctt cttgtacatg gagacgtcct    255780
     tcgtaatggg attttcgaat tgcggcatac cgcggagcac accgcaaggc atgggcaacc    255840
     acgggcgggc gatggaagcc gcgcccttga aacgctgcaa ttctaaatcc ctgtgcgcgc    255900
     cgctacacgg tcccgcgcgg gctttagggg taattcctag gtaagttggc cgatcggccg    255960
     aattgcttta ggcttggatg gtcgtggcgg cgcggcggcg ccttgccctg gggcaggcgc    256020
     cgctgttcgc gcctaccgca tcgccagcgg cagcgcggtc acgatcgccg gaaatatcgt    256080
     gatgatcgtc gtggccagca ccagcagcag gaagaacgga aaggccatgc gcaccagctc    256140
     gaacaggtcg cgtccggtaa tgccctggat cacgaacagg ttgaagccca ccggtggggt    256200
     gatctgcgcc atttcgacca ccaggatcag gtagatgccg aaccagatcg ggtcgatgtc    256260
     cgccgcctgg atggccggta tgagcacggc ggtggtcagc acgacgatgg atatgccatc    256320
     gaggaaggcg cccatcagga tgaagaagac ggtcagcacc gcgatcagtc catactggct    256380
     caggcccagc gacgagatcc actcggccag gttggccggc aggccggtga agctcatcgc    256440
     gctggtgaga taggccgcgc ccagcaggat gaacgagatc atgcacgaag tccgggtcgc    256500
     gcccatcagg ctgtcgatga acgacctgcg gttgagcgac ttgccccagg cggcgatcgc    256560
     cagggcgccg atggcgccga tcgtggcggc ctcggtggcg gtcgcgatgc gggcgtagat    256620
     cgaaccgatg accccggcga tcaacgccac caccggcagc agcaggcgca ggcgggccag    256680
     catggtgagc cagggcaccg cgggctcgcg cggcggcacc cgcgcggggt tgcgcagcga    256740
     ccatacgccg atgtagccgg agaacagcgc catcagcagc aggccgggca ggatgccggc    256800
     gatgaacagc ttgatgagcg agacctgggc cgccacgccg tagacgatca tgacgatgga    256860
     aggcggtatc agcaggccca gcgtgccggc gccggccagc gacccgcgat ggccaggccg    256920
     tcgtcgtagc cgcgcgcctt gagctccggc agcgagatgc ggccgatggt cgcggcggtg    256980
     gcggcggacg agccgctgac cgcggcgaag atcccgcagc ccagcacgtt gacatgcacc    257040
     aggcggcccg gcaggcggcg cacccagggg cccagtccgc tgaacatgtc ctcggccagg    257100
     cgggtgcggt agaggatttc gcccatccag atgaacagcg gcagcgcggt cagcgcccag    257160
     ttggccgagg cgtcccagct cttggtggcg aagatgatgc cggccggcgc gtcggtgaac    257220
     agcagcaagg ccaccaggcc gctggccacc agcgccagcg atacccatac gccggcggcc    257280
     agcaacagca ggaggctggc gatgagcacc aggctttgcg cgagctcacc catgggccgt    257340
     ctcctcgggt tgccggccgc gcgccaccat ggccaggcgc cgcgccagca tcagcgtcag    257400
     cagggccagg ccgatgggca tgcagatctg cggaatccac agcggcacgc gcagcatgcc    257460
     ctgggccacc tcgtcgtagg cgaacgattc gtggacgaag ccggccgtct gccacgcggc    257520
     ccaggccgac agcgccaggc ccagggccgt ggccgccagc tcgtagggac ggtgagcggt    257580
     cttgggcagg aactgcagca acagggtcac gcggatatgg tcgccgcgca gcatggcgta    257640
     gggcagggcc aggaacaccg aggccgccat cgaccaggcg gcgaagtcgt cggccgcggg    257700
     gatctgcatg ccgatcaggc ggctggcgat ctgcgcggcg acgatggcgc cgatcagcgc    257760
     caggaacagc gcggccacgg cgccgctggc gacggcgatg cgatcgagta tgggcatggc    257820
     gtcgtccggc ttacttgcgg taggcatcga gcagctgctg gccgtcggcg ccggctttct    257880
     tgctccagtc cgagaccatg gtggcgccga tggcctgcag ctccttggcc agttgcgggg    257940
     gcagcggctc gacgctcatg ccgttgcgcg ccagggtgtc ggtgagttcg cgagtcttgg    258000
     cgcgcgcggt ctgccagccc cggatttcgg ccttggcgcc ggcatccagc accgcctgcc    258060
     gcacttcggc gggcaggcgc tggaaggccc gcttgttggc gatgacgaag ctctggggga    258120
     tgaaagcctg ggcatcgtag tagtacttga cgtagtccca ggcctggctg tccacgccgg    258180
     tggcgggcga ggtgagcatg gcgtcgatca cgccggtcga aaaggcctgc gggacctcgg    258240
     gcgtctgcac ggtggtgggc accgcgccca tcagggcggc catgtggctg gtcgatgcgc    258300
     tgtaggcgcg gaaacgcgtg cccttcaggt cggccagcgc ggcgaccggc ttcttggtgt    258360
     agatgccctg cgggggccag ggcgacccgt acaccagcac gatgccttgc ttgtccaggc    258420
     gctgggccag caggggtcgc gtcgctttcc acagtttttc cgactcgttg aacgaggatg    258480
     ccaggaacgg gacgctgtcg atttcgaaca aggggtcttc gttgcccagt gccgagacca    258540
     gcacctcgcc gatctgcacc acgccttgct gcacgccgcg cttgacttcg ggacgcttga    258600
     gcagggtgct gttggactgc accttgatct ccagcgcgcc ggcggtggcg gccttgacct    258660
     cgtcggcgaa ctggcgtgcg ttctgggtca ggtagttggc gtcgggctgc tccgccgtca    258720
     tggtccagct ggtggcggcc tgcgcgccgg tcgagagggc gagggcggcg gcaagtacgg    258780
     cgaaggtcgt tttcatgtcg gactcctggg gcaggttcaa ggggcggcgc gcagatcgtc    258840
     ggcgcgcagg tcccacagca agtggaaggt ctggatgccg tcggtgggca gttccagctg    258900
     ttcggccagc gagcgggcgg cggcggcggc cggctcggtg gtcgcgtcga tgatcaggac    258960
     ggggtcgagc acgcgcgcgg cggggtcttc ggaaggcagc ggggtggaca gctgcggatc    259020
     gggggtcagc acgcgcagcg ccaggacgcc ttcgatctcc tgcgcgctgg ccgccagcgc    259080
     ggcggcgcgg gcggcgagtt cgacgctgcc caggcgcagc aggcccagcg ccgcgccggt    259140
     gccggcgccc gccagcggcg ataccaccat gacgcggcga tgggtgtcgc gcatgcgcgc    259200
     gaaattggcc agcgaccacg gcgtctggcg ttcgaacgcc tgccggtacg cggcgctgcc    259260
     gaatacatga aggtcctcgg tgcggtacag cgccaggtag cgccgccggc cgtgctgcga    259320
     gcgatagcgg cgggcccagc gaaagcccgc gatgccggcg cgctcggcca tgtgttcgcg    259380
     gtcgtaccac tggttgaagt cttcttcgtg cgcggggtcg atgtccgtcc agatgaacag    259440
     ttcgcccatg gcgtcgcggt cgtgccggat tggtgctgcc acgtgtttct ccatcgcgcg    259500
     gcctggatgg gccgtcatgg aggctgattc tcggcatcgg ccccgacagc ggcaaatggt    259560
     ttattccggt gcggcggatt aagaaaaagt tatcgcgcgc gcggcccgcg cggcgccgcc    259620
     gccggcgtgg cgggaagcct gggcgcgctg gggaaaaccc cgaaggcggc gcgctccggc    259680
     gtcacagcgc cagcacgccg ctgtcgagcg gcggcagcgc gtcgtcgttg tgctgagcgt    259740
     acaggcgcat ctcgtccagg gccagccgta ccaccgcctc ggccaggccg gccacgcggt    259800
     cctccggccg ccaggccggg acgcaccgcc gccagcggca gcgtggccgc gcccaggccc    259860
     gcctcgatga actgcgtgca cgcggcgatg gatgaaacga aatggatgcg cccggcctgc    259920
     acgcccgccg cgtccagcac gtcgagcagc tgcaggtgcg gctgggaatg gcgcggaaag    259980
     gtgaccaggg gatgggtggc cagttcggcg acgctggcct gcgcgggaat ccccgccgcg    260040
     gggctgcaga tccagcccat tttcagcatg cccatgtcgc ggttgcgcac atcgtcgccc    260100
     acgatggggt cggtctgcag ggcgacgtcg atgctaccgt gcttgagcag gtcctgcagc    260160
     cgccgggtcg attcggcggt cagctcgatc tccagctccg ggtgcgtttg cgacaggcgg    260220
     cggatgaatg gcgtgaacca ggtatggacg atggattcga ccacgcccag gcgcacgcgg    260280
     ccgcgcaagg ttccgctgcc gcgcagggcc tggcgcatgg cgtggtcggt atcgagcatg    260340
     cgctgggcgt agtcgagcag ggtgcgcccg gccggcgtca gccgcgtgtc gcggctgccc    260400
     cgctcgaaca gcagttcgcc caggtcgttc tcgagcgcgg caatgcgccc cgagatcgcg    260460
     gcctgggtca ggtgcagctt gcccgcggcg gccttgaagc tgcgcagctg ggcgacccag    260520
     ataaaggttt cgagaaagcg gatattcatg gcgttccccg tgcgcgagtc gcggcggccg    260580
     ggttgcgcgg gtaatcccca gtgcgccggc cgggcgttgt tgtgtgtttt ttgttgatga    260640
     aatatagata aattattagt atttcgtcta caagaacttt cggccacccg tcatgagcag    260700
     cacgcccctg atcgcttcct ccgcccatct ggccagcggc cgcgcgcccg atctgtccga    260760
     ggtcgagttc ggcctgatga tcgccagcca tgccttcaac cgctggacgg tgcgctgcat    260820
     ggcggcggtc ggcctgccgg acctcaccgc caacgacgtc atggtgatgc accacgtgta    260880
     ccaccggcag cgtcccaaga aactggccga catctgcttc acgctgaacg tcgaggatac    260940
     gcacatcgtc agctattcgc tcaagaaact ggagcgccac gacgtggtgc gcggcgatcg    261000
     cagcggcaag gaggtgttct acagcgttac gccgaaagga gccgaaatca tcaagcgcta    261060
