(data stored in ACNUC1104 zone)

EMBL: BX640427

ID   BX640427; SV 1; linear; genomic DNA; STD; PRO; 348997 BP.
XX
AC   BX640427;
XX
DT   09-AUG-2003 (Rel. 76, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 7)
XX
DE   Bordetella parapertussis strain 12822, complete genome; segment 5/14
XX
KW   complete genome.
XX
OS   Bordetella parapertussis
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Alcaligenaceae; Bordetella.
XX
RN   [2]
RP   1-348997
RA   Sebaihia M.;
RT   ;
RL   Submitted (06-AUG-2003) to the INSDC.
RL   Submitted on behalf of the Pathogen Sequencing Unit, Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA, E-mail:
RL   ms5@sanger.ac.uk
XX
RN   [3]
RA   Parkhill J., Sebaihia M., Preston A., Murphy L.D., Thomson N., Harris D.E.,
RA   Holden M.T.G., Churcher C.M., Bentley S.D., Mungall K.L.,
RA   Cerdeno-Tarraga A.M., Temple L., James K., Harris B., Quail M.A.,
RA   Achtman M., Atkin R., Baker S., Basham D., Bason N., Cherevach I.,
RA   Chillingworth T., Collins M., Cronin A., Davis P., Doggett J., Feltwell T.,
RA   Goble A., Hamlin N., Hauser H., Holroyd S., Jagels K., Leather S.,
RA   Moule S., Norberczak H., O'Neil S., Ormond D., Price C., Rabbinowitsch E.,
RA   Rutter S., Sanders M., Saunders D., Seeger K., Sharp S., Simmonds M.,
RA   Skelton J., Squares R., Squares S., Stevens K., Unwin L., Whitehead S.,
RA   Barrell B.G., Maskell D.J.;
RT   "Comparative analysis of the genome sequences of Bordetella pertussis,
RT   Bordetella parapertussis and Bordetella bronchiseptica";
RL   Nat Genet 35(1):0(2003).
XX
DR   MD5; cd1c663e72cac687417f58949bcc1b32.
DR   ENA-CON; BX470249.
DR   BioSample; SAMEA1705915.
DR   EuropePMC; PMC535204; 15574953.
DR   EuropePMC; PMC540052; 15608199.
DR   RFAM; RF00005; tRNA.
DR   StrainInfo; 494019; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..348997
FT                   /organism="Bordetella parapertussis"
FT                   /strain="12822"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:519"
FT   CDS_pept        80..703
FT                   /transl_table=11
FT                   /locus_tag="BPP1292"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2598"
FT                   /db_xref="GOA:Q7WAS6"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAS6"
FT                   /protein_id="CAE36594.1"
FT                   /translation="MYLPAHFAETRPEELARIIRAHPLGMLVTQDAQGLDADHLPFEFD
FT                   PDAGPHGTLIAHVARANTLWQRCPDGAAVMVVFRGAEGYISPNWYPSKHEAHRQVPTWN
FT                   YEVVHAHGTLAVRDDERFVRGVVARLTRRHEAGESRPWKMTDSTPEYIDSMLRNIVGIE
FT                   VAITSLVGKRKLSQNKDERDRLGAVQALQARGQDALAQSMARAE"
FT   CDS_pept        734..1345
FT                   /transl_table=11
FT                   /locus_tag="BPP1293"
FT                   /product="putative membrane transport protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2597"
FT                   /db_xref="GOA:Q7WAS5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAS5"
FT                   /protein_id="CAE36595.1"
FT                   /translation="MSLLAFLLAAALLAITPGPGIAYVVARTVAGGRAEGLASCLGTAL
FT                   GGLVHVLAAALGLSVLIAESALAFSLLKYAGAAYLVYLGLRMWLSPRPAAVRVVAPQGA
FT                   RRALAEGVLVEALNVKTALFFLAFLPQFVDPGAPLAPQLALLGGICVTLNTLVDVMAVV
FT                   AAHRLLRSEAARVARARVLTRVSGTTMVGLGVFLALARRD"
FT   misc_feature    734..799
FT                   /note="Signal peptide predicted for BPP1293 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.905 between residues 22 and 23"
FT   misc_feature    join(743..811,848..916,944..1003,1064..1132,1160..1228,
FT                   1274..1333)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPP1293 by TMHMM2.0 at aa 4-26, 39-61, 71-90, 111-133,
FT                   143-165 and 181-200"
FT   misc_feature    929..1240
FT                   /note="HMMPfam hit to PF01810, LysE type translocator,
FT                   score 2.5e-07"
FT   CDS_pept        1381..1851
FT                   /transl_table=11
FT                   /locus_tag="BPP1294"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2596"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAS4"
FT                   /protein_id="CAE36596.1"
FT                   /translation="MADKRTEGSGKGGAKAAGKGGLGEVVLLSGGNPQIAKGYGDAPVQ
FT                   AYIAAMPGWKRAVGERLDAIVERTVPGVYKAVKWNSPFYGFEGEGWFLSFHCMTKYIKV
FT                   AFFRGASLQPLPPGASKQKDVRYLDIYEDAPFDEARFADWVAQASRLPGERM"
FT   CDS_pept        2062..3330
FT                   /transl_table=11
FT                   /locus_tag="BPP1295"
FT                   /product="putative peptidase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2595"
FT                   /db_xref="GOA:Q7WAS3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAS3"
FT                   /protein_id="CAE36597.1"
FT                   /translation="MREAMSKQAMLDAIEAEREVLIGFLQEFVRAASPNPPGDTRAAAA
FT                   VIQGFLSARGVPNELLGPQESMPNVVSECEGGRAGPRLVYNGHMDVFPVGDGHGWTRDP
FT                   WSGDIEEGRLHGRGTCDMKTGTAASVIAYAYLYARRAQLAGSVALTAVSDEETGGRWGT
FT                   RWLLENDTRWRGDCVLNGEPSSLDTIRFSEKGTLRLKFEVLAAGAHGAYVHRSESPTRI
FT                   AAALIGRLAEVEAIEPSLPAALKAHLQREDVRRALDVAMGEGAADVVTRTTLNVGVLNG
FT                   GLKINMIPDRCVFEVDIRLPVGTEPDVVLARLEGILAEFPQASMEVQQWHSTPPNVCAH
FT                   DHPMVDFIADNAQAIVGRRPVAVPSIGSTDCRYWRRSGVPAYVYGPAPGRMAMSNESVD
FT                   LDEFIAVAKVHAAAGWDYLNGAA"
FT   misc_feature    2134..3165
FT                   /note="HMMPfam hit to PF01546, Peptidase family
FT                   M20/M25/M40, score 1.4e-48"
FT   CDS_pept        3367..4881
FT                   /transl_table=11
FT                   /locus_tag="BPP1296"
FT                   /product="ABC transport protein, solute binding component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2594"
FT                   /db_xref="GOA:Q7WAS2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAS2"
FT                   /protein_id="CAE36598.1"
FT                   /translation="MMSKTGKMAAALAALCLSVGLAGAARAESTLQVALFTSLNSLDPN
FT                   VTTLGEEYVFNGLVFGGLTRIDANSKVVPDLAVSWTPSADLREWTFKLRPGVKFHHGKP
FT                   LTASDVVFSFQRIVDPATGSPGRTQLEVMKSVDAPDDATVHFTLTQPYADFPGLLTGRQ
FT                   LRVVAQDRIDTIKTQPSGTGPFRFVRYTPGDQLELERNPDYYDKDRIKIDRVVMRVMPE
FT                   AAARVAALRSGSIDMIWNLPLETIPDLKKDAAVVVDSVPSASWDGIVLNNSKPPFNDVR
FT                   VRRAVFLALDKKELVNFALFGEGSPTHSPIAPTDPAFNKDIGFAPDLAQAKQLLAEAGY
FT                   AKGFAVDIFVPAGRPSRERLGVAAQQLLRPLGIKLNVQRVPYNRYSAGVAGIAPMYVDG
FT                   FFASPVIDAATSPWFYSTGSWNARMWHFSSKRVDQALDAARASTDRAEQIRHYQDFQRA
FT                   LTEEVPGVIGYVTNVATAYRADIKNYHTNPFLWLDLYDVEKTGGAR"
FT   misc_feature    3367..3447
FT                   /note="Signal peptide predicted for BPP1296 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.916 between residues 27 and 28"
FT   misc_feature    3388..4863
FT                   /note="HMMPfam hit to PF00496, Bacterial extracellular
FT                   solute-binding proteins, family 5, score 1.3e-72"
FT   misc_feature    4795..4845
FT                   /note="PS00179 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 1."
FT   CDS_pept        4885..5844
FT                   /transl_table=11
FT                   /locus_tag="BPP1297"
FT                   /product="ABC transport protein inner membrane component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2593"
FT                   /db_xref="GOA:Q7WAS1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAS1"
FT                   /protein_id="CAE36599.1"
FT                   /translation="MWAYLVRRLGHVVFVVAAMAVLIFLITQAMPGNVAYTIAGHFASP
FT                   EQVAAIEARLGLNDPLWTQFWRWAGAALHGDMGQSLVMGRPVGPLISAALGRSALLAVA
FT                   ALVLTAALGIFLGVVAAVRHGRWQDRLILAFSWLSISLPQFLIAIVLVLLVAGTLGWLP
FT                   ATGYVELSAGFGAWLSHLVMPVCTLVLGLVAHVTSLQRSSMLETLSAPYVRAARAKGLR
FT                   ERTVLYRHALRNALIPTVTVLALDFGILMGGIVVVETVFSYPGLGRLLIFAVEQKDLPV
FT                   LQAGVLAVTVIYALANLAADIAYAILDPRIRYGNLDTH"
FT   misc_feature    4885..4971
FT                   /note="Signal peptide predicted for BPP1297 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.903) with cleavage site
FT                   probability 0.836 between residues 29 and 30"
FT   misc_feature    join(4909..4977,5182..5250,5287..5355,5398..5466,
FT                   5587..5655,5737..5805)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPP1297 by TMHMM2.0 at aa 9-31, 100-122, 135-157, 172-194,
FT                   235-257 and 285-307"
FT   misc_feature    5494..5727
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 2.9e-06"
FT   misc_feature    5497..5583
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        join(5873..6364,6363..6674)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1298"
FT                   /product="ABC transport protein inner membrane component
FT                   (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2592"
FT                   /db_xref="PSEUDO:CAE36600.1"
FT   misc_feature    5873..5929
FT                   /note="Signal peptide predicted for BPP1298 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.927) with cleavage site
FT                   probability 0.886 between residues 19 and 20"
FT   misc_feature    join(5876..5944,6077..6145,6164..6232,6260..6313,
FT                   6434..6502,6560..6628)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPP1298 by TMHMM2.0 at aa 2-24, 69-91, 98-120, 130-147,
FT                   188-210 and 230-252"
FT   misc_feature    join(6317..6364,6363..6545)
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 0.0062"
FT   variation       6356..6363
FT                   /note="(CG)4 in parapertusis; (CG)5 in pertussis"
FT   CDS_pept        6676..8310
FT                   /transl_table=11
FT                   /locus_tag="BPP1299"
FT                   /product="ABC transport protein, ATP-binding component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2591"
FT                   /db_xref="GOA:Q7WAS0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAS0"
FT                   /protein_id="CAE36601.1"
FT                   /translation="MHQDTILNIKGLEVRYGRNQVLHGVDLELPRGASLGIVGESGSGK
FT                   STIAWTVLGLLPPGAAVTAGSVAFDGEDITGERAAGLRGDRIAMVFQDPFTALNPSLPV
FT                   GRQITEALVERGRADARSARAEALRLMDEVRLPRASTLLDAYPHQLSGGMKQRIVIATA
FT                   LACSPDLLLLDEPTTALDVTVEARILDLLDELRVQRGLSMVFISHNIGLVERMCSRVTV
FT                   MHGGRVQEAGAAQQVLWHPAHAYTRKLLAALPLLEKRAPAVPAVGAPIARVRDVRLTFR
FT                   PAHPLGGWARLLRLPRAEGVAALAGVSLELRPREVVGLVGESGSGKSTLGRCLVGLQAP
FT                   DAGTVELSDHDVYRASPEVARRLRRQSQMVFQNPDSSLNPRQRVGEVLRRLLQLMGLDR
FT                   RQQDRRMDELLDLVRLPAAYAERYPHQLSGGEKQRVGIARTLALEPSVLVCDEATSALD
FT                   VSVQASILELLKDLRDRLGVAMLFISHDLAVVSQISDRVVVMRHGAIVEQGRTDQVLSA
FT                   PAHEYTRLLLDSVPAFVARRAREAAVA"
FT   misc_feature    6769..7353
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.9e-57"
FT   misc_feature    6790..6813
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    7123..7167
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    7615..8184
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   4.2e-62"
FT   misc_feature    7636..7659
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    7954..7998
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        8394..9455
FT                   /transl_table=11
FT                   /locus_tag="BPP1300"
FT                   /product="putative LacI-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2590"
FT                   /db_xref="GOA:Q7WAR9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAR9"
FT                   /protein_id="CAE36602.1"
FT                   /translation="MTTKATGNRKVVKIVDVAKAANVSPAVVSRILSNDSKLVVREETR
FT                   ARVQQAIEALGYTPNLQARGLRLSRSNTLAMIVPELNSPVFPVIIQGAQRAAWERGYSL
FT                   LVGGMGGEEEDPKVAGRLLRSNRIDGLLVTTGRHEAQMLQELATLNAPFVLVNRYLDDQ
FT                   HPYVELDERGAAAAITRHFIELGHRRIAFLGGLQRRVGERRVAGYADALAEAGLPWVPQ
FT                   LVVDAGYYKPGGEDGLRQLLALDEPPTAVVATNEIVAAGAMAAAHRQGVRIPRDLSIAS
FT                   FSDGIVAELLSPALTAVRFPLERMGYLATAMLVDIVEGRGAPQAGLCLPHESVVVRDST
FT                   ARPPGRKARAATR"
FT   misc_feature    8421..8504
FT                   /note="HMMPfam hit to PF00356, Bacterial regulatory
FT                   proteins, lacI family, score 2.1e-05"
FT   misc_feature    8604..9404
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar binding domain of the LacI family, score 6.7e-23"
FT   CDS_pept        9927..10451
FT                   /transl_table=11
FT                   /locus_tag="BPP1301"
FT                   /product="putative DNA-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2589"
FT                   /db_xref="GOA:Q7WAR8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAR8"
FT                   /protein_id="CAE36603.1"
FT                   /translation="MEYLFTLKYQLADADSDLDPLVERLGQAGCDDALVGMGLPGRLAL
FT                   EFTREADSAEAAVRSALADVRRAMPTAALIEAAPDLVGLTDVAQIVGVSRQNMRKLMLA
FT                   HPATFPAPIHEGSASLWHLADVLGWLQARGGYPLAQATLDVARMALKVNVAKEARRLPR
FT                   SAGAGLDALVG"
FT   CDS_pept        complement(10460..10918)
FT                   /transl_table=11
FT                   /locus_tag="BPP1302"
FT                   /product="putative regulatory protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2588"
FT                   /db_xref="GOA:Q7WAR7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAR7"
FT                   /protein_id="CAE36604.1"
FT                   /translation="MDIAEVARRTGVPASTLRYYDKVGLIAPVSPPGARRRYAPAVLEQ
FT                   LALVALGQAGGLSLDDIRAMLSPQGAPRVDRQVLLAKAEEIDATVKQLQAMSRGLRHAA
FT                   ACPAPSHAQCPTFRRLLKAAAAGALSRRRPASTGVAPRSPRKRAPARP"
FT   misc_feature    complement(10805..10909)
FT                   /note="HMMPfam hit to PF00376, Bacterial regulatory
FT                   proteins, merR family, score 1.5e-07"
FT   CDS_pept        11002..11496
FT                   /transl_table=11
FT                   /locus_tag="BPP1303"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Brucella melitensis hypothetical membrane
FT                   spanning protein Bmeii0616 SWALL:Q8YCB6 (EMBL:AE009697)
FT                   (162 aa) fasta scores: E(): 8.1e-18, 39.1% id in 156 aa,
FT                   and to Rhizobium loti hypothetical protein Mll7507
FT                   SWALL:Q985V9 (EMBL:AP003012) (167 aa) fasta scores: E():
FT                   1.7e-17, 39.49% id in 157 aa"
FT                   /db_xref="GOA:Q7WAR6"
FT                   /db_xref="InterPro:IPR021329"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAR6"
FT                   /protein_id="CAE36605.1"
FT                   /translation="MAPQEMLARVVLVGMGATAVMDVWTMALRRLGVPVLDYALAGRWA
FT                   GHWRHGRFAHADIRQAPAVRGEAALGWGLHYATGVLFAGLLVGVAGQAWLRAPSPGPAL
FT                   AVGVATVLLPWFVMQPALGAGLASSRTPTPLRNCLRSVLVHAVFGLGLYLAGLALAWIG
FT                   R"
FT   misc_feature    join(11020..11085,11206..11274,11311..11379,11422..11490)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BPP1303 by TMHMM2.0 at aa 7-28, 69-91, 104-126 and 141-163"
FT   CDS_pept        complement(11537..12691)
FT                   /transl_table=11
FT                   /locus_tag="BPP1304"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Thermoplasma volcanium L-carnitine
FT                   dehydratase Tv1186 or Tvg1215416 SWALL:Q979H5
FT                   (EMBL:AP000995) (399 aa) fasta scores: E(): 1.6e-53, 39.08%
FT                   id in 371 aa, and to Rhizobium meliloti putative conserved
FT                   membrane-anchored protein Rb0848 or Smb21182 SWALL:Q92V66
FT                   (EMBL:AL603645) (394 aa) fasta scores: E(): 3.5e-50, 37.83%
FT                   id in 378 aa"
FT                   /db_xref="GOA:Q7WAR5"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAR5"
FT                   /protein_id="CAE36606.1"
FT                   /translation="MTGALQGLRVLDMGQWIAAPYCTAMLADFGAEVIKIEKPGGGDDQ
FT                   RHSSPFVDGQSAFFNLFNRNKHSVTIDLSTPAGRAQCRDLIGSADVLVENYRPGVMARL
FT                   GLDYATLHAEFPRLVYCSISGFGQSGPMRGEGGFDLVIQAMSGLAAQCGPTDGPAHRLP
FT                   IPIVDVSTALFATIGVLTALAARQQTGTGQLVDVALLDSALAMAPLEVADYLATGHNPE
FT                   RMGQASRNAAPYQIFRTQDGAIALGAASQGLWEKTCDLLDRPALKNDPRFADNTARLAH
FT                   RAVLAELVEQALATQPSEHWLARLREAGIPAGPVLSYADILRHPQVAAREMVRRPETAG
FT                   AATAATLASPIRLSDTPARFVSGAPALGAHNGLLASGTRTGPPA"
FT   misc_feature    complement(11921..12487)
FT                   /note="HMMPfam hit to PF02515, CAIB/BAIF family, score
FT                   1.5e-60"
FT   CDS_pept        complement(12688..13554)
FT                   /transl_table=11
FT                   /locus_tag="BPP1305"
FT                   /product="putative (R)-specific enoyl-CoA hydratase"
FT                   /note="Similar to Pseudomonas aeruginosa (R)-specific
FT                   enoyl-CoA hydratase Phaj2 or Pa1018 SWALL:Q9LBK1
FT                   (EMBL:AB040026) (288 aa) fasta scores: E(): 2.7e-41, 43.55%
FT                   id in 287 aa, and to Mycobacterium tuberculosis
FT                   hypothetical 30.2 kDa protein Ufaa2 or Rv3538 or Mt3642 or
FT                   Mtcy03c7.18C SWALL:P71863 (EMBL:Z82098) (286 aa) fasta
FT                   scores: E(): 8.9e-30, 38.94% id in 285 aa"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAR4"
FT                   /protein_id="CAE36607.1"
FT                   /translation="MNVQALLAHEFPVETQSYGARDCSLYALSAGYGQDPMDERQLQYV
FT                   YGDAPKTAGGMALVLANPGFWQRQPWTGIDWARCVLGEQRIATHRPLPAAGRIASQLRV
FT                   TRITDKGRQFGAMLHAERTLHDADNGTHYATLSMVTICRGDGGFGGPPDDSTRLPAVPA
FT                   RAPDIQTEQPTLPQQALLFDLHGIVNPVHSWPAAARQAGYPRPFLHGVCLMGLVQHAIA
FT                   RELAAYDTDGIATLSARFRGVFYPGETLLLSLWRDGDQVRYEAHAKERSTLAVEGSARL
FT                   QPAGAVQ"
FT   misc_feature    complement(12721..13086)
FT                   /note="HMMPfam hit to PF01575, MaoC like domain, score
FT                   1.5e-11"
FT   CDS_pept        complement(13568..14536)
FT                   /transl_table=11
FT                   /locus_tag="BPP1306"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Ra1058 or Sma1927 SWALL:Q92Y30 (EMBL:AE007292) (330 aa)
FT                   fasta scores: E(): 2.4e-48, 44.89% id in 323 aa, and to
FT                   Comamonas testosteroni OrfJ protein SWALL:Q9RHM9
FT                   (EMBL:AB029044) (326 aa) fasta scores: E(): 9.3e-39, 38.31%
FT                   id in 321 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAR3"
FT                   /protein_id="CAE36608.1"
FT                   /translation="MFCRKLALALGMAVSALSAGAAAAPYPAEPVRLVVPYAPGGTTDL
FT                   LARLIASKLSAKYERQVVVENKTGAGGNIAAGFLARSRPDGYTLMMASIGQFAINPLIF
FT                   SAPGYDAAKDFQPVIQVTRVPNVLVVNAASKLDSLQDLIKLAQAQPSVTYASSGNGSSN
FT                   HLAGALLAHMANIDMLHIPYKGSAPGLQALYGGDVQVMFDNLSSALPHVQGGKLRALGV
FT                   SSETRFSKLPDVPTIAESGLPGYEASAWFGLVAPAGTPAAIVEQLNRDVAAVLADNDVR
FT                   SKLLEMGMTPQGGSVAQFQAVIDADIQKWKPIVQSLNLAVN"
FT   misc_feature    complement(13580..14401)
FT                   /note="HMMPfam hit to PF03401, Uncharacterized protein
FT                   family, UPF0065, score 3.6e-109"
FT   misc_feature    complement(14468..14536)
FT                   /note="Signal peptide predicted for BPP1306 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.848 between residues 23 and 24"
FT   CDS_pept        complement(14562..15305)
FT                   /transl_table=11
FT                   /locus_tag="BPP1307"
FT                   /product="probable GntR-family transcriptional regulator"
FT                   /note="Similar to Deinococcus radiodurans transcriptional
FT                   regulator, GntR family Dra0211 SWALL:Q9RYU6 (EMBL:AE001863)
FT                   (279 aa) fasta scores: E(): 3e-12, 32.91% id in 237 aa, and
FT                   to Ralstonia solanacearum putative DNA-binding
FT                   transcriptional regulator Rsp0079 or Rs05542 SWALL:Q8XTM7
FT                   (EMBL:AL646076) (273 aa) fasta scores: E(): 5.5e-11, 30.9%
FT                   id in 220 aa"
FT                   /db_xref="GOA:Q7WAR2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAR2"
FT                   /protein_id="CAE36609.1"
FT                   /translation="MATVKDDLLASGSNKRYVNLAHLLRMRIRAGDYRPGDRLPAIDQL
FT                   ARQFNTAVVTARQALALLERNGLVQRRQGVGTFVLDDAVAPVGLELPLDQDWSGIRALW
FT                   GASQVRILAERDRVECPADYAQHGQPADAYFYMRRVHEAQGIPYTVADIYIDREVYRKA
FT                   PKRFRHEIALHVLPQLLPQRKLEAFEMIQVDAADVELAKWLDIAVGAPVVIMKRVVRDE
FT                   SGRIIYAGTPVYRGDIVRLDRTFKL"
FT   misc_feature    complement(15069..15248)
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 1.7e-18"
FT   CDS_pept        complement(15487..16476)
FT                   /transl_table=11
FT                   /locus_tag="BPP1308"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Ra1058 or Sma1927 SWALL:Q92Y30 (EMBL:AE007292) (330 aa)
FT                   fasta scores: E(): 1.5e-43, 42.03% id in 314 aa, and to
FT                   Comamonas testosteroni OrfJ protein SWALL:Q9RHM9
FT                   (EMBL:AB029044) (326 aa) fasta scores: E(): 9.3e-40, 39.51%
FT                   id in 329 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAR1"
FT                   /protein_id="CAE36610.1"
FT                   /translation="MQPRLTALHSALAALALCLPAGQAHAQADAAYPARPITLIVPFSA
FT                   GGGSDVVARILATGLGSQLKQTVIVENRTGAAGNIGAEAVARARPDGYTLLFGSMGVMS
FT                   VNSHLYRNMPLQPERDLAPVGRIYDTPHVIVVGQQSTLKSLPQLIEQAKARPDALTYAS
FT                   AGNGTSTHLVGALFMHETGTRLMHVPYKGNAPALNDTMAGHVDMMFDQATNSTGQIQAA
FT                   RLRALAATSHARIPDLPDVPTVAELGYPELEVTSWTVLAAPKATPAAAMATLSTALKKT
FT                   LADPAIKEKIRQTGGVINYQDLPSTTEFVNRETARWGALIQSAGITAN"
FT   misc_feature    complement(15499..16323)
FT                   /note="HMMPfam hit to PF03401, Uncharacterized protein
FT                   family, UPF0065, score 1e-114"
FT   misc_feature    complement(16399..16476)
FT                   /note="Signal peptide predicted for BPP1308 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.995 between residues 26 and 27"
FT   CDS_pept        complement(16512..17582)
FT                   /transl_table=11
FT                   /locus_tag="BPP1309"
FT                   /product="putative malate/L-lactate dehydrogenase"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   oxidoreductase Pa1252 SWALL:YC52_PSEAE (SWALL:Q9I492) (334
FT                   aa) fasta scores: E(): 3.1e-38, 39.03% id in 333 aa, and to
FT                   Agrobacterium tumefaciens malate dehydrogenase Mdh or
FT                   Atu0164 or Agr_c_268 SWALL:AAL41188 (EMBL:AE008990) (346
FT                   aa) fasta scores: E(): 3.4e-37, 36.73% id in 343 aa"
FT                   /db_xref="GOA:Q7WAR0"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAR0"
FT                   /protein_id="CAE36611.1"
FT                   /translation="MTISPAASHDELAGHLARCADTGAPCRLSADQLAALLARLFERAG
FT                   ASAATAAVLAQTCALAEQDEARSHGLHRVAGYVATLGTDWVDGHAEPAVIDASGATIIV
FT                   DARNGFAQCALRAARPLIEERVRQHGLAVLLTRNSHHFGALWLDVEPYARQQWIALTAV
FT                   NSISHMAPHGGTTPLYGTNPMAFACPRAGADPLVFDQASSVMAKGDVQLAAQHGHTLPP
FT                   DAGVDRHGQPTRDPAAVLDGGALLPFGGHKGSAIAMMVEVLAAALTGGSFSWEVDRSAH
FT                   PTAQTSRTGQFFLCIDPARSAGHGFAARIDQLAQALLRSGQQRLPGERRYAARRLAAQH
FT                   GIAIDPAALLALLRLA"
FT   misc_feature    complement(16518..17507)
FT                   /note="HMMPfam hit to PF02615, Malate/L-lactate
FT                   dehydrogenase, score 7.9e-51"
FT   CDS_pept        complement(17594..18784)
FT                   /transl_table=11
FT                   /locus_tag="BPP1310"
FT                   /product="putative FAD dependent oxidoreductase"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   transmembrane protein Rsp1590 or Rs02147 SWALL:Q8XPP8
FT                   (EMBL:AL646085) (398 aa) fasta scores: E(): 6.5e-50, 37.72%
FT                   id in 387 aa, and to Rhizobium loti hypothetical protein
FT                   Mll4416 SWALL:Q98E45 (EMBL:AP003004) (388 aa) fasta scores:
FT                   E(): 2e-42, 34.52% id in 391 aa"
FT                   /db_xref="GOA:Q7WAQ9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ9"
FT                   /protein_id="CAE36612.1"
FT                   /translation="MQAMNQPQVQQYDIVIIGGGIIGSSVAYHVLARDPAARVCVVEPD
FT                   PSYEFASALRSSGGCRVQFTCPENIAMSLYSLDVIKNFENTMAANGRPAPVDWVQGGYL
FT                   FLVPPERVAMLERNVARQQAMGCQVDLLTPAELKARFPSIHVDDLGAGAHTPQDGWCDP
FT                   NGLLWGFRRKAVELGAVYLKDRVVAADVTPARARRVTLESGAQLDAEAFVNAAGAWSGQ
FT                   VAELFGMHLPVVPMRRFEHYFTCGNPIEPLPYVKDLSRLAFRSEGRGFSGGLVNGDENR
FT                   GFNFDVDHDYFENVVWPAVAHHFPPLEAAKCHRTWSGLYEQNELDGNPVIGAWNVRLKN
FT                   LYTVAGFSGHGMMHAPAAGRGIAELLVHGAFQSLDLSKLGYERVQASQPYREEGIL"
FT   misc_feature    complement(17672..18751)
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 0.0055"
FT   CDS_pept        18896..19690
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="BPP1311"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="Similar to Pseudomonas aeruginosa
FT                   pyrroline-5-carboxylate reductase ProC or Pa0393
FT                   SWALL:PROC_PSEAE (SWALL:P22008) (272 aa) fasta scores: E():
FT                   1.2e-27, 45.45% id in 264 aa, and to Caulobacter crescentus
FT                   pyrroline-5-carboxylate reductase Cc0494 SWALL:Q9AAU9
FT                   (EMBL:AE005722) (260 aa) fasta scores: E(): 1.2e-23, 43.56%
FT                   id in 264 aa"
FT                   /db_xref="GOA:Q7WAQ8"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ8"
FT                   /protein_id="CAE36613.1"
FT                   /translation="MRQALFLGYGRMGAALGEAWLRAGLLAGIDAVDPGRDGAGLRARL
FT                   VRGADELPEQAYDLVVLAVKPAMAQQALRPVPPARLARACLVSIMAGVPAGALRQALQP
FT                   PRPVARAMPNTPVMAGQGCTGLYGGDDVAPAQRAAIGRLFEAVGAAFWVDTEDQLHAVT
FT                   ALSGSGPAYYHLFSEALAQAGEQLGLPAALARSLAARTALGAASLQCEEGADFAALRRE
FT                   VTSPHGTTHAAIEVFEQAGALRTLVRDAVRQAQARSRELARP"
FT   misc_feature    18896..19630
FT                   /note="HMMPfam hit to PF01089, Delta
FT                   1-pyrroline-5-carboxylate reductase, score 4.9e-54"
FT   CDS_pept        complement(19706..20359)
FT                   /transl_table=11
FT                   /locus_tag="BPP1312"
FT                   /product="probable GntR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator Pa1269 SWALL:Q9I475
FT                   (EMBL:AE004556) (222 aa) fasta scores: E(): 6.3e-24, 41.17%
FT                   id in 204 aa, and to Rhizobium loti transcriptional
FT                   regulator Mlr7144 SWALL:Q986Z8 (EMBL:AP003011) (253 aa)
FT                   fasta scores: E(): 1.9e-18, 37.43% id in 203 aa"
FT                   /db_xref="GOA:Q7WAQ7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ7"
FT                   /protein_id="CAE36614.1"
FT                   /translation="MTNANAGPLTLTADGVTDELRALILDGSLGIGVQLKQEVLAKRFG
FT                   VSRIPVREALKRLEAEGLVTHAPHQGSVVASRSVQELLETLDIRVGLESRALVLAIPHM
FT                   TPAVFKEAETIIARYDASEFPREWSELNLEFHMCLYRPSGRPRLLKTIENLVRGIDIHL
FT                   RAHQSYAVGRKSPQNEHRAILDACIAGKAKRARDLLEAHIEHTQDVLRKEHGLI"
FT   misc_feature    complement(20138..20314)
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 2.7e-12"
FT   CDS_pept        20580..21056
FT                   /transl_table=11
FT                   /locus_tag="BPP1313"
FT                   /product="putative phage-related protein"
FT                   /note="Similar to Bacteriophage T4 hypothetical 17.1 kDa
FT                   protein in gp30-riiI intergenic region Y12g or 30.3
FT                   SWALL:Y12G_BPT4 (SWALL:P32276) (152 aa) fasta scores: E():
FT                   6.3e-07, 32.66% id in 150 aa, and to Bacteriophage RB69
FT                   Gp30.3 30.3 SWALL:CAD28421 (EMBL:AJ439452) (137 aa) fasta
FT                   scores: E(): 5.1e-06, 33.62% id in 113 aa"
FT                   /db_xref="InterPro:IPR012596"
FT                   /db_xref="InterPro:IPR012816"
FT                   /db_xref="InterPro:IPR037238"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ6"
FT                   /protein_id="CAE36615.1"
FT                   /translation="MNSASRLNISSTSDDWRGLALSNFPLSPFVLDGELFASVEGFIQG
FT                   IKFREDDPRRATAFLSSGWDAKHLGDTVDRSGAYWGGARIRYGSAEHHQLIERAIRARI
FT                   KQCEGLRRTLRATEGMTLVHDTGKPEAPHTSLPATVFCRILETLRREILARARP"
FT   CDS_pept        complement(join(21066..21608,21607..22533))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1314"
FT                   /product="probable outer membrane efflux protein
FT                   (Pseudogene)"
FT                   /note="Similar to Pseudomonas putida TrpC SWALL:AAL95702
FT                   (EMBL:AF360362) (484 aa) fasta scores: E(): 8.5e-47, 40.2%
FT                   id in 490 aa, and to Pseudomonas aeruginosa probable outer
FT                   membrane protein Pa2837 SWALL:Q9I006 (EMBL:AE004710) (479
FT                   aa) fasta scores: E(): 7e-54, 42.85% id in 490 aa"
FT                   /db_xref="PSEUDO:CAE36616.1"
FT   misc_feature    complement(join(21074..21608,21607..21618))
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein, score 4.1e-25"
FT   misc_feature    complement(21673..22323)
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein, score 2.7e-22"
FT   misc_feature    complement(22468..22533)
FT                   /note="Signal peptide predicted for BPP1314 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.629 between residues 22 and 23"
FT   misc_feature    complement(22486..22518)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(join(22548..22733,22736..23650))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1315"
FT                   /product="putative membrane protein (Pseudogene)"
FT                   /note="Similar to Salmonella typhi putative inner membrane
FT                   protein Sty0850 SWALL:Q8Z881 (EMBL:AL627268) (368 aa) fasta
FT                   scores: E(): 1.2e-51, 42.12% id in 368 aa, and to
FT                   Escherichia coli hypothetical protein YbhR or B0792 or
FT                   Z1012 or Ecs0870 SWALL:YBHR_ECOLI (SWALL:P75774) (368 aa)
FT                   fasta scores: E(): 1e-51, 41.03% id in 368 aa"
FT                   /db_xref="PSEUDO:CAE36617.1"
FT   misc_feature    complement(join(22568..22633,22739..22804,22826..22891,
FT                   22937..23002,23066..23131))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BPP1315 by TMHMM2.0 at aa 180-202, 223-245, 260-282,
FT                   289-311 and 346-368"
FT   CDS_pept        complement(23678..24817)
FT                   /transl_table=11
FT                   /locus_tag="BPP1316"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Rhizobium meliloti putative ABC
FT                   transporter permease protein Rb0871 or Smb21205
FT                   SWALL:Q92V46 (EMBL:AL603645) (384 aa) fasta scores: E():
FT                   3.7e-57, 45.23% id in 367 aa, and to uncultured bacterium
FT                   pCosFS1 ElsD SWALL:Q9APR7 (EMBL:AF250767) (384 aa) fasta
FT                   scores: E(): 2.4e-50, 40.1% id in 374 aa"
FT                   /db_xref="GOA:Q7WAQ5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ5"
FT                   /protein_id="CAE36618.1"
FT                   /translation="MSPRAGAGGFWPRLASLVRKEFRQLLRDRSNLAIGLVLPILLILI
FT                   FGYGLSLDLRNAPIAVVLEDRSPQARDALAGLAGSDYLAPVWLADMHSAETLMRRHEVE
FT                   GIVRVPADFARRLAAGDAQVQLLLHGADANSAAALARYVDGALGHAARLRADRAGHAAP
FT                   PPGVTMVERLWFNAANTSTWYLVPGLIALIMTLVGAFLTALVVAREWERGTLEALFVTP
FT                   VRPTEILLAKMIPYFVVGMLELGLCLAAARLLFHVPLQGSLAVLLLSAMLYLVVALGIG
FT                   LLISATTRNQFLASQVAVLSSFLPALMLSGFLFDLRNVPAAIRFVGSLLPATYFMELVK
FT                   TAFLAGDNWPLIARNCAILAVYAVALLALARRLTRKSLD"
FT   misc_feature    complement(join(23708..23764,23876..23941,23963..24028,
FT                   24068..24133,24197..24262,24662..24727))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPP1316 by TMHMM2.0 at aa 30-52, 185-207, 228-250, 263-285,
FT                   292-314 and 351-370"
FT   CDS_pept        complement(join(24814..25401,25403..26563))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1317"
FT                   /product="probable ABC transporter ATP-binding protein
FT                   (Pseudogene)"
FT                   /note="Similar to Salmonella typhi hypothetical ABC
FT                   transporter ATP-binding protein YbhF or Sty0852
FT                   SWALL:Q8Z880 (EMBL:AL627268) (578 aa) fasta scores: E():
FT                   1.3e-74, 47.33% id in 581 aa, and to Rhizobium meliloti
FT                   putative ABC transporter ATP-binding protein, consisting of
FT                   2 fused ATP-binding domains Rb0872 or Smb21206 SWALL:Q92V45
FT                   (EMBL:AL603645) (582 aa) fasta scores: E(): 4.6e-69, 49.65%
FT                   id in 584 aa"
FT                   /db_xref="PSEUDO:CAE36619.1"
FT   misc_feature    complement(join(24943..25401,25403..25474))
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.1e-48"
FT   misc_feature    complement(25430..25453)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(25925..26470)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2.5e-57"
FT   misc_feature    complement(26108..26152)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(26426..26449)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(26560..27573)
FT                   /transl_table=11
FT                   /locus_tag="BPP1318"
FT                   /product="putative HlyD-family secretion protein"
FT                   /note="Similar to Thiobacillus ferrooxidans hypothetical
FT                   protein in asrC 5'region SWALL:Q9L9D4 (EMBL:AF173880) (338
FT                   aa) fasta scores: E(): 2.4e-41, 46.36% id in 330 aa, and to
FT                   Rhizobium meliloti hypothetical membrane protein Rb0873 or
FT                   Smb21207 SWALL:Q92V44 (EMBL:AL603645) (334 aa) fasta
FT                   scores: E(): 2.3e-38, 44.24% id in 339 aa"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ4"
FT                   /protein_id="CAE36620.1"
FT                   /translation="MKKPLIAAAAAIALAIAGAAWWLTRAQPPDDILTLYGNVDIRQVA
FT                   LAFDNSERIADMQVEEGDRVRAGQVLARQETRTLQLEAERAQARASAQEQALLRLRNGS
FT                   RPQEIAQARARADAATADAALAQQDLQRLQGTARATDGRAVSRQDIDRAAARLRVARAQ
FT                   AETQAKALQLALLGPRDEDIAEAAAQWQASLAELALLRHRLAQAELKAPTDAVVRARLL
FT                   EPGDMASPQRPVYTLALTEPKWVRAYLSEPDLGRVRPGMRARVYTDSQPDRAIDGQVGY
FT                   ISSVAEFTPKTVQTETLRTSLVYEIRIRVDDPQDRLRLGMPATVRLDLADAAEPGA"
FT   misc_feature    complement(26593..27450)
FT                   /note="HMMPfam hit to PF00529, HlyD family secretion
FT                   protein, score 0.00076"
FT   misc_feature    complement(26953..26997)
FT                   /note="PS00579 Ribosomal protein L29 signature."
FT   misc_feature    complement(27502..27558)
FT                   /note="1 probable transmembrane helix predicted for BPP1318
FT                   by TMHMM2.0 at aa 5-24"
FT   misc_feature    complement(27517..27573)
FT                   /note="Signal peptide predicted for BPP1318 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.669 between residues 19 and 20"
FT   CDS_pept        27692..28339
FT                   /transl_table=11
FT                   /locus_tag="BPP1319"
FT                   /product="putative TetR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas fluorescens PhlH SWALL:Q9RF00
FT                   (EMBL:AF207529) (223 aa) fasta scores: E(): 5e-29, 43.75%
FT                   id in 208 aa, and to Rhizobium meliloti putative
FT                   transcriptional regulator, TetR family protein Rb0874 or
FT                   Smb21208 SWALL:Q92V43 (EMBL:AL603645) (225 aa) fasta
FT                   scores: E(): 6.7e-05, 25.11% id in 227 aa"
FT                   /db_xref="GOA:Q7WAQ3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ3"
FT                   /protein_id="CAE36621.1"
FT                   /translation="MTRPRRSLRADGASTRARILEAAGQLFGQYGYAGVASKAICAAAG
FT                   ADLAAINYHFGSRDGLYRAVLVEGHKHFINLDTLTALTQSDLSPREKLCAFIDGMVAGL
FT                   WEQDWHTRVCAREVLAPSAHFAALIDEEVLPKFRLVAGILGDITGFAPGDPALARCAVS
FT                   IVAPCMMLMVVDRNAPSPPQQVLAQPAADLAEHLKRFALAGLDAVSAAAPRR"
FT   misc_feature    27746..27886
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 4.8e-11"
FT   CDS_pept        28399..30159
FT                   /transl_table=11
FT                   /locus_tag="BPP1320"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ2"
FT                   /protein_id="CAE36622.1"
FT                   /translation="MAKEAYTVGPVLSFRGVGGARQWRVSALIGVPRTAKAPALRVEGR
FT                   ACAAPVVLHQTARETFLRYDLSCDMQARERKVEFGPRGGPAWHFTVPAKGAAPRLAYVS
FT                   CNGFSDPSGMRKLVRPENAVWADLLCNHDRDLRPADYLLDKEQLWHETRTHDEGLQRFH
FT                   LLLMGGDQIYFDSIWEYIAALKQWVGLARAQQLEFKVSQALEDEIEAYYFGLYSRRWLP
FT                   PSRAPWAGAQPSLDAADAMARVPTIMMWDDHDIFDGWGSYSPAMQRCELFQTLFRHARR
FT                   AFWVFQMQHALADLPPLQAIARANVLPQDPQYEGIAWSRQLKRDRLALPLLDGQPGFTS
FT                   AYRLGPLALVAADLRTERSRTQILGTQAWTALQGWLHGLKGNRPASATGGCRHLIFMSS
FT                   VPVAHLKLSLAEGLLDTFGQDHVLDSNADDLKDHWSHDDHEGERKRLLETLMQVANEKL
FT                   LRVSIASGDVHVAAWGNAYRRDIPPTSNWAQIQQFTSSAVVHPSLLGVAERLFLFMLNG
FT                   TAAQAQPIDVNLSVEMMLFPGHNRYVMPARNWLAFELDAGKAGKLWASWRCETETGFSN
FT                   HLQAVQPAQG"
FT   misc_feature    29557..29589
FT                   /note="PS00626 Regulator of chromosome condensation (RCC1)
FT                   signature 2."
FT   CDS_pept        complement(30160..31005)
FT                   /transl_table=11
FT                   /locus_tag="BPP1321"
FT                   /product="putative aldo/keto reductase-family protein"
FT                   /note="Similar to Rhizobium meliloti putative
FT                   oxidoreductase protein R02112 or Smc01429 SWALL:Q92NR7
FT                   (EMBL:AL591789) (281 aa) fasta scores: E(): 1.2e-47, 54.21%
FT                   id in 273 aa, and to Agrobacterium tumefaciens aldo/keto
FT                   reductase Atu2032 or Agr_c_3682 SWALL:AAL43024
FT                   (EMBL:AE009154) (281 aa) fasta scores: E(): 1.5e-45, 51.47%
FT                   id in 272 aa"
FT                   /db_xref="GOA:Q7WAQ1"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ1"
FT                   /protein_id="CAE36623.1"
FT                   /translation="MKQHRFGATDRIVAAIGQGTWNLDNSARASAVDALRNGLDLGMAH
FT                   IDTAEMYGAGAAERLVGEAIAGRRDQVFLVSKVLPENASRAGTRAACERSLRRLGTDHL
FT                   DCYLLHWRGAHPLEETFAAFDALQREGKIRSYGVSNFDVDDLQEAQDIVGPGKLACNQV
FT                   LYHLRERAIEHAVMPWCAAHGVAVVAYSPFGHDDFPAPASAGGRVLARIAQAHGATPRQ
FT                   IALAFLTRQPGVFAIPKAADPAHVAANAAAGRLALSEQDCADLDAAFERGPRPASLPMI
FT                   "
FT   misc_feature    complement(30190..30984)
FT                   /note="HMMPfam hit to PF00248, Aldo/keto reductase family,
FT                   score 1.2e-64"
FT   CDS_pept        complement(31048..32916)
FT                   /transl_table=11
FT                   /locus_tag="BPP1322"
FT                   /product="putative sigma-54-dependent transcriptional
FT                   regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2158"
FT                   /db_xref="GOA:Q7WAQ0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ0"
FT                   /protein_id="CAE36624.1"
FT                   /translation="MPGYQLSASGQHLPSTQAAAPIVRSWERCASATADLHDDPVALRH
FT                   GDLQERLEQHACVLRAAQPEIETLAGMVASASSLVLLADASGVILQASGNTGFLQRADH
FT                   MALRPGVSWAENHRGTNAIGTALIEAAALRVHGAEHFLRRNQILSCHAAPIRSPRGDIL
FT                   GVLDISGDAGRMHAYALSLASMCARQVANRVIEQAGERCLYLVFHKQASLLDSVERGLL
FT                   LIEDERIVGANDAAVALLGATWPALLDQPLDGWLVDWRAVARTPGRVHTPQGAPFHAVL
FT                   RQGGHARSLPAPPRPPRAVPAQAPEETLPALAPALQAGFERARRALDGGLSVLLQGETG
FT                   AGKEVYAQHLYRRSIWRDGPFVAVNCGALPESLIEAELFGYEPGAYTGARRLGARGRLR
FT                   EADGGVLFLDEIGDMPLALQTRLLRALQERMVQPLGADKAVPVNFGLVSATHRDLDAMI
FT                   AAGEFRADLYYRLHDYAVPLPRLRERDDLRPFICAALRALDDTPAGLTLADDALDALAA
FT                   YAWPGNYRQLRSVLRTLALFHPPGSLIHRHHLPAAIAAPAVHAADGAAPRPGVAAPPAA
FT                   PASLRDASLHRIDQALARHGGNIAGAAHELGIHRSTLYRHLARQRG"
FT   misc_feature    complement(31057..31179)
FT                   /note="HMMPfam hit to PF02954, Bacterial regulatory
FT                   protein, Fis family, score 3.5e-10"
FT   misc_feature    complement(31333..31992)
FT                   /note="HMMPfam hit to PF00158, Sigma-54 interaction domain,
FT                   score 5.1e-86"
FT   misc_feature    complement(31879..31920)
FT                   /note="PS00675 Sigma-54 interaction domain ATP-binding
FT                   region A signature."
FT   CDS_pept        33111..34703
FT                   /transl_table=11
FT                   /gene="acoD"
FT                   /locus_tag="BPP1323"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2157"
FT                   /db_xref="GOA:Q7WAP9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAP9"
FT                   /protein_id="CAE36625.1"
FT                   /translation="MRPPRDGKQSSRRHNDIRRQTMDLSDLKKLGLDVAYPFKEQYENY
FT                   IGGQWVPPVGAEYFDNLSPITGQPFCRVPRSGAADIELALDAAHRARAAWARTSPAERA
FT                   NILLRIADRIEGQLPMLAVAESIDNGKPLRETTAADLPLAIDHFRYFAGCIRAQEGAIS
FT                   EIDANTVAYHFHEPIGVVGQIIPWNFPLLMAAWKLAPALAAGCVVVLKPAEQTPASILV
FT                   LAELIGDLLPPGVLNVVNGYGKEAGQALATSKRIAKIAFTGSTPVGKHILHAAADNLIP
FT                   ATVELGGKNPNIFFDDVMDHDDEFLDKALEGLAMFALNQGEVCTCPSRILIQESIYERF
FT                   IEKAIARVQSIKTGHPLDAGTMVGAQVSQVQMDKILSYIDIGRQEGAQCLTGGARNDML
FT                   PGGLDQGFYVQPTMLLGKNSMRIFQEEIFGPVAAVATFKDEEEAIAMANDTFYGLGAGV
FT                   WSRDGARAYRVGRGIEAGRVWTNCYHLYPAHAAFGGYKQSGIGRETHKAALSNYQQTKC
FT                   LLVSYSAKALGFF"
FT   misc_feature    33255..34676
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
FT                   family, score 1.8e-227"
FT   misc_feature    33960..33983
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT   misc_feature    34059..34094
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT   CDS_pept        complement(34907..35557)
FT                   /transl_table=11
FT                   /locus_tag="BPP1324"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2156"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAP8"
FT                   /protein_id="CAE36626.1"
FT                   /translation="MDSSQVPNPVLVLVGSPRRDGNSALLAQAVAEGARQSGAVATLLF
FT                   LDDYIAGFLTDEKEADARRPDDRYGELFFDHFLPARAVVLCTPVYWYGMSAQAKAFFDR
FT                   SFTYYSASHPRHAEVLRRMTGKRLALAVSSEETYPGAALGIVHQLQEFTRYTHSQFVGM
FT                   VHGAGNRRGEVAHDPRRPLQAAHRLGHGLLSLPYSDYRIDSPRDHQVWPGAPA"
FT   CDS_pept        join(35689..36219,36218..36595)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1325"
FT                   /product="putative LysR-family transcriptional regulator
FT                   (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2154"
FT                   /db_xref="PSEUDO:CAE36627.1"
FT   misc_feature    35707..35886
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 1e-21"
FT   misc_feature    35749..35841
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    join(35950..36219,36218..36556)
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 1.2e-25"
FT   CDS_pept        36592..37887
FT                   /transl_table=11
FT                   /locus_tag="BPP1326"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2153"
FT                   /db_xref="GOA:Q7WAP7"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAP7"
FT                   /protein_id="CAE36628.1"
FT                   /translation="MSAPADPRLAQLRRMQRWALALLAAMIAGFVASHLMGGQGAWAWV
FT                   RAFCEAATVGALADWFAVVALFRRPLGLPIPHTAIIPANKARIGDNLAVFVRDHFLDPA
FT                   TLLEKLRVFDPAARLGHWLADPRQTRSLGQGARQVALQALDLLDEQAVSRAIQGFAVAQ
FT                   LRRWDAARTAGEVLALLTRDGRHQELLDAALRRLGDYLGEEDIRQRACALLVKFARKEW
FT                   PRIIAAVDVIGSVEGIADNLADRMARALVDELRDVLSRPDHPVRRNYEAWVADYIARLR
FT                   DDPELAGQVEALKQRLIDDPRVQEYALGLWRDIHAVLRRDLQAEDSALARHLEDALQAL
FT                   GQRLSRDPELRRAVNEHVLDSARKLTDSLRSGVTEHISRTVKNWDERHLVRELELSVGR
FT                   DLQYIRFNGTLVGGLIGLALHAGVLLVQRAGG"
FT   misc_feature    36592..36720
FT                   /note="Signal peptide predicted for BPP1326 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.964) with cleavage site
FT                   probability 0.379 between residues 43 and 44"
FT   misc_feature    36649..36717
FT                   /note="1 probable transmembrane helix predicted for BPP1326
FT                   by TMHMM2.0 at aa 20-42"
FT   CDS_pept        complement(37909..38793)
FT                   /transl_table=11
FT                   /locus_tag="BPP1327"
FT                   /product="putative lysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2152"
FT                   /db_xref="GOA:Q7WAP6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAP6"
FT                   /protein_id="CAE36629.1"
FT                   /translation="MSRNIDTALLRAFLAVHDTGSLTAAAALLHLTQGAVSQQLQRLEA
FT                   LFGRTLLERRRSGAALTGDGARLLGRAREMVRINDELMQHMTGADCVGAVRLGVPHDLI
FT                   GTHLPGLLRAYSLRYPDVDISLISATSPELLEQVRRRKLDLTLAEEPIGAAAGGERLAV
FT                   DRVVWLAAPGGQAWRKNPLPVSLVSDACAFRPVLADALDGGRIPWRSVFENGNADATLT
FT                   TVRLDLAVTASLLSVAPADLQVLDAASGLPALPDYAINLYIAPGERSQAVEEMAHHIRQ
FT                   AYQERRPAYAAAA"
FT   misc_feature    complement(37942..38532)
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 9.7e-20"
FT   misc_feature    complement(38596..38775)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 2.2e-16"
FT   misc_feature    complement(38641..38733)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(38716..38793)
FT                   /note="Signal peptide predicted for BPP1327 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.880) with cleavage site
FT                   probability 0.495 between residues 26 and 27"
FT   CDS_pept        38892..39767
FT                   /transl_table=11
FT                   /locus_tag="BPP1328"
FT                   /product="putative oxidoreductase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2151"
FT                   /db_xref="GOA:Q7WAP5"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAP5"
FT                   /protein_id="CAE36630.1"
FT                   /translation="MQTTTSLIASVRRIAAFSDGARGGNPAGVHVAEVLPDAMTMQQMA
FT                   AEIGYSETVFAAPAYGGWRVRYFAPEAEVPFCGHATIALGAVLAEQEGDGVFALTTNHA
FT                   NITVEGRRQGGLYSAALQSPRTRSAPLEAAVRDEALALFGYTPADLDSRLPPAYAEAGA
FT                   AHLILPLNSRERLAAMRYDLAAGRAFMKRTGVVTIAWVHAESATLLHARNAFAAGGVYE
FT                   DPATGAAAAALAGHLRDSGWLRAGAIEILQGFDMGVPARLRAEYGPEPGSSVRVAGTAR
FT                   ALARQPALID"
FT   misc_feature    38913..39758
FT                   /note="HMMPfam hit to PF02567, Phenazine biosynthesis-like
FT                   protein, score 2.7e-41"
FT   CDS_pept        complement(39757..40113)
FT                   /transl_table=11
FT                   /locus_tag="BPP1329"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2150"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAP4"
FT                   /protein_id="CAE36631.1"
FT                   /translation="MDQYVDGFLLSVPNDKLDTYRQMATKAGAIWKEHGALAYCECTGD
FT                   DLDIEGMVSFKTSAAAREGETVVFAWIVYPNRAERDRINAAVMADPRLKEQCVEGVFDF
FT                   KRMAYGGFKTLVNL"
FT   CDS_pept        join(40187..40402,40406..41218)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1330"
FT                   /product="putative AraC-family transcriptional regulator
FT                   (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2149"
FT                   /db_xref="PSEUDO:CAE36632.1"
FT   misc_feature    join(40259..40402,40406..40798)
FT                   /note="HMMPfam hit to PF01965, ThiJ/PfpI family, score
FT                   0.0088"
FT   variation       40403..40405
FT                   /note="In-frame TAG stop codon in parapertussis; CAG in
FT                   pertussis"
FT   misc_feature    40919..41056
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 1.8e-05"
FT   misc_feature    41075..41206
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 0.00026"
FT   CDS_pept        complement(41389..41568)
FT                   /transl_table=11
FT                   /locus_tag="BPP1331"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2148"
FT                   /db_xref="InterPro:IPR021553"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAP3"
FT                   /protein_id="CAE36633.1"
FT                   /translation="MPAKSKAQQMAAGAALAAKRGESRVSDLKGASRDMYDSMSERELE
FT                   HMAGTARKGKPYHK"
FT   CDS_pept        41666..42190
FT                   /transl_table=11
FT                   /locus_tag="BPP1332"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2147"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAP2"
FT                   /protein_id="CAE36634.1"
FT                   /translation="MQCPAFPGRFLRSSRMQISRHFPRLARRAALALCLAGAAQVHAQE
FT                   AAVQRKSDYPFAATVARLQDALRAKGMTIFAVIDHQAAAKQAGLDMPPTQVVVYGNPKA
FT                   GTPLMLAAPDFALELPLKVLVRETASGEVLVVYHPAGTREGMLGLPAGMAQQLAGAERI
FT                   VDAAVRRAPAD"
FT   misc_feature    41666..41794
FT                   /note="Signal peptide predicted for BPP1332 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 43 and 44"
FT   misc_feature    41804..42169
FT                   /note="HMMPfam hit to PF03625, Domain of unknown function
FT                   DUF302, score 7.1e-26"
FT   CDS_pept        complement(42201..43037)
FT                   /transl_table=11
FT                   /locus_tag="BPP1333"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2146"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAP1"
FT                   /protein_id="CAE36635.1"
FT                   /translation="MTPPARSSAAVPAQYADVHYADRPMRIEYALLAPERRDAPLLVFL
FT                   HEGLGSLAMWRDWPRRVCDAAGCRGLVYSRYGYGRSTVRPLDESRPIDYLHQQAAQALP
FT                   ALFAALGIDARRDKPVLFGHSDGASIALLYAALCPDAVAGIAVAAPHIYVEDITVANIA
FT                   VALRAYRETTLRDRLARYHDDVDSTFASWTDTWLDPAFRQWNIEAYLPAITCPMLAMQG
FT                   VDDEYGTLEQIRGIRRLAPQTRLLEIQDCGHSPHKDQPELVTRALAGFVGALPRPA"
FT   misc_feature    complement(42225..42836)
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
FT                   score 4.1e-09"
FT   CDS_pept        43150..43521
FT                   /transl_table=11
FT                   /locus_tag="BPP1334"
FT                   /product="putative ArsR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2145"
FT                   /db_xref="GOA:Q7WAP0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAP0"
FT                   /protein_id="CAE36636.1"
FT                   /translation="MVEYQAPALDRVFHALSDPTRRAMLRRLADGEHNIRALAAPFAMS
FT                   FTAASKHLKVLESAGLVSRRVQGRSHLCRIDAAPLAAIDEWLKFYERFWHTRLDMLETL
FT                   LRADAASSVPSHPDQDPTP"
FT   misc_feature    43186..43419
FT                   /note="HMMPfam hit to PF01022, Bacterial regulatory
FT                   protein, arsR family, score 2.1e-13"
FT   CDS_pept        43518..44069
FT                   /transl_table=11
FT                   /locus_tag="BPP1335"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2144"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="PDB:2K5G"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAN9"
FT                   /protein_id="CAE36637.1"
FT                   /translation="MTSPSSAFPDGHGARLDAQSIRFERLLPGPIERVWAWLADADKRA
FT                   RWLAGGELPRQPGQTFELHFNHAALTAETAPARYAQYDRPIVARHTLLRCEPPRVLALT
FT                   WGGGAGEAPSEVLFELSEAGEQVRLVLTHTRLADRAAMLDVAGGWHAHLAVLAGKLAGQ
FT                   APPPFWTTLAQAEQDYEQRL"
FT   CDS_pept        complement(44085..45776)
FT                   /transl_table=11
FT                   /locus_tag="BPP1336"
FT                   /product="putative sulfate transporter"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2143"
FT                   /db_xref="GOA:Q7WAN8"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAN8"
FT                   /protein_id="CAE36638.1"
FT                   /translation="MPHSVACLDLRVIALLEAKRAGLLRRAHWLPNIVSGLIVGVVALP
FT                   LAMAFAIASGAKPEQGLYTAIVAGLLVSLCGGSRVQIAGPTGAFIVILAGITAQHGVAG
FT                   LQLATLMAGCILLALGAARLGAIIKYIPAPVIVGFTAGIGVIIWVGQWKDFFGLPSPAG
FT                   THFHEKLWQLVHSLPQLHLATTALAALSLALLLLNNRLPYLRRVPGPLVALVVATTLQA
FT                   VLGLDGVATIGSAFGGIPQGLPSWQWPEITVSRVIELIGPAFAIAMLGAIESLLSAVVA
FT                   DGMAGTRHDSNQELVGQGLANIVAPLFGGFAATGAIARTATSIRNGGTSPLAGVVHCIT
FT                   LLLMVLLLAPLAENVPLAALAAILFVVAWNMSDAPHFVRMIKRAPRADVAILLVTFVLT
FT                   VFADLVVAVNIGVVIAILHFLRRMASSVQVQAQSPAELGDELGHRGYGPLPDDVLVYAV
FT                   EGPLFFGAAENFERALAATHTDPRTLIIRLRWVPFIDITGLQALEEVITDLQRRGVRVI
FT                   LSGANPRVKAKLHRAGLVGLAGADNVFDRFEDAVLSCRAPAAPATA"
FT   misc_feature    complement(44127..44459)
FT                   /note="HMMPfam hit to PF01740, STAS domain, score 2.2e-20"
FT   misc_feature    complement(44508..45422)
FT                   /note="HMMPfam hit to PF00916, Sulfate transporter family,
FT                   score 4.5e-88"
FT   misc_feature    complement(join(44538..44603,44643..44708,44721..44786,
FT                   44823..44888,44934..44999,45186..45236,45330..45395,
FT                   45417..45482,45528..45593,45615..45680))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BPP1336 by TMHMM2.0 at aa 32-54, 61-83, 98-120, 127-149,
FT                   180-197, 259-281, 296-318, 330-352, 356-378 and 391-413"
FT   CDS_pept        complement(45825..46505)
FT                   /transl_table=11
FT                   /locus_tag="BPP1337"
FT                   /product="putative gntR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2142"
FT                   /db_xref="GOA:Q7WAN7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAN7"
FT                   /protein_id="CAE36639.1"
FT                   /translation="MRSSTDLSAEGISQAIATAIVSHRLPPGTRLREEALASVYKVSRT
FT                   KIRAALLMLSKDKLIQIVPDKGAFVSKPDAHEAREVYAVRRILEAALAREFVACAAPQD
FT                   YERLEQHLHQEREAIHEGDVQRRNQLLAGFHLQLAEIVGNSVLTAMLHELLARTAVITV
FT                   MYQSAHDASCSSQEHYAFLAAARDGDAERACALMDEHLLHLQTALDFDGAPAPNRDLVA
FT                   ALLS"
FT   misc_feature    complement(46296..46472)
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 4.7e-08"
FT   CDS_pept        complement(46754..47212)
FT                   /transl_table=11
FT                   /locus_tag="BPP1338"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2141"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAN6"
FT                   /protein_id="CAE36640.1"
FT                   /translation="MHTRARHATSPLPAMPTSLPARAYALPLILPLLLAACSDAVQTQY
FT                   RDLDEARAAGAIQRGWLPAWLPARTGAIAEAHDLDTNRRAARFVLPDGARIEPPGCAPA
FT                   SGRLPPPALALPGWPASLHQDGAAGRYRLYRCADGYAAFDASHGYLWN"
FT   misc_feature    complement(47144..47212)
FT                   /note="Signal peptide predicted for BPP1338 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.976) with cleavage site
FT                   probability 0.707 between residues 23 and 24"
FT   CDS_pept        47382..48311
FT                   /transl_table=11
FT                   /locus_tag="BPP1339"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2140"
FT                   /db_xref="GOA:Q7WAN5"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAN5"
FT                   /protein_id="CAE36641.1"
FT                   /translation="MNQPSSLAADLRGAWHAQAQSHPLITLGLAASAAGVVLLLVAGIV
FT                   NALTGENRVHVGYAVLGGTAGFAATALGALMALGLRAISARTQDAMLGFAAGMMLAASA
FT                   FSLILPGLDAAGTIVGPGPAAAAVVALGLGLGVLLMLGLDYFTPHEHERTGHQGPEAAR
FT                   VNRVWLFVLTIILHNLPEGMAIGVSFATGDLRIGLPLTSAIAIQDVPEGLAVALALRAV
FT                   GLPIGRAVLVAVASGLMEPLGALVGVGISSGFALAYPISMGLAAGAMIFVVSHEVIPET
FT                   HRNGHETTATVGLMAGFALMMFLDTALG"
FT   misc_feature    join(47442..47510,47553..47621,47655..47723,47751..47819,
FT                   47880..47948,48057..48125,48144..48203,48246..48305)
FT                   /note="8 probable transmembrane helices predicted for
FT                   BPP1339 by TMHMM2.0 at aa 21-43, 58-80, 92-114, 124-146,
FT                   167-189, 226-248, 255-274 and 289-308"
FT   misc_feature    47865..48296
FT                   /note="HMMPfam hit to PF02535, ZIP Zinc transporter, score
FT                   2e-29"
FT   CDS_pept        complement(48324..48971)
FT                   /transl_table=11
FT                   /locus_tag="BPP1340"
FT                   /product="putative lipoprotein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2139"
FT                   /db_xref="GOA:Q7WAN4"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAN4"
FT                   /protein_id="CAE36642.1"
FT                   /translation="MPFLRAPLRAHRAVREQDMKSRRLQLAGVALMMAAACGQAVAGGG
FT                   HHGHHGYYGGYGHSHGSSSDGWWIAGALALVAAGTYLAVSSQPSYAPAAQYSAGGITYT
FT                   TPGGYAASPYDSTVYDPPSYDPPTAYEDAGYAPAGHGQPAFDDGTVAGYPVAPQGAGIA
FT                   RTATRQPAGEAACRREAMNQSGYDPATPSAWTTGVSVDSYQRALSACLAGRG"
FT   misc_feature    complement(join(48717..48773,48834..48899))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP1340 by TMHMM2.0 at aa 24-46 and 66-85"
FT   CDS_pept        complement(49045..50856)
FT                   /transl_table=11
FT                   /locus_tag="BPP1341"
FT                   /product="putative ABC-transporter membrane-spanning
FT                   ATP-binding component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2138"
FT                   /db_xref="GOA:Q7WAN3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAN3"
FT                   /protein_id="CAE36643.1"
FT                   /translation="MRMLWTYLRPHGGLALLALLLAAASQVLALIDPIIFGRIIDEYAI
FT                   GRAGKTGDQLLAGVLGLLALAVAILSRLAKALQEYVTRLVVQKLGTQIFNDGLRQVMRL
FT                   RFQEFEELRSGETLSLLQKVRSDSERFINAFINTAFAAGVGVAFLCWYSVTRHWLLVPV
FT                   FFVGVLLLGGLTGLLSRQIRSQQRSIMRETNRNSGFITESLRNIELIKSLGLTYPEIRR
FT                   LQAQTQQIFALEMQKVKRIRLLSFLQGMILSVLKLSVLFALLWLILRDVLSTGELIAMQ
FT                   FISVAIFAPLQELGNLILAYREADASLNHYAALMARPVERNPESAQDSGPIQRVRFGEV
FT                   RFRHQGATENALDGVSFEARLGDTVAFVGPSGSGKSTLVKLLVGLYAPDHGEVYYNDVS
FT                   TRDLRFNPTRRQIGFVTQETHLFSGTLRENMQLVKPDVTDEEIVAAMRQASCANVQARS
FT                   PAGLDTTIGEGGVKLSGGERQRLSIARALVRQPRLLIFDEATSALDSLTEEQITQTIRD
FT                   VSRRAGQITILIAHRLSTIMHADTIFVLEKGRVVEQGSHAELLAGKGLYYAMWRQQIGE
FT                   RPAVRAPEPQSEPDTAGGGPEAGVSLL"
FT   misc_feature    complement(49213..49773)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   3.1e-52"
FT   misc_feature    complement(49396..49440)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(49729..49752)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(join(49960..50025,50056..50121,50317..50382,
FT                   50398..50463,50635..50691,50752..50817))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPP1341 by TMHMM2.0 at aa 13-35, 55-74, 131-153, 158-180,
FT                   245-267 and 277-299"
FT   misc_feature    complement(49984..50814)
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region, score 8.1e-10"
FT   misc_feature    complement(50704..50727)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(50770..50856)
FT                   /note="Signal peptide predicted for BPP1341 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.989 between residues 29 and 30"
FT   CDS_pept        complement(50940..51491)
FT                   /transl_table=11
FT                   /locus_tag="BPP1342"
FT                   /product="putative acetyltransferase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2136"
FT                   /db_xref="GOA:Q7WAN2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAN2"
FT                   /protein_id="CAE36644.1"
FT                   /translation="MPSAPATPSVAVRRAQAPDAALLPAIERSAGQRFLDAPGLAWIAA
FT                   DEVMSEQDHRAWIAAGTSWVAECPGAGLAGFLVAERTADALHVWELAVRREMQGRGIGG
FT                   RLVRAAIDAASAAGLPAITLTTFRDLPWNQPFYARLGFATLQADGLNVRLQAILAREAS
FT                   LGLPAARRCAMRREIAAARR"
FT   misc_feature    complement(51063..51299)
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 6.4e-13"
FT   CDS_pept        51546..51740
FT                   /transl_table=11
FT                   /locus_tag="BPP1343"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Hordeum vulgare low-temperature induced
FT                   protein Lt101.2 SWALL:LT02_HORVU (SWALL:Q9ARD5) (54 aa)
FT                   fasta scores: E(): 0.042, 45.83% id in 48 aa, and to
FT                   Xylella fastidiosa hypothetical protein Xf0135 SWALL:Q9PH11
FT                   (EMBL:AE003867) (64 aa) fasta scores: E(): 4.6e-15, 65.51%
FT                   id in 58 aa"
FT                   /db_xref="GOA:Q7WAN1"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAN1"
FT                   /protein_id="CAE36645.1"
FT                   /translation="MRLLLAIFLPFTVFFTIGRPIAGIICLLLQITLIGWIPAALWAVY
FT                   ALSQFHTDRKIRDAVGGRG"
FT   misc_feature    51606..51674
FT                   /note="1 probable transmembrane helix predicted for BPP1343
FT                   by TMHMM2.0 at aa 21-43"
FT   CDS_pept        complement(51759..52106)
FT                   /transl_table=11
FT                   /locus_tag="BPP1344"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2134"
FT                   /db_xref="GOA:Q7WAN0"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAN0"
FT                   /protein_id="CAE36646.1"
FT                   /translation="MHYHGSCHCGTIRFDVEGELTGAMSCNCSICRRKGALLWFVPRDH
FT                   LRLATPDEQIATYTFNRHLIKHRFCPTCGIHTHGEGVDQQGRAMAAINIRCLDDVDLDA
FT                   VAVHQYDGRAA"
FT   CDS_pept        complement(52135..53574)
FT                   /transl_table=11
FT                   /locus_tag="BPP1345"
FT                   /product="putative transmembrane efflux protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2133"
FT                   /db_xref="GOA:Q7WAM9"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM9"
FT                   /protein_id="CAE36647.1"
FT                   /translation="MPHTLDERKRWLALMVLCLGVLMIVLDTTIVNVALPSIKADLGFT
FT                   EASLVWVVNAYMLTFGGFLLLGGRLGDLLGQRRMFLAGLTLFTLASLACGMAQGQAMLV
FT                   AARAVQGLGGAVVSAVALSLIMTLFTEPAERARAMGVYGFVCAGGGSIGVLLGGLLTSS
FT                   LSWHWIFLVNLPIGALVYALCLPLLPASQGPTGHPRLDLAGAAAITASLMLAVYAVVNG
FT                   NEAGWTSPQSLGLLALAVALLALFLRIEARVPAPLMPLSLFALRNVATANIVGVLWAAA
FT                   MFAWFFISALYMQLVLGYTAMQVGLGFLPANIIMAAFSLGLSARLVMRFGIRAPLVCGL
FT                   LVAALGLALFARAPVAGSFAVDVLPGMLLLGLGAGIAFNPVLLAAMSDVDPSEAGLASG
FT                   VVNTSFMMGGALGLAVLASLAAGRSASLRAGGADVLTALNGGYHAAFAVGAVFAALAAL
FT                   LAGVLLRRPQPGASAPAADAH"
FT   misc_feature    complement(join(52186..52251,52312..52377,52417..52482,
FT                   52522..52587,52609..52674,52705..52770,52834..52899,
FT                   52915..52968,53005..53070,53086..53151,53188..53253,
FT                   53269..53334,53371..53427,53473..53538))
FT                   /note="14 probable transmembrane helices predicted for
FT                   BPP1345 by TMHMM2.0 at aa 12-34, 49-68, 80-102, 107-129,
FT                   141-163, 168-190, 202-220, 225-247, 268-290, 300-322,
FT                   329-351, 364-386, 399-421 and 441-463"
FT   misc_feature    complement(53476..53574)
FT                   /note="Signal peptide predicted for BPP1345 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.777) with cleavage site
FT                   probability 0.512 between residues 33 and 34"
FT   CDS_pept        complement(53593..54012)
FT                   /transl_table=11
FT                   /locus_tag="BPP1346"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2132"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM8"
FT                   /protein_id="CAE36648.1"
FT                   /translation="MPQISAYLMFDGDCAEAMRLYERILGGKLDALITYGESPPEMPCE
FT                   PQDRDLIMHARLRLDDQLLMASDSNSQCPYEGKKGFSLSLVYPTVSDAQRIFNALAEGG
FT                   QVTMPLQKTFWAEIFGVLVDRHGTAWMISGGQMNS"
FT   CDS_pept        54163..54771
FT                   /transl_table=11
FT                   /locus_tag="BPP1347"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2131"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="PDB:1ZBO"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM7"
FT                   /protein_id="CAE36649.1"
FT                   /translation="MAEIPLFPLSNALFPAGVLRLRVFEIRYLDMVRRCIADGSEFGVV
FT                   VLEQGTEVRRPDGREVLARAGTMARIDHWEAPMPALLELACTGTGRFRLHACTQGKYGL
FT                   WTGQAEPVPDDAPLEVPPELARSASALGRLIARLQREGVPPHIMPMAAPFRLDDCGWVA
FT                   DRWAEMLSLPPADKARLLLLPPLDRLREIDAVLAADGHA"
FT   misc_feature    54169..54756
FT                   /note="HMMPfam hit to PF02190, ATP-dependent protease La
FT                   (LON) domain, score 0.014"
FT   CDS_pept        54784..55602
FT                   /transl_table=11
FT                   /locus_tag="BPP1348"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2130"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM6"
FT                   /protein_id="CAE36650.1"
FT                   /translation="MTGTMTIRIDEELRAYIDPLTPDEYAALEQSLLAEGCRDALVLWG
FT                   DLLVDGHNRHAICSKHGIAFNTVQNTRLQSMDDVRLWMIDNHLGRRSVSDFQRGVLALR
FT                   KKEILESRRQAGAGDAALAGGDGPAPLTRQTLARQARLSSTTLGQIEKIRQQAAPELVR
FT                   AVQSGEISINAAAAVATLPAPQQAAAAAGGRGELRAAARQVREARLPVRRASEAEPAPA
FT                   AEPRVVDDYPAEVARLDRLVAQLAEERDALKKKVVQLTVALAEARAKPGD"
FT   CDS_pept        complement(55554..56528)
FT                   /transl_table=11
FT                   /locus_tag="BPP1349"
FT                   /product="putative araC-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2129"
FT                   /db_xref="GOA:Q7WAM5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM5"
FT                   /protein_id="CAE36651.1"
FT                   /translation="MSALPDSPSASPPPRHDELASLIERHTPADGSTATALPGLNFYRS
FT                   SSPTELNVSFYRPSLALLAQGAKRVQLGDDVYEYDTSHYLLTSFDLPVASRVTLATPGT
FT                   PYLCFALDLDPHRIAGLISELGAPPAGQPLRRGLTLARLTEPLLGAVLRLARLLDTPAD
FT                   IPVLAPLIEREIHYRLLSGPMGGRLRHIARAEGTALQIARAIDWLRRHYAQPLRVEHLA
FT                   TTVNMSVSSLHHHFKAVTALSPLQYQKQLRLHEARRLMVAETLDAGAAAHRVGYESASQ
FT                   FSREYSRLYGAPPLRDAARLRGTAPADAQSPGLARASASATVS"
FT   misc_feature    complement(55632..55763)
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 0.71"
FT   misc_feature    complement(55782..55919)
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 2.6e-07"
FT   misc_feature    complement(55797..55931)
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT   CDS_pept        complement(56557..57618)
FT                   /transl_table=11
FT                   /locus_tag="BPP1350"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2128"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM4"
FT                   /protein_id="CAE36652.1"
FT                   /translation="MRSIAMQAADLYVLQTAQSWLDAGQAAVLLTVARTWGSSPRPPGA
FT                   MMAIRADGAVAGSVSGGCIEDDLIDQIRQRGIAALCPGARPALATYGVDGEQARRFGLP
FT                   CGGTLQLVLEPLGAHSRLADLLARLRAHQTVRRSVRLADGAVTLEPAAADAEPRLDGAG
FT                   FASVLGPRHRLLVVGAGQLSRYLCEMAIALDFDVTVSDPRQEYRAGWQVEGVALTTAMP
FT                   DDMVIAARPDARTAVIALTHDPKLDDLALIDALQTPAFYVGALGSRANHARRVARLREH
FT                   FGLTPAQLARLRGPAGIYIGSRTPPEIALSIMAEIVAGKNGAPLPPAASVAAGKARQPG
FT                   GAGVIQAGLCATL"
FT   misc_feature    complement(56644..57567)
FT                   /note="HMMPfam hit to PF02625, Uncharacterized BCR,
FT                   COG1975, score 2e-22"
FT   CDS_pept        complement(57615..59828)
FT                   /transl_table=11
FT                   /locus_tag="BPP1351"
FT                   /product="putative exported oxidoreductase subunit"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2127"
FT                   /db_xref="GOA:Q7WAM3"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM3"
FT                   /protein_id="CAE36653.1"
FT                   /translation="MRIAIQNLSRRRFVQGAGGLLLGLSLPPLARRAMAAGPQAGDGFA
FT                   ANAFVRIGADGRITVLAKHLEKGQGAYTGLATLLAEELDADWRQVRVEGAPADSARYGN
FT                   QALGGLQGTGGSTAMFDSWEPMRRAGATARAMLVQAAAQRWQVPADTIEVAEGVLSHPA
FT                   SGRRAGFGELAEAAARSPVPEDVPLKDPARFRLIGKHRLPRVDSAAKSDGSALYTQDMK
FT                   LPGMLVAVVAHAPRLGAAVARVDDAAARAVPGVRAVVRFGGAALRHAGVAVLATNTWAA
FT                   RAGRDALRIEWDEGLAYRQGSADILARYREAVGRPGSMAARKGDIDAAFAGAAKVIEAE
FT                   YTYPYLAHAAMEPLNCLVRLDDERCEIWNGEQFQTADQRAIAQYLGMPAERITLTQLYA
FT                   GGSFGRRASSHADYLLEAVAIARTARAQGLNAPVKLVWMREDDMRAGYYRPLNLHRARL
FT                   ALGADGALQAVHVRMAGQSILLGTPLADWVRDGVDPVSVEGLSDLAYAVPNLQVELHTP
FT                   TDVPVPVLWYRSVGHTHTAFSAETLIDEAAVAAGQDPVAYRLALLAAHPRHREVLQLAA
FT                   ARAGWREPLAAGAPGTRRGRGVAVHESFRSVVAQVVEVTIAADGALKVDRVVCAVHCGL
FT                   AVNPDVVRAQMEGGIGFALSTALHGAITLKDGAVEQSNFHDYPVLRLAEMPAVEVHIAP
FT                   STQPPTGVGEPGVPPLAPALANAIAQATGQRLRTLPLGTTVKA"
FT   misc_feature    complement(57771..58922)
FT                   /note="HMMPfam hit to PF02738, Aldehyde oxidase and
FT                   xanthine dehydrogenase, molybdopterin binding domain, score
FT                   6.3e-08"
FT   misc_feature    complement(58938..59195)
FT                   /note="HMMPfam hit to PF01315, Aldehyde oxidase and
FT                   xanthine dehydrogenase, a/b hammerhead domain, score
FT                   0.0025"
FT   misc_feature    complement(59724..59828)
FT                   /note="Signal peptide predicted for BPP1351 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.980 between residues 35 and 36"
FT   CDS_pept        complement(join(59842..60111,60115..60300))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1352"
FT                   /product="putative oxidoreductase subunit (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2126"
FT                   /db_xref="PSEUDO:CAE36654.1"
FT   misc_feature    complement(59863..60087)
FT                   /note="HMMPfam hit to PF01799, [2Fe-2S] binding domain,
FT                   score 4.5e-34"
FT   misc_feature    complement(join(60106..60111,60115..60291))
FT                   /note="HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster
FT                   binding domain, score 1.7e-08"
FT   misc_feature    complement(60163..60189)
FT                   /note="PS00197 2Fe-2S ferredoxins, iron-sulfur binding
FT                   region signature."
FT   CDS_pept        complement(60458..60802)
FT                   /transl_table=11
FT                   /locus_tag="BPP1353"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2125A"
FT                   /db_xref="InterPro:IPR021719"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM2"
FT                   /protein_id="CAE36655.1"
FT                   /translation="MIWKLIPIALLADLTACASGTRTDSSPPASSQTSSSAAPGSATTP
FT                   SGPDCDAQPVQNLVGQKYSDSVGNDALRRSNSGSMRLLKPGQVMTMEYNAHRLNIILEG
FT                   NGSISALRCG"
FT   misc_feature    complement(60710..60802)
FT                   /note="Signal peptide predicted for BPP1353 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.985) with cleavage site
FT                   probability 0.677 between residues 31 and 32"
FT   CDS_pept        60959..61864
FT                   /transl_table=11
FT                   /locus_tag="BPP1354"
FT                   /product="putative lysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2125"
FT                   /db_xref="GOA:Q7WAM1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM1"
FT                   /protein_id="CAE36656.1"
FT                   /translation="MDKFQEVSLFLAVAEARSFAAAGRRLGLSASTVTRAVAALEARLG
FT                   ILLLVRTTRHVRLTDAGEQFAHDCRAVLDSLAQAEEAAAGGRVQPRGELSVTAPALFGE
FT                   LHVMPAIVDYLRQHRRVRLRALLVDRVVRLLDEGVDVAVRIGRLPDSSLTAIHVGDVRR
FT                   IVCAAPDFLARAGVPSHPGMLPRYCTVSVVMEGQMDRWRFVCDGHARDLDVQAQLTVTS
FT                   SQAAVRAAVQGWGLAQVVSYQAAGALREGALQVVLREFEPPPLPVHVVYPEGRKGAAKV
FT                   RSFVEFCVERLRAELAELPA"
FT   misc_feature    60968..61147
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 1.6e-18"
FT   misc_feature    61010..61102
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    61217..61837
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 8.2e-36"
FT   CDS_pept        61915..62964
FT                   /transl_table=11
FT                   /locus_tag="BPP1355"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2124"
FT                   /db_xref="GOA:Q7WAM0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAM0"
FT                   /protein_id="CAE36657.1"
FT                   /translation="MRRRRAGRAAGIMAVVRYDIPGALMSDSLVFHTDLPGLADGPWHG
FT                   GELAMQERAGARERMAQLGPRVIRDYMPQQHRDFFAQLPFMLLATVDAQGDPWASVLEG
FT                   PPGFAHSPDERTLRLDAWPAGDDPARAGLAHGAGVGMLGIELSTRRRNRVNGHVAALDG
FT                   QGFCVVVTQSFGNCPQYIQTRHARQAAPAPQPARWLAGLDAAARTLVGQADTLFVASYA
FT                   RQAGPHAVDVSHRGGPPGFVHLRGDTLTMPDFSGNRFFNTLGNLLANPRAGLVFVDFAR
FT                   GDLLQLCGRAEVLAEAGAPAAYPGAQRLWRVHVERAVRRPAALGLRAGFGEYAAQLAAV
FT                   GQWAGEPPA"
FT   CDS_pept        complement(62972..64090)
FT                   /transl_table=11
FT                   /gene="aroG"
FT                   /locus_tag="BPP1356"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase,
FT                   Phe-sensitive"
FT                   /EC_number="2.5.1.54"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2123"
FT                   /db_xref="GOA:Q7WAL9"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAL9"
FT                   /protein_id="CAE36658.1"
FT                   /translation="MTRIDDPLHDREAGQADATQDTTRIDDVRIGAVRPLISPALLQDE
FT                   LPVSAPLQALVEDSRARIADVLHGRDDRLVVVVGPCSIHDHEQAMEYARQLKEATDTLA
FT                   DDLLIVMRVYFEKPRTTVGWKGYINDPRLDGSFRINEGLRRARHLLLEIGALGLPIATE
FT                   FLDLLSPQYIADLIAWGAIGARTTESPSHRQLASGLSCPLGFKNGTDGGIQVAADAIVA
FT                   ASAPHAFMGMTKMGTAAIFETRGNDDTHVILRGGKQGPNYDAAAIDACCAALAKAGLRE
FT                   QVMVDCSHANSNKSHARQVDVARDLARQLAGGDRRIIGIMIESNLEEGRQDLKPGVPLK
FT                   RGVSITDACLSWAQTEPVLAELAQAVRQRREG"
FT   misc_feature    complement(62990..63970)
FT                   /note="HMMPfam hit to PF00793, DAHP synthetase I family,
FT                   score 3.8e-149"
FT   CDS_pept        complement(64212..64856)
FT                   /transl_table=11
FT                   /locus_tag="BPP1357"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2122"
FT                   /db_xref="GOA:Q7WAL8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAL8"
FT                   /protein_id="CAE36659.1"
FT                   /translation="MRAAMPEPTQLLAFALICLGMTLTPGPNMMYLVSRSLSQGYRAGL
FT                   VSLAGVALGLVFYVLCAVLGITALLMAVPLAYEALCVAGAIYLMYMAWQALRPGGQSPF
FT                   QVRALAPSPPRRLFAMGLFTALLNPKIAVLYLSLLPQFIDPQQGSVLTQSLALGFTQVG
FT                   ISICVNALFTVMAGAIAVFLARRPMWMVAQRWLMGSVLAGLAVRMALDARR"
FT   misc_feature    complement(64299..64637)
FT                   /note="HMMPfam hit to PF01810, LysE type translocator,
FT                   score 8.5e-08"
FT   misc_feature    complement(join(64305..64370,64440..64505,64581..64646,
FT                   64659..64724,64761..64826))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BPP1357 by TMHMM2.0 at aa 10-32, 44-66, 70-92, 117-139 and
FT                   162-184"
FT   CDS_pept        complement(65058..66410)
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="BPP1358"
FT                   /product="glutathione reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2120"
FT                   /db_xref="GOA:Q7WAL7"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAL7"
FT                   /protein_id="CAE36660.1"
FT                   /translation="MAFDFDLYVIGAGSGGVRAARFAAGYGARVAVAESRYLGGTCVNV
FT                   GCVPKKLLVYGAHFHEDFEQAAGFGWNPGRPEFDWPTLIANKNREIERLNGIYRNLLVN
FT                   SGVALHEGHARIVDPHTVEINGQRHSAQHILVATGGWPFVPDIPGKEHAITSNDAFFLP
FT                   ELPRRVLVVGGGYIAVEFASIFNGLGAQTVQVYRRELFLRGFDGSVREHLRDELVKKGL
FT                   DLRFNTDVERIDKRADGVLAVTLSDGSVLETDCVFYATGRRAMLDDLGLENTGVRLAES
FT                   GYIEVDDEYRTSEPSILAIGDVIGRVPLTPVALAEGMAVARRLFRPQEYRKVDYDLIPT
FT                   AVFSLPNIGTVGLTTEQALEHGFRVTRYESRFRPMKLTLTQSQKKTLMKLVVDADSQKV
FT                   LGCHMVGPDAGEIVQGLAVALKAGATKQVFDDTIGIHPTAAEEFVTMRTAT"
FT   misc_feature    complement(65070..65399)
FT                   /note="HMMPfam hit to PF02852, Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain,
FT                   score 6.3e-45"
FT   misc_feature    complement(65475..66395)
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreductase, score 1.4e-91"
FT   misc_feature    complement(66264..66296)
FT                   /note="PS00076 Pyridine nucleotide-disulphide
FT                   oxidoreductases class-I active site."
FT   CDS_pept        66585..66881
FT                   /transl_table=11
FT                   /locus_tag="BPP1359"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2119"
FT                   /db_xref="GOA:Q7WAL6"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAL6"
FT                   /protein_id="CAE36661.1"
FT                   /translation="MQNEDSFFGSLGAMLGAVIRAIVDGLRYVFGGLGRALGDFFGGLA
FT                   SALGMSPSVFNFALLVLGLLLLWTAVRAFMGRAIVAGIFWLVLAMLLLGGLIG"
FT   misc_feature    join(66603..66671,66729..66797,66816..66875)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BPP1359 by TMHMM2.0 at aa 7-29, 49-71 and 78-97"
FT   CDS_pept        66906..67283
FT                   /transl_table=11
FT                   /locus_tag="BPP1360"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa3386 SWALL:Q9HYL6 (EMBL:AE004760) (121 aa) fasta
FT                   scores: E(): 3.1e-22, 52.54% id in 118 aa, and to
FT                   Photobacterium profundum hypothetical 14.4 kDa protein
FT                   SWALL:Q93CF8 (EMBL:AF409100) (127 aa) fasta scores: E():
FT                   7.1e-18, 45.16% id in 124 aa"
FT                   /db_xref="GOA:Q7WAL5"
FT                   /db_xref="InterPro:IPR021218"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAL5"
FT                   /protein_id="CAE36662.1"
FT                   /translation="MLYRFLADLVLALHALFVAFAVLGGLLALRWPRLAWLHVPAALWG
FT                   AGIMLAGAVCPLTPLENHWRAQAGQQGYEDGFIAHYLLAAIYPEGLSRTAQTVLGALAL
FT                   AGNALVYAALWRRRRRGGIGR"
FT   misc_feature    66906..66977
FT                   /note="Signal peptide predicted for BPP1360 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.658) with cleavage site
FT                   probability 0.338 between residues 24 and 25"
FT   misc_feature    join(66933..66992,67005..67073,67182..67250)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BPP1360 by TMHMM2.0 at aa 10-29, 34-56 and 93-115"
FT   CDS_pept        67324..68019
FT                   /transl_table=11
FT                   /locus_tag="BPP1361"
FT                   /product="probable glutathione S-transferase"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   glutathione S-transferase Pa1033 SWALL:Q9I4U1
FT                   (EMBL:AE004536) (213 aa) fasta scores: E(): 1.6e-60, 71.42%
FT                   id in 203 aa, and to Anabaena sp. hypothetical protein
FT                   All1124 SWALL:Q8YXT7 (EMBL:AP003584) (232 aa) fasta scores:
FT                   E(): 4.8e-62, 67.25% id in 226 aa"
FT                   /db_xref="GOA:Q7WAL4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAL4"
FT                   /protein_id="CAE36663.1"
FT                   /translation="MIDLYFWATPNGLKIKLFLEEAGLPYTEHPINIGKGEQFQREFLA
FT                   IAPNNRIPAIVDQAPAGGGAPISLFESGAILLYLAEKIGRFIPADVRGRAEVLQWLFWQ
FT                   MGGLGPMAGQNGHFNVYAPEKVPYAIERYTAETARLYDVMDRRLAEREFLAGEYSIADI
FT                   ACYPWVVPHEAHGQKMAHFPHLSRWFEAIAARPATARAYKEAGDSYRPKAPMSDEERAV
FT                   LFGQPGAPR"
FT   misc_feature    67324..67566
FT                   /note="HMMPfam hit to PF02798, Glutathione S-transferase,
FT                   N-terminal domain, score 1.5e-10"
FT   misc_feature    67585..67911
FT                   /note="HMMPfam hit to PF00043, Glutathione S-transferase,
FT                   C-terminal domain, score 9.1e-10"
FT   CDS_pept        complement(join(68030..69406,69410..69472))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1362"
FT                   /product="putative GntR-family transcriptional regulator
FT                   (Pseudogene)"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   transcription regulator protein Rsc3119 or Rs00574
FT                   SWALL:Q8XUR6 (EMBL:AL646073) (488 aa) fasta scores: E():
FT                   6.9e-79, 50.92% id in 489 aa, and to Yersinia pestis
FT                   putative GntR-family regulatory protein Ypo2845
FT                   SWALL:Q8ZCW3 (EMBL:AJ414154) (501 aa) fasta scores: E():
FT                   4.9e-57, 39.34% id in 488 aa"
FT                   /db_xref="PSEUDO:CAE36664.1"
FT   misc_feature    complement(69230..69406)
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 9.2e-08"
FT   CDS_pept        69588..70298
FT                   /transl_table=11
FT                   /locus_tag="BPP1363"
FT                   /product="putative GNAT-family acetyltransferase"
FT                   /note="Similar to Brucella melitensis
FT                   ribosomal-protein-serine acetyltransferase Bmeii0002
FT                   SWALL:Q8YE16 (EMBL:AE009639) (242 aa) fasta scores: E():
FT                   1.2e-49, 58.9% id in 219 aa, and to Rhizobium loti
FT                   hypothetical protein Mll2986 SWALL:Q98H84 (EMBL:AP003000)
FT                   (228 aa) fasta scores: E(): 4.3e-49, 56.05% id in 223 aa"
FT                   /db_xref="GOA:Q7WAL3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAL3"
FT                   /protein_id="CAE36665.1"
FT                   /translation="MSARVNEFGQPIGQAMPQWQARPRPPRDPAEGRYCRLEPLDAARH
FT                   GDDLYAAFAVPDAASGWTYLSAGPFADRAGYDEYLRKAADSADPLHHAVIDLASGRAIG
FT                   TLSLMRIDPANGVIEVGHVNFAPALRRSPASTEAQYLLMRRAFDELGYRRYEWKCDSLN
FT                   APSRAAALRLGFLFEGIFRQALVYKGRTRDTAWFSIIDSEWPALRAAFERWLAPENFDA
FT                   AGRQRKRLDACRQP"
FT   misc_feature    69867..70115
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 0.00034"
FT   CDS_pept        complement(70401..71327)
FT                   /transl_table=11
FT                   /locus_tag="BPP1364"
FT                   /product="integral membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa1411 SWALL:Q9I3T3 (EMBL:AE004570) (303 aa) fasta
FT                   scores: E(): 3.7e-60, 59.67% id in 305 aa, and to Ralstonia
FT                   solanacearum hypothetical transmembrane protein Rsc0519 or
FT                   Rs04969 SWALL:Q8Y218 (EMBL:AL646059) (301 aa) fasta scores:
FT                   E(): 7.5e-54, 55.44% id in 303 aa"
FT                   /db_xref="GOA:Q7WAL2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAL2"
FT                   /protein_id="CAE36666.1"
FT                   /translation="MAAAAPLRRPLDGFATYVMLALCICWGFQQIAIKLVAADVSPTLQ
FT                   IGLRSAFAAVVLIWVVLRHEGLGALRDGTLGPGLAVGALFALEFLLVGVGLEYTTASHM
FT                   AVFLYTAPIFTALGLHLLLPDERLKPLQWLGVAVAFGGIATAFLGKGHAAVPGMLLGDL
FT                   LGVLAGAAWGATTVAIRKSSLSEAAPAKTLFYQMLMAGLALPAFHFASGGAAPVWSGAA
FT                   LASLGFQSVVVALSSYLAWFWLLRRYLATRLAVLSFMTPLFGVTFGVLILDEPLDSGFV
FT                   IGAVLVLAGITLVSGAELLREKLRRRT"
FT   misc_feature    complement(join(70428..70484,70515..70580,70602..70667,
FT                   70683..70748,70788..70853,70884..70937,70959..71024,
FT                   71040..71105,71142..71198,71229..71294))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BPP1364 by TMHMM2.0 at aa 13-35, 45-64, 76-98, 103-125,
FT                   132-150, 160-182, 195-217, 222-244, 251-273 and 283-302"
FT   misc_feature    complement(70440..70820)
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6, score 2.5e-17"
FT   misc_feature    complement(70884..71258)
FT                   /note="HMMPfam hit to PF00892, Integral membrane protein
FT                   DUF6, score 1.5e-13"
FT   CDS_pept        complement(71330..71665)
FT                   /transl_table=11
FT                   /locus_tag="BPP1365"
FT                   /product="putative thioredoxin"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa1751 SWALL:Q9I2Y6 (EMBL:AE004601) (125 aa) fasta
FT                   scores: E(): 3.1e-21, 53.7% id in 108 aa, and to
FT                   Lactococcus lactis thioredoxin TrxA or Ll1644 SWALL:Q9CF37
FT                   (EMBL:AE006395) (104 aa) fasta scores: E(): 0.4, 26.82% id
FT                   in 82 aa"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAL1"
FT                   /protein_id="CAE36667.1"
FT                   /translation="MDQIELTDGTADRYLLDAPGLSLLVFHSRTCATCGVARQRLPEFD
FT                   LPVDRLCWIDAGENGGLVQRYEVFHLPALFVTRDGAYYGPVSAQLADWDLRQQISLALD
FT                   SYPAELP"
FT   misc_feature    complement(71543..71599)
FT                   /note="PS00194 Thioredoxin family active site."