     tgccgaggtg cgcgagcaat gcttgctcga tgggctggag gcgggcgcag ccggcgggct    261120
     ggagttcacg cgccagctgg cgcataccct gcgctcgctg tcggggctgt acgaccaggc    261180
     cgcgcgggcg gccacctcac tgtaaatcca tcatgcatcg gcgcgcgccc gctgggcggg    261240
     gcgcggcctt tccccctgtt acgcctgcta atccgaggac gctatgaagt ggcaattctg    261300
     ggttgaccgt ggaggcacgt tcaccgatat cgtggcgcgc cggccagacg gcgccaccgt    261360
     gaccgccaag atgctgtcgg agaaccccga gcagtaccgc gacgctgcgg tggccggcat    261420
     ccgcaagctg ctgggcatcg cgccgggcca gccggtgccg gccgaccaag tcgagtgcgt    261480
     caagatgggc accacggtgg cgaccaatgc cttgctcgaa cgcaagggcg agcgcaccct    261540
     gctggtgacc acgcggggat tccgcgacgc gctgcgcatt gcctaccaga gtcggccgcg    261600
     cctgttcgac cgcaacgtgc agctgcccga gatgctgtac gaggcggtgg tcgaggccga    261660
     cgaacggctc gctgccgacg gcacggtggt gcgcgcgctg gcggaggacg gcctgcgcgc    261720
     cgacctgcgg cgcgtgttcg acgatggcat ccgcgccgtc gccatcgtgt tcatgcacgc    261780
     ctggaaggag ggcgtgcatg agcagcgcgc cgccgccatc gcgcgcgaga tcggctttac    261840
     gcaggtgtcg acctcgcacg aggccagtcc gctgatcaag tttgtctcgc gcggcgacac    261900
     cacggtggtc gatgcctatc tgtcgcccat tctcatgcgc tatgtcgagc aggtgggcag    261960
     cgagttgccg ggcgtgcgcc tgatgttcat gcaatccagc ggcggcctga ccgacgcgca    262020
     ccgtttccgc ggcaaggacg ccatcctgtc cggcccggcc ggcggtatcg tcggcatggt    262080
     ccgcaccagc gagctggcgg gctttgaccg cgtgatcggc ttcgacatgg gcggcacgtc    262140
     caccgacgtg tcgcattacg ccggcgagtt cgagcgcgag ttcgagacgc tggtggccgg    262200
     cgtgcgcatg cgcgcgccga tgatgagcat ccataccgtg gcggccggtg ggggatccat    262260
     cctgcatttc gatggcgccc ggctgcgcgt cggccccgat tcggccggcg ccaatccggg    262320
     gcccgcgtgc taccggcgcg gcggcccgtt ggcggtgacc gactgcaacg tcctgctggg    262380
     caagatccag cccgacttct tccccagcgt gttcggcccc gatgccgacc agccgctgga    262440
     tgtggcggcg gtgcgcgcgc gcttcgcggc catggccgag gaggtgcgga cggccacggg    262500
     gcgcgagatg agcgccgagc agctggccga aggtttcctg gagatcgccg tgggcaacat    262560
     ggccgaggcg atcaagcgca tctcggtgca gcgcggccac gacgtgaccg agtatgcgct    262620
     gaccactttc ggcggcgccg gcggccagca tgcctgcctg gtggccgacg cgctgggcat    262680
     gacgacggtg ttcgcccacc cgctgggcgg cgtgctgtca gcctatggca tgggattggc    262740
     cgaccagacg gaaatgcgcc agaagacggt ggagcaggtg ctcgacgccg cgctgatggc    262800
     gcaactggag gccggcctgg acgagctcgc cggacaggcc agcgcggagc tgctgcgcca    262860
     gcacgtgccg gccgacaagg tggcggtgca gcggcgcctg cacctgaagt accgcggcac    262920
     cgataccgcg ctggaggtcg cgttcggccc gctggagcag gtgcgcgccg cgttcgaggc    262980
     gggctaccgc cagcgctact cgttcctgat gcccggccgc gaactggtgg tcgagaccat    263040
     ttcggtcgag gccacgggcg gcggcgaggc cgccaccgag gcgccggtga cgcgcacgcg    263100
     cgccgcgccg ctggcggcgc gccgcacgat acgcatgttc agcgccggac aatggcgcga    263160
     gacccccctg tacgtgcgcg aagacctggc gcccggcgac atgatggccg gaccggccat    263220
     catctccgag ccgaaccaga cgacggtgat cgagccgggc tggcaggccg aggtcacgcc    263280
     gcgcgaccac ctggtgcttc ggcgcgtgca ggcgcgcgtg cagcgccgcg ccatcggcac    263340
     gcaggccgac ccggtcatgc tcgaggtctt caacaatctg ttcatgtcga tcgccgagca    263400
     gatggggtac cggctgcaga acaccgccta ctcggtcaac atcaaggagc gcctggactt    263460
     ctcctgcgcc atcttcgacg ccgagggcaa cctgatcgcc aacgcgccgc acatgccggt    263520
     gcacctgggc tcgatgggcg aatcgatcaa gacggtgatg cgcgccaatg cgtcgcgcat    263580
     gcggccgggc gacgcctatg tggtcaacga tccgtaccac ggcggcacgc acctgcccga    263640
     tgtgaccgtc atcacgccgg tgttcgaccg cgccggccag gacatcctgt tctttgtcgg    263700
     ctcgcgcggc caccatgccg acataggcgg aacgacgccg ggctcgatgc cgccggactc    263760
     ccggacggtg gaagacgaag gcgtgctgtt caccaatttc cagctggtcg gcaacggcga    263820
     gttccgcgac cgcgaggcgc gcgagatcct ggcctcgggg cgctggccgg cgcgcaatcc    263880
     ggaccagaac atcgccgacc tgcacgcgca gatcgccgcc aacgagaagg gcgtgcagga    263940
     gctgctgcgc atgtgcgacc acttcggcct ggacgtggtg cgggcctaca tggggcacgt    264000
     gcaggacaac gccgaggagg cggtgcggcg cgtgatttcg gtgctgaagg acgggcgcta    264060
     tacctatcgg ctggacaacg gcgcggtcat cgaggtggcc gtgcgcgtcg accgccaggc    264120
     gcgcagcgcg gtcgtcgatt tcaccggcac ctcgggccag ctggagaaca acttcaatgc    264180
     gccgggcgcg atcgcggtgg cggcggtgct gtacgtgttc cggaccctgg tcgatgacga    264240
     gatcccgctg aacgcaggct gcctcaagcc gctggagatc atcatcccgg aggggtcgat    264300
     gctgcgcccg aacccgcccg cgtcggtggt ggcgggcaac gtcgagactt cgatgtgcat    264360
     cgtcaatgcg ctgtatggcg cgctgggcgt gctggcggcc agccagggca ccatgaacaa    264420
     cttcacgttc ggcaatgcac gctaccaata ctacgagacc atctcgggcg gcacgggcgc    264480
     cgggccgctg cgcatcgacg ccgcgggccc cgcggatgcc ggttttgccg gcacgtcggt    264540
     ggtgcaggcg cacatgacca attcgcgcct gaccgatccc gaagtgctgg agctgcgctt    264600
     tccggtgcgg ctggagtcgt acgagatccg ccatgggtcg ggcggagccg gccgctatcg    264660
     cggcggcgac gggggcgtgc gccgagtgcg cttcctggag cccatgacgg ccgccatcct    264720
     gtcgaacaac cgccgccatg cgccgttcgg cctggcgggc ggcgaggccg gggcgatggg    264780
     acgcaactac gtggagcgcg ccgacggccg cgtcgagccc ctgggcccgc aggacagcgc    264840
     ggaactggcc gccggcgacg tgttcgtcgt cgagacgccc ggcggaggag gctacggccc    264900
     ggcctgagcg ggcgccggcg tcacgcggcc gggcacaccg tcacgcgcaa ggcgggctgg    264960
     tcgcgccggt catgcacctg cagggtcagc ccgccatcgc gcatttcgaa caaggcggtg    265020
     gccagcgtgt tttcctcgtc ggggtcgtcg gcgctgcagc gcaggatggg cagctcgcct    265080
     tcgcgatcca gcagcgtggc caccaggcgc gcgccatcga cgggcggctg ccagtggtcc    265140
     atcaggttct cgatgtggcg ctggcggctg cgcgacgaat cggtcacgat ctggccgatg    265200
     gcctcgctgc cagggtgcac caggtggttg gcgtgcccgt tgccgcgcgc gacttcgccg    265260
     atcgagcagg ccgccgggga ggcctcgacg ctgtagaggc gcggctcgcc ggccgcgccc    265320
     agcgtgtggt gaaagccgcc ggcgcgcgga tgatcgcgca gcaccgccag cgcgtcgtcc    265380
     agcgtggcgc agtcgagcac cgcgcgggcc agcagcatgc gcggtacgcc ggcgtgccgc    265440
     tggcggatgc gcacattgtt gatcgtctgc accagcccgg cgcggttggc ggcaaaggtg    265500
     tggccgggca gcgagccggg atagtagaag ctgatgtagc cgggggcgtc gtcgggccgc    265560
     acgtccacca tgtggcagcg gccgtacagg aacggatcgc cgtcttcgtt gtgcgcgatc    265620
     cagcgcgtgt cttcgtcgcc gcgccatgcg atcgacgtgc agccgtccga ggtcttgtgc    265680
     agcaggtcgc cgcggcagtt ccacagcagt atgtccacca gcggcatgcg caggccttcg    265740
     gccagccctt cgagctcgtc ccagatttcc ggcaaggcct ggctggcttc gtgcgccagg    265800
     gcctccaggt aggcgtggcc gcgccaggga cgcaacgcag cccagacggt gctctgctcc    265860
     aggtaggtgg ccatgagcgg acgcgccagc ttgcccaggg cctggccggt ctggcgccgc    265920
     gtgccggtga tgctgacggg tttgaaagcc atggctagct gtgaagattc aataggttgt    265980
     atgcatggtt catccgaacc ggatttgaga aactggaaat cgccaactcc ccagttcact    266040
     caaggagccc ggccggatga acacccataa gcatgcccga ttgaccttcc tacgtcgact    266100
     cgaaatggtc cagcaattga tcgcccatca agtttgtgtg cctgaagcgg cccgcgccta    266160
     tggggtcacc gcgccgactg tgcgcaaatg gctgggccgc ttcctggctc agggccaggc    266220
     gggcttggcc gatgcgtcct cgcgcccgac ggtctcgccc cgagcgattg cgccggccaa    266280
     ggcgctggct atcgtggagc tgcgccgcaa gcggctgacc caagcgcgca tcgcccaggc    266340
     gctgggcgtg tcagccagca ccgtcagccg cgtcctggcc cgcgccggtc tgtcgcacct    266400