FT   CDS_pept        complement(71723..72985)
FT                   /transl_table=11
FT                   /gene="amaB"
FT                   /locus_tag="BPP1366"
FT                   /product="N-carbamoyl-L-amino acid amidohydrolase"
FT                   /EC_number="3.5.1.-"
FT                   /note="Similar to Bacillus stearothermophilus
FT                   N-carbamoyl-L-amino acid amidohydrolase AmaB
FT                   SWALL:AMB2_BACST (SWALL:Q53389) (409 aa) fasta scores: E():
FT                   2.8e-50, 40.34% id in 409 aa, and to Arthrobacter aurescens
FT                   L-N-carbamoylase HyuC SWALL:Q9F464 (EMBL:AF146701) (412 aa)
FT                   fasta scores: E(): 4.8e-46, 37.44% id in 414 aa"
FT                   /db_xref="GOA:Q7WAL0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAL0"
FT                   /protein_id="CAE36668.1"
FT                   /translation="MTTTFPPLNAERLWSRVETLSRMTLPDVPWTRRAFSPLFEQSRQW
FT                   LRAEFEAAGLAVRLDAGGNLAGTRPGRDAARRPIATGSHCDTVMAGGRFDGIIGVLAGI
FT                   EVAHTLHEQGVTLEHPFEVIDFLSEEPSDYGISCVGSRALSGQLTPDMLAARNADGETL
FT                   AEGLRRIGGDPDALGAPLRGPGQTAAFVELHIEQGPVLESRGLPIGVVTNIVGIRRVLI
FT                   TVHGQPDHAGTTPMDIRRDALVGAARVIDAAHRRASTQSGKPHYVVATIGRIAMTPNAP
FT                   NAVPGMVELMLEVRSDSDAVLDAFPEAIMAEVADALAALRLSAAMAPVSRAHPTDCAPL
FT                   VMDAVEDAATRLGYASMRLPSGAGHDAVYMAPTGPIGMIFVPCLNGRSHCPEEWLEPSQ
FT                   LLDGTRVLYETVLELDRRLSR"
FT   CDS_pept        complement(73015..74397)
FT                   /transl_table=11
FT                   /gene="norM"
FT                   /locus_tag="BPP1367"
FT                   /product="multidrug resistance protein"
FT                   /note="Similar to Escherichia coli multidrug resistance
FT                   protein NorM or B1663 SWALL:NORM_ECOLI (SWALL:P37340) (457
FT                   aa) fasta scores: E(): 7.9e-41, 33.92% id in 451 aa, and to
FT                   Rhizobium loti multidrug efflux protein, NorM Mll4906
FT                   SWALL:Q98D15 (EMBL:AP003005) (467 aa) fasta scores: E():
FT                   3e-101, 59.1% id in 445 aa"
FT                   /db_xref="GOA:Q7WAK9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WAK9"
FT                   /protein_id="CAE36669.1"
FT                   /translation="MPRSTARAAWKRELAATLALGLPLVLTNLAQMAMTVTDVIFIGRL
FT                   GSQALAASALGANLFTAIEFFGLGLVAATAPMVAHALGRRGNTVRDVRRTVRQGLWTAV
FT                   IYSVPGCLLLWHGEAILLAIDQPPELAAQAGAYLRALMWAMPPFLGFLVLRSFVTALQR
FT                   PRSAFLIALAAIVLNVFGNWVLVFGNLGAPALGLVGAGLASALATLGLFLGMVGVVCLD
FT                   RRFRRYHLFGDVWQPDWQRLAEFWKLGLPIGAATAFEVTIFNAAAFLMGWLGEPELAAH
FT                   AIAIQIASVTFMIPYGIAQAATVRVGHAYGARQPDQVARAGWCAFSLGIGSMAIAAALM
FT                   LLAPGLLVSAFLDIGDPANAQVLRLATAYLAVAALFQIVDGAQVLGAGMLRGLHDTRVP
FT                   MLYAALGYWGVGLPSGAALAFWAGWRGVGVWSGLAIGLALVAVLMMQRWLRRDRVGLLR
FT                   RA"
FT   misc_feature    complement(join(73051..73116,73132..73197,73261..73311,
FT                   73357..73422,73486..73551,73582..73647,73741..73806,
FT                   73837..73902,73924..73989,74035..74100,74161..74226,
FT                   74287..74352))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BPP1367 by TMHMM2.0 at aa 19-41, 61-83, 103-125, 140-162,
FT                   169-191, 201-223, 254-276, 286-308, 329-351, 366-383,
FT                   404-426 and 431-453"
FT   misc_feature    complement(73147..73650)
FT                   /note="HMMPfam hit to PF01554, Uncharacterized membrane
FT                   protein family UPF0013, score 2e-35"
FT   misc_feature    complement(73846..74334)
FT                   /note="HMMPfam hit to PF01554, Uncharacterized membrane
FT                   protein family UPF0013, score 1.2e-26"
FT   misc_feature    complement(74245..74397)
FT                   /note="Signal peptide predicted for BPP1367 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.996) with cleavage site
FT                   probability 0.387 between residues 51 and 52"
FT   CDS_pept        74585..76441
FT                   /transl_table=11
FT                   /gene="pckG"
FT                   /gene_synonym="pck"
FT                   /locus_tag="BPP1368"
FT                   /product="phosphoenolpyruvate carboxykinase [GTP]"
FT                   /EC_number="4.1.1.32"
FT                   /note="Similar to Mycobacterium smegmatis
FT                   phosphoenolpyruvate carboxykinase [GTP] PckG or Pck
FT                   SWALL:PPCK_MYCSM (SWALL:Q9AGJ6) (605 aa) fasta scores: E():
FT                   3.7e-152, 59.59% id in 599 aa, and to Ralstonia
FT                   solanacearum probable phosphoenolpyruvate carboxykinase
FT                   protein pckA or Rsc0017 or Rs01839 SWALL:Q8Y3G3
FT                   (EMBL:AL646057) (622 aa) fasta scores: E(): 1.4e-210,
FT                   79.67% id in 620 aa"
FT                   /db_xref="GOA:Q7WAK8"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WAK8"
FT                   /protein_id="CAE36670.1"
FT                   /translation="MNKPSEVKPVALNVPDYVKHSGLIAWVERIAALTKPDRVVWCDGS
FT                   QEEYDRLCEQMVQGGTMRRLNPAKRANSYLACSDPSDVARVEDRTFICSEREEDAGPTN
FT                   NWAAPQAMRETLGGLFDGAMRGRTMYVVPFSMGPLGSPIAHIGVELSDSPYVVVNMRIM
FT                   TRMGRKVFDVLGSDGAFVPCVHSVGMPLAEGQQDVAWPCNPTKYIVHYPETREIWSFGS
FT                   GYGGNALLGKKCFALRIASTMGRDEGWLAEHMLILGVTSPKGRKYHVAAAFPSACGKTN
FT                   FAMLIPPHGMDGWKVTTIGDDIAWIKPGPDGRLHAINPEAGYFGVAPGTSEKTNFNAMA
FT                   MLKANVIFTNVALTDDGDVWWEGMTDTPPAHLIDWQGQDWTPAIAAETGRKAAHPNARF
FT                   TAPAAQCPSIDPEWENPKGVAIDAFIFGGRRSTTVPLVTEARNWVEGVYMAATMGSETT
FT                   AAAAGQQGVVRRDPFAMLPFCGYNMSDYFDHWLKLGRRLEETGATLPRIYCVNWFRKGP
FT                   DGKFVWPGFGENMRVLRWMLGRLDGQAGGVDQVFGISPAYGDIDWTGLEFSPDKFEQVI
FT                   SVDLPAWRAELALHDELFTQLAARLPEDLPLTRTAIERRMAA"
FT   misc_feature    74657..76435
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00821, Phosphoenolpyruvate
FT                   carboxykinase, score 0"
FT   misc_feature    75401..75427
FT                   /note="PS00505 Phosphoenolpyruvate carboxykinase (GTP)
FT                   signature."
FT   CDS_pept        76502..77125
FT                   /transl_table=11
FT                   /locus_tag="BPP1369"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Caulobacter crescentus hypothetical
FT                   protein Cc1925 SWALL:Q9A701 (EMBL:AE005866) (209 aa) fasta
FT                   scores: E(): 2.3e-10, 34.5% id in 200 aa, and to Vibrio
FT                   cholerae tellurite resistance protein-related protein
FT                   Vc0813 SWALL:Q9KTS5 (EMBL:AE004166) (192 aa) fasta scores:
FT                   E(): 2e-09, 29.38% id in 194 aa"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAK7"
FT                   /protein_id="CAE36671.1"
FT                   /translation="MTLTSDDLRQIAALTLAHYDDNAVSFEVGTRDHDVSQNIAALLRH
FT                   IQGDPPYAILDFGCGPGRDLKTFAALGHAAVGLDGAAHFVAMAHQATGCEVWQQDFLRL
FT                   ALPAGRFDGIFANASLFHVPTQELPRVLGELRDTLKPGGVLFCSNPRGGNEEGWSRGRY
FT                   GVWHDWESWRALLEAAGFQALEHYYRPAGLPREQQQWLASVWRR"
FT   CDS_pept        77113..77646
FT                   /transl_table=11
FT                   /locus_tag="BPP1370"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein Rsc0991 or Rs04301 SWALL:Q8Y0Q2 (EMBL:AL646062)
FT                   (166 aa) fasta scores: E(): 2.3e-21, 48.14% id in 162 aa,
FT                   and to Caulobacter crescentus hypothetical protein Cc2489
FT                   SWALL:Q9A5G1 (EMBL:AE005918) (191 aa) fasta scores: E():
FT                   5.4e-18, 43.45% id in 168 aa"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR026353"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAK6"
FT                   /protein_id="CAE36672.1"
FT                   /translation="MAQVAGFAALARADARVLVLGSMPGVASLRAQQYYGHPRNAFWPI
FT                   AAELFGLDAAQPYAHRVQALQRAGVALWDVLQACERPGSLDAAIVADSVRPNDFQAFFA
FT                   SHPGIACVGLNGAAAATLYRRHVLPRLHGLAHLRYVALPSTSPAHAAMDFAAKLRAWRA
FT                   IAPASSDPSACLSP"
FT   CDS_pept        complement(77796..78659)
FT                   /transl_table=11
FT                   /locus_tag="BPP1371"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Rb0265 or Smb20275 SWALL:Q92WR4 (EMBL:AL603642) (286 aa)
FT                   fasta scores: E(): 3.6e-47, 51.31% id in 267 aa, and to
FT                   Ralstonia solanacearum hypothetical protein Rsc0083 or
FT                   Rs02257 SWALL:Q8Y397 (EMBL:AL646057) (281 aa) fasta scores:
FT                   E(): 9e-35, 54.48% id in 279 aa"
FT                   /db_xref="GOA:Q7WAK5"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAK5"
FT                   /protein_id="CAE36673.1"
FT                   /translation="MSPSLFAAGAQAALADSPLIVTVAPNGAYKTAADHPAVPLTAAAL
FT                   AAEARACLDAGAAMMHMHVRTPEGRHSLDVAAYREALAAVRQAVGEELLVQVTSEAAGV
FT                   YRAAEQMAMVRELRPEAVSMGLREIAVPEMPERELADFLAWVAAERIMAQIILYDAADV
FT                   ARWQALRARGLAPEGAWSVLFVLGRYSAGQVSSPRDLLPFLEVYDGSLPWAVCAFGREE
FT                   NACVATAAAFGGHMRVGFENNLKLSDGATAPGNAALVAQAAQAGRVLGRPIATAAQARE
FT                   IYGRLA"
FT   misc_feature    complement(78615..78659)
FT                   /note="Signal peptide predicted for BPP1371 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.943) with cleavage site
FT                   probability 0.897 between residues 15 and 16"
FT   CDS_pept        complement(78656..79618)
FT                   /transl_table=11
FT                   /locus_tag="BPP1372"
FT                   /product="probable 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="Similar to Escherichia coli probable
FT                   3-hydroxybutyryl-CoA dehydrogenase PaaH or B1395
FT                   SWALL:PAAH_ECOLI (SWALL:P76083) (475 aa) fasta scores: E():
FT                   6.4e-20, 35.21% id in 284 aa, and to Mycobacterium
FT                   tuberculosis putative 3-hydroxybutyryl-CoA dehydrogenase
FT                   FadB3 or Rv1715 or Mtv048.02 or Mt1754 SWALL:O53928
FT                   (EMBL:AL022003) (304 aa) fasta scores: E(): 2.3e-29, 38% id
FT                   in 300 aa"
FT                   /db_xref="GOA:Q7WAK4"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAK4"
FT                   /protein_id="CAE36674.1"
FT                   /translation="MSSPDSALGRPGASHAVVIGGGTMGADVAVVLARALCRTTVVEPD
FT                   AARAAALPRRAADNLAQAGRAEGAAHIAVVPGLDAVEWDSVGLVIECVPERLDIKQALF
FT                   AELARRAPAHAILASNSSSFPISAIGAGLPTRERMLGLHFFMPAHLVPLVEVVLCEASD
FT                   PACADVLIAFMRRCGMVPVRVAQDLPGFLANRLQHALSREAFDLIDRGIASPEDVDAAV
FT                   RFGFGFRFLAAGPVMQRDHAGIDVHAAAGATMYPTFCNADTPARCLTERAADGRHGMKA
FT                   GTGFYAWTPETIAAERARYDRLLRAGLDLLGAELPEIQP"
FT   misc_feature    complement(78755..79051)
FT                   /note="HMMPfam hit to PF00725, 3-hydroxyacyl-CoA
FT                   dehydrogenase, C-terminal domain, score 1.9e-12"
FT   misc_feature    complement(79055..79591)
FT                   /note="HMMPfam hit to PF02737, 3-hydroxyacyl-CoA
FT                   dehydrogenase, NAD binding domain, score 5.9e-32"
FT   CDS_pept        79733..80734
FT                   /transl_table=11
FT                   /locus_tag="BPP1373"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator Pa1998 SWALL:Q9I2B1
FT                   (EMBL:AE004626) (306 aa) fasta scores: E(): 3.7e-25, 32.63%
FT                   id in 285 aa, and to Rhizobium loti transcriptional
FT                   regulator Mlr6981 SWALL:Q987N6 (EMBL:AP003010) (299 aa)
FT                   fasta scores: E(): 5.4e-23, 31.97% id in 294 aa"
FT                   /db_xref="GOA:Q7WAK3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAK3"
FT                   /protein_id="CAE36675.1"
FT                   /translation="MKINLSMRDIETVLVLGRTLNFRQAAAQLHLSQSALSTQVLRIEE
FT                   ALGVRLFDRTTRTVRLTAAGEVFMQQAASLQVAFREAIDAVSGIASAEHGQVAVAALPS
FT                   LAARLLPRVLMAYRQAHPGVALKVHDTLSGPAFDLVRAGEVDFALTAADPQQADLHYVP
FT                   MMSDSFILLIPQDHALARGKGPLRWADTLAAPHVSMVHPSSVRQYAEWAFLQNRIRFQP
FT                   AFEAEHLATIVAMVECGFGVAALPEIAAAAVAHSGIVEHPLTGPVAERSIGLVTSRNRT
FT                   LSPAAAALVAQLREHLAASAYKPAPAAPSARTTAARARSRETAPGSPGAPRR"
FT   misc_feature    79751..79930
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 1.5e-18"
FT   misc_feature    79793..79885
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    80000..80626
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 2.1e-46"
FT   CDS_pept        complement(80658..81950)
FT                   /transl_table=11
FT                   /locus_tag="BPP1374"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Agrobacterium tumefaciens putative
FT                   transmembrane protein DctM SWALL:Q9F7C8 (EMBL:AF282677)
FT                   (416 aa) fasta scores: E(): 4.9e-61, 43.9% id in 410 aa,
FT                   and to Pasteurella multocida hypothetical protein Pm1527
FT                   SWALL:Q9CKS9 (EMBL:AE006189) (442 aa) fasta scores: E():
FT                   1.2e-58, 39.11% id in 427 aa"
FT                   /db_xref="GOA:Q7WAK2"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAK2"
FT                   /protein_id="CAE36676.1"
FT                   /translation="MIESLSALGAMLALVFMRVPVAFAMALVGFVGLGLLRGWPPAYAM
FT                   AGSVIYESGFQYLLSVLPLFILMGNFVTESRMSRELYAAAHALLGHRRGGLAMSTIAAC
FT                   GGFGAICGSSLATAATMAKVAYPEMRRMGYSEKLAAGSIAAGGTLGVLIPPSIIMVVYC
FT                   LLTEQSIGKMFAAGVLPGVLAILCYMAAVAWVVRRDPAAGPRGPRSTWPHTLHALRQVW
FT                   MVLALIGMLLGGIYGGLFTPAEAAGVGAFLSFLFACSRRAMTWRRFLDVVVESAKTTGM
FT                   IFVVMIGALMLANFINFTSLPQDLLDVVARHQLSPLTVILAICVIYIVLGCVLESMSMI
FT                   LLTVPVFYPLVQSLGFDLIWFGVIVVVVTEISFITPPFGMNVFVLRGLLPGVSTPTIFR
FT                   GVMPFVVSDVVRLAILVLFPSISLLLPSYVR"
FT   misc_feature    complement(join(80664..80720,80811..80876,80898..80999,
FT                   81045..81110,81174..81275,81363..81428,81456..81521,
FT                   81603..81668,81732..81788,81849..81914))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BPP1374 by TMHMM2.0 at aa 12-34, 54-73, 94-116, 143-165,
FT                   174-196, 225-259, 280-302, 317-351, 358-380 and 410-429"
FT   misc_feature    complement(81072..81548)
FT                   /note="HMMPfam hit to PF00597, DedA family, score 0.0052"
FT   misc_feature    complement(81879..81950)
FT                   /note="Signal peptide predicted for BPP1374 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.849 between residues 24 and 25"
FT   CDS_pept        complement(81943..82434)
FT                   /transl_table=11
FT                   /locus_tag="BPP1375"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Rb0359 or Smb20373 SWALL:Q92WI0 (EMBL:AL603643) (155 aa)
FT                   fasta scores: E(): 0.0014, 24.34% id in 152 aa, and to
FT                   Escherichia coli hypothetical protein YiaM or B3577
FT                   SWALL:YIAM_ECOLI (SWALL:P37674) (157 aa) fasta scores: E():
FT                   0.0014, 25.8% id in 155 aa"
FT                   /db_xref="GOA:Q7WAK1"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAK1"
FT                   /protein_id="CAE36677.1"
FT                   /translation="MRILDRAVTALLRAIVVISLCGMSLLTVADATGRYLLNRPIMGTV
FT                   EMVELLMVAVIFASIPLVTRARGHITVDSFSHLFSPATLRAQDCVAGLLALTVSACLAW
FT                   VALRKAQSTADYGDMTPMLNIPLAPFVYAMAVLLALDAAYRLAALVGPAATQPEPTQDD
FT                   "
FT   misc_feature    complement(join(82003..82068,82114..82164,82246..82311,
FT                   82342..82407))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BPP1375 by TMHMM2.0 at aa 9-31, 41-63, 90-107 and 122-144"
FT   misc_feature    complement(82348..82434)
FT                   /note="Signal peptide predicted for BPP1375 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.982) with cleavage site
FT                   probability 0.885 between residues 29 and 30"
FT   CDS_pept        complement(82444..83475)
FT                   /transl_table=11
FT                   /locus_tag="BPP1376"
FT                   /product="putative extracellular solute-binding protein"
FT                   /note="Similar to Agrobacterium tumefaciens putative
FT                   periplasmatic membrane protein DctP SWALL:Q9F7C9
FT                   (EMBL:AF282677) (330 aa) fasta scores: E(): 4.2e-20, 27.19%
FT                   id in 342 aa, and to Pasteurella multocida DctP or Pm1525
FT                   SWALL:Q9CKT1 (EMBL:AE006189) (340 aa) fasta scores: E():
FT                   4.5e-21, 28.78% id in 337 aa"
FT                   /db_xref="GOA:Q7WAK0"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAK0"
FT                   /protein_id="CAE36678.1"
FT                   /translation="MMHKTLAAALFALGLAGTAPAIAQKPVELTLSSWLPPTHAVVADF
FT                   LMPWGEEIRKATDGRVTLRLLPKAVTNPAGHFDAVRDGLVDVTFVSHAYYPGRFQLTKF
FT                   AVLPFSGDTATSRSIAAWDTYEKYLLKADEHKGVRLLGIYAHGPGIAFTTSKPVKQIGD
FT                   FQGLKIRVGGGMAADVAKAVGASPIAKPAPESYELLSTGVADGVFFPAESLVSFKLDSI
FT                   IRHATEFPGGLYSDTHAVIINRDAFARLSKQDQDTLVRLSGRHLAELAGRAWDTHDAAA
FT                   RKVLEGGEIELVKADDALIEAVRERTKGFEQAWLDAAKAKGIDGPAALASFRAEIKQLD
FT                   QQR"
FT   misc_feature    complement(82513..83385)
FT                   /note="HMMPfam hit to PF03480, Bacterial extracellular
FT                   solute-binding protein, family 7, score 2.4e-19"
FT   misc_feature    complement(83407..83475)
FT                   /note="Signal peptide predicted for BPP1376 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.983 between residues 23 and 24"
FT   CDS_pept        complement(83531..84490)
FT                   /transl_table=11
FT                   /locus_tag="BPP1377"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Alcaligenes eutrophus hypothetical 34.2
FT                   kDa protein in gbd 5'region SWALL:Q44016 (EMBL:L36817) (324
FT                   aa) fasta scores: E(): 6.5e-35, 41% id in 317 aa, and to
FT                   Yersinia pestis hypothetical protein Ypo2238 SWALL:Q8ZED6
FT                   (EMBL:AJ414151) (333 aa) fasta scores: E(): 1.9e-31, 35.64%
FT                   id in 317 aa"
FT                   /db_xref="GOA:Q7WAJ9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ9"
FT                   /protein_id="CAE36679.1"
FT                   /translation="MRVLITGANGYIGRALAERLCALPGVPGYGALEQLTLCDLAFDAA
FT                   PADPRVRQVAGDFADPATLAAITDPPPDLVFHLACVASGRAELEFELGLRVNLEGSLRL
FT                   LEQLRRQGRSPGLVFTSSIAVYGAPLPALVTDDTPLAPALSYGAQKQAVEILLADYTRR
FT                   GFVRGRAVRLPGVAPRPPAPNGAWSAFSSTLLRALAAGQPCEMPVGPQATLWLMSLPCC
FT                   VDNLLRAAELTAQAPPPGGRTGWTLPALRVSVRDIVQAFDARSQGAATPLVSYTPRPDI
FT                   EAQFGNQPPLQCDAAQAAGFRHDSSLPALLERAVGPPP"
FT   CDS_pept        complement(84478..85284)
FT                   /transl_table=11
FT                   /locus_tag="BPP1378"
FT                   /product="putative exported protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa0550 SWALL:Q9I5Y6 (EMBL:AE004491) (265 aa) fasta
FT                   scores: E(): 8.6e-34, 46.12% id in 258 aa, and to Ralstonia
FT                   solanacearum hypothetical protein Rsc0020 or Rs01842
FT                   SWALL:Q8Y3G0 (EMBL:AL646057) (262 aa) fasta scores: E():
FT                   1.6e-32, 43.96% id in 257 aa"
FT                   /db_xref="GOA:Q7WAJ8"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ8"
FT                   /protein_id="CAE36680.1"
FT                   /translation="MKLAANLTLLYPGLPLAARMAAAREDGFAGVEILFPYDQPPAQLA
FT                   AQLREHGLALALVNTPLGAAGEKGLACVPGREADFGAALDQALALCRATGCRIVHAMAG
FT                   MPPAPAGMDECRATLIGNLQRAAPRAAQAGVTLTLEPLNRADMPGYFYYLPEQAADIIR
FT                   AVDHPNVGLQFDIYHNLREGLDPHAELRRVLPLVRHVQFAGPDGRHEPDPASPPVAATL
FT                   RLLAQSGYGGWMGCEYTPRGLASAGLKAWRGAYDAACGSGGAACAS"
FT   misc_feature    complement(85216..85284)
FT                   /note="Signal peptide predicted for BPP1378 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.867) with cleavage site
FT                   probability 0.708 between residues 23 and 24"
FT   CDS_pept        complement(85281..86177)
FT                   /transl_table=11
FT                   /locus_tag="BPP1379"
FT                   /product="probable dehydrogenase"
FT                   /note="Similar to Escherichia coli
FT                   2-hydroxy-3-oxopropionate reductase GarR or B3125
FT                   SWALL:GARR_ECOLI (SWALL:P23523) (294 aa) fasta scores: E():
FT                   6.9e-20, 33.21% id in 277 aa, and to Pseudomonas aeruginosa
FT                   probable 3-hydroxyisobutyrate dehydrogenase Pa3312
FT                   SWALL:Q9HYT2 (EMBL:AE004753) (296 aa) fasta scores: E():
FT                   8.3e-38, 47.97% id in 296 aa"
FT                   /db_xref="GOA:Q7WAJ7"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ7"
FT                   /protein_id="CAE36681.1"
FT                   /translation="MSATLAFCGAGLMGAPMIRRLLAAGHRVRVWNRSAAKAQALAADG
FT                   AVVCATPAEAAAGAQAVLLCLTDLAAVQATVFGPHGVADVAGGLLVDHSSIEPDATRAL
FT                   AARLLAASGRVWIDAPVSGGVAGAQAGTLSILAGGPAAAIEAAQPWLRAYAGRVTRLGD
FT                   TGAGQIGKLCNQTIVATTVNAIAEAVALARRNGIDVAALDTALAGGWADSVLLRIFVPR
FT                   MTAPVDQPLGALQTMLKNLENVAALAAASGTQLRGLQGVLDSYRTAAARGLGPGDLSDI
FT                   VRVAWPERPAAPTREPA"
FT   misc_feature    complement(85665..86174)
FT                   /note="HMMPfam hit to PF03446, NAD binding domain of
FT                   6-phosphogluconate dehydrogenase, score 0.00021"
FT   misc_feature    complement(86109..86177)
FT                   /note="Signal peptide predicted for BPP1379 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.715) with cleavage site
FT                   probability 0.695 between residues 23 and 24"
FT   CDS_pept        complement(86174..87886)
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="BPP1380"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="Similar to Mycobacterium tuberculosis dihydroxy-acid
FT                   dehydratase IlvD or Rv0189c or Mt0199 or Mtci28.28C
FT                   SWALL:ILVD_MYCTU (SWALL:O07433) (575 aa) fasta scores: E():
FT                   7.6e-93, 49.01% id in 557 aa, and to Rhizobium loti
FT                   dihydroxyacid dehydratase Mll1102 SWALL:Q98LB3
FT                   (EMBL:AP002996) (586 aa) fasta scores: E(): 8.1e-109,
FT                   56.17% id in 559 aa"
FT                   /db_xref="GOA:Q7WAJ6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ6"
FT                   /protein_id="CAE36682.1"
FT                   /translation="MSLHKHRSRMVTQGLTRTPHRAFLRATGFDDAALEKSMVGIVSTQ
FT                   GENTPCSMALGPQADRARLGVAAGGGVPVSFSTISISDGTSMNHAGMRMSLLSRETIAD
FT                   SVELVVRGHAYDALVAFAGCDKTLPAMMMAIVRLNVPAVFLYSGATLPGHAASGQVTIL
FT                   DTIEAVGRVQHGTMPAAELKAMERTCTPSAGSCPGQFTANTMAMVGEALGLSPLGSAMM
FT                   PAVYSERLAIAQRAGEHVMRALAAGGPLPRQLVTRASLENACAAVAATGGSTNAALHIP
FT                   AIAHEAGIAFTLDDVARVFKRTPLIADLQPGGRYLARDLHEAGGVPVVLKALLDGGHID
FT                   GSVLTLDGRTLAEALADTPAPDGKVVRACGQALHPTGGVAVLKGNLSPDGALLKIAGLK
FT                   SLKFSGPARVFENEEACMRAVSTHAYQPGEVLVIRNEGPRGGPGMREMLSVTAALYGQG
FT                   MGEKVALLTDGRFSGATRGLCIGYAGPEAAAGGPIALLRDGDMIHIDAEADTLDVALSD
FT                   EELARRRAAYQAPPQARLAGALEKYAALVRPACLGAVTHSGQVDWPYETPEAE"
FT   misc_feature    complement(86219..87781)
FT                   /note="HMMPfam hit to PF00920, Dehydratase family, score
FT                   1.3e-240"
FT   misc_feature    complement(86462..86497)
FT                   /note="PS00887 Dihydroxy-acid and 6-phosphogluconate
FT                   dehydratases signature 2."
FT   misc_feature    complement(87485..87517)
FT                   /note="PS00886 Dihydroxy-acid and 6-phosphogluconate
FT                   dehydratases signature 1."
FT   CDS_pept        complement(87927..88607)
FT                   /transl_table=11
FT                   /locus_tag="BPP1381"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /note="Similar to Rhizobium loti probable transcriptional
FT                   regulator Mlr1038 SWALL:Q98LF9 (EMBL:AP002996) (226 aa)
FT                   fasta scores: E(): 3.8e-22, 39.62% id in 212 aa, and to
FT                   Pseudomonas aeruginosa probable transcriptional regulator
FT                   Pa5525 SWALL:Q9HT48 (EMBL:AE004965) (246 aa) fasta scores:
FT                   E(): 3.7e-17, 35.18% id in 216 aa"
FT                   /db_xref="GOA:Q7WAJ5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ5"
FT                   /protein_id="CAE36683.1"
FT                   /translation="MPALTHPDPLVHTSVNEAIYRRLRDHLMRGDYAAGAVLGIQELAD
FT                   AFGTSAMPVREALRRLVTQRALEPMKSRSVRVPVISRASLEDIRRARVLIEGHVTAWAV
FT                   EHITAPELAELRALADQIGRSLSDTASVQAGLENNQRFHFTIYRAARSDSMLATIESLW
FT                   LQSGPYLRATRELMHSDERPSAELHAAIVDAIARRDAESARAVMAQDISWAFDRLQALQ
FT                   PAMP"
FT   misc_feature    complement(87945..87974)
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT   misc_feature    complement(88377..88553)
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 0.00024"
FT   CDS_pept        complement(88704..89390)
FT                   /transl_table=11
FT                   /locus_tag="BPP1382"
FT                   /product="probable GntR-family transcriptional regulator"
FT                   /note="Similar to Rhizobium loti probable transcriptional
FT                   regulator Mlr2114 SWALL:Q98J42 (EMBL:AP002999) (223 aa)
FT                   fasta scores: E(): 2.2e-26, 45.45% id in 198 aa, and to
FT                   Agrobacterium rhizogenes Riorf32 protein SWALL:Q9F5G0
FT                   (EMBL:AP002086) (217 aa) fasta scores: E(): 2.6e-12, 32.99%
FT                   id in 197 aa"
FT                   /db_xref="GOA:Q7WAJ4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ4"
FT                   /protein_id="CAE36684.1"
FT                   /translation="MTLTALPADPPPADALDLDLAVEQLEEDIVFGRLFPRQRLTEDEL
FT                   MARFGLKRHAVRQVLAQLEQRGAVERKRNVGAEVRAFTAREVMDLYDLRELLETRAAER
FT                   IALPVDEARLAALVAVQREHDAAVAAGNARRVFRSNQRFHRELFGLLDNPVLQQAIEEY
FT                   ARRTHPIRFGSLAAAGYRERARQEHWAMIQALRQGDRAALVALCRNHLLPSRDAYLAAA
FT                   GLRASA"
FT   misc_feature    complement(89154..89330)
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 4e-08"
FT   misc_feature    complement(89202..89276)
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT   CDS_pept        complement(89397..91139)
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="BPP1383"
FT                   /product="putative dihydroxy-acid dehydratase"
FT                   /note="Similar to Agrobacterium tumefaciens dihydroxy-acid
FT                   dehydratase IlvD or Atu3971 or Agr_l_1769 SWALL:AAL44773
FT                   (EMBL:AE009327) (574 aa) fasta scores: E(): 1.3e-95, 47.92%
FT                   id in 553 aa, and to Rhizobium meliloti putative
FT                   dihydroxy-acid dehydratase protein IlvD1 or R00822 or
FT                   Smc00884 SWALL:Q92RP0 (EMBL:AL591785) (574 aa) fasta
FT                   scores: E(): 4.5e-92, 49.09% id in 550 aa"
FT                   /db_xref="GOA:Q7WAJ3"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ3"
FT                   /protein_id="CAE36685.1"
FT                   /translation="MTQRDQGGKPPGGLSKGLTNYGDTGFSLFLRKAFIKGAGYTDDAL
FT                   ARPVIGIVNTGSSYNPCHGNAPQLVEAVKRGVMLAGGLPVDFPTISVHESFSQPTSMYL
FT                   RNLMSMDTEEMIRAQPMDAVVLIGGCDKTVPAQLMGAASAGVPAIQLVTGSMLTGSHRG
FT                   ERVGACTDCRRYWGRYRADEIDTAEITDVNNQLVASVGTCSVMGTASTMACLTEALGMM
FT                   ISGGASAPAVTADRIRVAERTGATAVAMAAARLTPERILTGKAIENALRVLLAIGGSTN
FT                   GIVHLTAIAGRLGIDIDLTGLDRMSRETPVLVDLKPSGQHYMEDFHKAGGMPALLRELR
FT                   PLLHLDALTVSGRTLGEELDAAPAPFAQEVIRAFDAPIYPVGGLAVLRGNLAPGGAIIK
FT                   QSAADARLMEHEGRAVVFEDAEDMARRIDDDALDVTADDILVLKRIGPTGAPGMPEAGY
FT                   MPIPRKLARAGVKDMVRVSDGRMSGTAAGTIVLHVTPEAAIGGPLAHVRNGDRIRLSVR
FT                   QREISLLVSEAELAQRAAAQPIERPQAERGYRKLFLDTVTQADQGVDFDFLRAPASKQT
FT                   VPPR"
FT   misc_feature    complement(89442..91001)
FT                   /note="HMMPfam hit to PF00920, Dehydratase family, score
FT                   1.2e-189"
FT   misc_feature    complement(90720..90752)
FT                   /note="PS00886 Dihydroxy-acid and 6-phosphogluconate
FT                   dehydratases signature 1."
FT   CDS_pept        91372..92376
FT                   /transl_table=11
FT                   /locus_tag="BPP1384"
FT                   /product="putative exported protein"
FT                   /note="Similar to Comamonas testosteroni OrfJ protein
FT                   SWALL:Q9RHM9 (EMBL:AB029044) (326 aa) fasta scores: E():
FT                   1.7e-46, 45.12% id in 328 aa, and to Rhizobium meliloti
FT                   hypothetical protein Ra1058 ra1058 or sma1927 SWALL:Q92Y30
FT                   (EMBL:AE007292) (330 aa) fasta scores: E(): 2.1e-52, 45.87%
FT                   id in 327 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ2"
FT                   /protein_id="CAE36686.1"
FT                   /translation="MSDRQSARLPRRAALCSMLALCAGFALQPVAAQSAYPDRPIRMIV
FT                   PYPPGGATDVIGRVLAKEMSGALGQSVVVENRAGAAGNIGADVVAKATPDGYTILMGAM
FT                   TSHAINAVLYQGRVSYDIEKSFAPVAIVGTVPLVFVVNPAVPADSLQSLIALAKSKPGY
FT                   LTMASAGNGSPQHLAGEMFKRVAGVDLLHVPYKGSGPAMTDLMGGQVLSMIETVPAAQG
FT                   NVKGGKLRALAVASAQRVESLPDVPTTAEAGLPNFQVSSMFGIAAPAGTPVPVVERLNA
FT                   VLKEALAKPEVQTALLNQGAISTWTTPADAAARISAERQQWATVIAEAGVKAE"
FT   misc_feature    91372..91464
FT                   /note="Signal peptide predicted for BPP1384 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.485 between residues 31 and 32"
FT   misc_feature    91408..91476
FT                   /note="1 probable transmembrane helix predicted for BPP1384
FT                   by TMHMM2.0 at aa 13-35"
FT   misc_feature    91537..92364
FT                   /note="HMMPfam hit to PF03401, Uncharacterized protein
FT                   family, UPF0065, score 3e-115"
FT   CDS_pept        complement(join(92390..92542,92547..93035,93037..94029))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="alkJ"
FT                   /gene_synonym="alcO"
FT                   /locus_tag="BPP1385"
FT                   /product="alcohol dehydrogenase [acceptor] (Pseudogene)"
FT                   /EC_number="1.1.99.-"
FT                   /note="Similar to Pseudomonas oleovorans alcohol
FT                   dehydrogenase [acceptor] AlkJ or AlcO SWALL:ALKJ_PSEOL
FT                   (SWALL:Q00593) (558 aa) fasta scores: E(): 9e-80, 41.54% id
FT                   in 532 aa, and to Ralstonia solanacearum putative choline
FT                   dehydrogenase lipoprotein oxidoreductase beta or Rsc3345 or
FT                   Rs02583 SWALL:Q8XU48 (EMBL:AL646074) (544 aa) fasta scores:
FT                   E(): 1.6e-87, 46.4% id in 543 aa"
FT                   /db_xref="PSEUDO:CAE36687.1"
FT   misc_feature    complement(join(92432..92542,92547..93035,93037..94005))
FT                   /note="HMMPfam hit to PF00732, GMC oxidoreductase, score
FT                   6.3e-179"
FT   misc_feature    complement(93205..93249)
FT                   /note="PS00624 GMC oxidoreductases signature 2."
FT   misc_feature    complement(93703..93774)
FT                   /note="PS00623 GMC oxidoreductases signature 1."
FT   CDS_pept        complement(94046..95053)
FT                   /transl_table=11
FT                   /locus_tag="BPP1386"
FT                   /product="putative exported protein"
FT                   /note="Similar to Brucella melitensis aliphatic
FT                   sulfonates-binding lipoprotein Bmeii0109 SWALL:Q8YDR6
FT                   (EMBL:AE009649) (319 aa) fasta scores: E(): 1.5e-23, 30.09%
FT                   id in 329 aa, and to Streptomyces coelicolor putative
FT                   lipoprotein Sc8g12.22 SWALL:Q9KYY3 (EMBL:AL355753) (340 aa)
FT                   fasta scores: E(): 3.9e-20, 28.04% id in 328 aa"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ1"
FT                   /protein_id="CAE36688.1"
FT                   /translation="MMNPQRRTLLKTGALAAAMAGIGIPSLARARDKVRVGYLHTPAVD
FT                   GQIWTGQQTGAFAKHGLDLELIQFTTGLELFQAMIGGSLDMLSTGAVVSNFPARGQGKV
FT                   FLVNNIEYATAQLWVRDDAGIKTLADLKGKKISTTTGTTAHVFLDRALRSVGLQAGKDV
FT                   QIVNQRMAEAVTSFISGAVPAVALWVPFDVTIRQKLPGARKLLDASTFYPEAAIVGGWA
FT                   ARNDYYDKNPKIINALIQAWAETNDYLLSHTDEALVALQKNHYQQVPLPDLKEQFKASK
FT                   YFTAAEWRQRYADGTVTRWLQQVTDFFVQSANIAQPVPAERYFDPKPYLEAVRA"
FT   misc_feature    complement(94964..95053)
FT                   /note="Signal peptide predicted for BPP1386 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.887 between residues 30 and 31"
FT   CDS_pept        complement(95076..95897)
FT                   /transl_table=11
FT                   /locus_tag="BPP1387"
FT                   /product="ATP-binding component of ABC transporter"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   ABC-transport protein, ATP-binding component Sc8g12.21
FT                   SWALL:Q9KYY4 (EMBL:AL355753) (270 aa) fasta scores: E():
FT                   2.8e-40, 46.79% id in 265 aa, and to Agrobacterium
FT                   tumefaciens ABC transporter, nucleotide binding/ATPase
FT                   protein Atu0159 or Agr_c_259 SWALL:AAK85980 (EMBL:AE008990)
FT                   (266 aa) fasta scores: E(): 7.9e-40, 46.56% id in 262 aa"
FT                   /db_xref="GOA:Q7WAJ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAJ0"
FT                   /protein_id="CAE36689.1"
FT                   /translation="MSATPASDVRIRFEDVCVDYPTADGPMRVLDGINYEIRQGEFVSV
FT                   IGPSGCGKTTMMGLVGGFVQPTAGRVLLDGQPVGGPGPDRGVIFQEYGVFPWLTVRENI
FT                   AFGLNLRSNRVAAGERAQICQRYMTLMGLSDFAHHYPKHLSGGMRQRLALARAYAVKPQ
FT                   FLLMDEPFGALDAQTRSAMQDLLLQVQMTEGKTVMLITHSVEEAIYLSSRIVVVTARPA
FT                   RIRTIIDVPFGYPRAENLHEDPRFGELRSHIRALVMEEYAKQARQTVRLSD"
FT   misc_feature    complement(95238..95780)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.7e-55"
FT   misc_feature    complement(95424..95468)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(95736..95759)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(95917..96684)
FT                   /transl_table=11
FT                   /locus_tag="BPP1388"
FT                   /product="permease component of ABC transporter"
FT                   /note="Similar to Escherichia coli taurine transport system
FT                   permease protein TauC or SsiC or B0367 SWALL:TAUC_ECOLI
FT                   (SWALL:Q47539) (275 aa) fasta scores: E(): 6.8e-30, 34.48%
FT                   id in 261 aa, and to Brucella melitensis taurine transport
FT                   system permease protein tauc bmeii0107 SWALL:Q8YDR8
FT                   (EMBL:AE009649) (246 aa) fasta scores: E(): 4e-36, 46.05%
FT                   id in 228 aa"
FT                   /db_xref="GOA:Q7WAI9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI9"
FT                   /protein_id="CAE36690.1"
FT                   /translation="MKRRSALMRALLVLAPWLLIVLLWYGIRASGLVSPALVPSPGEVW
FT                   TRFVALMQARLPHDILMSTQRVFVGVCLGTLLAVPVGFVLGWYRGVRSFIDPVINFFRA
FT                   LPPIALIPLVIVYFGIGETAKIAILFYASFFAGVIVMYEGISQINPIFVRVAKTLGATD
FT                   GEIFRKVIVPLTIPHMLTALRVALGVAWATLVASELIAAQQGLGALIQDASSFFQLDII
FT                   YVGIICIGFIALAMDLALRAAARRLVAWQDRIA"
FT   misc_feature    complement(join(95953..96018,96064..96129,96241..96306,
FT                   96322..96387,96424..96489,96604..96669))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPP1388 by TMHMM2.0 at aa 5-27, 65-87, 99-121, 126-148,
FT                   185-207 and 222-244"
FT   misc_feature    complement(96040..96255)
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 4.8e-12"
FT   misc_feature    complement(96166..96252)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   misc_feature    complement(96268..96315)
FT                   /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature."
FT   misc_feature    complement(96592..96684)
FT                   /note="Signal peptide predicted for BPP1388 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.899) with cleavage site
FT                   probability 0.228 between residues 31 and 32"
FT   CDS_pept        96784..97509
FT                   /transl_table=11
FT                   /locus_tag="BPP1389"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /note="Similar to Deinococcus radiodurans transcriptional
FT                   regulator, GntR family Dra0211 SWALL:Q9RYU6 (EMBL:AE001863)
FT                   (279 aa) fasta scores: E(): 1.4e-13, 30.04% id in 233 aa,
FT                   and to Ralstonia solanacearum putative DNA-binding
FT                   transcriptional regulatory transcription regulator protein
FT                   Rsp0079 or rs05542 SWALL:Q8XTM7 (EMBL:AL646076) (273 aa)
FT                   fasta scores: E(): 1.3e-14, 31.53% id in 241 aa"
FT                   /db_xref="GOA:Q7WAI8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI8"
FT                   /protein_id="CAE36691.1"
FT                   /translation="MAINFHDSPIPRYLQLADLMRQRIARGQWGQGHRLPSLEELVAEF
FT                   GVARVTVRQAIDVLTREGLVSPQQGRGTFVTGLPPNDRWLQVQTTLAELAKVYRDTKPK
FT                   IVNIDETITNPPLTAQDGVAAERYVYMRRVHEREGRPYCVINIYLDEQIFRRDPVRYRN
FT                   ETVIPLLVSDPALRIARAHQVLTIGTADMEVAGHLQVPVNTPIAEVRRLFLDEAGKVVY
FT                   LSEVSYRGDFIHLEMNLIP"
FT   misc_feature    96829..97008
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 8.6e-18"
FT   CDS_pept        97517..98665
FT                   /transl_table=11
FT                   /locus_tag="BPP1390"
FT                   /product="putative mandelate racemase/muconate lactonizing
FT                   enzyme"
FT                   /note="Similar to Streptomyces coelicolor putative racemase
FT                   Sce65.16C SWALL:Q9RKF7 (EMBL:AL133236) (361 aa) fasta
FT                   scores: E(): 4e-21, 32.43% id in 370 aa, and to
FT                   Agrobacterium tumefaciens hypothetical protein Atu3139 or
FT                   Agr_l_3340 SWALL:AAL43955 (EMBL:AE009244) (378 aa) fasta
FT                   scores: E(): 6.4e-26, 32.36% id in 377 aa"
FT                   /db_xref="GOA:Q7WAI7"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI7"
FT                   /protein_id="CAE36692.1"
FT                   /translation="MTRDAAPITPARVRAHVFRYPVSTPVKTSFGTMHDRPAVLVEVED
FT                   SDGAVGWGEVWCNFPACGAEHRARLVETVLAPLLTARAFADPAQAFAHLEARTAVLAIQ
FT                   TGEPGPLAQAIAGLDIALCDLAARRAGEPLWAWLGGSGDRIGVYASGINPENPEDVVAR
FT                   KAAEGYRAFKLKVGFDDARDVRNALHVRELLGAATPLMADANQGWDLPRARQMAQRLGP
FT                   AQLDWLEEPLRADRPAAEWAELAQAAPMPLAGGENIAGVAAFETALAARSLRVMQPDLA
FT                   KWGGFSGCLPVARAVVAAGLRYCPHYLGAGIGLQASAHLLAAVPGLASPGLLEVDANDN
FT                   PLRSLLSPALATLHEGRITLGGAPGLGVTPDLAALRAACAAR"
FT   misc_feature    97538..97933
FT                   /note="HMMPfam hit to PF02746, Mandelate racemase /
FT                   muconate lactonizing enzyme, N-terminal domain, score
FT                   4.9e-12"
FT   misc_feature    97892..98653
FT                   /note="HMMPfam hit to PF01188, Mandelate racemase /
FT                   muconate lactonizing enzyme, C-terminal domain, score
FT                   2.1e-10"
FT   misc_feature    98114..98209
FT                   /note="PS00909 Mandelate racemase / muconate lactonizing
FT                   enzyme family signature 2."
FT   CDS_pept        complement(98681..99601)
FT                   /transl_table=11
FT                   /locus_tag="BPP1391"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator Pa2534 SWALL:Q9I0V0
FT                   (EMBL:AE004681) (303 aa) fasta scores: E(): 9.5e-55, 50.34%
FT                   id in 294 aa, and to Rhizobium loti probable
FT                   transcriptional regulator Mlr1983 SWALL:Q98JE3
FT                   (EMBL:AP002998) (297 aa) fasta scores: E(): 5.4e-54, 47.47%
FT                   id in 297 aa"
FT                   /db_xref="GOA:Q7WAI6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI6"
FT                   /protein_id="CAE36693.1"
FT                   /translation="MDRFDSLQLFTRIVELGSFSRAAAALDIPRATATHAIKQLEARLG
FT                   ARLLDRTTRHVRATPDGQAFYERCVHVLSELDDAQSSLQRVASNPRGLLRVDMHSTHAT
FT                   KIVLPRIDDFRARYPGIDLAVSGGDRLVDLVREGIDCVIRAGNPRDSSLVARRLAVMPQ
FT                   VICASPEYLAAFGAPRHPDELAAHRVVKFFAASAAVDYPLELRIGGEIRAFALNGWISV
FT                   SDAENYVVCALRGCGLIQLPRFHVEDDLRAGRLVEVLSDWPSPDLPVSALYPSHRHLSP
FT                   RVRVFVDWLGKLYEEAFPAAAPARR"
FT   misc_feature    complement(98717..99343)
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 6.3e-46"
FT   misc_feature    complement(99413..99592)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 6.4e-17"
FT   misc_feature    complement(99458..99550)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   CDS_pept        99716..100456
FT                   /transl_table=11
FT                   /locus_tag="BPP1392"
FT                   /product="probable short-chain dehydrogenase"
FT                   /note="Similar to Bacillus subtilis 3-oxoacyl-[acyl-carrier
FT                   protein] reductase FabG SWALL:FABG_BACSU (SWALL:P51831)
FT                   (246 aa) fasta scores: E(): 1.1e-27, 42.91% id in 240 aa,
FT                   and to Pseudomonas aeruginosa probable short-chain
FT                   dehydrogenase Pa1470 SWALL:Q9I3P2 (EMBL:AE004576) (245 aa)
FT                   fasta scores: E(): 5.5e-57, 71.6% id in 243 aa"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI5"
FT                   /protein_id="CAE36694.1"
FT                   /translation="MNMDISKAAIVTGGSRGIGRAIAARLAADGFAVVVNYAGNGAKAH
FT                   ATVAAIESAGGKAIAIQGDVGKPQDVANLFAQARAAFGRIDVVVNSAGVMPMASIDAAN
FT                   LDAFDQVIATNLRGAFLVLAQAAANLGDDGRIIALSTSVIAKSLPGYGPYIASKAGVEG
FT                   LVHVLANELRGRNITVNAIAPGPVGTDLFFNGKSEEAVASIARQAPMERIGMPDEIAAA
FT                   VSFLAGPDGRWVNAQVLRVNGGFA"
FT   misc_feature    99728..100450
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 9.6e-66"
FT   CDS_pept        complement(100588..101361)
FT                   /transl_table=11
FT                   /locus_tag="BPP1393"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Salmonella typhi putative lipoprotein
FT                   Sty0979 SWALL:Q8Z804 (EMBL:AL627268) (253 aa) fasta scores:
FT                   E(): 3.5e-46, 53.3% id in 257 aa, and to Pseudomonas
FT                   aeruginosa hypothetical protein Pa0277 SWALL:Q9I6L3
FT                   (EMBL:AE004465) (252 aa) fasta scores: E(): 2.3e-50, 55.85%
FT                   id in 256 aa"
FT                   /db_xref="GOA:Q7WAI4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI4"
FT                   /protein_id="CAE36695.1"
FT                   /translation="MMKSKTKLLGGALAASLLLAGCASMKSMDTNSLLSAGSDMAKAAN
FT                   LSDADIIQLSDAACKQSDQESKIAPAGNKYSVRLTKLMRGFGNMTLNGQKVNYKVYMTE
FT                   DVNAWAMGNGCVRVYTGLMDLMNDDELRGVIGHEMGHVALGHTKKAMQTAYAVSAARQA
FT                   AGAAGNSVVASLSASQLGEMTEKFINAQFSQSQETAADDFSFDLLTEKKMNRKGLVTAF
FT                   QKLAELDGGESSMFSSHPSSPDRAARMEKRLQAGK"
FT   misc_feature    complement(100594..101094)
FT                   /note="HMMPfam hit to PF01435, Peptidase family M48, score
FT                   5.2e-05"
FT   misc_feature    complement(101239..101361)
FT                   /note="Signal peptide predicted for BPP1393 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.611 between residues 41 and 42"
FT   misc_feature    complement(101296..101328)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        101641..102063
FT                   /transl_table=11
FT                   /locus_tag="BPP1394"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium loti hypothetical protein
FT                   Mlr7891 SWALL:Q984Q5 (EMBL:AP003012) (140 aa) fasta scores:
FT                   E(): 4.5e-33, 64.49% id in 138 aa, and to Pseudomonas
FT                   aeruginosa hypothetical protein Pa4518 SWALL:Q9HVQ4
FT                   (EMBL:AE004865) (141 aa) fasta scores: E(): 1.2e-11, 39.7%
FT                   id in 136 aa"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI3"
FT                   /protein_id="CAE36696.1"
FT                   /translation="MQANLTVITLGVDDLERALRFYRDGLGLPTAGIVGREFEHGAVVF
FT                   IDLQAGLKLALWPRRSLAHDTGLPLAPPSATELSLGHNVTSRAEVDAVMAQAAQAGAAI
FT                   VKPAGDTFWGGYAGYFQDPDGHLWEVVHNPQLAPAG"
FT   misc_feature    101671..102054
FT                   /note="HMMPfam hit to PF00903, Glyoxalase/Bleomycin
FT                   resistance protein/Dioxygenase superfamily, score 4.7e-12"
FT   CDS_pept        102185..103378
FT                   /transl_table=11
FT                   /locus_tag="BPP1395"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Ralstonia solanacearum probable multidrug
FT                   transport transmembrane protein Rsp0429 or Rs00888
FT                   SWALL:Q8XSN8 (EMBL:AL646078) (399 aa) fasta scores: E():
FT                   3.8e-84, 60.93% id in 384 aa, and to Rhizobium loti
FT                   hypothetical protein Mlr8412 SWALL:Q983A8 (EMBL:AP003014)
FT                   (405 aa) fasta scores: E(): 1e-54, 43.52% id in 386 aa"
FT                   /db_xref="GOA:Q7WAI2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI2"
FT                   /protein_id="CAE36697.1"
FT                   /translation="MPSRSAQSSSNVLRLAAAQALAGANTTVVYATAAIIGEALAPSKS
FT                   LATLPISVFVVGMAASTLPAGAVAQRHGRRAAFMLGTLCGVLLGLLAALGIYLESFALF
FT                   CAAMAFGGAYAAVVLTFRFAAAECVEPHRKARALSTVLAGGVLAGVLGPQLVSYTMDAW
FT                   SGHVFAGTYLAASAVAVLAAVVLGGVDLPRPARAAAAGGRPLRVIARQPRFIAAVVCGV
FT                   VTYMLMNFLMTSAPLAMRMHGLSQHASNLGVQWHVIAMYAPSFVAGGLITRHGAVPVVA
FT                   AGLLLTAAAAVVGLAGMDAWHFWVSLTLLGVGWNFGFAGASAMVLECHLPQERTRVQAA
FT                   NDFIIFGTMVVGSFVSGDLLMRYGWEVVCWLALPPLAVAAFALRWFKPLPAGAAGRA"
FT   misc_feature    102185..102277
FT                   /note="Signal peptide predicted for BPP1395 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.971) with cleavage site
FT                   probability 0.415 between residues 31 and 32"
FT   misc_feature    join(102242..102310,102323..102391,102410..102478,
FT                   102491..102559,102596..102655,102683..102751,
FT                   102827..102895,102938..102997,103010..103078,
FT                   103106..103174,103211..103264,103274..103342)
FT                   /note="12 probable transmembrane helices predicted for
FT                   BPP1395 by TMHMM2.0 at aa 20-42, 47-69, 76-98, 103-125,
FT                   138-157, 167-189, 215-237, 252-271, 276-298, 308-330,
FT                   343-360 and 364-386"
FT   CDS_pept        complement(103385..104296)
FT                   /transl_table=11
FT                   /locus_tag="BPP1396"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator Pa2469 SWALL:Q9I113
FT                   (EMBL:AE004674) (304 aa) fasta scores: E(): 2.3e-38, 38.25%
FT                   id in 298 aa, and to Salmonella typhimurium, and Salmonella
FT                   typhi putative transcriptional regulator, LysR family
FT                   Stm2180 or Sty2410 SWALL:Q8XG81 (EMBL:AE008797) (302 aa)
FT                   fasta scores: E(): 1.2e-33, 37.74% id in 302 aa"
FT                   /db_xref="GOA:Q7WAI1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037405"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI1"
FT                   /protein_id="CAE36698.1"
FT                   /translation="MLTNWIDRLRPRHLRLLIRLCETGNLTEVAIEYGISQPALSKWLK
FT                   DLEADIGQRLFVREPRGVTPTACARELQAHARAIIGRLERARTAVDHIASGFAGHLSVG
FT                   FSPVVGPVVLPESIRRFRAAYPDVLVSVIEASIDLLLPGLRNGDFDIVVGRLEEVAMPE
FT                   DVRCETLYDEPVCLVAGRAHPLAGRRRISWEDAQAYPWISPQQGTPLRMRLEMELAVAG
FT                   QPLPRHAVESTSVQTNVALLDRSDMIAPMSRRLAEHFQRQGVLRILPLTLGSGGPIGML
FT                   WRADGVHGTHTAHFIACLRQAV"
FT   misc_feature    complement(103391..104017)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 5.3e-41"
FT   misc_feature    complement(104087..104266)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 3.1e-18"
FT   misc_feature    complement(104132..104224)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   CDS_pept        104423..106009
FT                   /transl_table=11
FT                   /locus_tag="BPP1397"
FT                   /product="probable sulfatase"
FT                   /note="Similar to Burkholderia caryophylli phosphonate
FT                   monoester hydrolase PehA SWALL:Q45087 (EMBL:U44852) (514
FT                   aa) fasta scores: E(): 2.1e-13, 28.98% id in 552 aa, and to
FT                   Pseudomonas aeruginosa probable sulfatase Pa2333
FT                   SWALL:Q9I1E5 (EMBL:AE004659) (538 aa) fasta scores: E():
FT                   1.7e-09, 31.65% id in 537 aa"
FT                   /db_xref="GOA:Q7WAI0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI0"
FT                   /protein_id="CAE36699.1"
FT                   /translation="MSQPNFLLFITDQHRADHLGAYGNSQIRTPALDALARRGWLAERF
FT                   YVASPICMPNRATLMTGRMPSAHGARHNGIPLSQRATTFVERLRQAGYGTALVGKSHLQ
FT                   NMTGNGPVWPRPQDPPAEGEAWAPEPGDYDQEWGPLWREDPAHDLATPFYGFSQVDLAV
FT                   DHGDRVWGHYWRWLQREHPEVAAQAGPDHALPAPGFELVRAGQAWRTRVPESCSTTAYL
FT                   GRRTMQALDGYAQRGQPFFIQCSFPDPHHPFTPPGKYWDMYRPEDVELPASFHASAAAG
FT                   RQPPPHVQWMYAQRDSGRAVKHTPAMFACTEREAREAIALNYGSISHIDHTVGEVLAHL
FT                   QRLGLADNTVVIFTSDHGDYLGDHQLLWKGPVHYQSVIRTPFIWADPAGAQGARSDALC
FT                   STTDIAPTILARAGLLPYNGIQGADLGALMRGEQAAPREAVLIEEEGQRVMFGFDKRVR
FT                   MRTLQTGRYRMSVYHGVSWGELYDLREDPLELRNLWDEPGSAALRQDLLFQLAQNLIGH
FT                   GETSPHPTALA"
FT   misc_feature    104432..105883
FT                   /note="HMMPfam hit to PF00884, Sulfatase, score 7.9e-27"
FT   misc_feature    104702..104725
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        106051..107028
FT                   /transl_table=11
FT                   /locus_tag="BPP1398"
FT                   /product="putative exported protein"
FT                   /note="Similar to Comamonas testosteroni OrfJ protein
FT                   SWALL:Q9RHM9 (EMBL:AB029044) (326 aa) fasta scores: E():
FT                   9.3e-35, 39.75% id in 322 aa, and to Rhizobium meliloti
FT                   hypothetical protein Ra1058 or Sma1927 SWALL:Q92Y30
FT                   (EMBL:AE007292) (330 aa) fasta scores: E(): 4.5e-37, 38.67%
FT                   id in 331 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH9"
FT                   /protein_id="CAE36700.1"
FT                   /translation="MRIFQALRHAALAAALSLGAAAAATAAYPDKPVRLVVNFTPAGPL
FT                   DLLARLVAERASRELGQTVIVENRAGAGGNIGADVVAKSAPDGYTLLITTDTLATVNPF
FT                   VYASMPADPFKDLQPVALTGTFNQVLVVQPSLGVRNLADYMAYLRQHGGTYASAGNATP
FT                   GHLTFESLRQALDLDVTHVPYRGTAPAVNDLLGGQVEAGFLVVPGVLQHIQAGKLVPLA
FT                   VSGAQRDAALPDVPTIAESGLAQVRDFDTSFGYLLMAPAGVPDEAVQAWQRVLARIYAS
FT                   PEFLERLAALDIAPTFGDAQQAAQWMRTRAARWEKVVAAAGIKP"
FT   misc_feature    106051..106128
FT                   /note="Signal peptide predicted for BPP1398 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.605 between residues 26 and 27"
FT   misc_feature    106069..106137
FT                   /note="1 probable transmembrane helix predicted for BPP1398
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    106192..107019
FT                   /note="HMMPfam hit to PF03401, Uncharacterized protein
FT                   family, UPF0065, score 1.7e-80"
FT   CDS_pept        complement(107049..107561)
FT                   /transl_table=11
FT                   /locus_tag="BPP1399"
FT                   /product="putative membrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="GOA:Q7WAH8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH8"
FT                   /protein_id="CAE36701.1"
FT                   /translation="MMRHERLRFWLAGLAAAATGWLCYAGLARLAGALGVATWIPYPAL
FT                   RRQWLLIGESWQSAEFSGAIADASVFLTALAAVAAYYCARIVYHLSFAPVRQRRARWLI
FT                   AGWIVGTVAMVALSQSLGWLYGAFPGFARIGWLSAALGFAVLAGAASGFARAWGRLMRA
FT                   RKVPATE"
FT   misc_feature    complement(join(107091..107156,107187..107252,
FT                   107292..107357,107475..107540))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BPP1399 by TMHMM2.0 at aa 7-29, 68-90, 103-125 and 135-157"
FT   misc_feature    complement(107469..107561)
FT                   /note="Signal peptide predicted for BPP1399 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.990) with cleavage site
FT                   probability 0.348 between residues 31 and 32"
FT   CDS_pept        108060..109565
FT                   /transl_table=11
FT                   /locus_tag="BPP1400"
FT                   /product="probable membrane protein"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   transmembrane protein Rsc0793 or Rs05044 SWALL:Q8Y197
FT                   (EMBL:AL646061) (500 aa) fasta scores: E(): 4.1e-134, 72.2%
FT                   id in 500 aa, and to Agrobacterium tumefaciens hypothetical
FT                   protein Atu0118 or Agr_c_184 SWALL:Q8UJ20 (EMBL:AE008986)
FT                   (501 aa) fasta scores: E(): 3.6e-122, 65.46% id in 501 aa"
FT                   /db_xref="GOA:Q7WAH7"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH7"
FT                   /protein_id="CAE36702.1"
FT                   /translation="MELLQNLALGFSVAFTPENLLYALLGCVLGTLVGVLPGLGPVPTI
FT                   AMLLPITYVLPPVAGLIMLAGIYYGTQYGGATTAILVNLPGETSAVVTVLDGHQMARNG
FT                   RAGAALALAAIGSFFAGTVATMLIAAFAPPLAEVAFKFGPAEYFSLMVLGLIGAVVLAS
FT                   GSILKAVAMIILGLLLGMVGTDVNSGVARYDFGIPELQDGIDFAIVAMGVFGFAEILTN
FT                   LEQKENRVDITDKVGSLYPNKQEMREAAPAIVRGTALGSCLGILPGGGSVLSAFASYSL
FT                   EKKLSRNPERFGKGHPAGLAGPESANNAGAQTSFIPLLTLGIPGNAVMALMVGAMTIHN
FT                   IQPGPQVMTSHPELFWGLIASMWIGNLMLVVLNLPLVGLWVKLLKVPYRILYPAILVFC
FT                   TIGVYSLNYNVFDVFVTAIFGVVGYVWSKLKCEGAPLLLGLVLGPMMEENFRRALLLSR
FT                   GDFLTFVERPLSASLLGAAALLVIIVALPSIRKKRDETFVEEE"
FT   misc_feature    108114..109373
FT                   /note="HMMPfam hit to PF01970, Integral membrane protein
FT                   DUF112, score 7e-115"
FT   misc_feature    join(108117..108185,108198..108266,108381..108449,
FT                   108492..108560,108564..108632,108675..108728,
FT                   109008..109076,109134..109202,109221..109289,
FT                   109449..109517)
FT                   /note="10 probable transmembrane helices predicted for
FT                   BPP1400 by TMHMM2.0 at aa 44-66, 71-93, 132-154, 169-191,
FT                   193-215, 230-247, 341-363, 383-405, 412-434 and 488-510"
FT   CDS_pept        complement(109663..110127)
FT                   /transl_table=11
FT                   /locus_tag="BPP1401"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium loti probable transcriptional
FT                   regulator Mlr1478 SWALL:Q98KH0 (EMBL:AP002997) (148 aa)
FT                   fasta scores: E(): 1.8e-17, 47.79% id in 136 aa, and to
FT                   Brucella melitensis transcriptional regulator, MarR family
FT                   Bmeii0520 SWALL:Q8YCK8 (EMBL:AE009688) (145 aa) fasta
FT                   scores: E(): 8.8e-16, 49.58% id in 121 aa"
FT                   /db_xref="GOA:Q7WAH6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH6"
FT                   /protein_id="CAE36703.1"
FT                   /translation="MSDVQTSSPSPAPPRGRKLDKADFAALADLRYALRRFMAFSEAAA
FT                   TESGLTAQQHQALLAIKASDDTLSVGELADRLLIRHHSAGELVDRLARMDMVRRIPSNA
FT                   DRRRVLVALTPLAEHTLDTLSAAHVEELRSVGPLLRTLLSYFDSPAYRRK"
FT   CDS_pept        complement(110237..110662)
FT                   /transl_table=11
FT                   /gene="stbB"
FT                   /locus_tag="BPP1402"
FT                   /product="putative plasmid stability protein"
FT                   /note="Similar to Pseudomonas syringae plasmid stability
FT                   protein StbB SWALL:STBB_PSESM (SWALL:Q52562) (139 aa) fasta
FT                   scores: E(): 1.3e-20, 46.76% id in 139 aa, and to Rhizobium
FT                   sp. putative plasmid stability protein Y4jK
FT                   SWALL:Y4JK_RHISN (SWALL:P55511) (140 aa) fasta scores: E():
FT                   2.9e-21, 48.57% id in 140 aa"
FT                   /db_xref="GOA:Q7WAH5"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH5"
FT                   /protein_id="CAE36704.1"
FT                   /translation="MILLDTDVLLEPLRPAPDPAVAAWLDAQHVETLYLAAPGAAEIQL
FT                   GLARLPRGKRAEALRHEFERRVLPLFMGHVLPFDTAAADAYAAVMMRAAAAGHALCAID
FT                   GCIAAIATAHGLAIATRHPARFEAAGLAAVDPWHAAA"
FT   misc_feature    complement(110252..110659)
FT                   /note="HMMPfam hit to PF01850, PIN domain, score 7.3e-13"
FT   CDS_pept        complement(110659..110898)
FT                   /transl_table=11
FT                   /gene="stbC"
FT                   /locus_tag="BPP1403"
FT                   /product="putative plasmid stability protein"
FT                   /note="Similar to Pseudomonas syringae plasmid stability
FT                   protein StbC SWALL:STBC_PSESM (SWALL:Q52561) (103 aa) fasta
FT                   scores: E(): 8.2e-12, 51.76% id in 85 aa, and to Rhizobium
FT                   sp. putative plasmid stability protein Y4jJ
FT                   SWALL:Y4JJ_RHISN (SWALL:P55510) (85 aa) fasta scores: E():
FT                   1.5e-13, 60% id in 85 aa"
FT                   /db_xref="GOA:Q7WAH4"
FT                   /db_xref="InterPro:IPR005569"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH4"
FT                   /protein_id="CAE36705.1"
FT                   /translation="MSSITVRNVPEEVHRALRVRAATHGRSTEAEIRAILENAVLPDGR
FT                   VKLGTLLSHIGRGARGMDLTIERNPAPARPASFE"
FT   CDS_pept        complement(110972..111814)
FT                   /transl_table=11
FT                   /locus_tag="BPP1404"
FT                   /product="putative AraC-family transcriptional regulator"
FT                   /note="Similar to Xylella fastidiosa transcriptional
FT                   regulator Xf1254 SWALL:Q9PDX5 (EMBL:AE003959) (280 aa)
FT                   fasta scores: E(): 5.5e-44, 45.98% id in 274 aa, and to
FT                   Agrobacterium tumefaciens transcriptional regulator, AraC
FT                   family Atu4575 or Agr_l_593 SWALL:Q8U779 (EMBL:AE009385)
FT                   (321 aa) fasta scores: E(): 4.1e-15, 31.37% id in 290 aa"
FT                   /db_xref="GOA:Q7WAH3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH3"
FT                   /protein_id="CAE36706.1"
FT                   /translation="MDRLSALLERFRVRTALLHAGTLCGHHRFEAQPGRAFLHVLRRGD
FT                   MEVRHRPGETALPRLRLAEPTLLFYPRPLHHEFINPPAEGPDLTCATLDFEGGDRHPLV
FT                   RSLPPVVCVPLDAVAGLRPALDLLFAEADQVRCGSRVLADRLFEVVLIQLLRWMLDHPA
FT                   QVGVSNGLIMGLSDPRLAKALAALHGAPGQAWPLTRMADIAGMSRSAFAAAFKTATGVT
FT                   PAAYLADWRLSLAASMLRAGHPMKRIAPELGFAGVPALSKAFRQRMGASARQWLDAQR"
FT   misc_feature    complement(110984..111112)
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 0.85"
FT   misc_feature    complement(110999..111124)
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT   misc_feature    complement(111131..111268)
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix proteins, araC family, score 8e-07"
FT   misc_feature    complement(111146..111280)
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT   CDS_pept        111952..112497
FT                   /transl_table=11
FT                   /gene="mip"
FT                   /locus_tag="BPP1405"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Legionella pneumophila Mip SWALL:Q53427
FT                   (EMBL:S71704) (184 aa) fasta scores: E(): 1.7e-22, 44.57%
FT                   id in 175 aa, and to Anabaena sp. hypothetical protein
FT                   Alr7524 SWALL:Q8ZSI6 (EMBL:AP003602) (193 aa) fasta scores:
FT                   E(): 6.8e-10, 30.06% id in 163 aa"
FT                   /db_xref="GOA:Q7WAH2"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH2"
FT                   /protein_id="CAE36707.1"
FT                   /translation="MSRVLLIDPSQAGAERQAILAQIQGAFGATPNMFKAVANSAAALK
FT                   SMWEAFGALGGGVIAARLGEQIAVAVANRNRCEYCLAAHTALGRKAGASAGDMAAAQDG
FT                   RSADPRTAAALRFALQLVEARGQVGEAEVQAVRAAGFSDEEIVEILAHVALNLFTNYVN
FT                   VAFAVPVDFPKVALRQAA"
FT   CDS_pept        112556..113068
FT                   /transl_table=11
FT                   /locus_tag="BPP1406"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Corynebacterium glutamicum
FT                   thiol-disulfide isomerase and thioredoxins cgl0914
FT                   SWALL:BAB98307 (EMBL:AP005276) (160 aa) fasta scores: E():
FT                   1.4e-28, 50.64% id in 154 aa"
FT                   /db_xref="GOA:Q7WAH1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH1"
FT                   /protein_id="CAE36708.1"
FT                   /translation="MSRHEALATVTAPPLQVDAWLNTPHPLELARLRGQVVVLHAFQML
FT                   CPGCLAHGLPQAERLHRLFRDDGVVVIGLHTVFEHHAVMGPEALRVFNHEYRWSFPIGI
FT                   DRPDPEGDMPMTMRAYSLGGTPSLVLLDRRGRIRLHHLGRLDDLALGAAIGRLLAEDAE
FT                   PAGAPPA"
FT   CDS_pept        113095..113382
FT                   /transl_table=11
FT                   /locus_tag="BPP1407"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical 7.8
FT                   kDa protein Sc10f4.38C SWALL:Q9F3M3 (EMBL:AL450350) (69 aa)
FT                   fasta scores: E(): 5.2e-13, 57.81% id in 64 aa, and to
FT                   Streptomyces coelicolor hypothetical 9.9 kDa protein
FT                   Scf43a.35C SWALL:Q9XA80 (EMBL:AL096837) (88 aa) fasta
FT                   scores: E(): 0.00075, 29.07% id in 86 aa"
FT                   /db_xref="InterPro:IPR021331"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH0"
FT                   /protein_id="CAE36709.1"
FT                   /translation="MREARPRAGRAFATGGDGMTGKTAFRIGDHVAWNSEAGQVSGTII
FT                   AIHTRDFDYKGHTHRASPDHPQYEIKSDKTDHIAAHRGEVLRRVRAKGGA"
FT   misc_feature    113140..113163
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    113173..113259
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        113379..113939
FT                   /transl_table=11
FT                   /locus_tag="BPP1408"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor conserved
FT                   hypothetical protein Sc10f4.37C SWALL:Q9F3M4
FT                   (EMBL:AL450350) (178 aa) fasta scores: E(): 7e-24, 44.25%
FT                   id in 174 aa, and to Aeropyrum pernix hypothetical protein
FT                   Ape2246 SWALL:Q9Y9P2 (EMBL:AP000064) (188 aa) fasta scores:
FT                   E(): 8.2e-19, 45.16% id in 155 aa"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="InterPro:IPR014519"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG9"
FT                   /protein_id="CAE36710.1"
FT                   /translation="MRPPFHTIGHSNRSLEAFVALLEAAGIELVVDIRTVPRSRANPQF
FT                   NQDALPGSLDGRGIAYEHLAALGGLRPRSRTVPREVNGYWDNDSFHNYADYALSQAFYA
FT                   GLEHLVARGRAQRSAVMCSEAVWWRCHRRIVADHLLARGETVFHIMEAGRIDPASLTPG
FT                   ALVRPDGMVVYPGADAAVRPPMP"
FT   CDS_pept        114017..115063
FT                   /transl_table=11
FT                   /locus_tag="BPP1409"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Zymomonas mobilis hypothetical 36.5 kDa
FT                   protein SWALL:Q9RH20 (EMBL:AF088897) (322 aa) fasta scores:
FT                   E(): 2.1e-70, 57.84% id in 306 aa, and to Mycobacterium
FT                   tuberculosis hypothetical protein Rv0799c or Mtcy07h7a.10
FT                   or Mtci429b.01 or Mt0820 SWALL:O07180 (EMBL:Z96797) (335
FT                   aa) fasta scores: E(): 6.9e-70, 56.56% id in 343 aa"
FT                   /db_xref="GOA:Q7WAG8"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG8"
FT                   /protein_id="CAE36711.1"
FT                   /translation="MPQNNPEPQAVVSPITRSAIFLVATVGADNEAADKVRALCGKLAD
FT                   LARAVGKRVPAGNLSCVCGFSAAGWDRLFGQPRPAELHPFREFSAGERRAPATPGDLLL
FT                   HIRAEQMDLCFELATHVMAQLGDAVTVVDEVHGFRYFDLRSMVGFVDGTENPTGREALD
FT                   FTLVDDADPDFAGGSYVLVQKYLHDMDGWNALSVETQERIIGRTKLSDIELDEAVKPSN
FT                   SHSALTTLEENGQEIKILRDNMPFGRPGSGEFGTYFIGYARSPAPIEQMLENMVVGRPP
FT                   GNYDRLLDFSRAVTGGLFFAPSADLLEALAERDPQDTDGSRLDPAPAARAPHDGSLNIG
FT                   SLKGNPQQ"
FT   CDS_pept        115060..115863
FT                   /transl_table=11
FT                   /gene="linM18"
FT                   /locus_tag="BPP1410"
FT                   /product="bacteriocin"
FT                   /note="Similar to Brevibacterium linens bacteriocin linocin
FT                   M18 LinM18 SWALL:Q45296 (EMBL:X93588) (266 aa) fasta
FT                   scores: E(): 9.5e-54, 56.6% id in 265 aa, and to
FT                   Mycobacterium tuberculosis 29 kDa antigen cfp29
FT                   SWALL:O07812 (EMBL:Y12820) (265 aa) fasta scores: E():
FT                   2e-59, 62.5% id in 264 aa"
FT                   /db_xref="GOA:Q7WAG7"
FT                   /db_xref="InterPro:IPR007544"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG7"
FT                   /protein_id="CAE36712.1"
FT                   /translation="MNNLYRDLAPISAAAWAQIEEEVARTFKRSVAGRRVVDVKDPGGF
FT                   GLAAVGTGHLRGIAAPQKGVDAKLREVKALVELTVPFELQRDEIDAVERGANDADWQPA
FT                   KDAATELAYAEDRAIFDGYKAAGIVGIREGSSNSRLELPTDAADYPAAVGRALEQLRLA
FT                   GVDGPYSVLLGADAYTALSEGSDDGYPTIDHIKRIVSGDIIWAPALNGGCVLSTRGGDF
FT                   ELHLGQDLSIGYQSHTDKVVRLYLRETLTFLMLTSEASVPVAPKG"
FT   CDS_pept        complement(115918..117216)
FT                   /transl_table=11
FT                   /locus_tag="BPP1411"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Agrobacterium tumefaciens putative
FT                   transmembrane protein DctM SWALL:Q9F7C8 (EMBL:AF282677)
FT                   (416 aa) fasta scores: E(): 6e-53, 40.67% id in 418 aa, and
FT                   to Rhizobium meliloti hypothetical protein Ra0081 or
FT                   Sma0151 SWALL:Q930W3 (EMBL:AE007202) (866 aa) fasta scores:
FT                   E(): 7.9e-52, 41.62% id in 382 aa"
FT                   /db_xref="GOA:Q7WAG6"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG6"
FT                   /protein_id="CAE36713.1"
FT                   /translation="MDAVLILTVILGLFGLLLVLGIPIFAALGVPSILGIYLVGGASAL
FT                   NVVPSVLHRGIASYSLICIPLFILMGETLARTSIGARLYTLFYTWLSRVRCSLAIASVG
FT                   ASAIFGAMSGVSVAGAATIGRVAIPEMLKRRYDPGLAGGSVAAAGSLALLIPPSVGFVL
FT                   YGEIASQSIGKLFSAAIVPGLLLSVLMMLYLYGLSRIKPSVAPDEAQKVSWRERWQALR
FT                   DVWAAIVLIVAVLGTIYLGIATPTEASGLGAAGALLVALGYRELDRAKLREIVRSTIVT
FT                   SSMILLIVAAALLFGHVLMRLQAPQMLIAWVAALAQPDWVILLLILVFLLIVGMFLDIV
FT                   SIILITTPIVLPVITSLGLDPIWFGVVMIIMCEMAVITPPIGLNLYVIKGVAPEISLRD
FT                   ITMGALPFVLVEALAVLILVLFPQLALWLPSHM"
FT   misc_feature    complement(join(115936..116001,116065..116130,
FT                   116191..116256,116320..116385,116479..116544,
FT                   116626..116691,116731..116796,116860..116925,
FT                   116986..117051,117073..117123,117136..117201))
FT                   /note="11 probable transmembrane helices predicted for
FT                   BPP1411 by TMHMM2.0 at aa 5-27, 31-48, 55-77, 97-119,
FT                   140-162, 175-197, 224-246, 277-299, 320-342, 362-384 and
FT                   405-427"
FT   misc_feature    complement(117130..117216)
FT                   /note="Signal peptide predicted for BPP1411 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.952) with cleavage site
FT                   probability 0.644 between residues 29 and 30"
FT   CDS_pept        complement(117220..117741)
FT                   /transl_table=11
FT                   /locus_tag="BPP1412"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Klebsiella pneumoniae putative small
FT                   integral C4-dicarboxylate membrane transport protein DctQ
FT                   dctQ SWALL:Q9RN75 (EMBL:AF186091) (136 aa) fasta scores:
FT                   E(): 1.3e-05, 26.89% id in 119 aa"
FT                   /db_xref="GOA:Q7WAG5"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG5"
FT                   /protein_id="CAE36714.1"
FT                   /translation="MKSLLDRLTRIGHGTNRAAVFIAQAALLLMMLLTVYSVIARYVLQ
FT                   QPSVHAVEISIYLLLLVTWLSVGWTHLLERHVSMEMLSIRVRGRGKRLLNVFRELVVLV
FT                   FCGFLLHAGVQIAATALARNYRSTSLLAFPMWIAYGLIAVGALLLAIAAACKLNHPDGN
FT                   AAIAPPSPEA"
FT   misc_feature    complement(join(117283..117348,117394..117459,
FT                   117523..117579,117625..117681))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BPP1412 by TMHMM2.0 at aa 20-39, 54-73, 94-116 and 131-153"
FT   misc_feature    complement(117607..117741)
FT                   /note="Signal peptide predicted for BPP1412 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.714) with cleavage site
FT                   probability 0.340 between residues 45 and 46"
FT   CDS_pept        complement(117783..118790)
FT                   /transl_table=11
FT                   /locus_tag="BPP1413"
FT                   /product="putative extracellular solute-binding protein"
FT                   /note="Similar to Rhizobium meliloti putative periplasmic
FT                   binding protein R01699 or smc00271 SWALL:Q92PN7
FT                   (EMBL:AL591788) (325 aa) fasta scores: E(): 1.4e-16, 29.2%
FT                   id in 315 aa, and to Pasteurella multocida hypothetical
FT                   protein Pm1252 SWALL:Q9CLH9 (EMBL:AE006164) (328 aa) fasta
FT                   scores: E(): 4.7e-18, 28.66% id in 314 aa"
FT                   /db_xref="GOA:Q7WAG4"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG4"
FT                   /protein_id="CAE36715.1"
FT                   /translation="MNKTWIAKLLPAVLLALSANAGAADKPIELTLSTYAPPSYEYMWK
FT                   PLETFIAYVEKESQGRVKIKAFHSAQLFDGYEELPALSRGDIDITTVVSTYASGAMPVL
FT                   NLFTMPFVFQDTAHLERAAKAGLLDVSIRGEMRDKYGIEVLGLAPIDPYQIYSRRAPVR
FT                   TAADFKGKVWATTGAADARAIQLLGGSPTSMPSSELYLALDRGVVDGTPRPLITGLGRS
FT                   LHEVVKHLSLATLAIDTSLLSMNKAKFDSLPPDIQDIIRRGAQVRDEEQFRQVYAYIEQ
FT                   GVAKFEKNGVSVYTIEPAALQDMRAATQPAVQEWVAQEPAASRHLELLEKTRAN"
FT   misc_feature    complement(117834..118697)
FT                   /note="HMMPfam hit to PF03480, Bacterial extracellular
FT                   solute-binding protein, family 7, score 6.8e-49"
FT   misc_feature    complement(118722..118790)
FT                   /note="Signal peptide predicted for BPP1413 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.987 between residues 23 and 24"
FT   CDS_pept        complement(118815..119441)
FT                   /transl_table=11
FT                   /locus_tag="BPP1414"
FT                   /product="putative isochorismatase"
FT                   /note="Similar to Escherichia coli isochorismatase EntB or
FT                   EntG or B0595 or Z0737 or Ecs0634 SWALL:ENTB_ECOLI
FT                   (SWALL:P15048) (285 aa) fasta scores: E(): 2.2e-06, 30.15%
FT                   id in 189 aa, and to Arthrobacter sp N-carbamoylsarcosine
FT                   amidase SWALL:CSH_ARTSP (SWALL:P32400) (264 aa) fasta
FT                   scores: E(): 1.8e-12, 31.86% id in 204 aa"
FT                   /db_xref="GOA:Q7WAG3"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG3"
FT                   /protein_id="CAE36716.1"
FT                   /translation="MLDLDNARGGFIGSHPFGRRPALVVIDFQRAFTDPDVSPLASDCA
FT                   PAIAQANRLIQAMRGRGPVVFTVVGYDGNHGDGGCFHRKCPPLKDLVRGSAGCALDERL
FT                   DYDAATDVLLHKTQASAFFGTPLAAMLAHAGCDAVLIAGCTTSGCVRASAVDAMQHGFP
FT                   PFVAQDAVTDRSAAQHLSNLIDLKSKYAEVLPTDALLPLLLNPTA"
FT   misc_feature    complement(118839..119387)
FT                   /note="HMMPfam hit to PF00857, Isochorismatase family,
FT                   score 4.1e-09"
FT   CDS_pept        complement(120016..120837)
FT                   /transl_table=11
FT                   /locus_tag="BPP1415"
FT                   /product="putative transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2117"
FT                   /db_xref="GOA:Q7WAG2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG2"
FT                   /protein_id="CAE36717.1"
FT                   /translation="MILGGAPGHEYDLHYIPAPLRRRHHSQAMSQAANPTALPAWDPPA
FT                   ILAQLRANTCFGHMAEPTLAAFAAIAQWRRLDHGELLAGRGTPAPGVVIILKGAIHTSS
FT                   FSDDGHEFALSMLEFDGLWGVAAVLDGGGMLRDSRAYQQTDILLLPRAAFLDILDGDPG
FT                   LYRYFVKLLCSRIRTAHAIIDELALRSLPQRLPRLLGALTAGRPGDDERGIAVAQTQDA
FT                   LATLLGVSRHAVNRELRQLANQGLVGLGYGEIWVRDLERLKQLWHERGAQP"
FT   misc_feature    complement(120349..120630)
FT                   /note="HMMPfam hit to PF00027, Cyclic nucleotide-binding
FT                   domain, score 0.042"
FT   CDS_pept        120876..121847
FT                   /transl_table=11
FT                   /locus_tag="BPP1416"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2116"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG1"
FT                   /protein_id="CAE36718.1"
FT                   /translation="MKIKSMLLAVLAVSMAGVSAAALSQGFPERALRVVVPYPPGGTTD
FT                   VLVRLLQKPVADAAGQSVVVDNRPGGASVIGTSHVAQAAPDGYTVLGGDLSMLVNPSLM
FT                   KDLPYDTLRDFRGVTMLARAPLVLLVHPSVPANTLDELIALAKARPGTLNFASGGYGTS
FT                   THMAGEMFRRAAGIDVVHVPYQGVAPAMSALLGGQVQMYFGGTTTGLPHIQSGKLRALA
FT                   VTGEAPSPLLPEVPTFVSRGIQGVNADTYWGVYAPARTPDAVIEKLNAYYTGALRDPAV
FT                   QQRTRDLGLTLIGNSAAEHTAQMKTMIGDWGAFVKEADIRLE"
FT   misc_feature    120876..120947
FT                   /note="Signal peptide predicted for BPP1416 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.485 between residues 24 and 25"
FT   misc_feature    120894..120947
FT                   /note="1 probable transmembrane helix predicted for BPP1416
FT                   by TMHMM2.0 at aa 7-24"
FT   misc_feature    121014..121835
FT                   /note="HMMPfam hit to PF03401, Uncharacterized protein
FT                   family, UPF0065, score 7.1e-93"
FT   CDS_pept        121851..122705
FT                   /transl_table=11
FT                   /locus_tag="BPP1417"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2115"
FT                   /db_xref="GOA:Q7WAG0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR037950"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG0"
FT                   /protein_id="CAE36719.1"
FT                   /translation="MAAKQSLVCLTFDFDAISVWLARGMDSPTPVSRGEFCAVAADRVL
FT                   DLLERLGLPSTWFIPGHTLASYPEHCRRVHEAGHEIGHHGWTHVAPNLMTREEELDGLV
FT                   RANEAIRALTGRAARGYRSPSWDLSPHTLALLLEHGFDYDSSMMGHDYLPYPVRQGDSF
FT                   PLDEPAVFGAPTRLIEVPVSWSLDDYPHFEFVRAGQSVIPGLMNANSVMDNWIEDFLYL
FT                   KENFDWGVITYTFHPFVIGRGHRMRMLERLLRRLIDEGATFVRMEEAVDAYRQRQALAA
FT                   GAA"
FT   misc_feature    121929..122384
FT                   /note="HMMPfam hit to PF01522, Polysaccharide deacetylase,
FT                   score 2.1e-11"
FT   CDS_pept        122724..123542
FT                   /transl_table=11
FT                   /locus_tag="BPP1418"
FT                   /product="putative hydrolase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2114"
FT                   /db_xref="GOA:Q7WAF9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAF9"
FT                   /protein_id="CAE36720.1"
FT                   /translation="MMQHYYERDGVRLSYYLDDYTDPWTQAPTLLLLHGAMANAQRFYS
FT                   WVPGLSRDYRVVRADLRGHGLSDVPPADKPLDLQVLTEDILALLDHLGCERVHLAGNSA
FT                   GGYVGQHLAMQHLQRIETLALFGSAPGLRNSQASTWLERVAEKGLRQFLADTIDDRFPP
FT                   ELVGTPRCEQFLDALSDHDMAYIGRFVGYMAQQEWGDQLHRITCPTLVVIPGAGRIGAM
FT                   DAYQPMRDHLKRAEILVYEGERHSICEYLPQRCVADLRSFLARHGGPAWP"
FT   misc_feature    122883..123512
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
FT                   score 1.5e-16"
FT   CDS_pept        123562..125022
FT                   /transl_table=11
FT                   /locus_tag="BPP1419"
FT                   /product="putative amidase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2113"
FT                   /db_xref="GOA:Q7WAF8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAF8"
FT                   /protein_id="CAE36721.1"
FT                   /translation="MASVMNIEQYVQQDGLALSAQLRAGATDPQALMQCAITLARQRAE
FT                   PLNALCYPDYDAALARAAAWRPTGVFGGLPFLLKDSGLACDRLPSSIGLALCKDMRFAA
FT                   NATLVERFDAAGLLPFARTTVPALCMVPTTEALVNGGPARNPWAPQRSAGGSSGGAAIA
FT                   VATGVVPLAHGSDGGGSIRIPASCCGVFGLKPSRGLVPLGPARGEAWGGMAGDGVLSRS
FT                   VRDTAAALDAIAGMERGAPYAAPAPPAGGYLAALARPFERPLRIGVWQHAWDGIEVDPA
FT                   CSATLAQAEALCRQLGHATEAIAAPPIDYQAFVRAHIGILCTHIALAVDARLAVLRRGL
FT                   RDDDLEPAILDGYRRARGISATDYAGMIQALHAVGRAMAACMQGYDLLLSPTLTRPPVP
FT                   LGEISMADDFVSFRQKAARYTTFLAVINASGQPAASVPLHIDGQGLPIGVQLIGALGRD
FT                   DLVLRLAAQLERAAPWAGRFPPAAGAGA"
FT   misc_feature    123667..124947
FT                   /note="HMMPfam hit to PF01425, Amidase, score 1.1e-67"
FT   CDS_pept        125025..125813
FT                   /transl_table=11
FT                   /locus_tag="BPP1420"
FT                   /product="putative oxidoreductase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2112"
FT                   /db_xref="GOA:Q7WAF7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAF7"
FT                   /protein_id="CAE36722.1"
FT                   /translation="MAGRTDCAPAAGRLAGRVALITGAAGGIGSAAALRFAAEGAALAL
FT                   LDRRPDAIEQLAGRICGQGGQAIGVAADVTDDDSVRQAVRRAVEHFGRIDTLFNCAGGS
FT                   VAGDTAVDKVDLALWNRTLRLDLDSTMLCCRHAVPAIVRAGGGAVVNMSSGAGLRGSFG
FT                   GHAYTAAKGAVIALTRALAAEYAPHGVRVNAICAGRIRTERILRNLDAGAPAQAGAAQR
FT                   YPCREGDPIDIAHIALFLASHESRMITGEAIAANGGYSAF"
FT   misc_feature    125067..125801
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 3.8e-72"
FT   misc_feature    125484..125570
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   tRNA            complement(125936..126011)
FT                   /note="tRNA Ala anticodon CGC, Cove score 84.28"
FT   CDS_pept        complement(126099..127604)
FT                   /transl_table=11
FT                   /locus_tag="BPP1421"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2111"
FT                   /db_xref="GOA:Q7WAF6"
FT                   /db_xref="InterPro:IPR009197"
FT                   /db_xref="InterPro:IPR010799"
FT                   /db_xref="InterPro:IPR015995"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAF6"
FT                   /protein_id="CAE36723.1"
FT                   /translation="MHILVAGFQHETNTFAPSKAGYDNFLRGEGFPALVRGDDLLALRA
FT                   VNIPAGGFLNAALADGHSVHPVLWAGASPSAHVTRDAFERIAGEIEAAARAGRYDAVYL
FT                   DLHGAMVTEHHDDGEGELLRRLRDAVGPATPIVASLDLHANVTRAMLAHASALVAYHTY
FT                   PHVDMADTGARAAALLQARAQAGKHWHGAARRLPFLIPINGMCTQLEPARGVYALLAEL
FT                   ERSEPGIASLSCALGFPAADFPECGPVVWAHGPDRDAVERAVQTLADRIAGLEAQWAPD
FT                   FLAPDEAIRQARQLAQGARRPVVIADTQDNPGAGGDANTTGMLRALIDADADNAAIGLM
FT                   CDPQAVAQALAAGVGKCVRLRLGGQSGVAGDAPCEAEFIVEHQSDGKTRYDGPMMHGMA
FT                   ADLGPTVCLRHRGVRVIVSSNKSQTLDRNLIRLGGIDPEDLAILVVKSSVHFRADFEPI
FT                   AHAVLIAKAPGPMQADPADLPWTRLAPGMRTRPRGRPFVPARP"
FT   CDS_pept        complement(127646..128428)
FT                   /transl_table=11
FT                   /locus_tag="BPP1422"
FT                   /product="putative exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2110"
FT                   /db_xref="GOA:Q7WAF5"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAF5"
FT                   /protein_id="CAE36724.1"
FT                   /translation="MKLATWNVNSLNVRLPQVLDWLAANPVDALCIQELKLTDDKFPLD
FT                   AFTEAGYHAAWAGQKTYNGVAIISREPGFALVRNNPRYEDPQQRILAVTLPSPAGDVRV
FT                   ICAYCPNGQSVDSDKYVYKLAWFDGLRDWLEEEMRTYPRLAILGDYNVAPADADVHNPE
FT                   KWEGQVLVSEPERAAFRALLDLGLTDSFRLFEQPEKSFSWWDYRQFAFRRNAGLRIDHV
FT                   LLSDALKPHCVACVIDKAPRANEQPSDHAPVIATLAFG"
FT   misc_feature    complement(127658..128428)
FT                   /note="HMMPfam hit to PF03372,
FT                   Endonuclease/Exonuclease/phosphatase family, score 1.8e-41"
FT   misc_feature    complement(127754..127789)
FT                   /note="PS00728 AP endonucleases family 1 signature 3."