     ggccgacctg gagccggccg agccggtggt gcgctacgag catcaggccc cggcgatctg    266460
     ctgcacatcg acatcaagaa gctgggacgt atccagcgcc ctggccaccg ggtcacgggc    266520
     aaccgacgcg ataccgttga gggggccggc tgggacttcg tcttcgtggc catcgatgac    266580
     cacgcccgcg tggccttcac cgacatccac cccgacgagc gcttccccag cgccgtccag    266640
     ttcctcaagg acgcagtggc ctactaccag cgcctgggcg tgaccatcca gcgcttgctc    266700
     accgacaatg gctcggcctt tcgcagccgc gccttcgccg cgctgtgcca tgagctgggc    266760
     atcaagcacc gctttacccg accttaccgc ccacagacca atggcaaggc cgaacgcttc    266820
     atccagtcgg ccttgcgtga gtgggcttac gctcacacct accagaactc ccaacaccga    266880
     gccgatgcca tgaaatcctg gctacaccac tacaactggc atcgacccca ccaaggcatc    266940
     gggcgcgctg tacccatctc cagactcaac ctggacgaat acaacctatt gacagttcac    267000
     acctagccct gcggcccggc gcgtgcgtca tgggcgcgcc ggggcgtgtc tgatagagtc    267060
     tgcgctattg gcgccgcgcc gccgcgcgcg cgaatcttga caggagcccg catgaaagaa    267120
     accctgaacg aaatctccac cctgatgccg cagctcgtcg acctgggaat caacctgggc    267180
     gtggcattgc tgatcctcat cctgggctgg tgggcctcgt cgctcctggg cggctgggtg    267240
     cgccgcgccg cgcagcgctc gccgcgcatc gatcccacca tcgtgccgat gttccagagc    267300
     acggtgatct ggacggtgcg cattttcacg ctgatcgcgg tgttggcccg tttcggcgtg    267360
     cagaccgcca gcctgatcgc ggtgctgggc gccgccggcc tggccgtggg cctggccctg    267420
     cagggcacgc tgcagaacat cgcggcgggc atcatgttgc tgatcctgcg cccgatccgc    267480
     gccggcgagt acgtggccct gagttcgggt tcggacggca ccgtggagga ggtggggctg    267540
     ttcctgacgc gcctggtcca ggtcgatggc atccacatca ccctgcccaa cagcacggtc    267600
     tggaacgcca ccatcatcaa ttacagccgc aacgccaacc ggcgcctgga tatcccggtg    267660
     acggtgcatt atggcgacga cctgggcgag gccatcgcca ggctggaggc gctggtgcgc    267720
     ggccacgaga tggtgctgca ggatcccgcg cccatcgtca aggccagcga ataccgcgac    267780
     aacggcacgg tggtcaatgt gcgcgtctgg acccaggcgg cgcaatactg ggacctgcgc    267840
     tgggacctgt tccaccagat ccggcgcgcc ctgggcgagg cggggttccg cgcgcccatc    267900
     ccggtgcgcg agatccaggg cggcggcaag gacgcggccg cctgaggccc gcggcccgct    267960
     acgccttggg cgccaggcgg gccagttcgg cgccgatcca gccggcgatc tcgcgctggc    268020
     gttgcgccgg catgcggtcg atgatggcgg tgacgctgac ggccagcacc ggcgcgccct    268080
     gcgcgtcgag cagcgcgcac cccacgccca gcgcgccgcg caccgcgtgg ttgcccacca    268140
     ccgagtagcc gcgcgcgcgc gtgttttcga tcaggcggtg catctcctgc ggtgtcatgc    268200
     cgccatattc gtccagccgg cccgagttgc gctggacgat ggcgtgcgcc acctcgtcgg    268260
     gcagggcggc cagcagcgcc atgctgcccg agcccacgcc cagcggctgg cgcttgccgg    268320
     cgtaagtggc caggatctgc acggggtagc tgccgatttc ccggtgcagg ctgaccgagt    268380
     cgtcgccgtc ccgtacgacc aggaacaccg cgtcgccggt gcggtcggcc agccggcgca    268440
     gcaccggcag catctggcgc acgcgcgggt tgggtgccgc caggtcggcg tcggccgcca    268500
     gctgggtgcg gtatttcttg gtgccctgca gcggaaccac cagcccggcg tccagcaagg    268560
     cggccagcag gcggtagatg gtggggcgct ggatgccggt ctggcgcgcg atgtcggtga    268620
     cgctcaggcc gcgcgggccc tggtcgcgca gggcggccag taccatcagg ccgcgccgca    268680
     gggtgcgcgg gccggcaccg gaatcagtct cttgcatggt gcttggatat cggatcgggt    268740
     atgcaggggc ggaaccaggg aaaaccatcg tctgcacagt ggactctacc ttgccctggc    268800
     gctcgtgtat agcgcaaaat cagcggctaa acaattctta tacgtccatt acatggacat    268860
     ttttcaggag accttccgat gaccaaaagt cagctgcctc gtctcgggcg ttttgccgtg    268920
     cgcctgtttg ccggcatcct gggcgccgcc gccatcggcg cgacggccca taccgcctat    268980
     cccgacaagc cggtgcgcat cgtggtcggc ttttccgccg gcggcaccac cgacgtgatc    269040
     gcacgcatca tggccaagga actgaccgag gcgctgggcc agtcgttcgt ggtggagaac    269100
     aagccgggcg gcggcagcaa catcgccacc gactacgtgg cgcgcgccac gccggatggc    269160
     tacaccttgc tgttcgtggc ggtgaccagc gccatcaacc agacgctcta caagaacgtc    269220
     aacttcgacc tgaccaagga tttcgcgccg gtcgcgctgg gcgccaaggt gcccaatatc    269280
     ctggtgctca acccctcggt gccggtcaag tcggtgcagg agctggtggc ctataccaag    269340
     gccaacccgg gcaagctggc tttcgcctcg tcgggcagcg gcacctcgat ccacatggcc    269400
     ggcgagctgt tcaagcagcg cgccggtatc gacgtgctgc acgtgccgta caagggcagc    269460
     gccccggcgg tcaccgacct gatcggcggc caggtgcagt tcatgttcga caacatgccg    269520
     tcgtcgtggc cgcacgtgca ggccggcaag ctgcgcgcgc tggcggtgac caccaccgag    269580
     cgctcggcca gcgcgcccga cctgccgacc atgaaggaat cgggtttcga gaacttcgac    269640
     gtgtcgtcgt ggttcggcct gatcgccccg gccggcactc cgcccgaagt cgtgaacacg    269700
     ctgaacgcgg ccatggtcaa ggcgctggac aagccggagg tcctgcagtc gtacgagaag    269760
     ctgggcgcgg tggcgcagaa gaccacgccg gccgagttcg gcgccttcat caagtccgaa    269820
     gtggaaggct gggccccggt ggtcaaggcc tcgggcgcca cggtggactg acggccggtc    269880
     cgtctcgagc gtgaagaaga cgcccgcgag ggcgtctttg cttttggagc cgtgcggatg    269940
     cctgccccag cgggggcaga taccgccttg gccgtcaagc gtcgatggcg tacagcagtg    270000
     tgcctgtccc ggcggggaca ggcacactgg ccgccggagt ggcttccccc acggggacag    270060
     gcaccccgcc ggcgcgccgg gaagggggtt atttcgggcg gttcggggcg atcatggcgg    270120
     tgcacacgcc gcgcagcatg tccacttcgt cgcggctgag cgcgctgcgc gtgagcaggt    270180
     gcttcatgcg cggcatcagt ttcttgggat gcgcggggtc gagaaagccc acggcgacca    270240
     gcgcctgctc ccagtgcgcc agcagcgcct ggacggccgc gccgtcggcc ggggcggcgc    270300
     ccgggttggc ctgctgggcc gacgaggccg gcagcagcga ctggccggtg ccggccagca    270360
     gggcgtagcg cagctcccag gcggccagtt gcagggcctg ggcgacgttc agcgagctgt    270420
     attgcgggtt ggccgggata tggcaaatac ggtgacagag ctcgatctgg gcattggtca    270480
     gcccggcgcg ctcggtgccc aggacgatcg ccaccacgcc cgcctcggtg tcgtccaggt    270540
     ggcgccgggc caggccggcc gcttcgcgga tgtcgcaggg gggcgggccc aggtcgcgca    270600
     cccgcgtggt cagggcgaag gccagggtga ccggggccag cgcttcttcc agcgtgtcgt    270660
     ggacggcggc gcgctccagc acgtcgagcg ccccgctggc cagcgccacg gcctccggct    270720
     gggcggtcat gtcgggaaaa cggggggcga ccaggaccaa ttcgccaaag cccatggtct    270780
     tgatcgcgcg ggccgccgaa cccacgttgc cagggtggct gggctgggtc atgatgaacc    270840
     gaacgcgtga aaatgcttga gtcatttaaa atgccatgtt tggcttagcg ccttcctggt    270900
     ttccgattgt attggccgcg tgtttttccg gcttgcaagg cggccgccct cactgcgttt    270960
     gtacggaatt ctatgcatcc gatgctcaat accgccatca aggcggcccg gcgtgccggc    271020
     accatcatca accgcgccag tctcgacctg gagcgcctta ccgtggcccg caaggggccg    271080
     cgcgattatg tcacggaagt cgaccgcgcc tccgaggagg tgatcgtcga agtcctgcgc    271140
     acggcctatc ccgaccatgc ggtgctgggc gaggagttcg gcctgcaggg gcccgagcag    271200
     gccgagttcc agtggatcat cgatccgctg gacggcacca ccaactatat ccatggcctg    271260
     cccaattacg cggtctcgat cgccttgctg catcgccgcc aggtgacgca ggcggtggtc    271320
     tacgatccgt cgcgcaacga gctgttcacg gccagccgcg gcagcggcac gttcctgaac    271380
     gatcgccggg tgcgcgtgtc gggccgcatc cgctaccatg atgcgctgct gggcgcgcac    271440
     tggccgcact cgaccgaccc cgaccagggc tcgggccgtt tccgcgccat ggccgagggc    271500
     agcgccagcg tgcgccggct gggatcgacc gtgctggacc tggcctacgt ggcctgcggc    271560
     cgcctcgacg gcttttgcgg cgtgggcctc aagccctggg acgtggccgc cggcagcctg    271620
     ctggtgctgg aagccggcgg cctgcttgcc gacttcgacg gcgagcaggg ctggctggac    271680
     accggcaacg tgctggcggg cacgcccaag gtcttcaccc acatgctcac cgcgctgcag    271740