FT   CDS_pept        complement(128498..128944)
FT                   /transl_table=11
FT                   /locus_tag="BPP1423"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2109"
FT                   /db_xref="GOA:Q7WAF4"
FT                   /db_xref="InterPro:IPR007418"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAF4"
FT                   /protein_id="CAE36725.1"
FT                   /translation="MTYPILLALHLLAAFVFIGTVFFEVLILESVRRQVPREAMNAVER
FT                   GIGNRARAIMPWVLLALFGAGIGMAWQHRGALEQPLASSFGLLLSLKIVLALSVLGHFA
FT                   AAMRWRRRGQLRGRRSRRLHLSVFCHLVAIVLLAKGMYYIDALR"
FT   misc_feature    complement(join(128510..128575,128636..128701,
FT                   128732..128797,128861..128926))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BPP1423 by TMHMM2.0 at aa 6-28, 49-71, 81-103 and 123-145"
FT   CDS_pept        complement(128941..130167)
FT                   /transl_table=11
FT                   /locus_tag="BPP1424"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2108"
FT                   /db_xref="GOA:Q7WAF3"
FT                   /db_xref="InterPro:IPR010266"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAF3"
FT                   /protein_id="CAE36726.1"
FT                   /translation="MAELLQIDEPAAGRAAPQWRAFLELGFRPLYLVGAAWGALSVALW
FT                   IGAPQWLGGAMAGVIWHAHEMLWGFIGAIAVGFLLTAAATWTGVNPLRGAPLAALAALW
FT                   LAARAAFLLPGMAAFWTGVACELLFFAWAAAALGRAIYRRGASRRNDGVPLLVLGLGAA
FT                   DALYLLAARAGDYPLLLQRFNAGLLCMAVIALLIARRIIPFFAMRAIAGLQIPMHTRSG
FT                   QWQLAAGLVAVAATLAQAGALTAVALAAAGLIALAQWLSWRPWATRGVPLLWILYTGYL
FT                   GLAAGLLVAAASAAGGIARAAWPAHVIGMAGFGLLIIGMITRTALGHLGRPLRTDRLML
FT                   ACYLLVIGAAALRLAALWPGPHTLAALHGATAAWVLAFVLYLWRFAPLLVRPRLRAPTA
FT                   AAMPVRSRP"
FT   misc_feature    complement(join(129010..129075,129097..129153,
FT                   129199..129264,129286..129351,129397..129489,
FT                   129550..129615,129646..129711,129775..129840,
FT                   129901..129966,130006..130071))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BPP1424 by TMHMM2.0 at aa 32-54, 67-89, 109-131, 152-174,
FT                   184-206, 226-257, 272-294, 301-323, 338-357 and 364-386"
FT   CDS_pept        complement(130160..130564)
FT                   /transl_table=11
FT                   /locus_tag="BPP1425"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2107"
FT                   /db_xref="GOA:Q7WAF2"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAF2"
FT                   /protein_id="CAE36727.1"
FT                   /translation="MGAPDLCTEEDITQLVHQFYAEVRRDAELGPIFNTHVDDWDVHLA
FT                   KLVDFWSSILRGTGRFRGTPMPRHVALPGLHAGLFERWLRLFRATAAAQPNQAMAEQAC
FT                   LMAGRIAQSLWYGYQLHRSPDQAPTDLAHG"
FT   CDS_pept        130724..131026
FT                   /transl_table=11
FT                   /locus_tag="BPP1426"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2106"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:2OJL"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAF1"
FT                   /protein_id="CAE36728.1"
FT                   /translation="MITPPDHPPRIAIQYCTQCQWLLRAAWMAQELLSTFGADLGEVAL
FT                   VPGTGGVFRIHYNGAPLWDREVDGGFPEAKVLKQRVRDHLDPGRPLGHIDGRPKP"
FT   CDS_pept        complement(131023..131793)
FT                   /transl_table=11
FT                   /locus_tag="BPP1427"
FT                   /product="putative amino-acid ABC transporter, ATP-binding
FT                   protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1362"
FT                   /db_xref="GOA:Q7WAF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAF0"
FT                   /protein_id="CAE36729.1"
FT                   /translation="MIGLQGIDKSFGGNRVLHGVDVVIPEGSVTALIGPSGSGKSTLLR
FT                   CVNLLEIPEAGVLRLGPETLAFDGRRPARDAVQRIRRQTGMVFQNFQLFPHQSVIDNVM
FT                   EGLVTVQRWDKPRARARAMELLEKVGMTAKADAWPVTLSGGQQQRVAIARALASSPRVL
FT                   LCDEPTSALDPSLAIEVVDVLRRLAGEGMTMLMATHDLRLAASIAQQVVFLEGGAVVEA
FT                   GTPREVFAQSRDARTAAFVSTLTQGLPEEWSAPA"
FT   misc_feature    complement(131143..131715)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   6.6e-64"
FT   misc_feature    complement(131326..131370)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(131671..131694)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(131790..132470)
FT                   /transl_table=11
FT                   /locus_tag="BPP1428"
FT                   /product="putative amino-acid ABC transporter, permease
FT                   protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1363"
FT                   /db_xref="GOA:Q7WAE9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAE9"
FT                   /protein_id="CAE36730.1"
FT                   /translation="MPAWLQLMLDSFWPLLHAGLMFTVPLTLLSFAAGLALAFVVALLR
FT                   LFGPWPIVALMRFYVWLIRGTPLLVQLFVIFYGLPSVGIVLDPLPAALIGFTLNVGAYN
FT                   SEVIRGAIESIPRGQWEAAYSLSMTRGQAMRRTVLPQAARVAVPPLANSFIALVKDTSL
FT                   AAVLTVPEIFQAAQRIAAVTYEPLILYTEAALIYLVFSSALSSLQVHLEKRFGQHAVFA
FT                   EQHR"
FT   misc_feature    complement(131928..132140)
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 2.3e-17"
FT   misc_feature    complement(join(132234..132299,132339..132404))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP1428 by TMHMM2.0 at aa 22-44 and 57-79"
FT   misc_feature    complement(132357..132470)
FT                   /note="Signal peptide predicted for BPP1428 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.635) with cleavage site
FT                   probability 0.379 between residues 38 and 39"
FT   CDS_pept        complement(132537..133325)
FT                   /transl_table=11
FT                   /locus_tag="BPP1429"
FT                   /product="putative amino-acid ABC transporter, periplasmic
FT                   amino acid-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1364"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAE8"
FT                   /protein_id="CAE36731.1"
FT                   /translation="MNFSLRKLLLAGLVPLAMVGTAAQADDLAAIKAAGVIKIGTEGTY
FT                   APFSYHDASNKLTGFDVEIGRAIAQKLGVKAEFVEGKWDGLIAGLDVKRYDAVINQVGI
FT                   TDARKAKYDFSDPYISSQAALIVREDNQAIKSFADLKGRKSANTLTSNFGKLAQSYGAE
FT                   VVPVQGFNEAIDLLMSGRVEATVNDNLSFLDFKKQKPNAKVKVAAYDKSKEFSESGVLI
FT                   RKNNPELQAAINKALAELKADGTYRKISEQYFGADLSAAQ"
FT   misc_feature    complement(132558..133217)
FT                   /note="HMMPfam hit to PF00497, Bacterial extracellular
FT                   solute-binding proteins, family 3, score 1.9e-82"
FT   misc_feature    complement(133110..133151)
FT                   /note="PS01039 Bacterial extracellular solute-binding
FT                   proteins, family 3 signature."
FT   misc_feature    complement(133251..133325)
FT                   /note="Signal peptide predicted for BPP1429 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.981 between residues 25 and 26"
FT   CDS_pept        complement(133568..135892)
FT                   /transl_table=11
FT                   /locus_tag="BPP1430"
FT                   /product="putative membrane transport ATPase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2722"
FT                   /db_xref="GOA:Q7WAE7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAE7"
FT                   /protein_id="CAE36732.1"
FT                   /translation="MPSTTRDLALDTPSGQRTDAHGHDHAGHDHAGHDHAHDHGIPACC
FT                   GHGHGQPAAPAAAPAWQPGPGQQVTRVRIGQMDCPTEETLIRKKLASLPEVHELDFNLM
FT                   QRVLTVLHADGALDRIDAAIRSLGMTPEPLAGDAPATPAGAAAPSRGWRLLAAGGVLAA
FT                   LSELAHFTGQPVYVAAALALAAILACGLSTYRKGWIAVRNGNLNINALMSIAVTGAMLI
FT                   GQWPEAAMVMFLFNVAELIEARALDRARHAVRGLLDLAPQTATARQPDGSWAEVPAARL
FT                   RPGDLVRVRPGERIAADGTISEGHSAIDQSPITGESLPVEKGPDDDVYAGTVNASGSFD
FT                   YRVTAAAGNTTLDRIIHAVEQAQGARAPTQRFIDRFSRIYTPAVVGLAVLVALAPPPLL
FT                   LGHAWLDSVYRALALLIIACPCALVISTPVSVVSGLTAAARRGILIKGGVYLEEGRKLR
FT                   WLALDKTGTLTQGKPVQTDLELLHDASAGGRPALRAAVSLAARSDHPVSRALAQADHAL
FT                   DAPLDEVNGFAALPGRGVQGEIGGERFQLGNRRLMRELGVSTPDIEARIDAYEAAGKTA
FT                   IALADGQRVLLLAAVADTLKASSAAAVADLHRLGVRTLMLTGDNTRAAQAVAAQAGIDE
FT                   ARGDLLPQDKLDAVEAKLDPALRVGMVGDGINDAPALARADIGFAMGAAGTGTAIETAD
FT                   VALMDDDLRKIGTFVRLSRATHRILTQNIVLALGIKAVFLVLAMAGQATLWMAVFADVG
FT                   ASLLVVANGLRLLRAGRHQAS"
FT   misc_feature    complement(join(133595..133660,133673..133738,
FT                   134594..134659,134690..134755,135317..135382))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BPP1430 by TMHMM2.0 at aa 170-192, 379-401, 411-433,
FT                   718-740 and 744-766"
FT   misc_feature    complement(133838..134524)
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 8.7e-27"
FT   misc_feature    complement(133841..133909)
FT                   /note="PS01229 Hypothetical cof family signature 2."
FT   misc_feature    complement(134168..134191)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(134486..134506)
FT                   /note="PS00154 E1-E2 ATPases phosphorylation site."
FT   misc_feature    complement(134534..135205)
FT                   /note="HMMPfam hit to PF00122, E1-E2 ATPase, score 3.1e-96"
FT   CDS_pept        135975..136409
FT                   /transl_table=11
FT                   /locus_tag="BPP1431"
FT                   /product="putative MerR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2723"
FT                   /db_xref="GOA:Q7WAE6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAE6"
FT                   /protein_id="CAE36733.1"
FT                   /translation="MKIGELARTAGTTVETVRYYEKEGLLPAPERGLNNYRSYGEAHVE
FT                   RLRLIRNCRALDMTQDEIRTVLALADNHEAGCAPINQVFDEHIAHVDARIAELTQLKAQ
FT                   LGELRQRCASARPDAEDCGILHGLSEMQVEERPERHTHLG"
FT   misc_feature    135984..136091
FT                   /note="HMMPfam hit to PF00376, Bacterial regulatory
FT                   proteins, merR family, score 1.8e-11"
FT   CDS_pept        136512..137096
FT                   /transl_table=11
FT                   /locus_tag="BPP1432"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2703"
FT                   /db_xref="GOA:Q7WAE5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAE5"
FT                   /protein_id="CAE36734.1"
FT                   /translation="MTVSPLHALTSRRSMKFLRAPAPKQDELEQILQAAMSAPDHGALR
FT                   PWRFVLIRGEAIGRLADLAIEAVKRSGDKRMTPEKEKSVREWAAGVPLFIAVAQKISHD
FT                   NTRIPEQEQLLATGAAVMNILNAAHMLGYGAFWSTGLGTYVEDVQDALGLDAMDYRFLG
FT                   FVALGTPGCAVPPAQRPDFREFVSEWQGVTV"
FT   misc_feature    136521..136970
FT                   /note="HMMPfam hit to PF00881, Nitroreductase family, score
FT                   3.7e-14"
FT   CDS_pept        complement(137166..138674)
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="BPP1433"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2702"
FT                   /db_xref="GOA:Q7WAE4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WAE4"
FT                   /protein_id="CAE36735.1"
FT                   /translation="MVQIIRQVGRRAVPWRRRGARRPYIIARIMANTSHSSQDQFANKA
FT                   QAWSARFSEPVSDLVKRYTASVDFDKRMARHDIRGSLAHADMLAAQGIISAQDLADIQR
FT                   GMQQILSEIDAGSFQWLLDLEDVHLNIEKRLVELVGDAGKRLHTGRSRNDQVATDIRLW
FT                   LRDEIDTLVDLLRQLRHALATVALENAATIMPGFTHLQVAQPVTFGHHLLAYAEMFGRD
FT                   AERLADCRRRVNRLPLGAAALAGTSYPIDRERVARTLGFDGVCRNSLDAVSDRDFGIEF
FT                   CAAGALIMTHISRLSEELVLWMSPRVGFIDLADRFCTGSSIMPQKKNPDVPELARGKTG
FT                   RVNGHLVALLTLMKGQPLAYNKDNQEDKEGLFDTADTLRDTLTIFADMAGGIKVKADNM
FT                   RAAALQGFATATDLADYLVKRGLPFRDAHEIVAHAVRDCEQRGCDLADLSLADLQAYHP
FT                   SIGEDIHQVLTLEGSVAARKHIGGTAPERVREEAQRVLAETAGA"
FT   misc_feature    complement(137250..138527)
FT                   /note="HMMPfam hit to PF00206, Lyase, score 5.1e-112"
FT   misc_feature    complement(137691..137720)
FT                   /note="PS00163 Fumarate lyases signature."
FT   CDS_pept        138695..140041
FT                   /transl_table=11
FT                   /locus_tag="BPP1434"
FT                   /product="putative membrane transport protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2701"
FT                   /db_xref="GOA:Q7WAE3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAE3"
FT                   /protein_id="CAE36736.1"
FT                   /translation="MLPKELENVVATLDNYVPDTAWGQTLVGIGVLVLTALFVQWVVAR
FT                   VVLYFAHRLLVLSGREDWDRALSRRRAYQNFWYAVPFAVVSMGIELVPHAERAVTVVGR
FT                   LSHAGAWICVFVAFSGVLSAWQDTYSATTRAQTRSIKGYIQIGKLILCAVGAVLVLSIL
FT                   LDRSPLWMISGLGALSAVLLLVFKDTLLSLVASTQLTSNDMLRIGDWIEMPQANADGFV
FT                   KDIALHTVKVQNWDNTVTTVPTYKLFSESYRNYRHMFESGGRRIKRTLRLDAASVRFMN
FT                   EEEGGRLKRFVLLRDYLQAKEDALLEANRQLGELAEVPANRRRLTNIGTFRGYALAYLR
FT                   QHPEVRQDMAMMVRMMEPQPNGIPIEIYCFTAITAWVEYERIQGDIFDHLLAILPELGL
FT                   RLFQEPSGSDLGNLAGGMREAALHEFRREQVAAGEAPLALRGDGAAPVR"
FT   misc_feature    join(138752..138820,138920..138973,139016..139069,
FT                   139118..139186,139199..139252)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BPP1434 by TMHMM2.0 at aa 20-42, 76-93, 108-125, 142-164
FT                   and 169-186"
FT   misc_feature    139127..139900
FT                   /note="HMMPfam hit to PF00924, Mechanosensitive ion
FT                   channel, score 4.6e-25"
FT   CDS_pept        140080..141714
FT                   /transl_table=11
FT                   /locus_tag="BPP1435"
FT                   /product="putative NAD synthetase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2700"
FT                   /db_xref="GOA:Q7WAE2"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAE2"
FT                   /protein_id="CAE36737.1"
FT                   /translation="MSLARVGIAQINACVGDLAGNAARVLQAARQAAGQGADVLVTPEL
FT                   VLTGYPPEDLLLRPRFIQEQQAVFERLCQDLAGLAGLHVVIGHVLARQDRLYNAATVVC
FT                   EGRVLGSYCKRELPNYSVFDEQRYFSAHGEAFGFTVKGVRFGLNICEDIWLERAPRAAA
FT                   ADGAQVLLVSNASPYNTGKQEERLSVARRSVQDTGCALIYANLVGGQDELVFDGASFAL
FT                   DAQGRMSARLPDFTEGVNVLEVDARGTVRPVTEQAAVQPYGLEEQVWNALVLGVRDYLG
FT                   KNGFPGAIIGLSGGIDSAVVLAVAVDAVGADNVRAVMMPSRYTADISLTDAADMARRLG
FT                   VQYDVIAIGEVVDRFEAALAPQFAGLPVDATEENIQARARGTLLMALSNKTGRLVLTTG
FT                   NKSEMTTGYCTLYGDMAGGFAVIKDVPKTLVYRLANWRNQRQPIIPERIITRPPSAELR
FT                   PDQTDQDSLPPYDILDGIIERYMEHNASAADIVAAGFPREAVGQVVRLIRINEYKRRQA
FT                   PPGPRITPRAFGRDWRYPVTNGFRETV"
FT   misc_feature    140086..140865
FT                   /note="HMMPfam hit to PF00795, Carbon-nitrogen hydrolase,
FT                   score 5.2e-11"
FT   misc_feature    141034..141645
FT                   /note="HMMPfam hit to PF02540, NAD synthase, score 2e-76"
FT   CDS_pept        141758..142096
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /locus_tag="BPP1436"
FT                   /product="nitrogen regulatory protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2699"
FT                   /db_xref="GOA:Q7WAE1"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAE1"
FT                   /protein_id="CAE36738.1"
FT                   /translation="MKQVTAIIKPFKLDEVREALAEVGVSGLTVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKIRVEVVLADDMVDPAIEAIVKAARTGKIGDGKIFVTPVEQAIRIRT
FT                   GESDEEAL"
FT   misc_feature    141761..142090
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00543, Nitrogen regulatory protein
FT                   P-II, score 6.8e-58"
FT   misc_feature    141893..141910
FT                   /note="PS00496 P-II protein urydylation site."
FT   misc_feature    142004..142045
FT                   /note="PS00638 P-II protein C-terminal region signature."
FT   CDS_pept        complement(142121..142495)
FT                   /transl_table=11
FT                   /locus_tag="BPP1437"
FT                   /product="endonuclease"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2698"
FT                   /db_xref="GOA:Q7WAE0"
FT                   /db_xref="InterPro:IPR004260"
FT                   /db_xref="InterPro:IPR021143"
FT                   /db_xref="InterPro:IPR024796"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAE0"
FT                   /protein_id="CAE36739.1"
FT                   /translation="MTRINCVPVEELSGPHLVAEYRELPRVFALAHKAAARGALVQPAA
FT                   YTLGKGHLLFFYTRLGYLARRHRALVEEMRRRGYRPAFAGVTREDFADIPAPFWNDWTP
FT                   TEEALALNRARIAARGGGKA"
FT   misc_feature    complement(142127..142495)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF03013, Pyrimidine dimer DNA
FT                   glycosylase, score 2.1e-22"
FT   CDS_pept        142581..142961
FT                   /transl_table=11
FT                   /locus_tag="BPP1438"
FT                   /product="putative heat shock protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2697"
FT                   /db_xref="GOA:Q7WAD9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAD9"
FT                   /protein_id="CAE36740.1"
FT                   /translation="MDKIRLDKWLWAARFYKTRSLAVQEIGKGRVQVNGQPAKPAREVA
FT                   PGDVVCIRKEDPPIHVRVCAVSGVRGPAPVARQLYEETPESAAARERAAEMRRLAPEPA
FT                   MDIVAGRPTKRDRRLIDKWRDA"
FT   misc_feature    142590..142730
FT                   /note="HMMPfam hit to PF01479, S4 domain, score 8e-13"
FT   CDS_pept        143079..145016
FT                   /transl_table=11
FT                   /locus_tag="BPP1439"
FT                   /product="putative phosphatase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2696"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAD8"
FT                   /protein_id="CAE36741.1"
FT                   /translation="MHEPTMSKRRLVLKMLGGAPMLPLGAVGAATLLAGCRAGADGAQA
FT                   AARGAGPRGDFVTAAFTSMAAPSLDAPEKMAITTVESTLEVSFSDGGRQTFQLGYEPFF
FT                   MTGDSVPDGQGATRVAGGYLDIHGRPIMDSSVPGKARQFFSDCPDGMSLLALPSARVPG
FT                   VKGNTVFAVVQFEYASHNQKGESMYGLLPSPIAVLTLAQDPATGRLALVKYSPVDTAPA
FT                   HGLWITCGASLSPWNTHLASEEYEPDATTARASAQFQGFSRNLYGDAAKANPYHYGHLP
FT                   EVVVHPDGTGTIRKHYCLGRISHELIQVMPDQRTCLMGDDATNGGLFMFVADRKADLSA
FT                   GTLYVAKWRQTSGEGPGAGTLGWINLGHARSADIEALADTLTAADIMDVRTADPGDPAF
FT                   KAIRVNGKANWVRLAPGREQAAAFLETHCYAALAGGTMAFSKMEGTTVNARDRIAYSAM
FT                   SRIETSMVDGTSPDLRVQGPEPGAVYALNLRGGQRDSAGTAIDSEWVPVDMAAVPALVG
FT                   EKLAAPDALGNRHHADRISNPDNIKFSEKLRTLFIGEDSNGHVNNFLWAYNVDSGALSR
FT                   ILSCPAGGESTGLQAVDEINGWTYITSNFQHAADWGGVHAVVRATLDPLVKANYRDGFG
FT                   ASVGYITITP"
FT   misc_feature    143079..143165
FT                   /note="Signal peptide predicted for BPP1439 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.972) with cleavage site
FT                   probability 0.408 between residues 29 and 30"
FT   misc_feature    143112..143180
FT                   /note="1 probable transmembrane helix predicted for BPP1439
FT                   by TMHMM2.0 at aa 12-34"
FT   CDS_pept        complement(145110..145655)
FT                   /transl_table=11
FT                   /locus_tag="BPP1440"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2695"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAD7"
FT                   /protein_id="CAE36742.1"
FT                   /translation="MLPIVIVSGPPGSGKTTACGLLAQADPQGLHLPSDLFYGFPAHPI
FT                   PPYRPQADAQNAAVIRAVCRSAASFAADGYRVYLDGIFGPWFLPLIAAQLQAARCPAAY
FT                   ALLDIGLDEALARVEQRSGPGQASMVRTMHDAFRAAGSLAGHRVVTAGRPAAEIADEIA
FT                   GRLQAGALALDLARWAPG"
FT   misc_feature    complement(145608..145631)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(145730..146611)
FT                   /transl_table=11
FT                   /locus_tag="BPP1441"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2694"
FT                   /db_xref="GOA:Q7WAD6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAD6"
FT                   /protein_id="CAE36743.1"
FT                   /translation="MSSIRFLRTFLAVAQHGTFSEAAEQVALTQAAVSFQMRALEAELG
FT                   RELFDRGGRLAILNAAGRELVPEIKRLLDLYDHLKAPRNVPGELAGSVSVGAIVSCMGT
FT                   LSKVVSQLKRDHPALDVRVFSGKASELAGKVEAGELDAALVVEAGRKMASTRWTPLYEE
FT                   PLVVLAHPHAPGADAREVLAANPFLRFDRTQRTGRQIDRIVRRLGGGLNEFLELNAIET
FT                   LVELVRQEVGVTLLPLLNGANWQASPQLRVLPLPAELGPAVRAIGMIERRDHARLAVTA
FT                   EICAQCGALFGR"
FT   misc_feature    complement(145736..146356)
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 8.5e-29"
FT   misc_feature    complement(146423..146602)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 5.8e-20"
FT   misc_feature    complement(146468..146560)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(146546..146611)
FT                   /note="Signal peptide predicted for BPP1441 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.716) with cleavage site
FT                   probability 0.571 between residues 22 and 23"
FT   CDS_pept        146719..148347
FT                   /transl_table=11
FT                   /locus_tag="BPP1442"
FT                   /product="putative gamma-glutamyltranspeptidase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2693"
FT                   /db_xref="GOA:Q7WAD5"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAD5"
FT                   /protein_id="CAE36744.1"
FT                   /translation="MKAFNWVNPYPSTRIPVFARNVVSTSHPLAAQAGLRMLLKGGNAV
FT                   DAAIAAAATIVLVEPVSCGLGGDCFAIVWDGRQLHGLNSSGVAPAAWNVEYFKRKYGTG
FT                   PDGLAVQPKRGWDAVTVPGVVAGWAALHEKLGKLPFEQLFEPAIEIAERGYTVPPVVAH
FT                   KWAAAAAELSEQPGYAQAFMPEGRAPRVGEHFRFPDAAYALRRIAASGGRDFYEGELAE
FT                   RIAAFSKECGGAMTLDDLRNYRPEWVKPISRSYRGYELHEIPPNGQGIAALIALGICER
FT                   FDLADMPVDSVQSQHLQIEAMKLAFSDLYRYVADPRSMEVTPQQMLDDAYLDSRARLID
FT                   PDRATHFEAGRPHAGGTIYLTAADENGMMISFIQSNYMGFGSGVVVPGTGISLQNRGVG
FT                   FSMNPASANVVEGGKRPFHTIIPGFLTRGGKPVMSFGVMGGDMQPQGHLQTVIRMLDYH
FT                   QQPQAACCAPRWKVNRDFTLDIESTMNRATVEGLRNLGHRLKAVDDPYMDFGAGQFIWR
FT                   MAESDNDLGYVAASDSRRDGQAVGF"
FT   misc_feature    146821..148332
FT                   /note="HMMPfam hit to PF01019,
FT                   Gamma-glutamyltranspeptidase, score 1.2e-170"
FT   misc_feature    146902..146946
FT                   /note="PS00678 Trp-Asp (WD) repeats signature."
FT   CDS_pept        148389..149906
FT                   /transl_table=11
FT                   /locus_tag="BPP1443"
FT                   /product="ABC-transport protein, solute-binding component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2692"
FT                   /db_xref="GOA:Q7WAD4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAD4"
FT                   /protein_id="CAE36745.1"
FT                   /translation="MTKTKSLSMMMGAAVLAGAGGAALAQDLRIGLQEDPDVLDPHRAR
FT                   TYVGRSLNVSVLLSSLKLHDCASCGTNCSFSSMSTSLSHNEVKTMRTDVQFHDGSKFDA
FT                   AAARANLERAMTLQDSMRKGELASVEKIEAPDPATLVLTLKRPDATLLAQLSDRAGMML
FT                   SPKAFEGDAAAVGRKPVCSGPYKFVERVQNDRIVLQKFDQYYGAKDYHFDKLVFLPIPD
FT                   TTVRLSNLRAGGLDILERMNPSDAPQVKNDASVQFMPVSGLGYQEVFFNTGNGKRAETN
FT                   PFKDKRVRQALALSIDRAIINEVVGGGIFDPASQPFPPASPYHSDKFPVPKRDVERARA
FT                   LLKQAGLQKVKAEFAFGNNTTTSAIAEMIQAMAAEAGFELSLRPTEYAAMLNEAQAGNF
FT                   EMIMRGWSGRVDPDGNIYQFVTCKGALNDGRYCNAEVDKLLAEARTVPDQAKRKAIYDQ
FT                   AQALLQADTHDIYLYYQPWPFVLGKNVRGFKPYPDGMVRLKGVTLAK"
FT   misc_feature    148389..148463
FT                   /note="Signal peptide predicted for BPP1443 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.995 between residues 25 and 26"
FT   misc_feature    148389..149897
FT                   /note="HMMPfam hit to PF00496, Bacterial extracellular
FT                   solute-binding proteins, family 5, score 1.5e-31"
FT   CDS_pept        149982..150926
FT                   /transl_table=11
FT                   /locus_tag="BPP1444"
FT                   /product="ABC-transport protein, inner membrane component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2691"
FT                   /db_xref="GOA:Q7WAD3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAD3"
FT                   /protein_id="CAE36746.1"
FT                   /translation="MFKLILRRVVVAIPTLILVSMIVFMLQKILPGDPVLTLAGEERDP
FT                   AVLDYLREKYRLNDPLPVQYGAWVAQVLQGDLGKSMRTDVPVLTLIAQKLPVTLQLAVM
FT                   AMAFALLVGIPLGIVAAVRKGTAVEMGANMAALSGMSIPNFWLGIILIMVVSVQWKLLP
FT                   ASGYVSPAEDFWLSIKTMLMPALALSTAIAAYLMRHTRSAMLEALSADYVRTARAKGVA
FT                   PRKVVLRHALRNALMPIVTLVTLLFGELLAGAVLTEQVFTIPGFGKLIVDAVFNRDYAV
FT                   VQGVVLCVAVGFIVMNLLADILYILVNPRLRHA"
FT   misc_feature    149982..150056
FT                   /note="Signal peptide predicted for BPP1444 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.821) with cleavage site
FT                   probability 0.559 between residues 25 and 26"
FT   misc_feature    join(149994..150062,150279..150347,150405..150458,
FT                   150501..150569,150681..150749,150834..150902)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPP1444 by TMHMM2.0 at aa 5-27, 100-122, 142-159, 174-196,
FT                   234-256 and 285-307"
FT   misc_feature    150591..150806
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 3.8e-07"
FT   misc_feature    150594..150680
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        150923..151798
FT                   /transl_table=11
FT                   /locus_tag="BPP1445"
FT                   /product="probable ABC-transport protein, inner membrane
FT                   component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2690"
FT                   /db_xref="GOA:Q7WAD2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAD2"
FT                   /protein_id="CAE36747.1"
FT                   /translation="MSAPIASAGMAAPRRANRSWGKFRRNRIAMLGALIVLAFVVLALL
FT                   APWVASHDPFQTSFMTIRKAPSAAFWMGTDELGRDIFSRMVYGARASLMAGMVSVLIAL
FT                   AVGVPFGLAAGYFGGWTDSVISRATEALLAIPFLILAIALAAFLGPSLTNAMIAIGVSA
FT                   APKFIRLTRGQVLAVKNEDYVQSARALGASDLRIIGRHVFPNVMPPLIVQATITIATAI
FT                   IAEASLSFLGLGLQPPNPSWGSMLNTAKNFMTQAPWMSIFPGSAIFLVVLGFNLLGDGL
FT                   RDALDPRQEK"
FT   misc_feature    150923..151051
FT                   /note="Signal peptide predicted for BPP1445 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.988) with cleavage site
FT                   probability 0.824 between residues 43 and 44"
FT   misc_feature    join(151004..151072,151208..151276,151313..151381,
FT                   151559..151627,151688..151756)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BPP1445 by TMHMM2.0 at aa 28-50, 96-118, 131-153, 213-235
FT                   and 256-278"
FT   misc_feature    151163..151249
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   misc_feature    151445..151675
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 1.3e-10"
FT   misc_feature    151448..151534
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        join(151801..153228,153227..153658)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1446"
FT                   /product="probable ATP-binding ABC transporter protein
FT                   (Pseudogene)"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   ATP-binding ABC transporter protein Rsc1379 or Rs04662
FT                   SWALL:Q8XZL6 (EMBL:AL646064) (627 aa) fasta scores: E():
FT                   3.8e-154, 73.13% id in 618 aa, and to Salmonella
FT                   typhimurium putative ATPase components of ABC-type
FT                   transport system, contain duplicated atpase domain ylia or
FT                   stm0848 SWALL:Q8ZQM4 (EMBL:AE008735) (623 aa) fasta scores:
FT                   E(): 9.2e-135, 65.03% id in 612 aa"
FT                   /db_xref="PSEUDO:CAE36748.1"
FT   misc_feature    151906..152517
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   6.3e-56"
FT   misc_feature    151927..151950
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    152287..152331
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    join(152845..153228,153227..153415)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2.4e-58"
FT   misc_feature    152866..152889
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    join(153187..153228,153227..153229)
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        complement(153661..154305)
FT                   /transl_table=11
FT                   /locus_tag="BPP1447"
FT                   /product="LysE-family efflux protein"
FT                   /note="Similar to Caulobacter crescentus efflux protein,
FT                   LysE family Cc0456 SWALL:Q9AAY6 (EMBL:AE005719) (208 aa)
FT                   fasta scores: E(): 6.7e-38, 56.54% id in 214 aa, and to
FT                   Zymomonas mobilis hypothetical 17.5 kDa protein Zm10orf7
FT                   SWALL:Q9XBR8 (EMBL:AF157493) (158 aa) fasta scores: E():
FT                   1.1e-22, 49.06% id in 161 aa"
FT                   /db_xref="GOA:Q7WAD1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAD1"
FT                   /protein_id="CAE36749.1"
FT                   /translation="MTPLAALLAFTVAATLLTITPGLDTALVLRTAAIDGPRRALLAGL
FT                   GVCAGCLAWGVAAALGLGALLAASSLAYDALRIAGAIYLCWLGARLLARSLRRRAGDAA
FT                   PGMLPAAPAGGGALQWFWRGCLTNMLNPKVGVFYVTFLPQFIPAGVDVLAFSLLLAALH
FT                   AALGLLWFAALVAATRPLSRWLARPSVARGLDRLSAGVFIAFGLKLALERR"
FT   misc_feature    complement(153751..154098)
FT                   /note="HMMPfam hit to PF01810, LysE type translocator,
FT                   score 4.7e-05"
FT   misc_feature    complement(join(153784..153849,153880..153945,
FT                   154030..154080,154120..154185,154225..154290))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BPP1447 by TMHMM2.0 at aa 15-37, 50-72, 85-102, 130-152 and
FT                   162-184"
FT   CDS_pept        154397..154933
FT                   /transl_table=11
FT                   /locus_tag="BPP1448"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein Rsc0785 or Rs05053 SWALL:Q8Y1A5 (EMBL:AL646061)
FT                   (182 aa) fasta scores: E(): 1.5e-37, 55.23% id in 172 aa,
FT                   and to Yersinia pestis hypothetical protein Ypo1065
FT                   SWALL:Q8ZH46 (EMBL:AJ414146) (182 aa) fasta scores: E():
FT                   1.1e-30, 46.06% id in 178 aa"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAD0"
FT                   /protein_id="CAE36750.1"
FT                   /translation="MALRATIYKADLHVADTDRHYYASHGLTIARHPSETDERMMVRVL
FT                   AYALHADEQLAFTKGLSDTDEPDLWRKDLTGDIELWVEVGQPDERRILKACGRAAEVVV
FT                   YCYGGHASQVWWDGVRGKLERARNLRVVCLPAAQTEALAQLARRTMQVHVNISDGAAFV
FT                   STDEGQVQVEPQSWR"
FT   CDS_pept        complement(join(155067..155279,155281..156258))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1449"
FT                   /product="putative membrane protein (Pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0980"
FT                   /db_xref="PSEUDO:CAE36751.1"
FT   misc_feature    complement(join(155092..155157,155170..155235,
FT                   155272..155337,155350..155415,155443..155508,
FT                   155539..155604,155689..155754,155770..155835,
FT                   155893..155943,155956..156006,156043..156108,
FT                   156139..156195))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BPP1449 by TMHMM2.0 at aa 21-40, 50-72, 84-101, 105-122,
FT                   141-163, 168-190, 218-240, 250-272, 281-303, 307-329,
FT                   341-363 and 367-389"
FT   variation       complement(155280)
FT                   /note="frameshift, (A) in parapertussis and pertussis; no
FT                   frameshift, (-) in bronchiseptica"
FT   CDS_pept        complement(156325..156897)
FT                   /transl_table=11
FT                   /locus_tag="BPP1450"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0981"
FT                   /db_xref="GOA:Q7WAC9"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WAC9"
FT                   /protein_id="CAE36752.1"
FT                   /translation="MTTPIPLARGWLPAAPSTLDPLRKYWLFRPGALTAGLRQLGHVRL
FT                   RVLAEYPTGAPRDEADGMRIAAQSPVWVREVLMSIDGVDSVVARSLTPLRASHGVWQGM
FT                   RRLLTRPLADMLYHDPGIHRSVFVCRRLAAGVPFHATAIARAPAGGPEPALWARRSAFW
FT                   RAGQPLLVAECFLPAFWSLARAPVAPR"
FT   CDS_pept        156957..157688
FT                   /transl_table=11
FT                   /locus_tag="BPP1451"
FT                   /product="putative RNA pseudouridylate synthase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0982"
FT                   /db_xref="GOA:Q7WAC8"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAC8"
FT                   /protein_id="CAE36753.1"
FT                   /translation="MEKVRISKLMSERGLCSRREADSYIERGWVRVDGVVVSELGARAF
FT                   PDQAITLERAAAARQTARVTILLHKPVGYVSGQAEKGYTPAVALIDARSRHAGDRAPLR
FT                   FERGQLQGLAVAGRLDIDSQGLLVLTQDGRIAKKLIGEDSEVDKEYLVRVQGRLSEAGL
FT                   ALLNHGLSLDGKPLRPAQVRWQNADQLRFVLREGKKRQIRRMCELVGLRVVGLKRVRIG
FT                   RVSLGDLPVGQWRYLRADERF"
FT   misc_feature    156966..157106
FT                   /note="HMMPfam hit to PF01479, S4 domain, score 0.00021"
FT   misc_feature    157146..157580
FT                   /note="HMMPfam hit to PF00849, RNA pseudouridylate
FT                   synthase, score 9.2e-08"
FT   CDS_pept        complement(157740..158657)
FT                   /transl_table=11
FT                   /locus_tag="BPP1452"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0983"
FT                   /db_xref="GOA:Q7WAC7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAC7"
FT                   /protein_id="CAE36754.1"
FT                   /translation="MELFVEVARTLSFSRAAENLAIPKSTLSRQVAELERSVGLRLLSR
FT                   TTRRVELTEAGQLYFERCQRIVAEARIAHEELQNLVETPSGPLRVNMPADFGTDFLSEA
FT                   FTEFSRRYPEVTFYLDLASPEHAERVFQTCDVSIEIGDLPDSTHIARLLGVLPAHLYAS
FT                   PDYLARHGEPQHPDDLPRHECIQFRAGTGRVTRWPLNSGERHVEITPGNRFSVNSVSMV
FT                   RNLATLGAGIAILAPMGNVREDIESGRLKRILPDWLAGPFPVYAVTDTRMLPAKTRIFV
FT                   EFLMERLSNKTLAGQNNPAFLNLR"
FT   misc_feature    complement(157791..158417)
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 4.7e-39"
FT   misc_feature    complement(158487..158657)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 1.3e-18"
FT   misc_feature    complement(158532..158624)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(158592..158639)
FT                   /note="PS00063 Aldo/keto reductase family putative active
FT                   site signature."
FT   CDS_pept        158908..160098
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /gene_synonym="mtcA"
FT                   /gene_synonym="lir"
FT                   /locus_tag="BPP1453"
FT                   /product="acriflavine resistance protein a precursor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0984"
FT                   /db_xref="GOA:Q7WAC6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAC6"
FT                   /protein_id="CAE36755.1"
FT                   /translation="MKNNYLVGRGIAALSLAALTLTLAACGKEQQAAQQGGQPQVGVVT
FT                   LKTQSVALFSELPGRTAAYRIAEVCPQVSGIVQKRLFTEGGEVAAGQQLYQIDPALYQA
FT                   EVDSRRAALARVQAQLKTATLLVQRYKPLVDTRAVSRQAYDDAVAARDQASADVLAAKA
FT                   ALDTARINLVYTKVLAPIGGIIGRSNVTEGALVTANQSAAVAAVQQIDPIYVDVTQSSV
FT                   QLLRLKSALDSGLLQREAGEQSARVTLTLEDGTQYDQDGKLQFSEVTVDPGTGSVLLRA
FT                   VFPNPQRKLLPGMFVRARLAEGVASEGLLVPQRGVTRNQRGLPTALVVNVENKVELRTL
FT                   KTDRAIGDQWLVSSGLAAGDRVIVEGLQSVRPGAEVKAAEWSPPASKAAAQPAAAK"
FT   misc_feature    158908..158988
FT                   /note="Signal peptide predicted for BPP1453 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.987) with cleavage site
FT                   probability 0.681 between residues 32 and 33"
FT   misc_feature    158953..158985
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    159100..159999
FT                   /note="HMMPfam hit to PF00529, HlyD family secretion
FT                   protein, score 1.3e-68"
FT   CDS_pept        160111..163290
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /gene_synonym="acrE"
FT                   /locus_tag="BPP1454"
FT                   /product="acriflavine resistance protein B"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0985"
FT                   /db_xref="GOA:Q7WAC5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAC5"
FT                   /protein_id="CAE36756.1"
FT                   /translation="MTKFFIDRPVFAWVIAIVLMMAGALSILSLPVAQYPNIAPPAISI
FT                   NVTYPGASAQTVQDTVVQVIEQQMNGIDNLQYISSESNSDGSMSITLTFSQGTNPDTAQ
FT                   VQVQNKLAVAQPLLPLEVQQQGIRVTKATKNFLIVAGFVSTDGTMDKSDLADYVASYIQ
FT                   DPISRTPGVGDFQLFGAPYAMRIWISPEKLVNFGLTASDVTTAIREQNVQVSSGQLGGQ
FT                   PAVRGQQLNATVIGPSRLQTPEAFGRILLKVNSDGSQVRLKDVASIELGAQTYAIDSYY
FT                   NGKPASGLAIKLASGANALDTAQAVRETINGLKPYFPPGMDVVYPYDTTPFVSLSIEGV
FT                   VKTLFEAVLLVFLVMYLFLQNVRATLIPTLAVPVVLLGTFGVLAAFGYSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLSPRQATRKSMSQITGALIGIAMVLAVVFVPMAF
FT                   FGGSTGVIYRQFSITIVSSMVLSVVVAIVFTPALCATMLKPIPKGHHGSKKGFFGRFNR
FT                   TFERSSQAYANNVARSMGRTKRLLLIYVVILLGMAWMFMRIPTAFLPDEDQGILFAQVQ
FT                   APAGATSERTQATIDAAVKYLLEDEKESVASVFAVNGFSFGGRGQNAAILFIKLRDWNE
FT                   RKGAEHRAAAVAARANAKFRAELRDAQAAVFVPPAVMELGNATGFDFQLQDRAGVGHEK
FT                   LLAARNQLLQEAGASPMLVAVRPNGIEDAPQYQLDIDREKARALGVSITEINNTLATAW
FT                   GSSYVNDFIDRGRVKKVFVQGEASSRMLPQDLDKWYVRNNAGDMVPFSAFSSAQWTFGP
FT                   QKLNRYNGVPSYNIQGQAAPGYSSGDAMAEMERLADKLPLGIGYDWTGLSFEERLSGAQ
FT                   APALYAISLIVVFLCLAALYESWSIPTAVMLVVPLGVVGALLATLTRGLSNDVYFQVGL
FT                   LTTIGLAAKNAILIVEFAKEHYEEGASLTEAAVHAARQRLRPILMTSLAFILGVVPLAI
FT                   STGAGSGSQNAIGTGVIGGMLTGTFLAIFFVPLFFVLTLRLFKVKRASENREDDDPHGG
FT                   AQPATHGGQPQ"
FT   misc_feature    160111..160212
FT                   /note="Signal peptide predicted for BPP1454 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.983) with cleavage site
FT                   probability 0.738 between residues 34 and 35"
FT   misc_feature    160111..163194
FT                   /note="HMMPfam hit to PF00873, AcrB/AcrD/AcrF family, score
FT                   0"
FT   misc_feature    join(160147..160215,161119..161187,161206..161274,
FT                   161284..161352,161422..161490,161518..161586,
FT                   161728..161796,162715..162783,162802..162870,
FT                   162883..162951,163024..163092,163120..163188)
FT                   /note="12 probable transmembrane helices predicted for
FT                   BPP1454 by TMHMM2.0 at aa 13-35, 337-359, 366-388, 392-414,
FT                   438-460, 470-492, 540-562, 869-891, 898-920, 925-947,
FT                   972-994 and 1004-1026"
FT   misc_feature    161629..161652
FT                   /note="PS00242 Integrins alpha chain signature."
FT   CDS_pept        163287..164753
FT                   /transl_table=11
FT                   /gene="cusC"
FT                   /gene_synonym="ibeB"
FT                   /locus_tag="BPP1455"
FT                   /product="probable outer membrane lipoprotein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0986"
FT                   /db_xref="GOA:Q7WAC4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAC4"
FT                   /protein_id="CAE36757.1"
FT                   /translation="MKPAVMRTLLSLAVATALAGCSLAPTYERPQAPVDAAYPSGPAYG
FT                   APGQAAAGAPAAADVGWRDFFGDPLLQELLALSLANNRDLRVAALNVEAARAQYRIQRA
FT                   DLAPSVGVGGTGSVQRTPADLNPSGQAGISRSYQVGASLSTWELDLFGRIRSLSEQALQ
FT                   LYLAQDETRLATQLTLVAETANAYLTLRADQELLALTRQTLVAQQESYKLTRQSYDLGV
FT                   ATELDLSQAEISLRTAERNLSQYTRMAAQDRNALVLLVGQPLPAGIGAQLDQAVALPDG
FT                   VVLADLPAGLPSDLLARRPDIRAAEHQLQAANASIGAARVAFFPRISLTGSAGTASASL
FT                   GGLFDAGSGAWSFAPQISVPIFAGGALRASLDLAKIQKDIGIARYEQAIQSGFREVSDA
FT                   LAGRGTLQEQIRSQELLVQANQRAYDLSQQRYQQGIDNYLSVLDSQRSLYTAQQTLVET
FT                   RLARLSNLIQLYKALGGGWSERTVAAAQAG"
FT   misc_feature    163287..163358
FT                   /note="Signal peptide predicted for BPP1455 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.995) with cleavage site
FT                   probability 0.604 between residues 24 and 25"
FT   misc_feature    163317..163349
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    163497..164102
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein, score 2.1e-44"
FT   misc_feature    164148..164741
FT                   /note="HMMPfam hit to PF02321, Outer membrane efflux
FT                   protein, score 3.9e-54"
FT   CDS_pept        complement(164823..165074)
FT                   /transl_table=11
FT                   /locus_tag="BPP1456"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0987"
FT                   /db_xref="GOA:Q7WAC3"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAC3"
FT                   /protein_id="CAE36758.1"
FT                   /translation="MSIIIMIIVGFVVGLIARAIMPGDQNMGYIMTTILGIIGSVVAGF
FT                   LGQQLGWYAPGEPAGWIGSVVGAIIVLFVVGLVAKKRA"
FT   misc_feature    complement(join(164838..164894,164925..164990,
FT                   165012..165062))
FT                   /note="3 probable transmembrane helices predicted for
FT                   BPP1456 by TMHMM2.0 at aa 4-21, 28-50 and 60-79"
FT   CDS_pept        complement(165220..165870)
FT                   /transl_table=11
FT                   /locus_tag="BPP1457"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0988"
FT                   /db_xref="GOA:Q7WAC2"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAC2"
FT                   /protein_id="CAE36759.1"
FT                   /translation="MRAPHRRLAVSTMYSPLSGRAWRGLLLAMLMLLAACSERSADWSL
FT                   YNVKGHLPDLKFSLPGAHGKTVSSDDLKGKTVLLFFGYASCPDVCPTTMAQLTAVLQQL
FT                   GEQARDVRILFVSVDPHRDTPDILQAYVNAFNNNAIGVTGNEKQIADLARRYRLAYQIE
FT                   KPKPGDDADIYDVTHSRGVYIFDNQGKARLLASDTDTIDTMVKDLRQLIAQTQ"
FT   misc_feature    complement(165274..165798)
FT                   /note="HMMPfam hit to PF02630, SCO1/SenC, score 6.2e-26"
FT   misc_feature    complement(165748..165870)
FT                   /note="Signal peptide predicted for BPP1457 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.981) with cleavage site
FT                   probability 0.737 between residues 41 and 42"
FT   misc_feature    complement(165763..165795)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(166005..168119)
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /gene_synonym="opdA"
FT                   /locus_tag="BPP1458"
FT                   /product="oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0989"
FT                   /db_xref="GOA:Q7WAC1"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAC1"
FT                   /protein_id="CAE36760.1"
FT                   /translation="MACAPFGPRPLVHGIPKPMTQNPLLAPVADLVDYAAVKPEHIVPA
FT                   VQALLDIARAAVEHAADPALPATWDAVVAPLDSASERLWRAWSVAGHLNAVVNTPVLRE
FT                   AYNAALPLVTEFSTWVGLHEGLYRQYQRLQAAEDFAAWPPVRRRVVELALRDFRLSGVE
FT                   LQGAARERYAEISDREAQASQKFSENVLDAIDAWSLLVDDQARLDGIPADVLAAARKAA
FT                   EDDGATGWKLTLKMPCYLPVMQYARDRALRETLYRAYGTVASEHGDAAYDNSPLIEELL
FT                   QLRADEAGLLQYPTFAALRLQTRMARDATEVVDFLRDLARRAKPYAERDLAELQAFAAG
FT                   ELGLAELQPWDVPFAAERLRESRYAYSEDEIKQYFTEPRVLAGLFEVIETLFDVRLREV
FT                   PVSSWHADVRGVRVESPAGATLGHLYLDLYARAGKQSGAWVDSERSRRSVQGDLQTPVA
FT                   YLTCNFSRPNGDKAALLTHDDVITLFHETGHALHALLSEVDEPGAAAFASVEWDAIELP
FT                   SQFMENFCWEWSVVQKLSAHVETGQPLPRDLYDRLVAARNFQSGMQTVRQIEFALFDMM
FT                   LHDRPQGAPIADVLALLQQVRQEVAVLFPPAWHRLPHSFSHLFAGGYGAGYYSYKWAEV
FT                   LSADAYEAFEEAARQGEPAATTLDGATGARFRKEILAVGGARPAADSFRAFRGREPRID
FT                   ALLRHSGMQA"
FT   misc_feature    complement(166014..167396)
FT                   /note="HMMPfam hit to PF01432, Peptidase family M3, score
FT                   3.4e-154"
FT   CDS_pept        complement(168195..169046)
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /gene_synonym="ads"
FT                   /locus_tag="BPP1459"
FT                   /product="FolD bifunctional protein [includes:
FT                   methylenetetrahydrofolate dehydrogenase and
FT                   methylenetetrahydrofolate cyclohydrolase]"
FT                   /EC_number="1.5.1.5"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0990"
FT                   /db_xref="GOA:Q7WAC0"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WAC0"
FT                   /protein_id="CAE36761.1"
FT                   /translation="MTARIIDGAALSQRIREEVAQRVQALTAKGVRPGLAVVLVGDDPA
FT                   SQVYVRNKVAACEKAGLHSVKEQYPADLTEAQLLERIDALNRDPSIHGILVQLPLPRHM
FT                   DAHKVIEAIAAEKDVDGFHISNAGLLMTGQPLFRPCTPYGVMKMLESEGVALRGAEAVI
FT                   VGASNIVGKPMAMLLLQAGATITICNSKTRDLGAQTRRADVLVVATGKPGMIDGSMIKP
FT                   GAVVIDVGINRGADGKLCGDVDMASAREVAGAISPVPGGVGPMTIAMLLVNTVEAAERA
FT                   AA"
FT   misc_feature    complement(168201..168683)
FT                   /note="HMMPfam hit to PF02882, Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, NAD(P)-binding domain, score
FT                   3.5e-92"
FT   misc_feature    complement(168246..168272)
FT                   /note="PS00767 Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase signature 2."
FT   misc_feature    complement(168687..169046)
FT                   /note="HMMPfam hit to PF00763, Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase, catalytic domain, score
FT                   5.5e-67"
FT   misc_feature    complement(168747..168824)
FT                   /note="PS00766 Tetrahydrofolate
FT                   dehydrogenase/cyclohydrolase signature 1."
FT   CDS_pept        complement(169043..169669)
FT                   /transl_table=11
FT                   /locus_tag="BPP1460"
FT                   /product="two-component response regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0991"
FT                   /db_xref="GOA:Q7WAB9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAB9"
FT                   /protein_id="CAE36762.1"
FT                   /translation="MNTPHLSSTVFIVDDDEAVRDSLRWLLEANGYRVRAYASGENFLD
FT                   EYDASQIGVLIADVRMPGMSGLELQEQLIARNAPLPIVFITGHGDVPMAVSTMKKGAVD
FT                   FLEKPFNESDLREIVARMLEQAVQRISKFQAQKDHEAMLARLTAREQQVLERIVAGRLN
FT                   KQIADDLGISIKTVEAHRANIMEKLEVTTVADLMKVALAKPEAHA"
FT   misc_feature    complement(169049..169243)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR family, score 8.9e-20"
FT   misc_feature    complement(169109..169192)
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT   misc_feature    complement(169289..169648)
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 6.6e-40"
FT   CDS_pept        complement(169666..171420)
FT                   /transl_table=11
FT                   /locus_tag="BPP1461"
FT                   /product="tw-component sensor kinase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0992"
FT                   /db_xref="GOA:Q7WAB8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAB8"
FT                   /protein_id="CAE36763.1"
FT                   /translation="MSSPPKSNIPMSFRDHARARRRGVYWLTPALVLVLYICVMGVFFW
FT                   LQRIHDDSVMFVTIDQELRQQRLIWVVLALSCVIVISLLMLWRYTRFRSEAEAALIAET
FT                   GFRRAMENSMSTGMRVLDMEGRIAYVNPAFCRMIGWNEADLIGRSPPFPYWVPGRHEQH
FT                   QHTLEVLTSGKTPSSGLEVEAQRRDGSRFTARMYVSPLLDPNGDQIGWMTSMTDITEPK
FT                   RIREALTAAHERFMTVLEGLDDAISVTADTHDGLELLFANRTYRRVFGAQTGGHNELLA
FT                   GRRGRFTDESVEVLAPSVQRWFEVHHRMLAWTDGRRVRMQVARDITERRVHEEASRVQQ
FT                   EKIQLTSRLTTMGEMASSLAHELNQPLTAIANYSMGAVALVKAGHTSPNMLLPALEKAA
FT                   SQAERAGKIISRIREFVKRSEPRRQRVAISRIVDNAIGFAEIDARKRRIRIERFVPSNA
FT                   PDVLADPILIEQVLLNLLKNGLEAMEKSESDELKVAVIPHEQHIEVAVVDRGHGLPEPE
FT                   RLFEPFFSTKSQGLGMGLNICRTIIESHHGRLWADPNPAGGTIFRFTLPCATPQSQAQN
FT                   DQSEELHA"
FT   misc_feature    complement(169717..170034)
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase, score 1.6e-32"
FT   misc_feature    complement(170158..170370)
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 1.3e-08"
FT   misc_feature    complement(170758..170886)
FT                   /note="HMMPfam hit to PF00785, PAC motif, score 4.2e-07"
FT   misc_feature    complement(170911..171108)
FT                   /note="HMMPfam hit to PF00989, PAS domain, score 6.7e-10"
FT   misc_feature    complement(join(171154..171219,171283..171348))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP1461 by TMHMM2.0 at aa 24-46 and 67-89"
FT   CDS_pept        171713..174418
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="BPP1462"
FT                   /product="pyruvate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.1"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0993"
FT                   /db_xref="GOA:Q7WAB7"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAB7"
FT                   /protein_id="CAE36764.1"
FT                   /translation="MSSFAQAGALAAANDEDTLETQEWLEALAAVLDREGPQRAHYLLE
FT                   RLIDEARRSGAHIPFSPNTAYVNTIPPGLEPAHPGNLELEARIRSYVRWNAMAMVVRAN
FT                   KHNPPDGGDLGGHIASFASLATMIGCGQNHFWHGETEEHGGDLVYFQGHTSPGMYGRAY
FT                   LEGRLTEDQLNHFRREVDGKGLSSYPHPKLMPDFWQFPTVSMGLGPLMAIYQARFLKYL
FT                   HARGIADTSNRKVWVFCGDGEMDEPESLGAIALAAREKLDNLIFVINCNLQRLDGPVRG
FT                   NGKIIQELEGDFRGSGWNVIKLIWGGYWDPLLAHDKEGILRRIMEEAVDGEYQAYKAND
FT                   GKYVREHFFGKHPKLLEMVARMSDEDIWRLNRGGHDPHKVYAAFDAASKHAGQPTVILA
FT                   KTIKGYGMGHVGQAKNPTHQQKKLELDSIREFRDRFGIPIPDDKLEELPYYKPAEDSPE
FT                   MQYLHERRKALGGYLPKRRAKADEQLKAPALDAFKAVLEPTAEGREISTTQAFVRVLNQ
FT                   ILRDKDLGPRVVPILADESRTFGMEGLFRQIGIYAPEGQKYTPVDKDQVMYYKESADGQ
FT                   LLQEGINEAGAMSSWMAAATSYSTNNRIMVPFYIYYSMFGFQRVGDLAWAAGDMQARGF
FT                   LLGGTAGRTTLNGEGLQHEDGHSHLLASTIPNCVSYDPTFAHELAVIIQHGLKRMVEDQ
FT                   ENVYYYLTVMNENYPQPGLTAGDEEGIIRGMYKLKSHGKGKQRVQLMGSGTILREVMAA
FT                   QELLEADWGVASDIWSVTSLTELRRDGLDAERHNLLHPEGKQQVPYVTTQLAKSEGPII
FT                   ASTDYMKLFADQIRPFVPKDRTYKVLGTDGFGRSDFRYKLREHFEVDRHFVVLASLRAL
FT                   ADEGKIPAAKVAEAIKKYGINPNKANPHHA"
FT   misc_feature    171962..173134
FT                   /note="HMMPfam hit to PF00456, Transketolase, thiamine
FT                   diphosphate binding domain, score 6.8e-06"
FT   CDS_pept        174431..176053
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="BPP1463"
FT                   /product="dihydrolipoamide acetyltransferase component of
FT                   pyruvate dehydrogenase complex"
FT                   /EC_number="2.3.1.12"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0994"
FT                   /db_xref="GOA:Q7WAB6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAB6"
FT                   /protein_id="CAE36765.1"
FT                   /translation="MSNIVEIKVPDIGDFKEVEVIEVLVSAGDTIKAEQSLITVESDKA
FT                   SMEIPASAAGVVKSVKVKVGDKIAEGTVILEVEAAGEAAAAPKAEQAPEAAEAPKADAA
FT                   KAEAPAAAGPIEVKVPDIGDFKEVEVIEVLVAEGDTIKAEQSLITVESDKASMEIPASA
FT                   GGVVQSLKVKVGDKVAMGTVIAVVQGQGAAAPAAKAEAPAAAEPAASASASAPAPAQRP
FT                   APAAALQDEDLKPGQLPHASPSVRKFARELGVNLSRVTGSAAKGRITADDVRAYVKQAL
FT                   SAGAPAGASGGGDGAALGLLPWPKIDFTKFGPIEAKPLSRIKKISGANLHRNWVMIPHV
FT                   TNNDEADITDLEALRVALNKENEKSGVKVTMLAFLIKAVVAALKKFPEFNASLDGDNLV
FT                   LKQYYHIGFAADTPNGLVVPVVRDADKKGILELARETSELARKAREGKVSPAEMQGGCF
FT                   SISSLGGIGGTHFTPIINAPEVAILGVSRSAHKPVWDGKQFVPRLTLPLSLSYDHRVID
FT                   GASAARFNAYLGQLLADFRRIAL"
FT   misc_feature    174443..174661
FT                   /note="HMMPfam hit to PF00364, Biotin-requiring enzyme,
FT                   score 1.4e-23"
FT   misc_feature    174512..174601
FT                   /note="PS00189 2-oxo acid dehydrogenases acyltransferase
FT                   component lipoyl binding site."
FT   misc_feature    174773..174991
FT                   /note="HMMPfam hit to PF00364, Biotin-requiring enzyme,
FT                   score 1.7e-22"
FT   misc_feature    174842..174931
FT                   /note="PS00189 2-oxo acid dehydrogenases acyltransferase
FT                   component lipoyl binding site."
FT   misc_feature    175145..175261
FT                   /note="HMMPfam hit to PF02817, e3 binding domain, score
FT                   2.3e-13"
FT   misc_feature    175361..176047
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00198, 2-oxo acid dehydrogenases
FT                   acyltransferase (catalytic domain), score 4.5e-105"
FT   CDS_pept        176066..177841
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /gene_synonym="lpd"
FT                   /locus_tag="BPP1464"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0995"
FT                   /db_xref="GOA:Q7WAB5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAB5"
FT                   /protein_id="CAE36766.1"
FT                   /translation="MSNIVEIKVPDIGDFKEVEVIEVLVAAGDTIKAEQSLITVESDKA
FT                   SMEIPASSAGVVKSVKVKVGDKVAEGTVILDVEAAGEAAAAPKAEAPKAEAPKADAPKA
FT                   PAAKASAPAAAAYSGSADLECDMLVLGAGPGGYSAAFRAADLGMDTVMVERYATLGGVC
FT                   LNVGCIPSKALLHNAAVIDEARALAAHGISFGEPKVDLDKLRGYKDGVVAKLTGGLAGM
FT                   ARACKVRVATGTGEFADPHHLTVTDGEGKKQTIRFKQAIIAAGSQSVKLPFLPDDERIV
FT                   DSTGALQLRAIPKKMLIIGGGIIGLEMGTVYSTLGARLDVVEMLDGLMQGADRDLVKVW
FT                   QKMNAPRFDNIMLKTKTVGAEARKDGIYVSFEGEGAPKEPQRYDLVLQAVGRSPNGKKI
FT                   GAERAGVAVTERGFIEVDRQMRTNVPHIYAIGDVVGQPMLAHKAVHEGHVAAEAAHGEK
FT                   SFFDARVIPSVAYTDPEVAWVGLTEDEAKKQGVKVEKGLFPWAASGRAIANGRDEGFTK
FT                   LLFDAETHRIVGGGIVGTHAGDLISEIALAIEMGADMVDIGKTIHPHPTLGESVGMAAE
FT                   VAEGVCTDLPPMRKK"
FT   misc_feature    176078..176296
FT                   /note="HMMPfam hit to PF00364, Biotin-requiring enzyme,
FT                   score 8.7e-24"
FT   misc_feature    176147..176236
FT                   /note="PS00189 2-oxo acid dehydrogenases acyltransferase
FT                   component lipoyl binding site."
FT   misc_feature    176441..177391
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreductase, score 6.1e-83"
FT   misc_feature    176543..176575
FT                   /note="PS00076 Pyridine nucleotide-disulphide
FT                   oxidoreductases class-I active site."
FT   misc_feature    177461..177790
FT                   /note="HMMPfam hit to PF02852, Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain,
FT                   score 1.2e-49"
FT   CDS_pept        complement(178064..179242)
FT                   /transl_table=11
FT                   /gene="flaA"
FT                   /locus_tag="BPP1465"
FT                   /product="flagellin"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0996"
FT                   /db_xref="GOA:Q7WAB4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAB4"
FT                   /protein_id="CAE36767.1"
FT                   /translation="MAAVINTNYLSLVAQNNLNKSQSALGSAIERLSSGLRINSAKDDA
FT                   AGQAIANRFTANVKGLTQAARNANDGISIAQTTEGALNEINNNLQRIRELTVQASNGTN
FT                   SASDIDSIQQEVNQRLEEINRIAEQTDFNGIKVLKSNATDMTLSIQVGAKDNETIDIKI
FT                   DRNSNWNLYDAVGTVPGGTVNGEARTVNALGFDVLSAVTTTIASSDTVTFDAAVAAAEQ
FT                   AAGAAVGDGSVVSYGDTANPQYAVVVDNAGTMTSYALTFDKDGKAALGDQLGAVASQAA
FT                   EAAVGTNDVAAGANVTVSGGAADALSKLDDAMKAVDEQRSSLGAIQNRFESTVANLNNT
FT                   ITNLSAARSRIEDSDYATEVSNMTKNQILQQAGTSVLAQANQVPQNVLSLLR"
FT   misc_feature    complement(178133..178348)
FT                   /note="HMMPfam hit to PF00700, Bacterial flagellin
FT                   C-terminus, score 7.9e-41"
FT   misc_feature    complement(178727..179158)
FT                   /note="HMMPfam hit to PF00669, Bacterial flagellin
FT                   N-terminus, score 2.6e-78"
FT   CDS_pept        complement(join(179629..179709,179712..180368))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="fliA"
FT                   /gene_synonym="flaD"
FT                   /locus_tag="BPP1466"
FT                   /product="RNA polymerase sigma factor for flagellar operon
FT                   (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1021"
FT                   /db_xref="PSEUDO:CAE36768.1"
FT   misc_feature    complement(join(179692..179709,179712..180365))
FT                   /note="HMMPfam hit to PF00140, Sigma-70 factor, score
FT                   2.8e-59"
FT   variation       complement(179710..179713)
FT                   /note="(C)4 in parapertussis; (C)2 in pertussis"
FT   misc_feature    complement(180228..180269)
FT                   /note="PS00715 Sigma-70 factors family signature 1."
FT   CDS_pept        180804..181127
FT                   /transl_table=11
FT                   /gene="flhD"
FT                   /gene_synonym="flbB"
FT                   /gene_synonym="frlA"
FT                   /locus_tag="BPP1467"
FT                   /product="flagellar transcriptional activator FlbB"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1022"
FT                   /db_xref="GOA:Q7WAB3"
FT                   /db_xref="InterPro:IPR023559"
FT                   /db_xref="InterPro:IPR036194"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WAB3"
FT                   /protein_id="CAE36769.1"
FT                   /translation="MKTADSSLLADIREVNLSYLLLAQRMLRDDYAASMFRLGFSNEVA
FT                   DILMRLSPAQLVKLASSSSLLCRFRFDDYSLLSALTQDVLGGALQQAHATILLARQPVE
FT                   ELA"
FT   CDS_pept        181162..181722
FT                   /transl_table=11
FT                   /gene="flhC"
FT                   /gene_synonym="flaI"
FT                   /gene_synonym="frlB"
FT                   /locus_tag="BPP1468"
FT                   /product="flagellar transcriptional activator FlhC"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1023"
FT                   /db_xref="GOA:Q7WAB2"
FT                   /db_xref="InterPro:IPR007944"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAB2"
FT                   /protein_id="CAE36770.1"
FT                   /translation="MATKSVSQEADEILLASSMITLGARLQVLQAETGLSHDRLARLYR
FT                   EIRGCSPPKGMLPFSVDWFMTWLPNIHSSLFYNVYTFLNQRTSSQGIRAVIDAYRLYLE
FT                   HAPADAAEPVLSFTRAWMLVRFFDGGMLQLSGCRQCGGHFIAHAHDPQTDFVCAICRPP
FT                   PRAGKTRAAARARAGQLAAPARP"
FT   CDS_pept        181843..182718
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="BPP1469"
FT                   /product="chemotaxis protein MotA"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1024"
FT                   /db_xref="GOA:Q7WAB1"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAB1"
FT                   /protein_id="CAE36771.1"
FT                   /translation="MLIVIGYAVVILAVVGSFIGLGGHLGALYQPFELTLIAGAAVGAF
FT                   MAGNSRKSLGLVAKAIPEAFRSSPYSKDVYMELMALLYVLLNKARREGLMAIESHIEDP
FT                   LSSPIFNEYPRIMKDAKLMEFITDYLRIMISGNMSSFEIETLMDEEIETYRHEREVPTH
FT                   ALQQVADALPAFGIVAAVLGVIKALAAVDQPPAILGDLISKAMVGTFLGVLLAYGFVAP
FT                   MAARIERRTSESVKVLECIKVTLLASMNGYPPQLAVEFGRKVLFSAVRPSFGELEEHVR
FT                   QAKSAATGRA"
FT   misc_feature    join(181846..181914,181924..181992,182344..182412,
FT                   182455..182523)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BPP1469 by TMHMM2.0 at aa 2-24, 28-50, 168-190 and 205-227"
FT   misc_feature    182455..182508
FT                   /note="PS01307 Flagellar motor protein motA family
FT                   signature."
FT   CDS_pept        182731..183678
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="BPP1470"
FT                   /product="chemotaxis protein MotB"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1025"
FT                   /db_xref="GOA:Q7WAB0"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAB0"
FT                   /protein_id="CAE36772.1"
FT                   /translation="MSTVNNHRVVIRRRKVRRGGHHGGSWKIAYADFITAMMAFFLVMW
FT                   LISIVPREELKGIAEYFRMPLRVALTGGPSSSAETSAIPGGGQDPLRSQGDVRRAEGNR
FT                   VEAQPMGDAERRDRHRLERLKVRLENLIEESPVLKNFRPQLLIDMTTEGLRIQIVDNQN
FT                   RPMFATGSADVQPYMRDILRELGPVLNDLPNKISIAGHTDASQYARGERAYSNWELSAD
FT                   RANASRQELVAGGMHEGKVLRIQGLASSMSLVKDDPFAAVNRRISLVVLNASTQRRIEN
FT                   ENAAAADVNARDAQGVGAALAGQLAASGSDGGAR"
FT   misc_feature    182812..182880
FT                   /note="1 probable transmembrane helix predicted for BPP1470
FT                   by TMHMM2.0 at aa 28-50"
FT   misc_feature    183226..183522
FT                   /note="HMMPfam hit to PF00691, OmpA family, score 7.9e-21"
FT   CDS_pept        183693..184073
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="BPP1471"
FT                   /product="chemotaxis protein CheY"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1026"
FT                   /db_xref="GOA:Q7WAA9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAA9"
FT                   /protein_id="CAE36773.1"
FT                   /translation="MTARILVADDSATMRMIVQAALTGAGWQVVTASDGKQALELAQAQ
FT                   AVDLVVSDWNMPVMGGLDLIRGLRGQARYQDLPVLVLTTEDDGDSKAAARDLGVCGWLN
FT                   KPLDPDVLVDLAAELLGVAPGA"
FT   misc_feature    183699..184064
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 7.6e-29"
FT   CDS_pept        184100..186157
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="BPP1472"
FT                   /product="chemotaxis protein CheA"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1028"
FT                   /db_xref="GOA:Q7WAA8"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR015162"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAA8"
FT                   /protein_id="CAE36774.1"
FT                   /translation="MSSGLDLSQFYETFFDEADELLAQMEQLLLELDVGAPDIEQLNAI
FT                   FRAAHSIKGGAATFGCFQKLAGTTHLLENLLDAIRRGEMGLRADMVDIFLETKDVLKSQ
FT                   LDAYRASEEPEDAVFERICAVLRQLALEGGQAPAAAAPAPVAASEPGPEPEPAPQPAAA
FT                   STAAGLPLRVRFSKVSDKDAQSLLEEMGNLGDVRASERAGQTLTVWVDTTCSPDDIEAV
FT                   CCFIIDADQLEIAREAEPAHASAQAAVAAAPDAAATPAPVAAPAAAQAAEPARAARPSI
FT                   APAHADKESTSIRVGVEKVDQVINLVGELVITQAMLAQTASTLDPVLHDRLLNGMEQLE
FT                   RNARDLQEAVMSIRMMPMDYVFSRFPRLVRDIAGKMGKQIELQTYGRATELDKSLIERI
FT                   IDPLTHLVRNSLDHGIETPDKRVAAGKEPVGQLVLSAQHNGGNIVIEVSDDGGGLSRER
FT                   ILRKAVAQGLTVNENSPDDEIWQLIFAPGFSTGDQVTDISGRGVGMDVVRRNIQDMGGH
FT                   VQLSSVPGQGTTTRIVLPLTLAILDGMSVRVGEETFILPLNHVTESLQPQADQIYSVAG
FT                   NERVMQVRGEYLPLVEMHRVFSVGQAQADPTQAIAVIMQAEERRFALLVDHLVGQHQVV
FT                   VKNLESNYRKVPGISAATILGDGSVALIVDVFALARANREKWSQPEAILN"
FT   misc_feature    184118..184435
FT                   /note="HMMPfam hit to PF01627, Hpt domain, score 3.9e-36"
FT   misc_feature    184139..184165
FT                   /note="PS00039 DEAD-box subfamily ATP-dependent helicases
FT                   signature."
FT   misc_feature    184967..185158
FT                   /note="HMMPfam hit to PF02895, Signal transducing histidine
FT                   kinase, homodimeric domain, score 1.6e-22"
FT   misc_feature    185291..185710
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase, score 1.2e-25"
FT   misc_feature    185717..186121
FT                   /note="HMMPfam hit to PF01584, CheW-like domain, score
FT                   6.1e-32"
FT   CDS_pept        186154..186672
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="BPP1473"
FT                   /product="chemotaxis protein CheW"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1029"
FT                   /db_xref="GOA:Q7WAA7"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAA7"
FT                   /protein_id="CAE36775.1"
FT                   /translation="MTERHIMAAKPHTQATRAEDVGNEFLVFTLGEEEYGIDILKVQEI
FT                   RGYDAATVTRIANVPSFIKGVTNLRGIIVPIVDLRIKFNLGSVEYNEQTVVIILNLDRR
FT                   VVGIVVDGVSDVLMLNAAQVRPAPEFGATLSTEYLTGLGTVDERMLILVDIEKLMTSDE
FT                   MALVEKVAS"
FT   misc_feature    186217..186642
FT                   /note="HMMPfam hit to PF01584, CheW-like domain, score
FT                   5.6e-49"
FT   CDS_pept        186746..188452
FT                   /transl_table=11
FT                   /gene="tsr"
FT                   /gene_synonym="cheD"
FT                   /locus_tag="BPP1474"
FT                   /product="methyl-accepting chemotaxis protein I"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1030"
FT                   /db_xref="GOA:Q7WAA6"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAA6"
FT                   /protein_id="CAE36776.1"
FT                   /translation="MRKFLANLSIRGSLLGVLAFFSFMLVVGAALGVLSLRVSNDTLQG
FT                   VKQTQDVADAMDRVVNSYKDAFNGLGRAAASHYGAIVSAIGQPVQVEQGLGSEAAGLLQ
FT                   RAKASLNRAETEYEYYKGLARPASAADSLKEVENAFEALVGQGLHPLAAALEKGDMAGY
FT                   QSHAQNVLDALEGRFSGAIAAFDFWRASELLDAHEVAETRYRFVLAAVAAGGVLAALLV
FT                   FSTYLFLRRRVLQPLREVGQHFDKIAAGDLTARVDVRNSNEIGQLFAGLKRMEESLTRT
FT                   VAAVRRGVDEINVGSREISAGNTDLSSRTEEQAASLEETAASMEQLASTVKQNADNARQ
FT                   ANQLAGVASDVAERGGSAVSEVVATMQDISASSRKISEIVSVIDGIAFQTNILALNAAV
FT                   EAARAGEQGKGFAVVAGEVRSLAQRSAQAAKEIKVLIEDSVGKVGTGSQQVERAGATMQ
FT                   EIVASVKRVTDIMGEISAASEEQSSGIEQVNRAVSQMDEVTQQNAALVEEAAAAAGSLQ
FT                   EQAQRLAEAVAVFRINAGEVIEVPAHQLGSRQAPGARETALAHDDALALGH"
FT   misc_feature    186746..186832
FT                   /note="Signal peptide predicted for BPP1474 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.658 between residues 29 and 30"
FT   misc_feature    join(186788..186856,187361..187429)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP1474 by TMHMM2.0 at aa 15-37 and 206-228"
FT   misc_feature    187376..187585
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 9.7e-14"
FT   misc_feature    187646..188344
FT                   /note="HMMPfam hit to PF00015, Methyl-accepting chemotaxis
FT                   protein (MCP) signaling domain, score 5.6e-111"
FT   CDS_pept        188461..189321
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /gene_synonym="cheX"
FT                   /locus_tag="BPP1475"
FT                   /product="chemotaxis protein methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1031"
FT                   /db_xref="GOA:Q7WAA5"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAA5"
FT                   /protein_id="CAE36777.1"
FT                   /translation="MATAMTTPAFSAERQFEFRDADFARVRQMIYARAGISLGAHKREM
FT                   VYSRLARRLRALGQQEFRVYLDGLENEPAAPEWEDFVNALTTNLTAFFRESHHFPILAD
FT                   FARQRGGPVSVWCCAASTGEEPYSIAMTLVESLGARAQASQLLATDIDTNCLQRARAGV
FT                   YPYERVAKLDPARLKRFFMRGRGANEGQVKVRAELADMVRFETLNLLAPHWPINEKFDA
FT                   IFCRNVMIYFDKPTQARILRRFVPLLKPGGLLFAGHSENFTYISRDFRLRGQTVYEQAS
FT                   GELPV"
FT   misc_feature    188515..188685
FT                   /note="HMMPfam hit to PF03705, CheR methyltransferase,
FT                   all-alpha domain, score 5.8e-16"
FT   misc_feature    188722..189297
FT                   /note="HMMPfam hit to PF01739, CheR methyltransferase, SAM
FT                   binding domain, score 9.7e-77"
FT   CDS_pept        189318..190370
FT                   /transl_table=11
FT                   /gene="cheB"
FT                   /locus_tag="BPP1476"
FT                   /product="protein-glutamate methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1032"
FT                   /db_xref="GOA:Q7WAA4"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WAA4"
FT                   /protein_id="CAE36778.1"
FT                   /translation="MKKIKVLCVDDSALVRGLMTEIINSHPDMEVVATAPDPLVARELI
FT                   KKHNPDVLTLDVEMPRMDGLDFLEKLMRLRPMPVVMVSSLTERGGEITLRALELGAIDF
FT                   VTKPKLGIRDGLIEYSEVIADKIRAASRARLRAPAPAGHAAPLRLRSPFASSEKLVIVG
FT                   ASTGGTEAIREVLQPLPADSPAILITQHMPAGFTRSFAQRLDALCAVTVREASDGERVL
FT                   PGHVYLAPGGETHMRLGRSGANYVIGLQASEPVNRHRPSVDVLFHSAAEAAGGNAIGVI
FT                   LTGMGKDGAAGLLAMKRAGARTMAQDEASCVVFGMPREAIALGAADEVMPLADISERIL
FT                   TRLGDRGHRV"
FT   misc_feature    189327..189698
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 1e-31"
FT   misc_feature    189792..190343
FT                   /note="HMMPfam hit to PF01339, CheB methylesterase, score
FT                   5.5e-110"
FT   CDS_pept        190423..190812
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="BPP1477"
FT                   /product="chemotaxis protein CheY"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1033"
FT                   /db_xref="GOA:Q7WAA3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAA3"
FT                   /protein_id="CAE36779.1"
FT                   /translation="MVDKGMKILVVDDFPTMRRIIRNLLKELGFENVDEAEDGAIGLEK
FT                   LRNGAFQFVVSDWNMPNLDGLEMLKQIRADAALKSLPVLMVTAEAKKENIVAAAQAGAN
FT                   GYVVKAFTAATLEEKLNKIFEKLAG"
FT   misc_feature    190438..190806
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 3.3e-39"
FT   CDS_pept        190821..191453
FT                   /transl_table=11
FT                   /gene="cheZ"
FT                   /locus_tag="BPP1478"
FT                   /product="chemotaxis protein CheZ"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1034"
FT                   /db_xref="GOA:Q7WAA2"
FT                   /db_xref="InterPro:IPR007439"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAA2"
FT                   /protein_id="CAE36780.1"
FT                   /translation="MNATDTGMQADPTDLIQRIASLTRMLRDSMRELGLDQAIKDAAEA
FT                   IPDARDRLRYLAQMTEQAANRVLNAIEAAGPIQDGMARGAQALDERWQQWYDQPLELPQ
FT                   ARALVQDTRAFLAAVPQHTQQTQAKLMEIVMAQDFQDLTGQVIMRMMDVVGAIERELLQ
FT                   VLLDNVPQERRDEANSLLNGPQVNPGGKADVVTSQDQVDDLLASLGF"
FT   CDS_pept        191680..192834
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="BPP1479"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1366"
FT                   /db_xref="GOA:Q7WAA1"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAA1"
FT                   /protein_id="CAE36781.1"
FT                   /translation="MAEESDLEKSEAASPRRLEKAREEGQIARSRELGTFMMLAAGVVG
FT                   VWLSGSMLYQGLTGVLRRGLGFEPRVAQDPGVMVEQAVHGAGRALLTVLPMFGMLAVVA
FT                   VLSAVLLGGFVFSTKPLEPNFSKLSLWSGIKRMFSAQTVVELVKALAKAALVGGVAVWV
FT                   IWHYHDDMLGLMHVAPSAALTSAMSLVALCSALIVGSLLFVVLLDVPWQIWNHLKKLRM
FT                   TKEDVRQEHKESEGDPHVKGRIRQQQRAMARRRMMSEVPGADVVVTNPTHYAVALKYAD
FT                   GAAGAPRVVAKGTGLIAARIRELAAEHRIPTLEAPPLARALHQHVELGQEIPTALYTAV
FT                   AEVLAWVFQLRSWRPGLGREPQAPTALAVPAELDPHSPPATQGA"
FT   misc_feature    191695..192723
FT                   /note="HMMPfam hit to PF01312, FlhB HrpN YscU SpaS Family,
FT                   score 6e-141"
FT   misc_feature    join(191785..191853,191959..192027,192106..192174,
FT                   192232..192300)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BPP1479 by TMHMM2.0 at aa 36-58, 94-116, 143-165 and
FT                   185-207"
FT   CDS_pept        join(192838..194451,194455..194955)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="BPP1480"
FT                   /product="flagellar biosynthesis protein FlhA (Pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1367"
FT                   /db_xref="PSEUDO:CAE36782.1"
FT   misc_feature    join(192871..192939,192952..193020,193054..193122,
FT                   193180..193248,193453..193521,193579..193647,
FT                   193684..193743,193753..193812)
FT                   /note="8 probable transmembrane helices predicted for
FT                   BPP1480 by TMHMM2.0 at aa 12-34, 39-61, 73-95, 115-137,
FT                   206-228, 248-270, 283-302 and 306-325"
FT   misc_feature    join(192916..194451,194455..194919)
FT                   /note="HMMPfam hit to PF00771, FHIPEP family, score 0"
FT   misc_feature    193267..193338
FT                   /note="PS00994 Bacterial export FHIPEP family signature."
FT   CDS_pept        join(194952..196325,196324..197310)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="flhF"
FT                   /locus_tag="BPP1481"
FT                   /product="flagellar biosynthesis protein FlhF (Pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1368"
FT                   /db_xref="PSEUDO:CAE36783.1"
FT   misc_feature    195522..196118
FT                   /note="HMMPfam hit to PF00448, SRP54-type protein, GTPase
FT                   domain, score 2.5e-23"
FT   misc_feature    195549..195572
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   variation       196323..196325
FT                   /note="14 bp deletion in parapertussis, relative to
FT                   pertussis, following this codon"
FT   CDS_pept        complement(197328..197810)
FT                   /transl_table=11
FT                   /locus_tag="BPP1482"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1370"
FT                   /db_xref="GOA:Q7WAA0"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAA0"
FT                   /protein_id="CAE36784.1"
FT                   /translation="MNSAALKSCLERENALVVEFLHALEAETEALMDRRAHESLQAAVQ
FT                   RKETLADDLAQLGAERDALLSDAGLASGPAGTDAAAAAHPELGPLWQALQANAAQAREH
FT                   NQRNGTLIAVNLRHTQESLDALRQAAGTGAAATYDAQGRGKRGYSSAASGRAIVAT"
FT   CDS_pept        complement(197827..198117)
FT                   /transl_table=11
FT                   /gene="flgM"
FT                   /locus_tag="BPP1483"
FT                   /product="negative regulator of flagellin synthesis"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1371"
FT                   /db_xref="GOA:Q7WA99"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA99"
FT                   /protein_id="CAE36785.1"
FT                   /translation="MKIQSSTSHPVGPNAVGARAEHAVAQAYGGGAQAGSGSAQVALSP
FT                   ASRQLLAQEGGSDIDVERVAAIRAAIASGQLRIDPTRIADSLIASARDLLK"
FT   CDS_pept        complement(198244..199119)
FT                   /transl_table=11
FT                   /gene="flgA"
FT                   /locus_tag="BPP1484"
FT                   /product="flagella basal body P-ring formation protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1372"
FT                   /db_xref="GOA:Q7WA98"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="InterPro:IPR041231"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA98"
FT                   /protein_id="CAE36786.1"
FT                   /translation="MRTDWPKKTGRTAWLAFWHDGILGCGRPPQKAKQPAISEPIRLLR
FT                   GTAPFYNLPIMKSPRSRSIARLAALAILAGAMPRAAAEPPAQDPAELAAAAESYLRQQL
FT                   AALPGEPSITLDPLRTDRLDACEALTPFMPSGMRVRARMTVGLRCVAPRTWTVYAQATV
FT                   SVPGQYYVAARQIAPGKTIEAADLTTRDGDLVALPPGVITDAAAILGMRPAHRIAAGQP
FT                   IKGAGLRSAESVSRGQSVRITARGNGFVVSSEGQALDNAPPSATVQVRTASGQVVSGIV
FT                   QAAGLVEIQL"
FT   misc_feature    complement(198250..198753)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF03240, FlgA family, score 5.8e-28"
FT   CDS_pept        199138..199545
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /gene_synonym="flbA"
FT                   /gene_synonym="fla FII"
FT                   /locus_tag="BPP1485"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1373"
FT                   /db_xref="GOA:Q7WA97"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA97"
FT                   /protein_id="CAE36787.1"
FT                   /translation="MLDRLNEDFRFFQQSIALRAQRQEVLSSNIANADTPNYKARDFDF
FT                   KAAMQGALEQRMRLPDTNLALTSARHIPGQATTPSPAELMYRLPYQPSLDGNTVDMDSE
FT                   RVRFADNTLHYQSSLQVLSGRIRSLMSAIQE"
FT   misc_feature    199162..199254
FT                   /note="HMMPfam hit to PF00460, Flagella basal body rod
FT                   protein, score 1.9e-06"
FT   CDS_pept        199558..199977
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /gene_synonym="flaW"
FT                   /gene_synonym="fla FIII"
FT                   /locus_tag="BPP1486"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1374"
FT                   /db_xref="GOA:Q7WA96"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA96"
FT                   /protein_id="CAE36788.1"
FT                   /translation="MSLLSIFEIAGSALSAQSQRMNVSASNMANADSVAGPDGQPYRAR
FT                   QVVFQVNPPPGQAFGQEIGGVRVAGVVEDQSPFKKIYDPKHPMADAQGYVNMPNVDPVA
FT                   ETVNMIAASRSYQANVEVLNTAKQLMLKTLTIGQS"
FT   misc_feature    199576..199671
FT                   /note="HMMPfam hit to PF00460, Flagella basal body rod
FT                   protein, score 1.1e-08"
FT   misc_feature    199594..199656
FT                   /note="PS00588 Flagella basal body rod proteins signature."
FT   CDS_pept        200025..200729
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /gene_synonym="flaV"
FT                   /gene_synonym="fla FIV"
FT                   /locus_tag="BPP1487"
FT                   /product="basal-body rod modification protein FlgD"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1375"
FT                   /db_xref="GOA:Q7WA95"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA95"
FT                   /protein_id="CAE36789.1"
FT                   /translation="MTTVNETTSQAGLALAQAGSNSAAQGIQDQFLTLLVTQLRNQDPL
FT                   NPMENAELTSQLAQISTVEGINNLKNTMLAISGQIDVSQSMDAVSMIGKGVLMPGDKVS
FT                   LGTDPNDPAQRGATPFGIDLQGDATKVTVKVLDPSGAVVRTMELGDLKTGVHTLQWDGN
FT                   NDGGQPLADGKYSITVSASDADANPVKTEALTYGQVKSVAYSTNGLRLDLGLAGQISML
FT                   DVRKVIGASGSA"
FT   misc_feature    200025..200093
FT                   /note="Signal peptide predicted for BPP1487 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.780) with cleavage site
FT                   probability 0.389 between residues 23 and 24"
FT   CDS_pept        200795..202216
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /gene_synonym="flaK"
FT                   /gene_synonym="fla FV"
FT                   /locus_tag="BPP1488"
FT                   /product="flagellar hook protein FlgE"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1376"
FT                   /db_xref="GOA:Q7WA94"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA94"
FT                   /protein_id="CAE36790.1"
FT                   /translation="MGFGQGLSGLNAASQNLDVIGNNIANSGTVGFKSGAASFADVYAS
FT                   SRVGLGVKVSAINQRFTVGNISTTGGEYDMAIDGGKGFFRLTDQSGGVFYSRNGEFMVD
FT                   KNFYIVNAQGFRLTGYPAGGVGAQPVDLQLPQGNIAPQATSTAGLQTNLNANAKVIDPN
FT                   DTPADDGAVELDGTTYRFTNASGTFAWVAPAPLDGTYNGGDIVIAGGAVTGDLASQPGY
FT                   QPYKPLVAGIPFDPTNPLSYTDQVPTTVYDSLGNSHQMIQYFAKRPAVGTESVYEVYYV
FT                   LDGQPMQVNGGASQTLNFDTAGNLLNQPPTAQVTFANPGGNAAPADPLAITVSYNGVTQ
FT                   YGSDFAPKVVQNGYSSGEFMGLSVGKDGSLVAKYTNGETQTIGTLVLANFNNVQGLQPV
FT                   GNNAWVETSESGQATLGQPGTNGLATIAGQALEASNVDMSRELVNMIVAQRTYQANAQT
FT                   IKTQDEVMQVLMNMR"
FT   misc_feature    200801..200893
FT                   /note="HMMPfam hit to PF00460, Flagella basal body rod
FT                   protein, score 3.4e-10"
FT   CDS_pept        202255..203019
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /gene_synonym="flaX"
FT                   /gene_synonym="fla FVI"
FT                   /locus_tag="BPP1489"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1377"
FT                   /db_xref="GOA:Q7WA93"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA93"
FT                   /protein_id="CAE36791.1"
FT                   /translation="MDRIIYTAMNGAARIAEHQTVLGNNMANVNTPGFREQIALYRSVP
FT                   MADGTSLPTRVSTVASTPGNNFEMGNMMTTGRELDVALAGPGWFALQTPQGEAYTRAGA
FT                   LQVGVNGLLQTATGQPVLSDQNAVIEVPDQASLTIASDGTVTAIGAGDPPNNILNLGRL
FT                   KMVNPPPQQLVHGDDGVFRMPQQPGGQPAAPLPADPSQRLLSGVLEGSNASPMGAMVGM
FT                   IQNARRFEMQMQVIREADKNAERANGILAAAS"
FT   misc_feature    202267..202359
FT                   /note="HMMPfam hit to PF00460, Flagella basal body rod
FT                   protein, score 1.7e-06"
FT   misc_feature    202285..202347
FT                   /note="PS00588 Flagella basal body rod proteins signature."