     ccccgtacgg cttgatgcgc catacgccgg ctgatcggcc ggcaggccgc gcccacgctg    271800
     gatgcgcggc cgcgcgccgt caccggcgtg tcatggcatt tccatgtacg attaccggtt    271860
     ccaaaacttc cggagctcct gatggagtgg ctgcaggacc ccgccgcgtg ggtcggcctg    271920
     cttaccttgg tcgtcctcga aatcgtactg gggatcgaca accttatctt catagccatc    271980
     ctggcggaca agctgccccc cgcgcagcgc gaccgcgcgc gcatcgtcgg gctgagcctg    272040
     gcgctgctca tgcgcctggg cctgctgtca gtgatgtcct ggctggtcac gctgaccacg    272100
     ccgtggttct ccgtgggacc gatgtcgttt tccggcagag acctgattct catgctgggc    272160
     ggcctgttcc tactcttcaa gggcaccatg gagctgcacg aacgcatcga aggcggccag    272220
     agcctggaca caggcggccc gcgcgtctat gccagcttct gggtcatcgt gacccagatc    272280
     gtggtgctgg acgcggtgtt ctcgctggat tcggtcatca ccgcggtggg catggtggac    272340
     cacctggcca tcatgatgat cgccgtcatc atcgccatcg gcatcatgct gctggcgtcc    272400
     aagccgttga cgcgcttcgt caacgcgcac cccacggtgg tggtgctgtg cctgggcttt    272460
     ttgctgatga tcggcttttc gctgctggcc gagagcttcg gcttcaaggt gcccaagggc    272520
     tacctgtatg ccgccatcgg cttttccgtg gctatcgagg cgctcaacca ggtggcgcgc    272580
     cgcaacctgc tcaagctgga cgcgcgccgt ccgatgcgcg agcgcaccgc cacggcggtg    272640
     ctgcgcatgc tgggcaagcg cccgcccgcc agcgacgaat ccgacctgcc cagcgccatg    272700
     cccgccgtgc cggcgttcgg cgtggaagag cgcaacatgg tcagcggcgt gttgacgctg    272760
     gccgagcgtt ccatccggtc catcatgacg ccgcgcaccg atgtgtcgtg ggtcaatatc    272820
     gatgatgacg ccgccaccat ccgccagcag ctgaccgccg cgccgcacag tttcttcccg    272880
     gtgtgccggg gctcgctgga cgaagtggtg ggcatcggcc gtgccaagga cctggtggcc    272940
     gacctgatca cggaagggcg ggtgcgccgc aatcgcctgc gcgaccccat catcgtgcac    273000
     gagtcgatcg gcatcctgcg cctgatggac accctcaagc gttcgcgcgg ccagctggtg    273060
     ctggtggccg acgagttcgg cgccatcgaa gggctggtaa cgcccatcga cgtattcgag    273120
     gccatcgccg gcgagttccc cgacgaggac gaactgcccg acatcgtcgc cgagagcgaa    273180
     aacgtctgga aggtcgacgg cgccgccgac ctgcatcacc tggagcaggt gctggagatc    273240
     gaggggctga tcgacgagtc cgaggactac tccaccctgg caggctacct gctggcccgt    273300
     ttcggccatc tgcccaagcc cggcgacacc tgcgaattcg aaggatccca tcatcggcgc    273360
     gtgcgcttcg aagtgctgca gatggatggg cggcgcgtgg cgctggtgcg ggtcgagcgc    273420
     ctgccctacg acaccgtcga cgaaagcgag gcggccgacg ccgattaacc gttcttaccc    273480
     ggatactgtt tagtgactga tagcacgctc cacctgctca aggcattctt tctcggcatc    273540
     gtcgaaggcc tgaccgagtt catcccggtg tccagcaccg ggcacctgat cgtcatcggc    273600
     gactggatca acttcgcgtc cagctcgggc aaggtgttcg aggtggtcat ccagttcggc    273660
     tccattctgg ccgtgatgtg gatattccgg gcccgcctgt ggcagttgat ccgcggcacc    273720
     ctgaccgggg tgcgccagga ggtcaatttc acgcgcaacc tgctgctggc gttcctgccg    273780
     gcggcggtca tcggcgccat cttcatcaag tccatcaagc aggtcttcta ccacccgggc    273840
     gtggtagcgg tgacgctggt ggtgggcggg ttcatcatgc tgtgggtcga gcggcgcgcg    273900
     ccgcacacgc cgggcgacgc gcccggcgcg gccgacgata ccgcctcgga cgagcgcgcc    273960
     agcgcccata cgctggagca gatcagcgcc aagcaggcgc tgggcgtggg cgtggcgcag    274020
     tgcgtggcca tgatcccggg cgtttcgcgc tcgggcgcga ccatcatcgg cggcatgatc    274080
     gccgggatcc agcgcaagac cgccaccgag ttctcgttct tcctggccat gccgaccatg    274140
     ctgggcgcgg cggtctacga cctgtaccgc aatatcggcc tgctcagcca gcacgacatg    274200
     tcggccatcg ccgtgggttt cgtggcggcc tttctcagtg cgctggtggt cgtgcgcgcg    274260
     gtgctgcgct tcgtggccaa ccatacctac cgcgtgttcg cgtggtaccg catcgccctg    274320
     ggcctggtgg tggccgcctg gatctacgcc aaatgaaaag agcctgtccc gacggggaca    274380
     ggctcttttt cccggcgcgg acagatgccg tcctggccgt caagcgttca tggcgcatga    274440
     cggggtgcct gtccccgcgg ggacaggcac ccgcacgggc agacgccatc ttgcaggcgc    274500
     cagtccccat gcggggactg gcaccaggat tcctgcgagg acaggggcct catgacgggg    274560
     ccttcaatct tcgtcttcga ccaggtcgaa gcactgcagg ccatcgcggt cgatgaccag    274620
     ccagccgccg cgcggcggat cggcgtggtc gcagtcccag tccggcagca cccagcgttc    274680
     gcgcttgcgg ccgtcgaccg acagcacatg gcgcgccggc cggtgggtgt ggccatgcac    274740
     cagcacatcg acgtcggcct cgcgcagggc ggcctcgacg gccgccggat tgacgtccat    274800
     gatttccatc gacttggcct ggttggccgc ctggctttcg ccgcgggcct gctcggccat    274860
     ggccagccgc tcggggatgc tcttggccag gaactgcgcc tgccattgcg ggttgcgcac    274920
     catggcgcgg aactgctggt aggcgctgtc gtcggtacag tactcgtcgc cgtgcgtgag    274980
     caggatgcgg ccgtagtcgg tttcgagcag caccggctcg ggcagcagat gcgcgccgag    275040
     cgcgtcggcc agctcctggc cgatcaggaa gtcgcggttg ccgcggccca ggtaaaccgg    275100
     aatgcgcccg gcggccgcgc ggatgccatg cagcaccgcc gccagccagg gcggcgcggc    275160
     ccggatgacg tcgtccccga tccaggcgtc aaagatgtcg cccggaagaa gcagggccga    275220
     cgcctcgtcg gcggcggcct gcagcagtcc caggaatgct tcggcggtgg ccggcgtggc    275280
     cggccccagg tgcaggtcgg aagccagcca caacggcccc tgcagcgcca gcttattcaa    275340
     ggacttcggc cttttcgatg atcacgtcct cggccggcac gttctggtgg aatccacggt    275400
     tgccggtctt gacgttcttg atcttgtcga ccacctcggt gccctcggtg accacgccga    275460
     acacggcgta gccccagccg ttgggcgtgg gcgcggtgaa gttgaggaag tcgttgtcgg    275520
     acacgttgat gaagaactgc gcggtggccg agtgcggatc gctggtgcgg gccatggcga    275580
     gcgtgtattt gtcgttcttc aggccgttgt tggcctcgtt ctcgatgggc gccttggtgg    275640
     gcttttgctt catgccgggc tcgaagccgc cgccctggat catgaagccg tcgatgacgc    275700
     ggtggaacac cgtgccgtca tagaagccgt ccttggtata ggcgacgaag ttttccacgc    275760
     tcttgggcgc cttttcggca ttcagggtga tgatgatgtc gccctggttg gtgtgcagct    275820
     tgacgcgggg attcgtgctc atggatgagg tgccttttga agtgggggtg gagttggcgg    275880
     gctgggcgcc cgcgcctgcg ggcagcatgg ctgccagcgc gatcgtgcac gccgtcaggc    275940
     gcagcatctt aagcggaaaa tggcgggaca tcatttaggc tgtttatcct tcaacaggga    276000
     ttcgatttcc tcgacgcgag ccttcatgcc cgggacgccg cgagcctcct cctggcggta    276060
     ggtgcgcagg gccatcatca gctggatgtc gccgaggttg gcgcgcgcgg cggcgtagtc    276120
     gggattcgcg cgcagggcca tctgtagact gtcctgggcg cgttcgagtt caccgcgcga    276180
     ggcatagagg gccgccaggt tgttccaggg ttcgggcagc tccgggaatt gggtcgtcat    276240
     gtcactgtat accgcaatgg cctcgtcggc gcgacccagc gcggccagcg cgcgggcgtg    276300
     ctggaacatc agctgcacgt cggcgccgcg ctggcccttg atggcggcct cgcgccgctc    276360
     gatcaggctg agggcctctt cgttggcgcc gcggttgagc agctcctcga tgcggtcggt    276420
     gatctgcgag ggcgtggggt ccaggcgcgt gtccacgccg ggcttggcgg cctccagcag    276480
     gttggccagc ccctgccagc cgccttcggg cgggtagggg tccagcttgg tctggttggc    276540
     gtagcggttc ttggccgagc cgccggccat cgattgcgcc agcacggggg cgctggccga    276600
     tacggcgatg gccagggtca ggagggcagt gcaaaggcgc ggcttggtgg tcacgatggc    276660
     atccgtagta aggcccgggg aaccgcgcgc tgcgcgtgca gtcaggccgc ttgctatact    276720
     tgacgatcgc cattttagcc ctggttgcgt ttcaggctcg agcgcggccg tgcaggctgt    276780
     ccgggccggc gccacgtgcc tgccggcggg cccgccgcgg cgccccgggg cagcctgggc    276840
     gcggcggcgg tgctgccttg cccgcgcaac ctttccaaca attccagagc gccatgctgc    276900
     acatctacaa cacgttgtcg cgtaccaaag aaccgttcaa gccggcccat gccggccagg    276960
     tgcgcatgta cgtgtgtggc atgaccgtct acgactattg ccacctcggg cacgcccgca    277020
     tgctggtggc cttcgacgtg gtgcagcgct ggctgcgcgc cagcgggctg gcggtcgact    277080
     acgtgcgcaa catcaccgac atcgacgaca agatcatccg ccgcgcggtc gagaccggcc    277140
     ggcgcatcgg cgaggtcacc gaatactaca tcgccgccat gcacgcggac gaacgcgccc    277200
     tgggcgtgca gccgcccgac cgcgagccgc gcgccacgca gtacgtgggc gagatgctgg    277260
     acatcatcgg ccgcctggag agcaagggcc tggcctaccg ggccgaggac ggcgatgtca    277320
     attacgcggt gcgcgggttc gccgactacg gcaagctgtc gggcaagtcg ctcgacgacc    277380
     tgcgcgccgg cgagcgcgtc gcggtgggtt cggccaagcg ggatccgctg gatttcgtgc    277440
     tgtggaagtc ggccaagccg caggagccgg acgacaccaa atgggagtcg ccctatgggc    277500
     tgggccgccc gggctggcat atcgaatgct cggccatgag caagaccctg ctcggcctgc    277560
     cgctggatat ccacggcggc ggcccggacc tgaagtttcc ccaccacgag aacgagatcg    277620
     cccagaccga aggggcgttc ggcggcgcgc tggccaatgt ctggatgcat tgcggcccct    277680
     tgatggtcga cgccgacaag atgtcgaagt cgctgggcaa cttccgcacc atccgccaga    277740
     ccatcgcgca gggtccgctg tcggacacgc aggccgagta cgcggtcaat ccgcgcgagg    277800
     ccgagatgct gcgctttttc atcgtgcgca accactatcg cagcccgcag aactacgcgc    277860
     cggacaacct ggtcgacgcg cagaacgcgc tcgatcggct gtaccaggcg ctgcagaaca    277920
     ccgcggccga cggccagggc gtggactgga gcgaggagcc gcaggcgcag gccttcaagg    277980
     ccgccatgga cgacgatttc aacagctccg gggcggtcgc cgccctgttc gagctggctt    278040
     ccgaggccaa ccggaccggc agcgcgcgcg ccgtcggcca gctcaaggcg ctgggggcgg    278100
     tgctgggcct gctgcagcag gatccgccgg cctatttcca gtcgcccacg cgctattcgg    278160
     ccgccgcccg cgggcagggc gcgcccgccg cggcgctgga cgccgccgcc atcgaggcgc    278220
     gcatcgccga gcgcgcggcc gccaaggcgg cgcgcgactt cgcccgcgcc gacgcgatcc    278280
     gcgccgagct gcgcgcggcc ggcatcgagc tcgacgacaa gcccggcggc ctgacgcaat    278340
     ggcgtcgcgc ctgaggcggg gaagcacagc tccatgtcca gcgccgatat cgtcatcgtc    278400
     aagcccgaat actgggacga cgcggttgcg cacctgatgc gccgcgaccg cattctcaaa    278460
     cggatcatcc cccagcacgg tgaaacctgg ctgacctcgc gcggctcgcc gttcgtgacg    278520
     ctggcgcgcg ccatcatcgg ccagcagatc tcggtcaagg ccgccgacgc gctgtggcag    278580
     cgcttcctgg agaccgtggg caagcgtccc acgccggcca ccgtgctgcg cgccggcgtg    278640
     ccggcgctgc gcgcggcagg cctgtcgcag cgcaaggccg agtacctggt ggacctggcc    278700
     acccatttcg ggcagcgcct ggtgcatccg gagaaatggg ccgccatgga cgacgaggcc    278760
     gtcatcgccg agctggtcgc gatccgcggc atcggccgct ggacggcgga gatgtttttg    278820
     attttcaatc tgcagcgccc cgacgtcctg ccgctggatg atcttgggct gctgaaggca    278880
     atctcgttac actatttcag cggcgagccc gtttcgcgct tcgaggcccg tgaggtctcg    278940
     ctggcatggc agccctggcg taccgtggcg acctggtatt tgtggcgcag tctggaaccg    279000
     gcagcggtcc agtactgaac cggccaggcc gcccatcaac ggaacctcac ttacatgcgc    279060
     aatactttcc tggaattcga acaaccgctc gccgagcttg agaacaagat cgagcagctg    279120
     cgctacgtgc aggccgactc cgcggtggac atctccgacg aaatcggccg cctgcagcaa    279180
     aagagccaga acctggccaa ggaaatctac ggcaagctga cgccatggca gaccgcgctg    279240
     gtggcgcgcc atccgcagcg cccgtacacg ctggactacg tgcgcgaaat cttcaccgac    279300
     ttccatgagc tgcacggcga ccgcatgtac gccgacgacc agtccatcgt cggcgggctg    279360
     gcccgcttca acggctcggc ctgcatggtc atcggccacc agaagggccg cgacaccaag    279420
     gagcgcgccg cgcgcaactt cggcatgccg cgccccgagg gctaccgcaa ggcgctgcgc    279480
     ctgatgcgcc tggccgagaa gttccgcctg cccatcttca ccttcatcga cacgccgggc    279540
     gcctatcccg gcatcggcgc cgaagagcgc ggccagtccg aggcgatcgg ccgcaacctg    279600
     tacgccatgg ccgagctaaa ggtgccggtc atctgcaccg tgatcggcga gggcggttcg    279660
     ggcggcgcgc tggccatcgc ggtcggcaac gccgtgctga tgctgcagta cgcaacctat    279720
     tcggtgattt cgcccgaagg ctgcgcgtcc atcctgtggc gcagcgccga caaggcgccc    279780
     gaggcggccg aggcgctggc catcaccgcg ccgcgcctga aggacctggg cctggtcgac    279840
     cgcgtggtca acgagccggt cggcggcgcc caccgcgacc cgcgcgtgat ggcgcgcctg    279900
     ctgcgccggg ccctgggcga cgccctgcgc cagctgcagg gcctggggcc cgagcaattg    279960
     gtcgaccagc gcctgcagcg cctgatgtcg tacggacgct tccaggaagt ccgcgcctag    280020
     ctgtgaagat tcaataggtt gtatgcatgg ttcatccgaa ccggatttga gaaactggaa    280080
     atcgccaccc ccccagttca ctcaaggagc ccggccggat gaacacccat aagcatgccc    280140
     gattgacctt cctacgtcga ctcgaaatgg tccagcaatt gatcgcccat caagtttgtg    280200
     tgtctgaagc ggcccgcgcc tatggggtca ccgcgccgac tgtgcgcaaa tggctgggcc    280260
     gcttcctggc tcacggccag gcgggcttgg ccgatgcgtc ctcgcgcccg acggtctcgc    280320
     cccgagcgat tgcgccggcc aaggcgctgg ctatcgtgga gctgcgccgc aagcggctga    280380
     cccaagcgcg catcgcccag gcgctgggcg tgtcagccag caccgtcagc cgcgtcctgg    280440
     cccgcgccgg tctgtcgcac ctggccgacc tggagccggc cgagccggtg gtgcgctacg    280500
     agcatcaggc ccccggcgat ctgctgcaca tcgacatcaa gaagctggga cgtatccagc    280560
     gccctggcca ccgggtcacg ggcaaccgac gcgataccgt tgagggggcc ggctgggact    280620
     tcgtcttcgt ggccatcgat gaccacgccc gcgtggcctt caccgacatc ccccccgacg    280680
     agcgcttccc cagcgccgtc cagttcctca aggacgcagt ggcctactac cagcgcctgg    280740
     gcgtgaccat ccagcgcttg ctcaccgaca atggctcggc ctttcgcagc cgcgccttcg    280800
     ccgcgctgtg ccatgagctg ggcatcaagc accgctttac ccgaccttac cgcccacaga    280860
     ccaatggcaa ggccgaacgc ttcatccagt cggccttgcg tgagtgggct tacgctcaca    280920
     cctaccagaa ctcccaacac cgagccgatg ccatgaaatc ctggctacac cactacaact    280980
     ggcatcgacc ccaccaaggc atcgggcgcg ctgtacccat ctccagactc aacctggacg    281040
     aatacaacct attgacagtt cacacctagc ggccgcgcgg gctggccacg ccagcccgcc    281100
     agcgcgtcac gccggcgccg ccagccacca tgtccacctc ccccgcagcg ccggctccct    281160
     ctctttccga tctatgcccc gcggccttac gccggccggt ggcggccgcc ctgcgcgccc    281220
     tggatcccgc gccggcgcgg ctggccgtgg ccgtcagcgg cggcgccgat tcggccatgc    281280
     tggccgtggc ggcggccgcg gccttgccgc ccggctgcac gctgcgcctg ttccatgtcc    281340
     accacgggct gcaggcggcg gccgaccaat gggccgcgca ggtgcgcggc ctgggcgcgc    281400
     tgctgggcgt gccggtggac gaggcgcgcg tcaccgtgcc gccgggccag gggctgggca    281460
     tggaggccgc cgcccgcctg gcgcgctacc aggccttggc cgggctggcc cgccagcatg    281520
     gcgtgcggca tatcctgctg gcgcatcacc gcaacgacca ggcggagacc gtcctgctgc    281580
     gcttgctgcg tggcaccggc ctgcagggca tggcggccat ggcgccgttc agcgagcgcg    281640
     atggcgtggc ctacctgcga ccctggctgg acgtcgacca cgcagccatc ctggcgctgg    281700
     ccggcgcggt gcgcgcgcag tgcggctggc aggcggtgca ggaccccacc aataccgacc    281760
     cgcgctatgc gcgcgccgcc gtgcgcacgc agctcgcccc ggcgctggac gcgcgctggc    281820
     ccggctggca ggccatcgtg gcgcgccatg cgcgccaaat ggccgaggcg gccgagatcg    281880
     tggccgaggt ggcgcaggcc gatttcgcta cgctggagcc ggccgatgcc ggccgcagtt    281940
     tttcgctggc ggcctggcgc ggcctgtcgg cggcgcgcca ggcgcaggcg ttgcggcact    282000
     ggctggccag ccaggacgcg ccgatgccga ccgaggcgcg gctggcggaa ctgcagcgcc    282060
     agttgcgcca attgcacgcg ctgggccacg accgccactt gcgctggcaa cacgcggggc    282120
     gcgtcgtgcg ctgcgagcgc ggccgcgtct ggatcgacga ttagggcctg gcgcgccggc    282180
     gctgcgcaaa tttttaccgt cgcgttaaaa tactcagctt tgcccgccca gaccctatgc    282240
     gggcttgtca gccagagtac gagatgtccc tgatcgttca aaagtatggc ggtacttcga    282300
     tgggctcggt cgagcgcatt aagaacgtgg cgcgccgcgt cgcgaagtgg catgctgccg    282360