FT   CDS_pept        join(203063..203542,203546..203848)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /gene_synonym="flaL"
FT                   /gene_synonym="fla FVII"
FT                   /locus_tag="BPP1490"
FT                   /product="flagellar basal-body rod protein FlgG
FT                   (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1378"
FT                   /db_xref="PSEUDO:CAE36792.1"
FT   misc_feature    203075..203167
FT                   /note="HMMPfam hit to PF00460, Flagella basal body rod
FT                   protein, score 1.1e-10"
FT   variation       203543..203545
FT                   /note="In-frame TAG stop codon in parapertussis; CAG in
FT                   pertussis"
FT   CDS_pept        203845..204537
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /gene_synonym="flaY"
FT                   /gene_synonym="fla FVIII"
FT                   /locus_tag="BPP1491"
FT                   /product="flagellar L-ring protein precursor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1379"
FT                   /db_xref="GOA:Q7WA92"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA92"
FT                   /protein_id="CAE36793.1"
FT                   /translation="MMLKTVLRLPVCAALLALAAGCAMIPPEPVVTGPLTAPPPPPPQP
FT                   SARPNGSIYQPSAYGNYPLFEDRRPRNVGDIVTIVLEEKTNAAKGVATNTSRDGSATLG
FT                   VAAAPRFMDGVINDKLDTDISGGNTANGTGKSSANNTFTGTITTTVIGVLPNGNLQIAG
FT                   EKQIAINRGSEYVRFSGVVDPRSITGSNTVSSTRVADARIEYRSKGVMDEVQTMGWLQR
FT                   FFLIASPF"
FT   misc_feature    203845..203940
FT                   /note="Signal peptide predicted for BPP1491 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.424 between residues 32 and 33"
FT   misc_feature    203878..203910
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    203908..204531
FT                   /note="HMMPfam hit to PF02107, Flagellar L-ring protein,
FT                   score 2.9e-68"
FT   CDS_pept        204540..205673
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /gene_synonym="flaM"
FT                   /gene_synonym="fla FIX"
FT                   /locus_tag="BPP1492"
FT                   /product="flagellar P-ring protein precursor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1380"
FT                   /db_xref="GOA:Q7WA91"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA91"
FT                   /protein_id="CAE36794.1"
FT                   /translation="MTFPTSLSVLLIPLARAVLALALLGAGAAHAERLKDLASIQGVRG
FT                   NQLIGYGLVVGLDGSGDQVRQTPFTQQSLTNMLSQLGITVPQGSNMQLKNVAAVMVTAT
FT                   LPSFARPGQTVDVVVSSMGNAKSLRGGTLLMTPLKGADNQVYAIAQGNLLVGGAGASAG
FT                   GSSVQINQLNGGRISNGAIVERAVPTMYAQDGTVYLEMNNTDFGTTQNAAAAINRQFGA
FT                   GTAMALDGRVIQVRGPLDPSMMPAFMSQVENLQVARAPATAKVIINARTGSVVMNRTVM
FT                   IEEAAVAHGNLSVIINRQNQVFQPDTPFTEGQTVVVPNTQIEVRQDGGALQRVTTSANL
FT                   ADVVKALNALGATPQDLLAILQAMKTAGALRADLEII"
FT   misc_feature    204540..204632
FT                   /note="Signal peptide predicted for BPP1492 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.990 between residues 31 and 32"
FT   misc_feature    204558..204626
FT                   /note="1 probable transmembrane helix predicted for BPP1492
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    204636..205667
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02119, Flagellar P-ring protein,
FT                   score 4.1e-196"
FT   CDS_pept        205691..206710
FT                   /transl_table=11
FT                   /gene="flgJ"
FT                   /gene_synonym="flaZ"
FT                   /gene_synonym="fla FX"
FT                   /locus_tag="BPP1493"
FT                   /product="peptidoglycan hydrolase"
FT                   /EC_number="3.2.1.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1381"
FT                   /db_xref="GOA:Q7WA90"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR013377"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA90"
FT                   /protein_id="CAE36795.1"
FT                   /translation="MSFVSYTPRPGVQESVFDLGRLADLKRDAVKAPDGQRQQTEVARQ
FT                   FEALFLQMMLKRMREATPKEGLFDSQQTEMLQGMADEQLALQLASPGIGLAQALLGQMQ
FT                   QGQPPVPAAAAAGGDAAAARALAGTAAPAPLVRDLRGNYVQPDPAPRREVNALLDVLRS
FT                   NRARDRAMAAAEGAPSHVVDFVSRMSRAANVAAQQSGVPARLILGQAALESGWGRRELR
FT                   HEDGSTSYNLFGIKAGASWKGKVVNVMTTEYVDGVAQKLVQPFRAYSSYEESFSDYARL
FT                   IGNSPRYEAVTQAGNEIEAARRIQEAGYATDPRYAEKLISIMGQLRTSVARADFSGGL"
FT   misc_feature    206228..206680
FT                   /note="HMMPfam hit to PF01832, Mannosyl-glycoprotein
FT                   endo-beta-N-acetylglucosamidase, score 1.1e-39"
FT   CDS_pept        206780..208426
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /gene_synonym="flaS"
FT                   /gene_synonym="flaW"
FT                   /locus_tag="BPP1494"
FT                   /product="flagellar hook-associated protein 1"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1382"
FT                   /db_xref="GOA:Q7WA89"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA89"
FT                   /protein_id="CAE36796.1"
FT                   /translation="MNLYNLALTGLNASQAGLETTSHNINNATTVGYSRQRVITSTAGA
FT                   GETGQGFFGRGVQVDTVTRQYDSFLYRQLVGAQGSSAQLSTHLAQVSQVNNLFGDRTVG
FT                   ITPALAGLFTSTNAAATKPADPAVRADMIGKANSLVTQINTAYQELENQRNGLNTQIST
FT                   TVEQVNSYLERINDLNKQIVIARGKDGHAPNDLLDQRDQAVSELNQLTGIRFYEQGDTF
FT                   NITLQSGQTLLSGTTVYPLQAVPSASDPKRLAVAYTLPSGPGTTIQVEMNDSEVTGGQL
FT                   GGLLSFRSQSLDAVQDQLGQLAIGLAMAFNAQHREGYDLDGQPGGDMFGLQAPAAIRNS
FT                   GNTSTGEWQSAYTDADAIRASAYRIQYDGANYTVTRLSDGSSFDVTPSGTPPTLSFDGL
FT                   TLTGSGTPAAGDAWTLQPARDAARDLKQLISDPSKLALADSALGTTNGNNGLKLAELQT
FT                   AKVLGNGSMSLNEMFSQLVNNVGVQTQQVSTANTAQANLVKQQATAHLSVSGVNLNEEY
FT                   VNLTIFQEQYQASAKILDVASTVFDTLLGLR"
FT   CDS_pept        208460..209992
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /gene_synonym="flaT"
FT                   /gene_synonym="flaU"
FT                   /locus_tag="BPP1495"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1383"
FT                   /db_xref="GOA:Q7WA88"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA88"
FT                   /protein_id="CAE36797.1"
FT                   /translation="MRLSTALIYQNGLNGVLNQEAAMARLQEQLSSGRRVLTPADDPLA
FT                   AALAVNVSQTSSMNSNYDANRKQAEQALGAQTNTLQSVVKNMQEMLKRVVEAGNGTMSD
FT                   ADRQALVIALKGAREELVGLANATDGNGQYLFSGYKGFTQPYSFDAATGKVTYNGDLGQ
FT                   RGIQVDQSRLMSGGDVGSDIFNSVTSGTLAYIADAGAGNAGTGQYSAVSFDGPRAGNYV
FT                   GRDFRIEFTRDAVTDELQYSVLSDPPVVPPEQPLPANMPYSEGSVIDMNGVSIKLSGQP
FT                   EAGDVFTVETPKSWKMGVQGDAANTGSATLTPVSLPDGLTGKNLSVAFLDDGAGGLLYS
FT                   VTSTPPDPSLPANVPVKPGDVIDIGGLKVKVDGQPAAGDTYAVTTPKSANVDVFDTLND
FT                   LIGALDTPISGDPQAAAALANTLATANKKLNLSLDNVLTVQASVGARLNELEALGNTGA
FT                   QKGLSYVKQLSDLEDVNIYQATSDLLLRQVALQAASLALQRIQGNSLFSMGR"
FT   misc_feature    208538..208960
FT                   /note="HMMPfam hit to PF00669, Bacterial flagellin
FT                   N-terminus, score 3.7e-09"
FT   CDS_pept        210020..211687
FT                   /transl_table=11
FT                   /gene="tsr"
FT                   /gene_synonym="cheD"
FT                   /locus_tag="BPP1496"
FT                   /product="methyl-accepting chemotaxis protein I"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1384"
FT                   /db_xref="GOA:Q7WA87"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA87"
FT                   /protein_id="CAE36798.1"
FT                   /translation="MARAPLEERVFDGKRINMWSNLKVRTCITLVLGLFLVAMLVSNAM
FT                   AWLGMSSSNDKLERVNNAYSNQAVPAYEAYVMLLRARLNMVSSMMDLQEGRLKESADTL
FT                   AHAQRQAGEARERFEAFLAVAKASSGADRVGAVETAFHAYLEVAARQMEAMQNQKLGEF
FT                   VQLNPSAQRLNTAFDTAASAYLDRIDTDTDALVDDARAEHLRANTVTLVLIVLALALCA
FT                   GCGVFIGRAVLRPLKEAGQHFDRIAAGDLTARVDVRSTNEIGQLFAALKRMQESLTRTV
FT                   AAVRRGVDEINVGSREISAGNTDLSSRTEEQAASLEETAASMEQLASTVKQNADNARQA
FT                   NQLAASASDVAERGGSAVSEVVTTMQDISASSRKISEIVSVIDGIAFQTNILALNAAVE
FT                   AARAGEQGKGFAVVAGEVRSLAQRSAQAAKEIKVLIEDSVDKVGTGSQQVERAGATMQE
FT                   IVASVKRVTDIMGEISAASEEQSSGIEQVNRAVSQMDEVTQQNAALVEEAAAAAGSLQE
FT                   QAQRLAEAVAVFKINTGEVIEVPAHQLSGYAAPLVAQS"
FT   misc_feature    210020..210157
FT                   /note="Signal peptide predicted for BPP1496 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.782) with cleavage site
FT                   probability 0.390 between residues 46 and 47"
FT   misc_feature    join(210101..210169,210650..210718)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP1496 by TMHMM2.0 at aa 28-50 and 211-233"
FT   misc_feature    210647..210856
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 1.7e-14"
FT   misc_feature    210917..211615
FT                   /note="HMMPfam hit to PF00015, Methyl-accepting chemotaxis
FT                   protein (MCP) signaling domain, score 1.1e-110"
FT   CDS_pept        join(211866..213281,213285..213464)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1497"
FT                   /product="methyl-accepting chemotaxis protein (Pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1386"
FT                   /db_xref="PSEUDO:CAE36799.1"
FT   misc_feature    212103..212228
FT                   /note="HMMPfam hit to PF00785, PAC motif, score 6.4e-06"
FT   misc_feature    212481..212690
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 9.7e-06"
FT   misc_feature    join(212751..213281,213285..213449)
FT                   /note="HMMPfam hit to PF00015, Methyl-accepting chemotaxis
FT                   protein (MCP) signaling domain, score 1.1e-81"
FT   variation       213282..213284
FT                   /note="In-frame TAG stop codon in parapertussis; TCG in
FT                   pertussis"
FT   CDS_pept        complement(join(213613..213771,213777..214406))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /gene_synonym="flaP"
FT                   /locus_tag="BPP1498"
FT                   /product="flagellar biosynthetic protein FliR (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1389"
FT                   /db_xref="PSEUDO:CAE36800.1"
FT   misc_feature    complement(join(213643..213771,213777..214388))
FT                   /note="HMMPfam hit to PF01311, Bacterial export proteins,
FT                   family 1, score 2e-77"
FT   misc_feature    complement(join(213705..213770,213807..213872,
FT                   213954..214019,214119..214184,214215..214280,
FT                   214308..214373))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPP1498 by TMHMM2.0 at aa 11-33, 42-64, 74-96, 129-151,
FT                   178-200 and 212-234"
FT   variation       complement(213773..213787)
FT                   /note="(GCGCC)3 in parapertussis; (GCGCC)2 in pertussis"
FT   CDS_pept        complement(214429..214698)
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /gene_synonym="flaQ"
FT                   /locus_tag="BPP1499"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1390"
FT                   /db_xref="GOA:Q7WA86"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA86"
FT                   /protein_id="CAE36801.1"
FT                   /translation="MTAETVMSMTYQALKVALALAGPLLLVTLIVGLVISIFQAATQIN
FT                   EMTLSFIPKLLAMCGTLVLLGPWLLGLLTDYIRQLIGQIPMLVS"
FT   misc_feature    complement(214462..214689)
FT                   /note="HMMPfam hit to PF01313, Bacterial export proteins,
FT                   family 3, score 1.9e-36"
FT   misc_feature    complement(join(214483..214548,214594..214659))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP1499 by TMHMM2.0 at aa 13-35 and 50-72"
FT   misc_feature    complement(214579..214698)
FT                   /note="Signal peptide predicted for BPP1499 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.889) with cleavage site
FT                   probability 0.864 between residues 40 and 41"
FT   CDS_pept        complement(214715..215515)
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /gene_synonym="flaR"
FT                   /locus_tag="BPP1500"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1391"
FT                   /db_xref="GOA:Q7WA85"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA85"
FT                   /protein_id="CAE36802.1"
FT                   /translation="MPVMSISFRFSDTRPRAPWWPAMAAVAVAAAALWPSGALAQATLP
FT                   ALTATPGPNGSETYSLSMQTLLLMTSLSFLPAALLMMTGFTRIIIVLGLLRSAMGTAMS
FT                   PPNHVLIGLALFLTFYTMSPVFDKIYTDAYQPLAAGSIPFETAVERAGSPLHNFMLHQT
FT                   RENDLTLFANLANLPAMEDPSQVPMRILIPAFITSELKTAFQIGFTIFIPFLIIDLVVA
FT                   SVLMALGMMMVPPVTVALPFKLMLFVLADGWHLLLGSLAQSFYQ"
FT   misc_feature    complement(214733..215314)
FT                   /note="HMMPfam hit to PF00813, FliP family, score 7.9e-108"
FT   misc_feature    complement(join(214745..214810,214832..214897,
FT                   215138..215194,215231..215296,215390..215455))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BPP1500 by TMHMM2.0 at aa 20-42, 73-95, 107-126, 206-228
FT                   and 235-257"
FT   misc_feature    complement(214757..214795)
FT                   /note="PS01061 Flagella transport protein fliP family
FT                   signature 2."
FT   misc_feature    complement(214892..214939)
FT                   /note="PS01060 Flagella transport protein fliP family
FT                   signature 1."
FT   misc_feature    complement(215396..215515)
FT                   /note="Signal peptide predicted for BPP1500 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.988 between residues 40 and 41"
FT   CDS_pept        complement(215518..215859)
FT                   /transl_table=11
FT                   /gene="fliO"
FT                   /gene_synonym="flbD"
FT                   /gene_synonym="flaP"
FT                   /locus_tag="BPP1501"
FT                   /product="flagellar protein FliO"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1392"
FT                   /db_xref="GOA:Q7WA84"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA84"
FT                   /protein_id="CAE36803.1"
FT                   /translation="MTESAVLRVVIGLALVIAAILVSAWLARRSGLIQRHGGALLRQVG
FT                   GMSLGPRQRVVVLEIEGTWLVLGVTPNQLTTLHTLPAGQLPDPSPAAAGTFAAKLGQAL
FT                   QRGHRVDRP"
FT   misc_feature    complement(215779..215844)
FT                   /note="1 probable transmembrane helix predicted for BPP1501
FT                   by TMHMM2.0 at aa 5-27"
FT   misc_feature    complement(215791..215859)
FT                   /note="Signal peptide predicted for BPP1501 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.646) with cleavage site
FT                   probability 0.347 between residues 23 and 24"
FT   CDS_pept        complement(join(215870..216202,216206..216388))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /gene_synonym="motD"
FT                   /locus_tag="BPP1502"
FT                   /product="flagellar motor switch protein FliN (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1393"
FT                   /db_xref="PSEUDO:CAE36804.1"
FT   misc_feature    complement(215903..216133)
FT                   /note="HMMPfam hit to PF01052, Surface presentation of
FT                   antigens (SPOA) protein, score 5.5e-34"
FT   CDS_pept        complement(216381..217391)
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /gene_synonym="fla AII"
FT                   /gene_synonym="fla QII"
FT                   /gene_synonym="CheC2"
FT                   /locus_tag="BPP1503"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1394"
FT                   /db_xref="GOA:Q7WA83"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA83"
FT                   /protein_id="CAE36805.1"
FT                   /translation="MAYEAFLSQDEVDALLAGVTGESDEKQPAGDEAGAPRAYDLSSPE
FT                   RVVRRRMQTLELINERFARHMRNVLLNFMRRNADITVGAIKILKYADFERNLPVPSNLN
FT                   MIQMKPLRGTALFTYDPNLVFLVIDSLFGGDGRYHTRVEGRDFTTTEQRIIRRLLNLTL
FT                   ESYGKSWDPVYPIEFEYVRSEMHTKFASITGNNEVVVVSPFHIEFGATGGDLNICLPYS
FT                   MIEPVRDLLTRPLQDTALEEVDQRWAQQLQSQVRSADIDLVAEFGHIPSSIGELMRMKT
FT                   GDVLPIAVPETVTAHVDGVPLMEYGYGVFNGRYALRVQNLINYDDTDSNEAPDHD"
FT   misc_feature    complement(216417..216641)
FT                   /note="HMMPfam hit to PF01052, Surface presentation of
FT                   antigens (SPOA) protein, score 0.0037"
FT   misc_feature    complement(216699..217277)
FT                   /note="HMMPfam hit to PF02154, Flagellar motor switch
FT                   protein FliM, score 5.8e-95"
FT   CDS_pept        complement(217394..217966)
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /gene_synonym="fla AI"
FT                   /gene_synonym="fla QI"
FT                   /gene_synonym="cheC1"
FT                   /locus_tag="BPP1504"
FT                   /product="flagellar protein FliL"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1395"
FT                   /db_xref="GOA:Q7WA82"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA82"
FT                   /protein_id="CAE36806.1"
FT                   /translation="MATTKTSTMPPRTTLPLRPGGAGRLLRPLLMLLVLALVVAASVAG
FT                   TWYFMKRMQPPVAVPVQLGVGQPQATPMQFVAPPATPPVVPAPIFIPLEAFTVTLQNAD
FT                   SERILHVGITLRVSDEQTRQRIEKYMPEVRSRILMVLSSQSPQAVQTLQGKTEMAHAIT
FT                   EAVKRPFSPLPDGQYVTDALFTAFVVQ"
FT   misc_feature    complement(217817..217882)
FT                   /note="1 probable transmembrane helix predicted for BPP1504
FT                   by TMHMM2.0 at aa 28-50"
FT   misc_feature    complement(217835..217966)
FT                   /note="Signal peptide predicted for BPP1504 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.980) with cleavage site
FT                   probability 0.665 between residues 44 and 45"
FT   CDS_pept        complement(218108..219424)
FT                   /transl_table=11
FT                   /gene="fliK"
FT                   /gene_synonym="flaE"
FT                   /gene_synonym="flaR"
FT                   /locus_tag="BPP1505"
FT                   /product="flagellar hook-length control protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1398"
FT                   /db_xref="GOA:Q7WA81"
FT                   /db_xref="InterPro:IPR001635"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA81"
FT                   /protein_id="CAE36807.1"
FT                   /translation="MSRNRTAAMTTATLPIPALTPAPGPAAQGGPAAAGKGPSFSQVLA
FT                   RQQGGKPGEAGTPAAPGAQAGAPAQGPATQNPAGAGKPGKPGDTAALPVDGQQEPAAET
FT                   AADAATLAALAAQTAPAPALPLQALEIAAEAAAVNAQVAAATQAAGAAARQPAHAALLA
FT                   GQPAAPAAAGAPPADTAPAMPPALPQAAQPAVAAQAAVAASAPNAPAAETAATPPAAPS
FT                   LPHPLPSTGGTPQDGGEAAEPPATAPAQPQPLAAAEHGAALHAAAQAHIAARQAVGNPA
FT                   PASLPAAAQPLGLEVAAPVGSSQWGQDLGRQLVTISHDARQGHHTAELRLDPPDLGPLR
FT                   VSINLHEGVASAAFVSVHAAVRQAVEAALPQLQQALAQAGISLGQTSVGDQSAQQGFAE
FT                   QQGRGAGASGGSAAGADSETVVVAATPARNADALVDTFA"
FT   misc_feature    complement(219338..219424)
FT                   /note="Signal peptide predicted for BPP1505 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.992) with cleavage site
FT                   probability 0.341 between residues 29 and 30"
FT   CDS_pept        complement(219430..219864)
FT                   /transl_table=11
FT                   /gene="fliJ"
FT                   /gene_synonym="flaO"
FT                   /gene_synonym="flaS"
FT                   /locus_tag="BPP1506"
FT                   /product="flagellar protein FliJ"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1399"
FT                   /db_xref="GOA:Q7WA80"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="InterPro:IPR018006"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA80"
FT                   /protein_id="CAE36808.1"
FT                   /translation="MPSQLPLDMLIGLAKDSTDEAARELGRLSAERNNAEQQFNMLQDY
FT                   RQDYLQRMQSGMSAADCHNYQRFIATLDDAIGQQRHVLHRAEAHLNDGRLNWQQQKRKL
FT                   NSFDTLAQRESRTQALLEARREQRVNDEYSARLVRRQAGF"
FT   misc_feature    complement(219436..219864)
FT                   /note="HMMPfam hit to PF02050, Flagellar FliJ protein,
FT                   score 4.5e-10"
FT   CDS_pept        complement(219857..221332)
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /gene_synonym="fla AIII"
FT                   /gene_synonym="flaC"
FT                   /locus_tag="BPP1507"
FT                   /product="flagellum-specific ATP synthase FliI"
FT                   /EC_number="3.6.3.14"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1400"
FT                   /db_xref="GOA:Q7WA79"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR020005"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA79"
FT                   /protein_id="CAE36809.1"
FT                   /translation="MNPPALPLPADTAAVPVADRWQTQLQIGSIRAASTEPWLVSGRIT
FT                   RAAGLVLHATGLRLPVGAACRIELARGHDHWADAEVVGFDGHTLYLMPQSDISGLPPGA
FT                   RVVPAEPAVQRPVPLPRKAELNGNAKPQVGRHLPVGNAMLGRVVDGAGRPLDGLGPLAG
FT                   AEQAPLTALPINPLSRAPIDSVLDVGVRAINGLLTVGRGQRMGLFAGSGVGKSVLLGMM
FT                   ARYTRADIIVVGLIGERGREVKEFIEHNLGPEGLARSVVVAAPADVSPLLRLQGASYAT
FT                   RLAEHFRDQGLDVLLIMDSLTRFAMAQREIALAIGEPPATKGYPPSVFAKLPALVERTG
FT                   MGAPSPNGKAGSITAFYTVLAEGDDQQDPIADSARAILDGHVVLSRHLAEAGHYPAIDI
FT                   EASISRAMTSLITTEQFQQVRRFKQILSRYQRNRDLISVGAYVAGADPQLDDAIARYPR
FT                   LEAYLQQNIGDSVDYGTAIDQLQRSLETREAYA"
FT   misc_feature    complement(220103..220930)
FT                   /note="HMMPfam hit to PF00006, ATP synthase alpha/beta
FT                   family, nucleotide-binding domain, score 1.3e-131"
FT   misc_feature    complement(220121..220150)
FT                   /note="PS00152 ATP synthase alpha and beta subunits
FT                   signature."
FT   misc_feature    complement(220685..220708)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(221329..222084)
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /gene_synonym="fla BIII"
FT                   /gene_synonym="fla AII.3"
FT                   /locus_tag="BPP1508"
FT                   /product="flagellar assembly protein FliH"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1401"
FT                   /db_xref="GOA:Q7WA78"
FT                   /db_xref="InterPro:IPR000563"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA78"
FT                   /protein_id="CAE36810.1"
FT                   /translation="MSEALAREPAALPRSAAWRRWQMLSFDEPAEAETPEPAALEPEPE
FT                   PAPDPEELLREWRATAERAGHAAGHQAGQEQGQREGYAAGHAQGLAAGRAEGHAEGLAQ
FT                   GREEARQQAERLHALAQACAASVARLEDNMGQSLLTLALDIAGQVLRTALAEHPETMVA
FT                   AVREVLHINPATGAAMRLWVHPDDLELVRTHLADELNEANWRLQADESITRGGCRTETA
FT                   YGDVDATLQARWRRVAASLGRSAAWEETA"
FT   misc_feature    complement(221371..222084)
FT                   /note="HMMPfam hit to PF02108, Flagellar assembly protein
FT                   FliH, score 9.2e-11"
FT   CDS_pept        complement(222077..223087)
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /gene_synonym="fla BII"
FT                   /gene_synonym="fla AII.2"
FT                   /locus_tag="BPP1509"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1402"
FT                   /db_xref="GOA:Q7WA77"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA77"
FT                   /protein_id="CAE36811.1"
FT                   /translation="MKNDGKPLDGMTRSAVLMMSLGEDAAAEVFKYLSAREVQQVGAAM
FT                   ASLKQVTRGDVAVVLEEFRQEADQFMAVTLGSDDYIRTVLTKALGSDRAAGLIEDILEA
FT                   GEGGSGIDALNWLDPHTVAELIGDEHPQIIATILVHLERDRAASVLAMLSERMRNDVML
FT                   RIATFGGVQPAALSELTDVLNSVLAGQGAKRSKMGGVRTAAEILNMMNSSQEEAVVESL
FT                   RERDSDLAQKIIDEMFVFDNLLDVEDRAVQLILKEIDNDTLMVALKGAGDELRNKFLRN
FT                   MSSRAAEMLREDLEAQGPIRMSKVEGEQKKILQIARRLAESGQIVLGTQGDDAYV"
FT   misc_feature    complement(222104..222433)
FT                   /note="HMMPfam hit to PF01706, FliG C-terminal domain,
FT                   score 3.4e-52"
FT   CDS_pept        complement(join(223077..223892,223896..224753))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /gene_synonym="fla BI"
FT                   /gene_synonym="fla AII.1"
FT                   /locus_tag="BPP1510"
FT                   /product="flagellar M-ring protein FliF (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1403"
FT                   /db_xref="PSEUDO:CAE36812.1"
FT   misc_feature    complement(join(223302..223367,224613..224669))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP1510 by TMHMM2.0 at aa 28-47 and 462-484"
FT   variation       complement(223893..223895)
FT                   /note="In-frame TAG stop codon in parapertussis; CAG in
FT                   pertussis"
FT   misc_feature    complement(224067..224693)
FT                   /note="HMMPfam hit to PF01514, Secretory protein of
FT                   YscJ/FliF family, score 3.3e-77"
FT   misc_feature    complement(224622..224753)
FT                   /note="Signal peptide predicted for BPP1510 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.814) with cleavage site
FT                   probability 0.509 between residues 44 and 45"
FT   CDS_pept        225066..225398
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /gene_synonym="flaN"
FT                   /gene_synonym="fla AI"
FT                   /locus_tag="BPP1511"
FT                   /product="flagellar hook-basal body complex protein FliE"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1404"
FT                   /db_xref="GOA:Q7WA76"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA76"
FT                   /protein_id="CAE36813.1"
FT                   /translation="MAVSGLSGIESMLSQMRAVVRAAQSGGATEAELAPGPSGFAAELQ
FT                   RSIRRVSQAQNAASDQAKAFELGAPGISLNDVMIDLQKASLGFQTSVQVRNRLVAAYKE
FT                   ISSMAV"
FT   misc_feature    225084..225392
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02049, Flagellar hook-basal body
FT                   complex protein FliE, score 6.7e-20"
FT   CDS_pept        complement(225412..225807)
FT                   /transl_table=11
FT                   /locus_tag="BPP1512"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1405"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA75"
FT                   /protein_id="CAE36814.1"
FT                   /translation="MTAQDQIVVLTQSDQIRSTLQELRHPDCQIVISGIDQRPWPVRIL
FT                   GPDAKDGYFFWRPLDLACPDSVMLARMADEDEPPLAFHAQTADGARIHFCVDSPVTLRF
FT                   GDGSIAVLSLFPSAVRHTCARPPQAPA"
FT   CDS_pept        complement(225817..226131)
FT                   /transl_table=11
FT                   /locus_tag="BPP1513"
FT                   /product="conserved hypothetical protein"
FT                   /product="putative flagellar protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1406"
FT                   /db_xref="GOA:Q7WA74"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA74"
FT                   /protein_id="CAE36815.1"
FT                   /translation="MNTPAPPAADDASRPVAVALSYDGGEAAPRVVAKGYGQLADTIVR
FT                   TAREHGLHVHESRELVGLLMQVDLDAHIPPQLYTAVAELLAWLYRLEARELPEVLAPQA
FT                   "
FT   CDS_pept        complement(226128..227399)
FT                   /transl_table=11
FT                   /locus_tag="BPP1514"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1407"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA73"
FT                   /protein_id="CAE36816.1"
FT                   /translation="MSVGPPALGSILVQRLDAVLGTTMSAQSNLVSGARPDAVAQPGEA
FT                   ARPGASQTATRDPRQAVQTGGERGARQGAAGVDAKTAAALALAARGLQTSTGTTASAPT
FT                   TLGQTARTILALLAQYPGQAPAVSARAPLWTPPAQDGASPPAGGQPAAAAPNAPAQASA
FT                   AAGGAASTPSRPEAAQAGAASARTPAQTPPATLAALAGRAVLPAAPALAQALRQTLQAS
FT                   GLFYESHLSDLAFGKRSVQQLQAEPQARLPAAGAEPAATPRAPENATPARALPAAEAAP
FT                   PGQPATHTPGAPVPGIHQDATLLVRQQLDVLANQMLAWQGQAWPGTPMEWEVAREHGDD
FT                   AAGQPGTHWATRLKLNLPRLGTVEARLNLAANQLVLHVVAPDSAAEIGAAADALRQQLS
FT                   AAGLTLTNLSVDAIGAPGFDLPEA"
FT   CDS_pept        complement(227396..227776)
FT                   /transl_table=11
FT                   /gene="fliT"
FT                   /locus_tag="BPP1515"
FT                   /product="flagellar protein FliT"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1408"
FT                   /db_xref="InterPro:IPR008622"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA72"
FT                   /protein_id="CAE36817.1"
FT                   /translation="MSSRPQREKSMTALTQHAPVLEIYQDIANLTSRMLAAANASNWDL
FT                   VLNHGQEYVCLVERLRELEPGEPLDEAARGMKFDLLVRILENDAAVRDLALPQLARLSD
FT                   LLGRMKRQQSLLATYSGKANGT"
FT   CDS_pept        complement(227794..228222)
FT                   /transl_table=11
FT                   /gene="fliS"
FT                   /locus_tag="BPP1516"
FT                   /product="flagellar protein FliS"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1409"
FT                   /db_xref="GOA:Q7WA71"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA71"
FT                   /protein_id="CAE36818.1"
FT                   /translation="MTYAARRPTGSYSVKSYSYIGLETQVMSATPERLITLLYAGARAA
FT                   IAQARLHLEAGRIVERGQAIGKAIRIVDEGLKLGLNQDAGGEVAANLARLYDYITRTLL
FT                   TANLKADKEQLDIADRLLADLSEAWQASVDHPAPAVPA"
FT   misc_feature    complement(227815..228189)
FT                   /note="HMMPfam hit to PF02561, Flagellar protein FliS,
FT                   score 9.3e-23"
FT   CDS_pept        complement(228230..229603)
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /gene_synonym="flbC"
FT                   /gene_synonym="flaV"
FT                   /locus_tag="BPP1517"
FT                   /product="flagellar hook-associated protein 2"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1410"
FT                   /db_xref="GOA:Q7WA70"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA70"
FT                   /protein_id="CAE36819.1"
FT                   /translation="MATISSLGSSGLELEGILEKLQAAEEKKLTLITARQASYETRISA
FT                   YSKIQAAVEAVQKAAATLGSIDTLSAVKAVVSGDGLSVKTAAGAVPGQYTVNIDKLATA
FT                   QNLQSGELDSRTDKHGTGGSIEIVQKDGTTTTVTLGEDTSLNGIVKAINGTDGLDVRAT
FT                   VISDGNGKHYLMLNNKTEGTEAAVTRITVSGNQEVADILDFDAANAGASNLTVQLAAQK
FT                   AELTINGIPVVSDTNTVETAIDGLTLTLTKQTAAPLTVTVSSDPSVAATAVNDFVKAYN
FT                   GLQTTIADLTAFDVKAEKQSALTGDGTTRNIQSAIAAALRVATGEGTLRTLSQLGITTD
FT                   PKTGSLKTDTEKLEAALRDNPADVARIFSGPFGLGEKVKLATEQILGDEGSIKIRQEGL
FT                   EETLESLQNQYDRQKLSIAATIEAYRKQFVQLDVFVTQMNNTSNYLSQQFAALSGTKK"
FT   misc_feature    complement(228284..229579)
FT                   /note="HMMPfam hit to PF02465, Flagellar hook-associated
FT                   protein 2, score 1.2e-58"
FT   CDS_pept        complement(229744..230106)
FT                   /transl_table=11
FT                   /locus_tag="BPP1518"
FT                   /product="putative flagellar protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1411"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="InterPro:IPR035924"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA69"
FT                   /protein_id="CAE36820.1"
FT                   /translation="MAVSPINAAAPALVSAAPAPVPAQPAAAAAANGGGAQSATQDQYG
FT                   APKLPMDRALEEINAQLKAWSTQLQFEIDPDVHQVVVSIVDAETGDVLRTIPSEAVIRI
FT                   AKMIVKMQGNAVETTA"
FT   misc_feature    complement(229750..230085)
FT                   /note="HMMPfam hit to PF03646, FlaG protein, score 0.00021"
FT   misc_feature    complement(230023..230106)
FT                   /note="Signal peptide predicted for BPP1518 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.534 between residues 28 and 29"
FT   CDS_pept        230596..231903
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /gene_synonym="dedC"
FT                   /locus_tag="BPP1519"
FT                   /product="FolC bifunctional protein [includes:
FT                   folylpolyglutamate synthase and dihydrofolate synthase]"
FT                   /EC_number="6.3.2.17"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1412"
FT                   /db_xref="GOA:Q7WA68"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA68"
FT                   /protein_id="CAE36821.1"
FT                   /translation="MSTSRPDASADLPAWLQYLESIHAKAIDLGLDRVRQVAGRLDLSL
FT                   DGVKFMVGGTNGKGSTCAMLESILLAAGYRVGLYTSPHLIDFNERARINGEIASDAALV
FT                   QQFEAVEAARGDISLTYFEFTTLAILRLFAQSRLDAVVLEVGLGGRLDAVNIVDADCSI
FT                   ITSIDLDHTDWLGDTREKIGFEKAHIYRAGRPAICADPVPPQSLLDHVQAIGADLWLLG
FT                   RDYNYSGDRQQWAYGGRAQRRNALAYPALRGANQLLNAAAALAALEAVRDRLPVPQQAV
FT                   RVGLLQASLPGRFQILPGQPTVILDVAHNPHAAAVLAQNLDNMGFHPYTHAVFGMLADK
FT                   NVDGVIARLGSRVDHWYCAGLPGPRGLDGQALADHVRQVLPEAEGAAETPTVQACADPA
FT                   AAYAAAREKAGEGDRIIVFGSFLTVASVLQALGRKI"
FT   misc_feature    230635..231444
FT                   /note="HMMPfam hit to PF01225, Mur ligase family, catalytic
FT                   domain, score 1.9e-14"
FT   misc_feature    230743..230814
FT                   /note="PS01011 Folylpolyglutamate synthase signature 1."
FT   misc_feature    231463..231717
FT                   /note="HMMPfam hit to PF02875, Mur ligase family, glutamate
FT                   ligase domain, score 0.0015"
FT   CDS_pept        231964..232794
FT                   /transl_table=11
FT                   /locus_tag="BPP1520"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1413"
FT                   /db_xref="GOA:Q7WA67"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA67"
FT                   /protein_id="CAE36822.1"
FT                   /translation="MGLFTSKDSASETQSSRPRPSVSSEAQAAELRARARRRLAGAVAL
FT                   VLAAVIVLPMILDSEPVPVDSDIPIRVPDRNSAFQPTVNDPQAAAPQPEQPAPQAPAGT
FT                   PEAGAPQPPALASAPPQTPPPGQTPAQPQTPPAAQPPATPPQQAATPPAAPKPEAKPEP
FT                   KPAKPAAPARSDDGARAIALLEGRSPPPAQPKPAANGNFVLQVASYTTQADAQARRGKL
FT                   HQAGVTNAFVEQASINGKQQYRLRVGPFPSREAAQAAQARLRTLGYDNGFIAAQ"
FT   misc_feature    232078..232134
FT                   /note="1 probable transmembrane helix predicted for BPP1520
FT                   by TMHMM2.0 at aa 39-57"
FT   CDS_pept        232791..233279
FT                   /transl_table=11
FT                   /gene="cvpA"
FT                   /gene_synonym="dedE"
FT                   /locus_tag="BPP1521"
FT                   /product="colicin V production protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1414"
FT                   /db_xref="GOA:Q7WA66"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA66"
FT                   /protein_id="CAE36823.1"
FT                   /translation="MTGFDFVVLTILAVSAVLGLVRGLLKEILSLLAYLLAFVAAIWWG
FT                   PTVYVWLEPYIETALLRMGIAYAVVFIIVLLAVGLVNMTLAALIRTTGLTPADHGLGAM
FT                   FGLARGLVLVLVLVALAGFTPLPQEDWWRDAMFSHSATEAVRQVKSWLPPSLATWLPY"
FT   misc_feature    232797..233252
FT                   /note="HMMPfam hit to PF02674, Colicin V production
FT                   protein, score 4.4e-30"
FT   misc_feature    join(232806..232865,232878..232946,232989..233057,
FT                   233091..233159)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BPP1521 by TMHMM2.0 at aa 6-25, 30-52, 67-89 and 101-123"
FT   CDS_pept        233321..234841
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="BPP1522"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1415"
FT                   /db_xref="GOA:Q7WA65"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA65"
FT                   /protein_id="CAE36824.1"
FT                   /translation="MCGIVGVIGRGPVNQLLYDSLLLLQHRGQDAAGIATLQGNHFNMY
FT                   KAHGLVRDVFRTRNMRALPGTSGVGQVRYPTAGSSASEEEAQPFYVNAPFGIMFAHNGN
FT                   LTNWRELRESLYRADRRHINTNSDSEVLLNVLAHELQSAASGVSLDDDTIFRAVSAVHQ
FT                   RVKGAYAVVAQISGYGMLAFRDPHGIRPLCIGRQETEEGVEWMAASESVALEGSGFAFV
FT                   RDVEPGEAIFVDLDGRMTSRQCADNAQLVPCIFEYVYFARPDSLIDGVSVYDARLRMGE
FT                   YLADKVARSMRLGDIDVVMPIPDSSRPAAMQLAHRLGLDYREGLIKNRYVGRTFIMPGQ
FT                   AVRRKSVRQKLNAIGMEFKGKNVLLVDDSIVRGTTSREIVDMARAAGANKVYFASAAPP
FT                   VRFPNVYGIDMPTQKELIATGRTDDEIARTIGADALIYQDLQDMQQAVRDINPRLSRFE
FT                   ASCFDGEYVTGDITAEYLARLGQSRDSSAGDEEAGGLQFNMGYAANDA"
FT   misc_feature    233321..233338
FT                   /note="PS00443 Glutamine amidotransferases class-II active
FT                   site."
FT   misc_feature    233324..233905
FT                   /note="HMMPfam hit to PF00310, Glutamine amidotransferases
FT                   class-II, score 4.9e-65"
FT   misc_feature    234089..234580
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain, score 3.9e-12"
FT   misc_feature    234407..234445
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT   CDS_pept        complement(234885..235361)
FT                   /transl_table=11
FT                   /gene="dsbB"
FT                   /gene_synonym="roxB"
FT                   /locus_tag="BPP1523"
FT                   /product="disulfide bond formation protein B"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1416"
FT                   /db_xref="GOA:Q7WA64"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA64"
FT                   /protein_id="CAE36825.1"
FT                   /translation="MTRYRERLLFLIAILCFGAVGLALLSQHVFDMPPCAWCVLQRLIY
FT                   LCIGVVALAGALAGAIAARLAAMLAALLAICGIVAAWYQYSVAAKMLSCDQTFADRFMS
FT                   ATGLDGALPWLFGIYATCMDATVAVLGIEYAIWSLALFVIVLALALPAALRRNA"
FT   misc_feature    complement(join(234903..234959,234966..235031,
FT                   235098..235163,235179..235244,235275..235340))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BPP1523 by TMHMM2.0 at aa 7-29, 39-61, 66-88, 110-132 and
FT                   134-153"
FT   misc_feature    complement(235293..235361)
FT                   /note="Signal peptide predicted for BPP1523 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.992) with cleavage site
FT                   probability 0.573 between residues 23 and 24"
FT   CDS_pept        complement(235412..236125)
FT                   /transl_table=11
FT                   /gene="marC"
FT                   /locus_tag="BPP1524"
FT                   /product="putative multiple antibiotic resistance protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1416A"
FT                   /db_xref="GOA:Q7WA63"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA63"
FT                   /protein_id="CAE36826.1"
FT                   /translation="MPYNEYLLVFGRSFFFALATLLPFLNPPAITPIFWTLTEGASKQT
FT                   LAQLSKRVAINVALMMIGAMIAGNVVLSFFGISLAIVRVGGGMLVIYSAWRLVNSPDAD
FT                   TSRHAQMAESFTPEMAQARAFYPLTFPISCGPGTIAACITVGASLRDENHMLSLARLAG
FT                   SLPGVALVAFTLFICLRFAAQMLHRLGDNGTAVFMRLSAFIMLCLGVQIFWSDASELLL
FT                   DVMRQIMQPIAAPPA"
FT   misc_feature    complement(235463..236095)
FT                   /note="HMMPfam hit to PF01914, MarC family integral
FT                   membrane protein, score 1e-19"
FT   misc_feature    complement(join(235481..235537,235577..235642,
FT                   235688..235753,235832..235888,235901..235966,
FT                   236015..236080))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPP1524 by TMHMM2.0 at aa 15-37, 53-75, 79-98, 124-146,
FT                   161-183 and 196-215"
FT   CDS_pept        complement(236164..238761)
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="BPP1525"
FT                   /product="[protein-PII] uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1417"
FT                   /db_xref="GOA:Q7WA62"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA62"
FT                   /protein_id="CAE36827.1"
FT                   /translation="MPHVDLNPLKQRMQAARAAAVAQFRQHPRPDMLLTELRRIVDQAL
FT                   RELVKLCPLPAGATLAAVGGYGRGELYPHSDVDLLILLPQPPSAADARAVEALVAALWD
FT                   LGLEPGHSVRTLEDCEREARGDITVETALLESRWLAGSRTLMKRLDSAMQARLDAAVFF
FT                   QAKRVEMQQRHARYQDTPYALEPNCKESPGGLRDLQVILWMARAAGFGHSWREVAQAGL
FT                   LTSSEARDLRRAEQAFKRLRIELHLLTGRREDRVLFDLQPGLAAVYGIASTATRRASEL
FT                   LMQRYYWAARLVTQLNVILVQNIEERLFPRPDSDARLIDDDFRNLRERLDIVREDGFER
FT                   NPTLLLRAFLVMQQHPELIGMSARTLRAIWHSRHRIDAQFRRNPVNRKLFLQILQQPRG
FT                   IVHELRRMTMLNILPRYLPVFRRIVGQMQHDLFHVYTVDQHTLAVVRNLRRFTMPEHAQ
FT                   EYPLASQLIAGLDRHWLLYVAALFHDIAKGRGGDHSELGAREVRRFAQDHGLDPADAEL
FT                   VEFLVRHHLLMSAVAQKRDLSDPQVVRDFAAQVGDERRLAALYLLTVADIRGTSPRVWN
FT                   AWKGKLLEDLFRLALAALGGAHADAHTVLTERKDEAARLTRLAGLRDDAREAFWNQLDI
FT                   AYFLRHDASEIAWHTRHLYYQVAPDEPVVRVRPTEHGEGLQVMVYTRDAPDLFVTTCGY
FT                   FDAKSLSVQDARVHTTRHGWALDSFIVLAPEGFADLRAQATLVEHELAERLRDPHAARH
FT                   AHAPRRLPHSHARRSRVFPVMPQAELSPDERSQSWRLSVTATDRPGLLYALARVFAEHG
FT                   VDLIMAKIMTLGERVEDVFIVSGSALERPRSQMQFERAILDALAGDEPRQQAA"
FT   misc_feature    complement(236191..236400)
FT                   /note="HMMPfam hit to PF01842, ACT domain, score 0.00012"
FT   misc_feature    complement(236527..236739)
FT                   /note="HMMPfam hit to PF01842, ACT domain, score 18"
FT   misc_feature    complement(237049..237453)
FT                   /note="HMMPfam hit to PF01966, HD domain, score 3.7e-10"
FT   misc_feature    complement(238360..238653)
FT                   /note="HMMPfam hit to PF01909, Nucleotidyltransferase
FT                   domain, score 3.6e-08"
FT   CDS_pept        complement(238791..239612)
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="BPP1526"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1418"
FT                   /db_xref="GOA:Q7WA61"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA61"
FT                   /protein_id="CAE36828.1"
FT                   /translation="MGIVTDPADLAKMRAACQDAAKILDFITPYVKPGVTTGELDKLCL
FT                   AYLTDELKVKSATIGYAPPGYPPFTGAICTSVNHQVCHGIPGDKVLKNGDSLNIDVTII
FT                   KDGWFGDTSRMYHVGEPSILSRRLTDITYDCMWKGIEQVRNGATLGDIGHAIQKYAEAQ
FT                   GFSVVREFCGHGIGQRFHEDPQVLHYGKPGTGVKLVTGMLFTVEPMINAGRREIRQLAD
FT                   GWTVVTRDHSLSAQWEHTVLVTDTGYEVLTVSPGMPAPPAFVTRPVEIPAL"
FT   misc_feature    complement(238866..239606)
FT                   /note="HMMPfam hit to PF00557, metallopeptidase family M24,
FT                   score 2.5e-73"
FT   misc_feature    complement(239046..239102)
FT                   /note="PS00680 Methionine aminopeptidase subfamily 1
FT                   signature."
FT   CDS_pept        240334..241083
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="BPP1527"
FT                   /product="30S ribosomal protein S2"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1419"
FT                   /db_xref="GOA:Q7WA60"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA60"
FT                   /protein_id="CAE36829.1"
FT                   /translation="MSLMREMLEAGVHFGHQTRYWNPKMAPYIFGHRNKIHIINLEQTV
FT                   AKYQEASKFVKQLVARGGNILFVGTKRAARELVATEAARCGMPYVDARWLGGMLTNFKT
FT                   VKSSIKRLKDMEAMVADGGFERMTKKEGLLFQRELDKLNKSIGGIKDMNGLPDALFVID
FT                   VGYHKIAVAEAKVLGIPVVAVVDTNHSPDGIDHVIPGNDDSARAIALYAKGMADAVLEG
FT                   REQNINGLVEEIGEGQEEFVEVQDNQA"
FT   misc_feature    240343..240378
FT                   /note="PS00962 Ribosomal protein S2 signature 1."
FT   misc_feature    240352..241002
FT                   /note="HMMPfam hit to PF00318, Ribosomal protein S2, score
FT                   3.5e-100"
FT   CDS_pept        241216..242145
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="BPP1528"
FT                   /product="elongation factor Ts"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1420"
FT                   /db_xref="GOA:Q7WA59"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA59"
FT                   /protein_id="CAE36830.1"
FT                   /translation="MSRFMLAGPCLSEFGANMAEITAALVKELREKTDAPMMECKKALT
FT                   EAEGDLARAEEILRVKLGNKASKAAARVTAEGLIGLYIAADGKQGAVIEVNCETDFVAK
FT                   NTDFIDFINKLAELVATQNPGDVAALSALPFGEGTVETTRTALVGKIGENISVRRFERI
FT                   QTPNSLASYVHGGKIGVLVEFSGAEEVGKDLAMHIAATKPKALNADGVNAEDIAAERSV
FT                   AEQKAAESGKPAEIVAKMVEGSVQKFLKEVTLLSQPFVKNDKQTIEQMLKEKGASITKF
FT                   VLFVVGEGIEKKTADFASEVAAAAAGRA"
FT   misc_feature    241216..241272
FT                   /note="Signal peptide predicted for BPP1528 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.750) with cleavage site
FT                   probability 0.575 between residues 19 and 20"
FT   misc_feature    241276..241398
FT                   /note="HMMPfam hit to PF00627, UBA/TS-N domain, score
FT                   0.002"
FT   misc_feature    241435..242079
FT                   /note="HMMPfam hit to PF00889, Elongation factor TS, score
FT                   1.1e-87"
FT   misc_feature    241495..241527
FT                   /note="PS01127 Elongation factor Ts signature 2."
FT   CDS_pept        242297..242959
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /gene_synonym="smbA"
FT                   /locus_tag="BPP1529"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1421"
FT                   /db_xref="GOA:Q7WA58"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA58"
FT                   /protein_id="CAE36831.1"
FT                   /translation="MGEDAFGINRSTIVRMTDEIAEVAALGVELAIVIGGGNIFRGVAP
FT                   GAQGMDRATADYMGMMATIMNALALQDALKHKGVDTRVQSALNIDQVVEPYIRPKALRY
FT                   LEEGKVVIFAAGTGNPFFTTDTAAALRGAEIGAEIVLKATKVDGIYSADPNKDPTATRY
FT                   ARISFDEAIVRRLEVMDATAFALCRDQKLPIKVFSINKFGALKRAVSGEDEGTLVHV"
FT   misc_feature    242297..242890
FT                   /note="HMMPfam hit to PF00696, Amino acid kinase family,
FT                   score 4.8e-46"
FT   CDS_pept        242974..243534
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /gene_synonym="rrf"
FT                   /locus_tag="BPP1530"
FT                   /product="ribosome recycling factor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1422"
FT                   /db_xref="GOA:Q7WA57"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA57"
FT                   /protein_id="CAE36832.1"
FT                   /translation="MSVADIRKSAETRMAKSLETLKASLAKIRTGRAHTGILDHVQVEY
FT                   YGSPVPISQVANVNLVDARTISVQPYEKSMAGPIEKAIRESDLGLNPVSMGETIRVPMP
FT                   ALTEERRRDLTKVVKSEGEDAKVAVRNLRREANEALKKLVKDKEISEDDERRAQDDVQK
FT                   LTDRAVGDIDKMIVQKEAEIMTV"
FT   misc_feature    243031..243525
FT                   /note="HMMPfam hit to PF01765, Ribosome recycling factor,
FT                   score 6.6e-85"
FT   CDS_pept        243572..244465
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /gene_synonym="rth"
FT                   /locus_tag="BPP1531"
FT                   /product="undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1423"
FT                   /db_xref="GOA:Q7WA56"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA56"
FT                   /protein_id="CAE36833.1"
FT                   /translation="MSISESVPYAPSRPRWSCRIWRRRDGAGFCNTFLLAALRQAPAMA
FT                   LSSTQAIPETGDIPRHVAIIMDGNGRWATRRHLPRTAGHAKGVHAVRRVVEACGRRGVR
FT                   YLTLFAFSSENWRRPADEVSLLMRLFVQALEREVDKLQDQGVRLHVVGDLSAFEPKLQE
FT                   LIAQAQERTEHNDRLHLTVAANYGGRWDILQATRAMLRADPGLAQDPDRIDEARLAEHL
FT                   SMAWAPEPDLFIRTGGEQRISNFLVWQLAYAEFYFTEQFWPDFGADELDAAFEWYRTRE
FT                   RRFGRTSAQLRGGAKR"
FT   misc_feature    243764..244429
FT                   /note="HMMPfam hit to PF01255, Putative undecaprenyl
FT                   diphosphate synthase, score 4.1e-98"
FT   CDS_pept        244485..245342
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /gene_synonym="cds"
FT                   /locus_tag="BPP1532"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1424"
FT                   /db_xref="GOA:Q7WA55"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA55"
FT                   /protein_id="CAE36834.1"
FT                   /translation="MLGQRIITAAVLLAVLALTLALANPWWFVALLALGAACAAWEWLR
FT                   LTVRQPPSGALCVGLAAALLAAMLAMAQAWIQGGVSGLRLEVWVGYWLTPAIVAVWLLG
FT                   AGTAVARGRADAPAASLGWTLFAIPAVLAAWSVLALMYLSRGGAYVVSLLALVWVADIA
FT                   AYFAGRAFGKRKLAPRVSPGKTVAGAVAGVLGAVAWIALSSQWDGTYGQALVERWSWWL
FT                   ALPAAALLGVVSIVGDLFESLLKRRAGRKDSSALLPGHGGVYDRIDAILPVAPLALLMS
FT                   GVLF"
FT   misc_feature    244485..244553
FT                   /note="Signal peptide predicted for BPP1532 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.637 between residues 23 and 24"
FT   misc_feature    join(244497..244550,244560..244628,244647..244715,
FT                   244743..244811,244845..244913,244926..244985,
FT                   245022..245090,245148..245216)
FT                   /note="8 probable transmembrane helices predicted for
FT                   BPP1532 by TMHMM2.0 at aa 5-22, 26-48, 55-77, 87-109,
FT                   121-143, 148-167, 180-202 and 222-244"
FT   misc_feature    244923..245336
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF01148, Phosphatidate
FT                   cytidylyltransferase, score 3.4e-51"
FT   misc_feature    245208..245288
FT                   /note="PS01315 Phosphatidate cytidylyltransferase
FT                   signature."