     gccacaaggt cgtggtggtg ccgtcggcca tggcgggcga gaccaatcgc ctgctgagcc    282420
     tggcgcgcga aatcagcccg cagcccgacg gccgcgagct cgacatgatc gccgccaccg    282480
     gcgagcaggc cagcagcggc atgctcgcca tcgccctgca ggccgagggc gtgcccgcgc    282540
     gcagctacgc gggctggcag gtgccggtgc gcaccgactc gtcctatacc aaggcccgca    282600
     tcaagtcgat cgacgacaag cgcgtgctgg ccgatctgga cgccggccgc gtggtcatcg    282660
     tgacggggtt ccagggcgtg gacgacgacg ggcacatcac cacgttgggc cgcggcggtt    282720
     cggatacctc ggcggtggcc gtggcggccg ccatcaaggc cgacgagtgc ctgatcttca    282780
     ccgacgtcga cggcgtatac accaccgatc cgcgcgtggt gccggaagcg cgccgcatgg    282840
     cggtggtgtc gttcgaggaa atgctcgaaa tggcctcgct cggctccaag gtgctgcaga    282900
     tccgctcggt cgagttcgcc ggcaagtacc atgttccgac ccgcgtgctg tcctcgctga    282960
     ccgacccgct tatcccgctc gaagaagaaa tgcgttcggg cacgctgatt acttttgagg    283020
     aagacgaaaa aatggaagcc gccgttgtct ccggcatcgc cttcagccgc gacgaagcca    283080
     aaatcaccct gctggccgtg ccggacaagc cgggcatcgc ctattcgatc ctgggcccgg    283140
     tggctgcggc caatatcgat gtcgacatga tcgtgcagaa ccagtcggtg gccggtacca    283200
     ccgacttctc gttcaccgtc aatcgcaacg aataccagcg cacgctggac ctgctcaagc    283260
     gcgaggtcat ccccgcagtg agcgcgcgcg aactggtcac cgacgagaag gtcgccaagg    283320
     tgtcgatcgt cggcatcggc atgcgttcgc acgtgggcgt ggccagcctg atgttccaga    283380
     cgctgtcgca ggaaggcatc aacatccaga tgatcagcac cagcgagatc aagacctcgg    283440
     tgatcatcga cgacaagtac atggaactgg ccgtgcgttc gctgcacaag gcattcggcc    283500
     tggaccaggt cccgggcgat caggtctaag aaaggatcgg cacgattttt cgctgttcgg    283560
     ggcagggcgc ctgcagacgc agtggaaatc gtgctagaat cctcgactct tttggagatg    283620
     tgcccgagag gctgaagggg ctcccctgct aagggagtat gtggctaaaa actgcatcgt    283680
     gggttcgaat cccaccatct ccgccaaaga tcaaaaaggc ccttgagcaa tcaagggcct    283740
     ttttcttttg cggcgcggcg gtgcctgtcc ccacgtggac aggcacctgc gaccgagcca    283800
     cgtcgctcgg cctcccgtcg tcgtccacgc ccggtgcctg cccctgcggg gacaggcacc    283860
     cccgaccgag ccacaccgtt cccggtgcca gtcccccgcg gggacagata ccgtcttggc    283920
     agtcaaccgt tcatggcgta attgggctgg taggggatgc ggtttttgag gaccccgaag    283980
     cacagatgca ccagttttct catggccgcg cccagcgcgg cctttttgct ttttcctgct    284040
     ttgagcaggc gctggtaaag ggcgcggatg tgggggttgt ggcgggtccc aaccagggcc    284100
     gccatgtata acgtggcgcg cacctgggag gggccggctt tggacaggcg tgcgcagctg    284160
     ttcagactgc tgccggattg gcgctgcaca gggaccaccc cgagataggc ggccaggctc    284220
     tgggcggagt cgatatgccg attgtgcatg acggccagga tggcgttgcc ggcctgaggc    284280
     ccgatggcgg ggatggagtt cagcagctcg cagtcttgct tgaggtcggg gtggttgtcg    284340
     atgtgctgat cgatcgcccg ctcgatttgt ttgatctgtt cgcgcaagaa cgcgatggcc    284400
     ttgtcgatgg aaccatcgac caagggcgcc gaggggctga actggctctt ctctttgcga    284460
     ttgagctcac gcaacagatc cttgctcagc gcctcgcgtc gcgtcaacaa ggcgcgcagt    284520
     tgacgcgcat gcaagggcgc cgggtgccac agcgccgggc tcagcgtctg tccatagcga    284580
     gccagcacgt agctgtcgag cgcatcattt ttggagcgca gcgccaaggc cttggcaaag    284640
     tcccgggcct gggcgggatt gaccaaagag acccggacct ggggcagcgc cgtggccgct    284700
     tgctcgtgat acagacccgt aggctccagg atggcgtgca actgcgccgg ctgtgcgccg    284760
     tgtttggcgc accacgccag cagggcttgt acgcccgcgg cggtgttgac caccaccttg    284820
     gtcttacact tgtcagcctc agccgtcagc aacgtgcaat ccagcttggc ctttgataca    284880
     tcaataccta tgaaaacatg gacttggcct cctgcagata acaaactgct gtcagccact    284940
     gcgcccactt gccttgtaca tacagggtcc tcgccctacg ataccgtcca gtgtctcgcc    285000
     ggcccagcag tgcgctgccg agccgctatc tgtcccacaa agtcctcgct ttgggcacca    285060
     actcgcggtc atcggcgcgc ggtggtgata gctaatcacc accggaggaa agatacaagg    285120
     cacctgcaac cgagccacat cggacgcatg gagtccgagt tgcgcgcacg ctacgaataa    285180
     ctgcctgtcc tgacataatt gtcagttttt cgggaattcc ctagtattgc ccgcgcttgc    285240
     tcgtccatat actgactgtc atgtcagtaa aacgagcgca atatgaaaca gcagcatgag    285300
     cccggcatcg ccgtggtggt ggggccggac gagggcgaca gcttctggca gccggtgccg    285360
     gccaacggct tcgtgcgcac cttgctcaac cgcgcgaaca ccggcgcctc ggtcgatttc    285420
     agcgccggca cccagacggt cgcgccgggc tgccacgtgc gcgagcactt ccatgacgac    285480
     cgcgaggaag tgatcttcat caccgaaggg accggcacgg cgctcatcga cggcgtcgag    285540
     catccgctgg ccccgggcgc ctgtctgttc ctgggcaagt cgcgcaagca cagctttctc    285600
     aatgccgggc ccgagcccct gtcgttcttc tggatcctca tgccgggcgg gctggacgac    285660
     ttctttcgcc agatcggccg cgtgcgccag ccgggcgaac cggcgccgca gtcgttcgcg    285720
     cgcccggccg acatcgaccg catcgaagcc aatacggtgt tcggctggac cgccaagtcc    285780
     tgagccgctc gtcccgtttc acctctacca gtacggaagt tccagtgttt atcgaagaac    285840
     gcgattaccg catcaagccg ggcaaggccg gccttttcgt ggccacctac gaagcgcacg    285900
     gcctggcgct gcagaagaag tacctgggcc gcttcctggg ctatttcatg tccgagatcg    285960
     gcgagctcaa ccacgtggtg gcctggtggg cctacgacag cctggatgaa cgcgacgcgg    286020
     cccgctcgcg catgctggcc gatccccagt ggcaggcgta cctggagcgg gtgaccgacc    286080
     tgatcgatct gcagcagacc cgcattctca agccggtttc gttctcgccc atccagtaac    286140
     aagccatcat gaatcacgta gcagtaatcg ggggcggcat catcggcgcc tcctgggcca    286200
     ttgtgttcgc gcgccgcggg ttggaagtga ccatcgtcga gcgcgacgcg gcctgcctgg    286260
     ccggactgcc ggcgcggctg gccggcatga tcgagcgcag cgcgtccttg ttgcgggcgg    286320
     gcgagcagcc cggcgacgtg gcggcgcgca tcggcgcgac cgacgcgttg gcggcggcgg    286380
     tgggccgcgc ggattacgtg caggaagcgg tttcggagaa cctggcgttc aagcgcacgc    286440
     tgttcgccga actggacgcg ctggcgccgg gccatgcgct gctggccagt tcgacctcga    286500
     cctatggcgc cagccagttc accgaggcgc tggccgggcg cgcgcgctgc ctggtcgcgc    286560
     atcccatgac gccgccgcat ctgtcgccgg tggtggagat ggcggcgtcg gcctggaccg    286620
     acccgcaggc cctggccggc gccgagacgt tcatgcgctc gctggggcag catccggtgc    286680
     gcatcaggaa agagattccg ggcttcgtgc tcaaccggct gcaaggcgcc ttgctgatgg    286740
     agatgttccg cgtgatcgcc gacgacgtga tttcgccggc ggacgccgac gccctgatca    286800
     gccaggggct gggcctgcgc tgggcgacgc tggggccgct ggagggggtg gacctgaatg    286860
     cgccgggcgg gattgccgac tacctgcagc gctacggcca catcttcaat gacatggcgg    286920
     ccggccaggg cttgcccgcg ccggtcgatg ccgagctgat cagcgcgctg gatggcgcga    286980
     tgcgcgccgc gctgccgctg gagcgcctgg aggccaagcg cggctggcgc gatcgcgcca    287040
     tcgccggcgt acgggtggcg ctacacgatt acacagggga aaaaccatga aattgatcag    287100
     ggccgtcgat ggcctgaatc gcctggcgtg ctggctgatg gccggactga tgctgggcat    287160
     gacattgtgc acgctgtggc aggtgtcggt gcgcttcctg cttaccgggc tgggctggaa    287220
     cgtggccgcg ccgtggagcg aagaggtatc gcgctacctg atgatctgga tcatctttct    287280
     cggcgccggc gtggcctgcc gcaaggcgca gctgatcgcg ctggagctgg tggtgacgct    287340
     gctgcccgcg ccgctggggc gcgcgctgcg ctttgccgcg ctgctgggct gcctggtgtt    287400
     cttcacgctg atgatctacc tgggcctgga gttcatggag ttcggcgcga tcgagaccag    287460
     cccggtgctg tccatgccca agacctggat ctacctggcc atgccggtgg gtttcggact    287520
     gatgttcctc aacaccgcga cgctgatcgc cgaatgcctg ctgcaaggca tcgacatccg    287580
     ccacgccagc cagcaagaag cccaggagta atcatgcttt cagccgttgt tctgctgttg    287640
     ctgctgttcg ccgccagcat ccccgtggcc ctgagcctgg gcatcgcgcc gctgccggcg    287700
     ctgctggcgc gcgacgtgcc gttgctggcc gtgccccaga ccatgttcga gtcgatggac    287760
     tcgttcgcgc tgatggccgt gccgttcttc gtgctggccg ggcgcctgat gcagaccggc    287820
     ggcatcgccg ggcggctgat ggacctgggc ctggcgctga tcggctgggt caagggcggc    287880
     ctgggcggcg ccgcggtgct gaccaccatg ttcttctcga ctatctgcgg ctcgtcctcg    287940
     gccaccaccg cggccatcgg ctcggtgatg attcccgaga tggagcggcg cggctatccg    288000
     cgtccgttcg ccgcgtcggt ggtggcctcc agcggcgagc tgggcgtgat cctgccgccg    288060
     tcggtgccga tgatcatcta cgccatgctg accggcacgt cggtggcgca gatgttcgtg    288120
     gccggcatcc tgcccggcct gctgatcggc ctgtcgctga tcatcaccat tctcatcatg    288180
     tcgcgcctgg gcgattacgg cggttcgcag cgcgtgagcg tgggcgaatg ggcgctcaac    288240
     gtctggcgcg cgctgcgccg ggccagcctg tcgctgctga tgccggtgat catcctgggc    288300
     ggcatctacg gcgggctgtt caccgccacc gaggccgcgg tcgtggcggt ggcctatacc    288360
     ttcgtggtca gcgtgttcat ctaccgcgaa atcaagtgga aggacctgcc cgagatcttc    288420
     tggtcgtcgg cggtgacctc cggcatcgtc ctgttgatcg tgggcttcgc gtcggtgttc    288480
     gcctatgtgc tgtcgctcta ccaggcgccg cagcaggtgg ccgcgctgtt gctgggcgtg    288540
     tccgacaacc cgctggtgtt cctgctgctg gtcaacatcg cgctgctggt ggtgggcctg    288600
     ttcatggaga ccttcgcggc gatcctgatc ctggccccgg tgctggcgcc ggtggccgtc    288660
     agcctgggca tcgacccggt gcatttcggg ctgatcgtga tcgtcaacct ggcggtgggc    288720
     atggtcacgc cgccggtcgg ggtgaacctg ttcctggtat gcggcatagc ccgcgtgtcg    288780
     atggagcgcc tgatgcgccc gctgtcggta ttcctgggcg tgctgctgct ggacctgatc    288840
     atcattacct acgggccggt gctgtacgcc cgctttttct gaaccctgtc acttcccaag    288900
     gaagcgcaac atgaacgtcg tgaaatccct gtttgccgcg ctcgcactgg ccggcgcctc    288960
     gttcggcgcc agcgccgagc ccatccagat caatatcggc cacgcgctgg gcgacaccag    289020
     ctcgtaccag gtggccggcc tgcatttcgc cgagctgatg aagcagaagg tgggcgacaa    289080
     ggtcaaggtc accctgtatc cgtccggcgg attgggcggc gagctcaagc tggtgcaggg    289140
     cgcgcgcacc ggcgtggtcg atgcgatgat catcgcccag gcctcgctgg agaacacggt    289200
     gcgcgaatac cgcgtcctgt cgctgccgta cctgttcacc gactacgaag aggccaaccg    289260
     catcatgcag ggcccggttg gcgatcgcct gctggacgtg ctgcccaagt acaacatggt    289320
     cgggctgggc tggggcgcgg tgtatgcgcg cagcctggcg tcgatgaagc cggttcccga    289380
     cctggcggcg atgaagggcc tgaaggtgcg ggtcatccag tcgccgggct tcgtcgaggc    289440
     ctatcgcgcc ctcggttcgc agcccacgcc gaccgcctac gccgaactgt tcctcagcct    289500
     gcagaacggc gtggtcgacg ccgccgaact gagccccgac cagaccgtgg ccgatggctt    289560
     tgccgaagtg atcaagtatt actcggtgac cgccgcccac cagctgccca gcctgttcat    289620
     catctccaag gccaagttcg accgcctgcc cgaggacgtg cgcaaggctg tcgaggaagc    289680
     gggccgtgaa tccatgcagg tggcggtgaa gttccaggac cagaagctgg ccgaggcgtt    289740
     cgacgtgctc aagcagcgcg gcgtgcaggt gcagtacccc gaccaggcgc cgctgcgcga    289800
     ggcggcccgt ggcgcgtggg atcagatcgc caaggcggcg ccgggcggcg agcagttcct    289860
     ggtagagatc gaagcggccc gcgcggccaa gtgatccggc agcgcatgac ggatttcacc    289920
     gtgatcctgc ccgacggcgc gcgcctggcg gcgcgcgaga cgggcgcggg cgaggccgtg    289980
     ctgctggtca gcgggctggg cggcacgggc gccttctgga cgcccgtggc ggccggcctg    290040
     caagggcggc gctgcgtggt gttcgaccag cgcggcgtgg ccggctccac gcgcggcgat    290100
     gccgcggtgg acatcgcccg gctggccgcc gacgcctggg ccgtgctgga tgcgcgcggc    290160
     atcgaacgcg cccatctggt ggggcattcg accggcggct gcatcgtgca ggagatggcc    290220
     ctgtcggcgc ccgcgcgggc ggccagcctg gtgctgggcg gcacctgggg cgggcgcaac    290280
     gcctatatgc agtcgctgtt cgccatgcgg gccgcgctgc tggcggcgtc gccggcgctg    290340
     tacgagcagg cgggcgccta tctgtcgtat ccggccgcct ggttgctggc gcatcccgaa    290400
     gccgtgccgg cggcggcagc gccgtggccg gcgcagcggg tcgccgtggt gcgcgagcgc    290460
     atcgccgcct tgctggcgta cgatcgcctg gacgatctgc cggggctgga cgcgcccgcg    290520
     ctggtgctgg gcgcgcgcga cgaccagatc gtgccgttcg cgctgcagca gcagctggcg    290580
     cgcgtgctgc cgggggcgca attgcgcccg ctggagcatg gcggccattt ctttcccatt    290640
     gtgcgcggcg ccgattacgt cgccgcgctg ctcgattggt ttggacatca ttccctatga    290700
     cgcatcgcat tgcattcatc ggcctgggcg ccatcgcctc ggacgtggcc gccggcctgc    290760
     tggccgacgc cgcgcagccg tgccagctgg ccgcgctgac gcgcaacgcg gcggacctgc    290820
     cgcccgcgct ggccgggcgc gtcgccttgc tcgacggctt gcccggcctg ctggcctggc    290880
     gtcccgacct ggtggtcgag gcggccggcc agcaggcgat tgccgagcac gccgagggct    290940
     gcctgacggc cggcctggac atgatcatct gctcggccgg cgcgctggcc gatgacgccc    291000
     tgcgcgcacg cctcatcgcc gcggctgagg ccggcggcgc ccggatccgc gtgccggccg    291060
     gggcgatcgc cggtctggac tacctgcagg ccgtggcggg ccgcgacgac gccgaagtgg    291120
     tgtacgaatc gcgcaaaccc gtggcggcct ggcgcgccga actgcccggc atggggatag    291180
     acccggatac gctggccgaa agccgcacgc tgttcagcgg accggcgcgc gaggcggcgc    291240
     tgcgctttcc caagaatctg aacgtggcgg ccacgctggc gctggccggc atcggcatga    291300
     cgcgcacgcg cgtggaggtg gtggtcgatc cgcaggcgcg cggcaaccag caccgcatcc    291360
     aggtgcgcag cccgttgggc gagatgcaga tcgagctggt caacgcgccg tcgccggcca    291420
     atcccaagac ttcatggctg gtggcgcata gcgtgctggc cacgatccgc cgccatctgg    291480
     cgcgctttac catcggctga gccgggagca ggacatgacg caacgcttat ccggcaggat    291540
     cgccatcgtg accggcgcgg gctcgggaat cggcgaggcc acggcccgcc tgatggcgcg    291600
     cgagggcgcg gtcgtggtgg tggccgacaa ggccatcgaa gtggccgagc gcgtcgcgca    291660
     ggccatcgtg gccgagggcg gacgcgccga ggcgcgccag gccgacgtgg gcgaggcgca    291720
     atcggtgcgc gccctggtcg acgccgtggc ggcgcgctgg gagcgcatcg acgtgctggt    291780
     caacaatgcc ggctacggta tcgccgccac cgtggtcgat accgacgagg ccgactggtc    291840
     ggcgctgatg cgcgtcaacg tcgacggcgt gttcctgggc tgcaagtacg tcatcccgat    291900
     catgcagcgc cagggggccg gcgtgatcgt caatacggcg tcggcgggcg cgctggtggg    291960
     cttgcgccag cgcgccgcgt attgcgcctc caagggcgcg gtggcggcgc tgacgcgcgc    292020
     catggcgctg gaccacgcca ccgaggggat ccgcatcaac tgcgtggcgc cgggcacgat    292080
     cgagtcgccg tacttccgcg agatctacgc gcgcagcgac gatcccgaag ccttgcgcgc    292140
     cagcctggcg gcgcgccagc ccatgaaccg cctcggccag cccgaggaag tggcgcgcgc    292200
     catcgttttc ctggccagcg acgacgcctc gttcgccacc ggcagcacgc tggtgctcga    292260
     cggcggcctg acggcggcgt agccgagcgc gcgcaacagg ccctagaatg cactgtttgc    292320
     cgtggcgcgg cgggccgccc ggcatgacat cggaggaggc aaggacacgg tgaaggcaac    292380
     cccggctcag gttcccatga aagagcgcat caaggaagtc gccaccgata tgctgatcgc    292440
     acacggcagc tcgggctttc ggtttcagca gatcgcccag gcgctcgact gcacgcgcgg    292500
     caatatccac tatcactacc ggcacaagca cgagttggtg gaagacgtca cgatcgagta    292560
     ttgccagcgt acgatcggcc atttcgacca gatctggctg tcggactcca cgctatcgca    292620
     gaagatccag ctcagcatgc agttcaacga gatgcgctat ctcaagcgca acccgcaggg    292680
     cgacaccagc catccctgga gcctgatcgc ccgcatgcgc ctggaaagcg cgctgatcac    292740
     gccggcggcg cgcgaggcgc tggcgcgcta ttcgcacgag ctgcagcgca gcgtggtggc    292800
     gggggtgcgc cgcgcggtcg aaaagggcga gttgcggccc gataccccgg tggaaatggt    292860
     ggccctgccc atcatcgaga tggccaacag cgccgatccg atcacccgcg acgcgggccg    292920
     tttcgaccgt ttgcgccaga tgtaccaggc cgtcgaccgg ctgatccacg acgcctacgg    292980
     gatggcgggg cacaggccgg cgccttgagc gcctaggcct ggaagctgtc gggccgcgcc    293040
     tgcagcacga ccgcgcggta ggcttcgagc agcagttcgg catggcgcgt gagcgggcgc    293100
     aggcgcgagc gcacgatgcg cgagcgcacc ggcagcgccg gcaggaaggg cttgatgacg    293160
     aagccggtgg cgccaaaggg cgcgatggcg gccggctcga ccagccccac gcccacgccg    293220
     gcgcggatca gggccagcag ggccgccgac gaggtgactt ccaccgccac cggcatgcgc    293280
     acgccggccg aggcgaaggc cgtctccagc atggcgccga agttggtctg cggcccgtac    293340
     gaaagaaagg tctcgttcct caggtcgtgc gcggcgacgt gcggcaggcc ggcatagcgg    293400
     tggccggccg gcgccacgca caccacatgc tgcaggccca ggtcttcatt gagcgtggac    293460
     accgacgggg tgatgtcgtg caccaggccg aaatcggcct ggccgctctg cacgcggtcg    293520
     acgatgggct ggttggccag gatctcgacc gtgaccgtga tgccctggta gcgctcgcgc    293580
     agccgcttga tggcctgcgg caggaaggtc gtggcctgcg tcgggatggc ggccacgttg    293640
     acatggcccg tgtccgggtc ggccaggctg ttgatctggc gctgcaccac cccgtaggcg    293700
     ccgtagagct gctcgacgct gtcctgcagg ccttgcgcgt gcggcgtggg caccagccgc    293760
     tggtgctggc gctcgaacag gcgcagcccg gtgtcgtcct cgagctggcg cagcatcttg    293820
     ctggcggccg attgcgtcat gcccatcagc cgggccgcgc gcgacaccga gctggtgatc    293880
     atgatcgcat ggaatacgcc cagttgcgca aagctgggct cgtgcagcgc cttgggcttg    293940
     gccaggccga cgggtaaggg tgacatcagg gggagaccta gggatagtac ggacaggtgc    294000
     aaaactcata tattgcatga agccggcccg gtgatcacta tggtttttcc ccaagttccc    294060
     atgcgaggac gcataccatg aagatgtctg taccgcagga tggctggctg gccgacgccg    294120
     ccgaactggc gctgcaatct cccggactga cgtcggcgcg ccgacgccag ctgttgggca    294180
     tgctgggcgc ggcaggcctg gcgtcgctgg cgcccatgcg gcccgccgcg gccgccgccg    294240
     accgcatcgt cgtgtacaac tggggcggcg acgccatcaa gaaccagccg ctggtgtggg    294300
     gcaagccgta cgagaaggcc accggcacca aggtcgagtt cgacggcacg gggccgtcgt    294360
     tcggcaagat ccgcaccatg gtcgagtccc ggaacgtggc gtgggacgtg tgcgacgcca    294420
     acctggccgc gggccactcg ctgggcaagc gcggctacct ggagcccatc gactacagcg    294480
     tggtcgaccg caacaaggtg cgcccgggct tcagcagcga attcggcgtc tcgcatttca    294540
     tctacagctt tgtgctgacc tacgacaaga aggcctttgg cgaccggccg ccgcgcacct    294600
     gggccgactt ctggaacacc aaggacttcc ccggcacgcg catcctgccc gaccgggtgc    294660
     tggccacgct ggaagcggcc ctgatggccg acggcgtgcc ggccgatgcg tcccagctgt    294720
     atcccatcga cgagcggcgc gcgctggaca agatcgctgc catcaaggac aagaccattt    294780
     tctggaagac cggcgccgag agccagcagc tgctgcgcca gggcgaggcc actatgggcc    294840
     tggtctggca tacgcgcgcc accgtgatgc gccgcgaacc ggggtcgacc atcgatttca    294900
     cctggaacca gggcatcctg atcccggcgg ggtggctggt gcccaagggc aacccggccg    294960
     gccgcaaggt gttcgacttc atcgcgtcga cgcaatcgcc tgaaagccag atcgaactgc    295020
     tgcgcctgat gggcaacggc ccggccaacc cggcggccaa cgccctggtg ccgcccgagc    295080
     tgcgccagga caacccgacc gacgaagaga acttccgcca gcaggtggtg gccaactaca    295140
     cctggcatgg cgataaccag gaccgcatct acaacgagta cgtcaaggtg atcacgggct    295200
     gagcaacgca ccatgacgat gtacgcggat ttggtattgc atggcggcag catcgccacg    295260
     ctggacgaca agctggagca ggcccaggcg gtggcgatcg ccgccggccg catcatcgcg    295320
     gtgggttcgg atgcgcattg tctggcgctg gccgggccgg gcacgcgccg catcgggctg    295380
     ggcggcgcgt gcgtgatgcc gggcatcaac gacagccatt gccaccccga cgggcaggcg    295440
     gtcaaggccg ggcgctggga cgacgtatcg caggtggcga cgcagcaggc gctcttggcg    295500
     cgcatcgccg atttccaccg gcgcatgccg gccggcgcct ggtacctggg gtttcgcttc    295560
     gacgatacgc acagcggcgg ctatcccgcg cgccaggcgc tcgaacaggc ggcgcccggc    295620
     cggccggtgt tcctgttgcg ccgcgatgcg caggtcggac tggccagcgc gccggccctg    295680
     gccgcgttgc tggccagcgg cctggcggcg caggtgccgc cgcattgcct ggacgccgcc    295740
     accggcctgg cgcgcgggcg cggcgtgttc gccttcacga cccatatcgc cgccgccgac    295800
     agcctggacg actacctgga gggcttcccg acgctgttcg cggaaatggg gcgcatgggc    295860
     atcaccagcg tccacaacgc cctgaccagc gcgctggcgg tgcaggccta ccgcgcgctg    295920
     cacggcgcgg gccgcctgcc ggtgcgcgtg ggcatgatgc tcaacggccg cgaccagcgg    295980
     ctggtggacg agacgctggc ggccgggctg cgctttggcg cgggcgatga ccggctgtac    296040
     ctgctgggcg tggagtatgg ctcggacggc agcaccagcg gccgcacggc ggcctattac    296100
     cagccgtacg tgggcgagga gggaggcgat ggccggcccg ccaaccgtgg cgacgtgaat    296160
     ttctccgccg aggacctggc cgccaaggtc ggacgcgtga tggcggcggg cctgcaggcg    296220
     gccgccaccg gcaacggcga ccgcggcatc gacttcgcgc tggatgcctt cgagcagggc    296280
     ctgcgcgccc accccggcgc ggtgccgcca cgcatcgagc attgctgctg cgcgccgccg    296340
     gccatccagc agcgcatggc ggcgctgggc gtgatcgact cgtcggcggc gggctttgcc    296400
     tacaacctgg gcgatgccta tctgcgcaat cgccctggat gtggccgcac cgcgacatgc    296460
     tggaccgcgg ggtgctggtc tgcgcgcact ccgacgcgcc ggtgtgcgag cgcaatccgt    296520
     tcctcggcat gtggtccatg gtgacgcgca agaccgcgtc gggcgccagc ctgggtgccg    296580
     ggcaggccat tacgccgctg gaggcgatgc gctgctatac cgccaatccg gcgcgcgccg    296640
     aggggcaggc cgcgcgcaag ggcacgctca gtcccggcaa gctggccgac ctgatcgtgc    296700
     tggaccgcga tccgtgcgcc gtcgacccgg acgagatccg ccacacgcag gtgctggcca    296760
     ccctggtggg cggccaggcc acttatcgcg ccgcgggcgc gccatcctgg gcggacgagc    296820
     tgcccatgcg ggagtaacca tgcgacgatc cctgccagcc ttgctggtgc tgccggccgc    296880
     ggtactgata ggcgggatgt tcctgctgcc ggtgctgcgc atcctggcca tcagcttcac    296940
     cgagccgcat gccggcctgg gcaattacgc ggcgctgttc accgagccgc tgtacctgaa    297000
     gatcatggcg accacggcgc gcatctgcgc ctggaccacg ctgatcgccc tgggcctggg    297060
     ctatgtgctg gcctatgtga tggccaattc gtcgccgcgc atgcgcagct ggatgatcat    297120
     cggcctgctg gtgccgttct ggctgtcggt gctggtgcgc gccttcgcct gggtgctgct    297180
     gctggccagg gaaggaccgg tcaacgccac gctgatggcg ctgggcgtga tcgacagccc    297240
     gctggcgctg ctgcgcaacg aaaccggcgt gctgatcggc atggtccatt acatgattcc    297300
     ctatgccgtg ctgcccatgc tgaccaacat gctgggtatc gaccgctcgc tgatggcggc    297360
     tgcgcgggcg ctgggcgcgg ggccggtcgc gaccttcctg cgcgtctacc tgccgctgtc    297420
     gctgccgggc gtgctggccg ccggcgtgct ggtgttcatc ttttcgctcg ggttcttcat    297480
     tacgcccgcg ctgcttggag gaggcaagac cgtgatggtg gcgcaataca tagaattcgg    297540
     tatcagcgag accatgaact ggggcatctc gaccgccttc gcggccacgc tgctggtggc    297600
     ggtgatcatg agcctggtgc tggtgtcgcg cgtggtgcgc gtgccgtcgc tgttcggtgc    297660
     gccatgagcg tgcgaccctc atggtggttc gccgcggcgg cggtggtggc ggcgctggtg    297720
     ctggcctttc tgttcctgcc ggcgctggtg gtgatcccgg tgtcgttcac cgaccgctcc    297780
     tatctgtcgt tcccggccga gtcatggtcg tggcagcact accgccaact ggtggacagc    297840
     ccggtgtggc gcggcagcct gctgcaaagc gtggcggtat cagcggtgtc cacgctggcg    297900
     gccaccttgc tgggcgcggc cgcggccatc ggcgcatggc ggctgggcgc acggctgggg    297960
     gcgctggtgc gcctgctggc gctgctgccg ctgatcgtgc cgaccatcgt gggcgcgctg    298020
     gcgtattacc gcctgtacat cgacctgggc ctgctcgaca cgttcaccgg agtggtcatc    298080
     gcccacgtcg tggccgccat gcccttcgta ttcgtctcgg tcggttcggc gctggccaac    298140
     ttcgatccgc gcctggagca ggccgcgcgc tcgatgggcg cgcggccctg gcaggtgctg    298200
     tggcgcatca ccctgccggg cgtgcgcagc ggacttgtct ccggcgccat cttcgccttc    298260
     atcgtgtcgt gggacgagct ggtggtgctg ttgttcgtga cgacccgcaa cgtctatctg    29832