FT   CDS_pept        245339..246538
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="BPP1533"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1425"
FT                   /db_xref="GOA:Q7WA54"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA54"
FT                   /protein_id="CAE36835.1"
FT                   /translation="MTRFQRVAVLGSTGSIGDSTLDVIARHPDRLGVYALSAYSRMDKL
FT                   AAQAAACGAAVVVVPDDAAAARFRAAWRGKAAMPEVRVGPRTLAETAAAPECTTVMAAI
FT                   VGAAGLPAALAAAQAGKRVLLANKEALVAAGSLFMAAVRENGAELLPIDSEHNAIFQCM
FT                   PQGARAAAPTAPAPGVRRLLLTASGGPFRRQDPADLHEVTPAQACAHPNWSMGRKISVD
FT                   SATMLNKGLEVIEAHWLFAMPSERIDVLIHPQSVVHSMVEYDDGSVLAQLGQPDMRTPI
FT                   AYGLGFPERLASGVGLLDLTRWGRLDFEQPDLQRFPCLALSFAALRAGQPACVALNAAN
FT                   EVAVAAFLEGRLRYTWVARVIEAVLEWQAKQASVTLTSLDDVLDLDARARSFAGNLGLA
FT                   "
FT   misc_feature    245357..246517
FT                   /note="HMMPfam hit to PF02670, 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase, score 2.2e-173"
FT   CDS_pept        246578..247912
FT                   /transl_table=11
FT                   /locus_tag="BPP1534"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1426"
FT                   /db_xref="GOA:Q7WA53"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA53"
FT                   /protein_id="CAE36836.1"
FT                   /translation="MLFTLLAFVVALGTLITFHELGHYWIARLCGVRVLRFSVGFGRVL
FT                   ARRTDRHGTEWAISAIPLGGYVKMQDDPPAGASAAEAARSFNAQPVGRRIAIVAAGPLF
FT                   NLFLAVVLYAGLNLAGTEVPAPVVGQPAAGTPAAQAGLMAGDRIEAVQGRAVDSWNDAR
FT                   WRLLDVLSSQGEAQLEVRGPGGAARGLVLQVPGGNRLDPADGDPLAETGLRLAQPKPVV
FT                   REVIAGGAGEQAGLRGGDLIVAAGQAADLDAGALVALIQRHAGQPLALTVQRGADRLTL
FT                   TVVPRAESVQGQEVGRIGVQLGGDIPMVTVRYGVIDSVWRGAQRTWDTAWLSLRMMGRM
FT                   VLGEVSWRNISGPVTIADYAGQTARIGLEAYIAYLALISISLGVLNLLPIPMLDGGHLL
FT                   YYLVEIVKGSPVSDRWIDIGQRAGIGLLAGLMGLALFNDFARLFT"
FT   misc_feature    join(246590..246658,246860..246928,247688..247756,
FT                   247829..247897)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BPP1534 by TMHMM2.0 at aa 5-27, 95-117, 371-393 and
FT                   418-440"
FT   misc_feature    246623..246652
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT   misc_feature    247106..247402
FT                   /note="HMMPfam hit to PF00595, PDZ domain (Also known as
FT                   DHR or GLGF), score 0.01"
FT   CDS_pept        247965..250301
FT                   /transl_table=11
FT                   /locus_tag="BPP1535"
FT                   /product="probable surface antigen"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1427"
FT                   /db_xref="GOA:Q7WA52"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA52"
FT                   /protein_id="CAE36837.1"
FT                   /translation="MSLRRMFHHKKGVIPGLLAAALLAPALAHAFEPFVVRDIRVEGIQ
FT                   RTDAGTVFGYLPVKVGEKFTDEEATEAVRRLYGTGFFSDVQIQTDNNVVVVVVQERPTI
FT                   ASISFNGMREFDSKAITKSLAQVGFGEGRIFDQSMLERAEYELKEQYLAKGKYGVEVTA
FT                   TVTPLPRNRVGVSFDVFEGEVAKIREIRVVGSKAFSEGELLDQFDLTTPGWLTWYTNTD
FT                   KYSREKLEGDIERLRSFYLDQGYLEFTVEPPQVTISPDRKDIYITITVHEGEPYKVREV
FT                   KLAGNLMGLDSEINNLVEIKSGEVFSAAKANNSAKAITDYLGDLGYAFANVNPNPQLDR
FT                   AKHEADVTFYVDPSRRVYVRRIQIGGNTRTRDEVVRREMRQQEAAWYDAGDIKVSRDRV
FT                   DRLGYFNEVNVKTDPVPGSPDQVDVNVDVKEKPTGIINLGVGYGSSEKAILSAGISEDN
FT                   VFGSGTNLTLQLNTSKTNRAVVLSHTDPYFTKDGISRTTSAYYRVTEPWDNNDGDYRVK
FT                   AMGLGMNFGVPISEYDRIFLGGTFERNQIDLYNNSPQAYRDFVDQYGDSTNALIFNTGW
FT                   SKDTRDSALAPTKGAYTRLKGDFSTMDLKYYLLTAQQQYYLPLGRSYTLALNGMIDYGR
FT                   SYGGLDYPVIKNVYAGGIGTVRGYEGASLGPRDRLTGDYIGGSRRMVANAQLYLPFPGA
FT                   SKDRTLRWFVFTDAGQVAAGSGMSCTAGKPGSEVEDPCGWRFSAGIGLSWQSPLGPLQL
FT                   SYARPLNSKSGDDTQAFQFQIGTGF"
FT   misc_feature    247965..248054
FT                   /note="Signal peptide predicted for BPP1535 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.755 between residues 30 and 31"
FT   misc_feature    247992..250295
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF01103, Bacterial surface antigen,
FT                   score 1e-206"
FT   misc_feature    247998..248057
FT                   /note="1 probable transmembrane helix predicted for BPP1535
FT                   by TMHMM2.0 at aa 12-31"
FT   misc_feature    249177..249200
FT                   /note="PS00867 Carbamoyl-phosphate synthase subdomain
FT                   signature 2."
FT   CDS_pept        250379..250990
FT                   /transl_table=11
FT                   /locus_tag="BPP1536"
FT                   /product="putative outer membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1428"
FT                   /db_xref="GOA:Q7WA51"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA51"
FT                   /protein_id="CAE36838.1"
FT                   /translation="MAQYRLCFTSLEGEIFMMSDFALNTSGSKRAKRGAGKLGVSLALA
FT                   GALLFGSSAAVTAQAQGTKIGFVNTERILRESGPAKAAQSKIESEFKRRDDELQRLSSS
FT                   LRSQAEKFDKDAPVLSESDRVKRQRELSNLDMDLQRKRREFQEDFNRRRNEEFSSIVTK
FT                   ANDAIKRIAEQENYDLIIQDAVTVNPRIDITDKVIQSLGR"
FT   misc_feature    250379..250558
FT                   /note="Signal peptide predicted for BPP1536 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.788) with cleavage site
FT                   probability 0.380 between residues 60 and 61"
FT   misc_feature    250490..250558
FT                   /note="1 probable transmembrane helix predicted for BPP1536
FT                   by TMHMM2.0 at aa 38-60"
FT   CDS_pept        250999..252090
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /gene_synonym="firA"
FT                   /locus_tag="BPP1537"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1429"
FT                   /db_xref="GOA:Q7WA50"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA50"
FT                   /protein_id="CAE36839.1"
FT                   /translation="MPVLLDPENALALDVLLAGTDAQGLDWHLSAPDAADLPRIRGIGT
FT                   LSSAGNEEISFLSNPRYQNQLATTRAAAVIVTPDVAQARQEQGASGHVLVVCKHPYLLY
FT                   ARLAQWFERASRPAGPAGVHPSAVVDPSAEIDADARVGAQCVIEAGARIGRGARLGPGC
FT                   VIGAGSTVGADSLLHPRVTLYAGVHVGERAIIHSGAVLGADGFGFAPDPTLGRGAWGKI
FT                   PQLGGVRVGNDVEIGANTTIDRGALDDTIVGDGVKLDNQIMVAHNVRIGAHTAIAACVG
FT                   IAGSTTIGERCTIGGASMLSGHLAIADDVNISGGTAVTSNIAKAGRYTGVYPYAEHSEW
FT                   QRNAAVIQQLALLRRRLRALERE"
FT   misc_feature    251392..251445
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats), score 39"
FT   misc_feature    251446..251499
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats), score 0.016"
FT   misc_feature    251455..251541
FT                   /note="PS00101 Hexapeptide-repeat containing-transferases
FT                   signature."
FT   misc_feature    251500..251553
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats), score 33"
FT   misc_feature    251554..251607
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats), score 0.47"
FT   misc_feature    251677..251730
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats), score 0.3"
FT   misc_feature    251743..251796
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats), score 41"
FT   misc_feature    251752..251838
FT                   /note="PS00101 Hexapeptide-repeat containing-transferases
FT                   signature."
FT   misc_feature    251797..251850
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats), score 14"
FT   misc_feature    251851..251904
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats), score 65"
FT   CDS_pept        252114..252617
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /gene_synonym="sefA"
FT                   /locus_tag="BPP1538"
FT                   /product="(3R)-hydroxymyristol-[acyl carrier protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1430"
FT                   /db_xref="GOA:Q7WA49"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA49"
FT                   /protein_id="CAE36840.1"
FT                   /translation="MAAHCNIIYFCFAGKQMELDIKGIMDRLPHRYPMLLIDRVLEMVP
FT                   GKSIVAIKNVSINEPFFTGHFPHHPVMPGVLIVEAMAQASALFSFTDENGGLKCDGAKT
FT                   AYYLVGIDGARFRKPVVPGDQLRLEVEAERLSCTICKYQGRALVDGQLVAEAKLMCAIR
FT                   SLEE"
FT   misc_feature    252168..252578
FT                   /note="HMMPfam hit to PF01377, Thioester dehydrase, score
FT                   1.5e-65"
FT   CDS_pept        252618..253412
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="BPP1539"
FT                   /product="acyl-[acyl-carrier-protein]--UDP-N-acetylglucos
FT                   amine O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1431"
FT                   /db_xref="GOA:Q7WA48"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA48"
FT                   /protein_id="CAE36841.1"
FT                   /translation="MSGNIHPTAVVDPAAQIDSSVVIGPYSVVGPGVSIAAGTEVGAHC
FT                   VLDGVTSIGRDNRFYRFCSIGGMPQDKKYSGEPTRLVIGDRNTVREFTTFNTGTVQDGG
FT                   VTSIGDDNWIMAYVHIAHDCHIGNNTILANSVQLGGHVQVGDWAIVGGLTGVHQFAKIG
FT                   AHSMTGSNSSLMQDAPPFVLAAGNPCRPVGVNVEGLKRRGFSAAAISALRDAYKSIYRR
FT                   GLSLDEARAELRARQQAEPDVAEHLQTMLDFLDASTRGIIRP"
FT   misc_feature    252657..252710
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats), score 62"
FT   misc_feature    252711..252764
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats), score 17"
FT   misc_feature    252765..252818
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats), score 2.5e+02"
FT   misc_feature    252930..252983
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats), score 36"
FT   misc_feature    252984..253037
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats), score 2.1"
FT   misc_feature    253038..253091
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats), score 2.5e+02"
FT   misc_feature    253092..253145
FT                   /note="HMMPfam hit to PF00132, Bacterial transferase
FT                   hexapeptide (four repeats), score 2.5e+02"
FT   CDS_pept        253409..254590
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /gene_synonym="pgsB"
FT                   /locus_tag="BPP1540"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1432"
FT                   /db_xref="GOA:Q7WA47"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA47"
FT                   /protein_id="CAE36842.1"
FT                   /translation="MSLRIGMVAGEPSGDLLAGRIIAGLQARAPGVHCAGIGGPQMAAR
FT                   GFEAWHPMHALTVFGYIDAFKRIPSLLSTYGDVKRRLLAEPPSVFVGIDAPDFNLRLEH
FT                   QLRQAGTPTVHFVGPSIWAWRYERINKIRAAVSHMLVLFPFEEALYRKEGIPVTYVGHP
FT                   LAGVIPMQPDRAAARARLGIDADARVLAILPGSRSSEIRLLAPRFLQAAAELVRRDPRL
FT                   QCVVPMVNPQRRAEFEAIAAQHPVPGLRCVTAAEGQGETPVAWSVMEASNAVLVASGTA
FT                   TLETALYKRPMVISYVLSPWMRRIMAWKSGQQRPYLPWVGLPNVLLRDFAVPELLQDEA
FT                   TPAALAEATWQALTDEAGAARIEARFTALHQDLLRDTPALAAQAILEVADGAA"
FT   misc_feature    253421..254563
FT                   /note="HMMPfam hit to PF02684, Lipid-A-disaccharide
FT                   synthetase, score 4.5e-97"
FT   CDS_pept        254577..255182
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="BPP1541"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1433"
FT                   /db_xref="GOA:Q7WA46"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA46"
FT                   /protein_id="CAE36843.1"
FT                   /translation="MEQPDLFGTLAPLPAIIAGVDEAGRGPLAGAVYAAAVILDPDRPV
FT                   DGLADSKVLKAEQREALAVQIRAQALAWFVASASVQEIDSLNILRATMLAMQRAVAGLA
FT                   MAPELAMVDGNQAPKLRCAVQTVIKGDALVPAISAASILAKTARDADLLRLHALYPQYG
FT                   FDQHKGYGTPQHLSLLREHGPCPEHRRSFAPIKAYGAP"
FT   misc_feature    254628..255161
FT                   /note="HMMPfam hit to PF01351, Ribonuclease HII, score
FT                   1.3e-65"
FT   CDS_pept        255128..255952
FT                   /transl_table=11
FT                   /locus_tag="BPP1542"
FT                   /product="putative RNA methyltransferase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1434"
FT                   /db_xref="GOA:Q7WA45"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA45"
FT                   /protein_id="CAE36844.1"
FT                   /translation="MPRTPAQLRADQGVRRAMKHLSSRDNPAVKALHKLAAGGGRRDGR
FT                   ILLDGVHLCQAWLAHQGTPLQALFDVARLDHPEIRALAGQVPPQHCLALDSRLLQGLAS
FT                   VESGQGVVFVARAPEPALPERIDENCVLFDRIQDPGNVGTLLRTCAAAGVRRVLLAAGT
FT                   AAAWSPKVLRSGQGAHFALHIHEHLDLEAVLPRLDVPLVATTLARSGSLYDTDLPARCA
FT                   WVFGHEGQGVAEALLRAAALRVHIPHESAAVESLNVGAAAAICLFEQRRQRR"
FT   misc_feature    255509..255928
FT                   /note="HMMPfam hit to PF00588, SpoU rRNA Methylase family,
FT                   score 2.6e-19"
FT   CDS_pept        complement(255964..256791)
FT                   /transl_table=11
FT                   /locus_tag="BPP1543"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1435"
FT                   /db_xref="GOA:Q7WA44"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026530"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA44"
FT                   /protein_id="CAE36845.1"
FT                   /translation="MTSTPIERAVYIVSDSTGITAETFSHSVLSQFDEVNFKPVRLPFI
FT                   DTLDKAREVVARINRNALEAGVPPIVFSTLVNPEILALVRQSNGVFLDLFGTFVSHIEQ
FT                   ALGLKSSHSIGRSHMAANSEKYRNRIDAINFSLAHDDGQFVNQLDQADVILVGVSRCGK
FT                   TPTSLYLAMQYAVKAANFPLTPDDFERGALPKTIAPYRGKLFGLSIQPERLAEVRNERR
FT                   PNSHYARLEQCRYEVAEAERMMRREGISWLSTTTKSIEEIATTVLQEVGLERV"
FT   misc_feature    complement(255976..256779)
FT                   /note="HMMPfam hit to PF03618, Domain of unknown function
FT                   (DUF299), score 6.7e-120"
FT   misc_feature    complement(256300..256323)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        256953..259316
FT                   /transl_table=11
FT                   /gene="ppsA"
FT                   /gene_synonym="pps"
FT                   /locus_tag="BPP1544"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1436"
FT                   /db_xref="GOA:Q7WA43"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA43"
FT                   /protein_id="CAE36846.1"
FT                   /translation="MSYVVSFEQLRMTDVDSVGGKNASLGEMISQLAGAGVRVPGGFAT
FT                   TAQAFRDFLQASGLDKRIADRLATLNPEDVRELASAGAQIRQWVIDAPFSPEFEQAIRT
FT                   AFAELDADGKGSFAVRSSATAEDLPDASFAGQQETFLNVVGVDDVLDKIRHVFASLYND
FT                   RAISYRVHKGYAHAEVALSAGIQRMVRSDKGSAGVMFTIDTESGFQDVVFITSSYGLGE
FT                   TVVQGAVNPDEFYVFKPSLERGNYPIVSRRIGSKLIKMEFDPERPEGRAVRTVDVPVSE
FT                   RNRYSLTDDEVIELARYAVIIEKHYQRPMDIEWGRDGVDGKIYILQARPETVKSQQGVN
FT                   DVQQRYRLKATGQVLVTGRAIGQKIGAGKVRVVADISEMDKVQAGDVLVTDMTDPNWEP
FT                   VMKRASAIITNRGGRTCHAAIIARELGIPAVVGCGDATDLLKDGQAVTASCAEGDEGRI
FT                   YDGLIETEVEEVRRGEMPPIDVKIMMNVGNPQLAFDFAQIPNAGVGLARLEFIINNNIG
FT                   IHPKAVLDYPNVDGELKKAVESAARGHASPRAFFVEKLAEGVATIGAAFWPKPVIVRMS
FT                   DFKSNEYRKLVGGSRYEPEEENPMLGFRGASRYIAADFEECFRMECEALKKVRDEMGLT
FT                   NVEIMVPFVRTLGQARKVVELLAAHGLARGENGLKLIMMCEVPSNAILAEQFLEYFDGF
FT                   SIGSNDMTQLTLGLDRDSGMELLAADFDERDDAVKFMLRRAIKACLAANKYVGICGQGP
FT                   SDHPDFAQWLKDEGILSMSLNPDTVVETWQQLAK"
FT   misc_feature    256956..258038
FT                   /note="HMMPfam hit to PF01326, Pyruvate phosphate dikinase,
FT                   PEP/pyruvate binding domain, score 2.1e-129"
FT   misc_feature    258039..258320
FT                   /note="HMMPfam hit to PF00391, PEP-utilizing enzyme, mobile
FT                   domain, score 3.4e-40"
FT   misc_feature    258186..258221
FT                   /note="PS00370 PEP-utilizing enzymes phosphorylation site
FT                   signature."
FT   misc_feature    258342..259310
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02896, PEP-utilizing enzyme, TIM
FT                   barrel domain, score 7e-104"
FT   misc_feature    259026..259082
FT                   /note="PS00742 PEP-utilizing enzymes signature 2."
FT   CDS_pept        complement(join(259384..259614,259614..260093))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1545"
FT                   /product="probable class-I glutamine amidotransferase
FT                   (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1437"
FT                   /db_xref="PSEUDO:CAE36847.1"
FT   misc_feature    complement(join(259486..259614,259614..260042))
FT                   /note="HMMPfam hit to PF00117, Glutamine amidotransferase
FT                   class-I, score 2.2e-08"
FT   variation       complement(259614..259616)
FT                   /note="GCC in parapertussis; GCC(GGCGCCACCG) in pertussis"
FT   misc_feature    complement(259782..259817)
FT                   /note="PS00442 Glutamine amidotransferases class-I active
FT                   site."
FT   CDS_pept        join(260217..260342,260345..260644)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1546"
FT                   /product="putative membrane protein (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1438"
FT                   /db_xref="PSEUDO:CAE36848.1"
FT   misc_feature    260217..260309
FT                   /note="Signal peptide predicted for BPP1546 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.622) with cleavage site
FT                   probability 0.235 between residues 31 and 32"
FT   misc_feature    join(260235..260303,260346..260399)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP1546 by TMHMM2.0 at aa 7-29 and 44-61"
FT   variation       260343..260344
FT                   /note="AC in parapertussis; (-) in pertussis"
FT   CDS_pept        260698..261624
FT                   /transl_table=11
FT                   /locus_tag="BPP1547"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1440"
FT                   /db_xref="GOA:Q7WA42"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA42"
FT                   /protein_id="CAE36849.1"
FT                   /translation="MIDVSTVVLIVIVILALMIVVKAIAIVPQQHAWVVERLGKFDRVL
FT                   SPGAGFVIPFIERVSYKHSLKEIPLDVPSQVCITRDNTQLQVDGVLYFQVTDPMRASYG
FT                   SSNYISAITQLAQTTLRSVIGKLELDRTFEEREFINSTIVASLDEAALNWGVKVLRYEI
FT                   KDLTPPNEILRAMQAQITAEREKRALIAASEGRRQEQINIATGEREAAIARSEGEKQAQ
FT                   INQAQGEAAAVLAIAEATAKAIEQVGEAVRQPGGMEAVNLKVAERYVDAFSNVAKEGNT
FT                   LILPSNLSDVGGLIASAMTIVKSTKSA"
FT   misc_feature    260698..260772
FT                   /note="Signal peptide predicted for BPP1547 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.709) with cleavage site
FT                   probability 0.611 between residues 25 and 26"
FT   misc_feature    260716..260784
FT                   /note="1 probable transmembrane helix predicted for BPP1547
FT                   by TMHMM2.0 at aa 7-29"
FT   misc_feature    260764..261288
FT                   /note="HMMPfam hit to PF01145, SPFH domain / Band 7 family,
FT                   score 1.1e-70"
FT   CDS_pept        join(261690..262247,262251..262427,262429..262842)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1548"
FT                   /product="probable membrane protein (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1441"
FT                   /db_xref="PSEUDO:CAE36850.1"
FT   misc_feature    261690..261782
FT                   /note="Signal peptide predicted for BPP1548 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.887) with cleavage site
FT                   probability 0.280 between residues 31 and 32"
FT   misc_feature    join(261699..261767,261801..261860,261870..261938,
FT                   261957..262016,262044..262103,262140..262208,
FT                   262251..262319)
FT                   /note="7 probable transmembrane helices predicted for
FT                   BPP1548 by TMHMM2.0 at aa 4-26, 38-57, 61-83, 90-109,
FT                   119-138, 151-173 and 188-210"
FT   variation       262248..262250
FT                   /note="In-frame TGA stop codon in parapertussis; TGG in
FT                   pertussis"
FT   misc_feature    join(262341..262427,262429..262821)
FT                   /note="HMMPfam hit to PF00990, GGDEF domain, score 1.8e-46"
FT   variation       262421..262428
FT                   /note="(CG)4 in parapertussis; (CG)5 in pertussis"
FT   CDS_pept        complement(262823..263290)
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /gene_synonym="smqB"
FT                   /locus_tag="BPP1549"
FT                   /product="SsrA-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1442"
FT                   /db_xref="GOA:Q7WA41"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA41"
FT                   /protein_id="CAE36851.1"
FT                   /translation="MSIIDNRKATHDYFIEDRYEAGMVLEGWEVKAIRDGRVHLKESYV
FT                   IVRDGEIYLLGMHVSPLPTASTHIRPDATRTRKLLLKAEEIRKLIGKVEQRGYTLVPLN
FT                   LHYKNGRIKLDFALGRGKKLYDKRDTAREKDWQREKERVLKHDTRVNQRDS"
FT   misc_feature    complement(263084..263290)
FT                   /note="HMMPfam hit to PF01668, SmpB protein, score 3.4e-38"
FT   misc_feature    complement(263192..263230)
FT                   /note="PS01317 Protein smpB signature."
FT   CDS_pept        263356..263790
FT                   /transl_table=11
FT                   /locus_tag="BPP1550"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1443"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA40"
FT                   /protein_id="CAE36852.1"
FT                   /translation="MHKVQRSVLVPYSAAQMFDLVADVEKYPEFMPWCGGAEVHSRSEH
FT                   GMQASILISFAGLKQRFSTRNTHDYPQRIDLELVDGPFSMLVGHWVFQPLAEDACKVLF
FT                   TLEYAFSNRALEMVVGPVFNRIAASFIDSFTKRAQAKYGE"
FT   misc_feature    263356..263784
FT                   /note="HMMPfam hit to PF03654, Uncharacterised protein
FT                   family (UPF0083), score 3.2e-53"
FT   CDS_pept        263780..264130
FT                   /transl_table=11
FT                   /locus_tag="BPP1551"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1444"
FT                   /db_xref="InterPro:IPR005346"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR037021"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA39"
FT                   /protein_id="CAE36853.1"
FT                   /translation="MANDTPAPAGSLRVTVCHACPDGAWQRAVTLPAGATVADAVAASG
FT                   FAAAHRGQDPWAHGVGVFGKAQAADAPLADGDRVEIYRGLSFDPKESRRRRAEHRRALA
FT                   ARGGKARPAGLL"
FT   misc_feature    263813..264064
FT                   /note="HMMPfam hit to PF03658, Uncharacterised protein
FT                   family (UPF0125), score 3.4e-17"
FT   CDS_pept        264327..265481
FT                   /transl_table=11
FT                   /locus_tag="BPP1552"
FT                   /product="probable acyl-CoA dehydrogenase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1445"
FT                   /db_xref="GOA:Q7WA38"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA38"
FT                   /protein_id="CAE36854.1"
FT                   /translation="MDFELTDEQRAFAQAARDYAQGELAPHAARWDAEGIFPREAFARA
FT                   GELGFCAIYASEEIGGLGLPRLDATLVFEEMAAVDPSTTAFLTIHNMATWMVGQWARPA
FT                   VREQWGPLLASGEKLASYCLTEPNAGSDAGSLATRAERQGDDYVLNGAKAFISGGGDTD
FT                   LLVVMARTGGDGPGGVSAFAVPADAAGIAYGRKEEKMGWNSQSTRPITFEQVRVPASHM
FT                   LGEPGEGFKIAMKGLDGGRINIGTCSVGAAQGAMDAARRYMDERRQFNRKLAQFQALQF
FT                   KLADMATHLVAARQMVRLAACKLDAGSADASTYCAMAKRFATDMGFQICLDAQQIHGGY
FT                   GYLRDYPLERLVRDTRVHQILEGTNEIMRVIVARQLLEKGADIR"
FT   misc_feature    264339..264689
FT                   /note="HMMPfam hit to PF02771, Acyl-CoA dehydrogenase,
FT                   N-terminal domain, score 1.9e-17"
FT   misc_feature    264693..264731
FT                   /note="PS00072 Acyl-CoA dehydrogenases signature 1."
FT   misc_feature    264693..264995
FT                   /note="HMMPfam hit to PF02770, Acyl-CoA dehydrogenase,
FT                   middle domain, score 5.7e-46"
FT   misc_feature    265005..265457
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal domain, score 6e-71"
FT   misc_feature    265329..265388
FT                   /note="PS00073 Acyl-CoA dehydrogenases signature 2."
FT   CDS_pept        265478..266650
FT                   /transl_table=11
FT                   /locus_tag="BPP1553"
FT                   /product="enoly-CoA hydratase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1446"
FT                   /db_xref="GOA:Q7WA37"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA37"
FT                   /protein_id="CAE36855.1"
FT                   /translation="MNAPVLFEERIADNGVRLGVATLNAPQTLNGLSLEMVELLDARLL
FT                   AWAADAAVAMVILQGAGEKAFCAGGDLHGLYRSMRENTGGDPWANTHARRFFEHEYRLD
FT                   YLIHTYPKPVLCWGHGIVMGGGVGLMMGASHRVVSETTRMAMPEITIGLFPDVGGSWLL
FT                   NRMPGRTGLFLALTGAHVNASDAFFAGLADFRLDSAQWPDFCASLLSLPWAGQPGGPGT
FT                   GNAAPRSINDGLLRQALLAHEPATQLEPGPLRQHSFLVNSLCSGKRLDDIYAEIAELKD
FT                   HADPWLARAAATMLAGSPGSARLAYALQQHTRLRSLADVFRIEYVAALACAAHGDFAEG
FT                   IRALLVDKDRQPRWNPATLSEASDDWVRKFFDEPWPAGQPHPLADLGHGA"
FT   misc_feature    265532..266068
FT                   /note="HMMPfam hit to PF00378, Enoyl-CoA
FT                   hydratase/isomerase family, score 1.9e-14"
FT   CDS_pept        266698..267591
FT                   /transl_table=11
FT                   /gene="mmsB"
FT                   /locus_tag="BPP1554"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1447"
FT                   /db_xref="GOA:Q7WA36"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011548"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA36"
FT                   /protein_id="CAE36856.1"
FT                   /translation="MSSIAFIGLGNMGAPMALNLVKAGHDLTVFDLVPAAVKTLTDAGA
FT                   RAAGSAAEAVQGAELVISMLPASKHVEGLYLGQDLLASIGASALVIECSTIAPDSARKV
FT                   AAAAQARGIAMIDAPVSGGTGGAAAGTLTFIVGGEAPALERARPVLASMGKNIFHAGGA
FT                   GAGQVAKICNNMLLGILMAGTSEALALGVANGLDPKVLSDIISKSSGRNWATELYNPWP
FT                   GVMEHAPASKGYAGGFGVDLMLKDLGLAAEAALGTRSSILLGELARNLYSLHSQGGSGG
FT                   LDFSSIVNLYSPGERN"
FT   misc_feature    266698..267183
FT                   /note="HMMPfam hit to PF03446, NAD binding domain of
FT                   6-phosphogluconate dehydrogenase, score 0.0015"
FT   misc_feature    266713..266748
FT                   /note="PS00895 3-hydroxyisobutyrate dehydrogenase
FT                   signature."
FT   CDS_pept        267637..268074
FT                   /transl_table=11
FT                   /locus_tag="BPP1555"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1448"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA35"
FT                   /protein_id="CAE36857.1"
FT                   /translation="MPDTEAFEAARQRVHDNFARQSVMALIGARLGAVEPGEVEIALPY
FT                   RADLCQQNGFLHAGISTTIADSAGGYAAYTLFGPGEDVLTSEFKMNFLAPADGEHFVAS
FT                   GKVLKPGRRLSICQVELRACRGERSTLCLVGLMTAVRVTPR"
FT   misc_feature    267685..268062
FT                   /note="HMMPfam hit to PF02584, Uncharacterized protein
FT                   PaaI, COG2050, score 0.00016"
FT   CDS_pept        268134..268823
FT                   /transl_table=11
FT                   /locus_tag="BPP1556"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1449"
FT                   /db_xref="GOA:Q7WA34"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA34"
FT                   /protein_id="CAE36858.1"
FT                   /translation="MPARSHHRIFRSGWLRAAVLGANDGIVSTASLIAGVAAAQASHAA
FT                   ILTSGLAGLVAGALSMAAGEYVSVKSQADIEAADLRLEQSSLKRNSREELEELTGIYVE
FT                   RGLSPDLAGQVARQLTRHNALDAHARDELGISVHNRAQPVQAALASAASFAVGAALPLA
FT                   IAMAAPLAQLMPVVIAGSVAGLGILGAVAARAGGAPVGPAAVRVVLLGAAAMALTAGVG
FT                   ALFGVAV"
FT   misc_feature    268134..268265
FT                   /note="Signal peptide predicted for BPP1556 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.967) with cleavage site
FT                   probability 0.865 between residues 44 and 45"
FT   misc_feature    join(268170..268238,268266..268334,268569..268637,
FT                   268650..268709,268746..268814)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BPP1556 by TMHMM2.0 at aa 13-35, 45-67, 146-168, 173-192
FT                   and 205-227"
FT   CDS_pept        complement(268833..269849)
FT                   /transl_table=11
FT                   /locus_tag="BPP1557"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1845"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA33"
FT                   /protein_id="CAE36859.1"
FT                   /translation="MHAFYDSIPARADGSAQCAPLASLRVIGAAGADALAFLHGQLTQD
FT                   VTGQPADHARLAGYCTAKGRLLATLVMWRAAAADESAPVWQALVRADVAEAVLKRLSMF
FT                   VLRAKARLAPVPAWAAGVQCAPAALAALQDAAGGALPAAPWQRAELPTGTWIGAPSADA
FT                   QPRWWWIATEAQLERAGALAAHLGRASESAWQAADLAAGLPWIGAATQDVFIPQTVNLD
FT                   LIGGVSFTKGCYPGQEVVARSHYRGTVKRRMAHGVIAEAPADLPDPLAGQDIYDSARPD
FT                   EPCGRVVDAARSDGQLALLFETTLASLPDGDLRLLSAQGPRIALAPLPYELAGNAAG"
FT   CDS_pept        270016..271062
FT                   /transl_table=11
FT                   /locus_tag="BPP1558"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1846"
FT                   /db_xref="GOA:Q7WA32"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA32"
FT                   /protein_id="CAE36860.1"
FT                   /translation="MRTLMRKRIRFYFLLLVLVALLGAALAAGGAWTWMHRPVALKSDR
FT                   IDFVVDPGSTPRAIARTLNQAGVAVWEPGFVWMARLSELDKQIKAGGYQAIDGDSPWQL
FT                   LQRLARGDMSQRQITFLEGWMFRQMRQALREHPDVKQTLGETSDEALMERLGSTVTHPE
FT                   GMFFPDTYVFTPGSTDFDILRRAYQEGQRILESTWAKRQDGLPVGTPYEALILASIVEK
FT                   ETGHGPERARVAGVFANRLRIGMLLQTDPTVIYGMGEAYQGRIRKRDLQTDTPWNTYTR
FT                   PGLPPTPIAAPGRAALLAAVQPERHKYLFFVSRGNGTSEFSVNLNDHNRNVSRYILGQG
FT                   QPQQGSQQ"
FT   misc_feature    270016..270096
FT                   /note="Signal peptide predicted for BPP1558 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.719 between residues 27 and 28"
FT   misc_feature    270028..271029
FT                   /note="HMMPfam hit to PF02618, Uncharacterized BCR, YceG
FT                   family COG1559, score 3e-86"
FT   misc_feature    270052..270120
FT                   /note="1 probable transmembrane helix predicted for BPP1558
FT                   by TMHMM2.0 at aa 13-35"
FT   CDS_pept        271059..271685
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="BPP1559"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1847"
FT                   /db_xref="GOA:Q7WA31"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA31"
FT                   /protein_id="CAE36861.1"
FT                   /translation="MTPRGRFITLEGVDGAGKSTHTAWMVQALRDLGLTVLATREPGGT
FT                   PVGEKLRELLLSEPMALETETLLMFAARCEHVREVIAPALARGEWVVCDRFTDASYAYQ
FT                   GGGRQLGAARVAALEQWVHPDLQPDRTWLFDVPLDVARARLARSRQLDRFEREEDAFFE
FT                   RTRAAYHERARSSDGRIRIIDSSRPLEVVRAQLDSEVRELVAQAA"
FT   misc_feature    271086..271646
FT                   /note="HMMPfam hit to PF02223, Thymidylate kinase, score
FT                   5.4e-57"
FT   misc_feature    271092..271115
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        271682..272734
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="BPP1560"
FT                   /product="DNA polymerase III, delta' subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1848"
FT                   /db_xref="GOA:Q7WA30"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA30"
FT                   /protein_id="CAE36862.1"
FT                   /translation="MSLGRFLPWQTEIARSWLSGRDRFAHAWLIHGNGGIGKLDFAAAA
FT                   AASLLCESPRQGLACGECAACAWVASGNHPDLRRIRPEAVALEEGADQAEGAEEAEAGS
FT                   GGAAAKRAPSKDIRIDQIRALEPWFNTATHRGGWRVALLYPAHALNVISANALLKVLEE
FT                   PPAHTVFLLVADAPDRLLPTLVSRCRRLPLPTPSAGQALQWLGEQGVEPAADWLAAAGG
FT                   APLAAQRLAARGDAPCPAWLAQLVQPLAAGKAPDVGTLTENLEKVAAAEWIDALQRLFT
FT                   DLTLAAHGAASRYYPSLAEPVRQAAARAQPAQLAETARWLSRQRGLATHPLNAKLFVHA
FT                   ALQRVVLSCQ"
FT   CDS_pept        272775..273554
FT                   /transl_table=11
FT                   /locus_tag="BPP1561"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1849"
FT                   /db_xref="GOA:Q7WA29"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA29"
FT                   /protein_id="CAE36863.1"
FT                   /translation="MVRMYVDSHCHLNFPELAQDLPAVLDRMAANQVTHALVVSVNMPD
FT                   WPGLMQLVEPHGNLWASVGVHPDYEDTPDPEPAELERLAAHPKVVAIGETGLDYYRLSE
FT                   PLDWQRERFRRHIRAARSTGLPLIVHTRASAQDTVRLLREEGADEVGGVMHCFTESWEI
FT                   AQQAMALNFHISLSGIVTFKNAQLVHEVAANMPLDRLLIETDSPYLAPVPYRGKLNDPS
FT                   KVIHVAEKIAELKGIPVAEVAHASTENFFKLFNKIKR"
FT   misc_feature    272787..272813
FT                   /note="PS01137 Uncharacterized protein family UPF0006
FT                   signature 1."
FT   misc_feature    272802..273539
FT                   /note="HMMPfam hit to PF01026, TatD related DNase, score
FT                   2.1e-88"
FT   misc_feature    273345..273395
FT                   /note="PS01091 Uncharacterized protein family UPF0006
FT                   signature 3."
FT   CDS_pept        273605..274441
FT                   /transl_table=11
FT                   /locus_tag="BPP1562"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1850"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA28"
FT                   /protein_id="CAE36864.1"
FT                   /translation="MKPLRTRFLRWRGAAAGGLLAGALLASPAWAAKQADWWVYVHNDK
FT                   ARDIGALLAAGADPNVRYDNGQPAIMRAVVDNAWEVFDVLAANRRTDLNAENPAGETPL
FT                   MYLAVAGQTERAQALIARGAQVNRLGWTPLHYAASKGRLETARMLLGKQALVNAPSPDG
FT                   TTPLMMAAYSGDRRMVQLLLDAGADITTRNLKGMSAADWAAFGKSEALARELKPMIARA
FT                   EAERQARHGAVATPKLAPAAETPPTAQPAAAPAAASQPGEGRSLSGVSGVRLNSYD"
FT   misc_feature    273605..273697
FT                   /note="Signal peptide predicted for BPP1562 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 31 and 32"
FT   misc_feature    273989..274087
FT                   /note="HMMPfam hit to PF00023, Ankyrin repeat, score
FT                   2.3e-07"
FT   misc_feature    274088..274186
FT                   /note="HMMPfam hit to PF00023, Ankyrin repeat, score
FT                   6.5e-09"
FT   CDS_pept        274637..275374
FT                   /transl_table=11
FT                   /locus_tag="BPP1563"
FT                   /product="probable transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1851"
FT                   /db_xref="GOA:Q7WA27"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA27"
FT                   /protein_id="CAE36865.1"
FT                   /translation="MQEQAIAGGAERVLYVLATLAREEAPLTVAALAERTGLAQSTLYR
FT                   QVALLKRWGFVLEQAGAYTPGPLCVQLARGFDQSSYLIQEALPDMTRLAADSGETVGLL
FT                   VAMSDQAVCLEMVESRHPLRCSFVKGRGLPLARGASAKSLMAFMAPARLQGRLHELAGQ
FT                   GVDAAALARDLEAIRAAGYAVSDSEVDAGVWGCSAPVFERPHQAAGSVTLMAPSTRVAE
FT                   RTANLINLTLAAAKRISSRLQHS"
FT   misc_feature    274823..275359
FT                   /note="HMMPfam hit to PF01614, Bacterial transcriptional
FT                   regulator, score 5.3e-15"
FT   CDS_pept        join(275374..275700,275703..276194)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1564"
FT                   /product="putative glutamine-binding periplasmic protein
FT                   precursor (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1852"
FT                   /db_xref="PSEUDO:CAE36866.1"
FT   misc_feature    275374..275523
FT                   /note="Signal peptide predicted for BPP1564 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.987) with cleavage site
FT                   probability 0.987 between residues 50 and 51"
FT   misc_feature    join(275533..275700,275703..276182)
FT                   /note="HMMPfam hit to PF00497, Bacterial extracellular
FT                   solute-binding proteins, family 3, score 6.1e-73"
FT   misc_feature    275596..275637
FT                   /note="PS01039 Bacterial extracellular solute-binding
FT                   proteins, family 3 signature."
FT   variation       275700..275703
FT                   /note="(C)4 in parapertussis; (C)2 in pertussis"
FT   CDS_pept        join(276191..276328,276331..276861)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1565"
FT                   /product="glutamine transport system permease (Pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1853"
FT                   /db_xref="PSEUDO:CAE36867.1"
FT   misc_feature    join(276248..276316,276353..276421,276434..276502,
FT                   276746..276814)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BPP1565 by TMHMM2.0 at aa 20-42, 55-77, 82-104 and 186-208"
FT   variation       276329..276330
FT                   /note="AC in parapertussis; (-) in pertussis"
FT   misc_feature    276523..276735
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 5.4e-16"
FT   misc_feature    276526..276612
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        276858..277631
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="BPP1566"
FT                   /product="glutamine transport ATP-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1855"
FT                   /db_xref="GOA:Q7WA26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA26"
FT                   /protein_id="CAE36868.1"
FT                   /translation="MSTQEMIRIRGLRKAYGEHEVLRGIDFNVEASQVVVVIGPSGSGK
FT                   STLLRCCNGLEVAQGGTIDICGHNLLKDGRLLPEAELNRLRMQVGMVFQGFNLFPHLSV
FT                   LDNVTVGPRTLRGMSRAQAEELGGDLLAKVGLREKMAAMPGSLSGGQKQRVAIARALAM
FT                   QPRVMLFDEPTSALDPELVGEVLQVMKLLAREGMTMMVVTHEMGFAREVADVVAVMDGG
FT                   SIVESGPPELIFSQPREARTRAFLQAVLSASQGAA"
FT   misc_feature    276951..277523
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   4.4e-58"
FT   misc_feature    276972..276995
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    277296..277340
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        join(277628..277699,277702..277812,277815..278567)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1567"
FT                   /product="probable arginase (Pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1856"
FT                   /db_xref="PSEUDO:CAE36869.1"
FT   misc_feature    277827..278561
FT                   /note="HMMPfam hit to PF00491, Arginase family, score
FT                   1.3e-05"
FT   misc_feature    277971..278012
FT                   /note="PS00147 Arginase family signature 1."
FT   misc_feature    278058..278084
FT                   /note="PS00148 Arginase family signature 2."
FT   misc_feature    278337..278402
FT                   /note="PS01053 Arginase family signature 3."
FT   CDS_pept        278700..280049
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /gene_synonym="gdh"
FT                   /locus_tag="BPP1568"
FT                   /product="glutamate dehydrogenase"
FT                   /EC_number="1.4.1.3"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1857"
FT                   /db_xref="GOA:Q7WA25"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA25"
FT                   /protein_id="CAE36870.1"
FT                   /translation="MGPQLVSWKNKRNLSPEILPMSQAPAHSLPSYLDAEHLGPWGIYL
FT                   QQVDRVTPYLGPLARWVETLKRPKRALIVDVPIEMDNGSIAHFEGYRVQHNTSRGPGKG
FT                   GVRFHQDVTLSEVMALAAWMSIKNAAVNLPYGGAKGGVRVDPRTLSHSELERMTRRYTS
FT                   EIGVIIGPSKDIPAPDVNTNAQTMAWMMDTYSMNEGATATGVVTGKPIALGGSLGRVEA
FT                   TGRGVFVVGCEAARDLNLDVSKARIVVQGFGNVGGTAARLFHEAGAKVIAVQDHTGTIH
FT                   NDGGLDVHKLLAHVGNQGGVAGFTGAQQLADDDFWGLETDFLIPAALEGQINENNAARV
FT                   RAKVVVEGANGPTTPEADDILRENGVYVVPDVLANAGGVTVSYFEWVQDFSSFFWSEEE
FT                   INQRLERLMREAYSAVSQVAKEHKVTLRTAAFIVACTRILQARQVRGLYP"
FT   misc_feature    278901..279293
FT                   /note="HMMPfam hit to PF02812, Glu/Leu/Phe/Val
FT                   dehydrogenase, dimerisation domain, score 2.5e-64"
FT   misc_feature    279096..279137
FT                   /note="PS00074 Glu / Leu / Phe / Val dehydrogenases active
FT                   site."
FT   misc_feature    279339..280037
FT                   /note="HMMPfam hit to PF00208,
FT                   Glutamate/Leucine/Phenylalanine/Valine dehydrogenase, score
FT                   2.9e-95"
FT   misc_feature    279648..279689
FT                   /note="PS01039 Bacterial extracellular solute-binding
FT                   proteins, family 3 signature."
FT   CDS_pept        complement(280125..281621)
FT                   /transl_table=11
FT                   /gene="aldH"
FT                   /locus_tag="BPP1569"
FT                   /product="probable aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1858"
FT                   /db_xref="GOA:Q7WA24"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA24"
FT                   /protein_id="CAE36871.1"
FT                   /translation="MTLHDSAYWRAQAAALAPEGRAYIDGAYCDAADGATFAAHSPIDG
FT                   RKLADIAACGAADVDRAVAAARRAFEAGVWSGLAPRERKHRLLRLAALITEHQEELALL
FT                   ETLDMGKPIRDALAFDLPETARCYAWYGEAIDKRYDEIAPTGADALATITREPLGVVAA
FT                   VVPWNYPLMMAAWKVAPALAVGNSVILKPAEQASLSALRLAALAEQAGIPPGVFSVVPG
FT                   LGAQAGQALGLHPDVDCIAFTGSTATGKRFMTYSGQSNLKRVWLECGGKSPHIVFADCP
FT                   DLDRAAQVAALAIFSNQGEVCIAGSRLYVQHGIYDAFMEKVAAFAATLRPGNPLDPDSA
FT                   LGAMVDERQTQAVMARIAAGAQEGARLRLGGRQVLTDSGGYYIEPTIFDCPGQDNSLVR
FT                   EEIFGPVLAAQGFADEDEAVALANDSIYGLGAGLWTADLGRAHRLSRRLRAGLVWVNCY
FT                   ADGDITVPFGGVKQSGFGRDKSLHAMDKYSDLKTTWISLR"
FT   misc_feature    complement(280131..281543)
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
FT                   family, score 3.5e-193"
FT   misc_feature    complement(280704..280739)
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT   misc_feature    complement(280803..280826)
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT   CDS_pept        complement(281671..282918)
FT                   /transl_table=11
FT                   /gene="amaB"
FT                   /locus_tag="BPP1570"
FT                   /product="N-carbamoyl-L-amino acid amidohydrolase"
FT                   /EC_number="3.5.1.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1859"
FT                   /db_xref="GOA:Q7WA23"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA23"
FT                   /protein_id="CAE36872.1"
FT                   /translation="MSNNSPISIDGQRLWQSLMDLARIGATPKGGNCRLALTALDGQGR
FT                   DLVTGWMRDAGLTVRVDQVGNIFARRAGRDPSRAPVMTGSHIDTQPTGGKFDGCYGVLA
FT                   GLEVMRTLDDHGVQTDAPLEVAIWTNEEGSRFLPVMMGSGVFAGKFPLETALTARDAEG
FT                   KSVADELRAIGYAGADPVGGRAVDAYFEAHIEQGPILEHEDRIVGVVTGSLGVRWYDVV
FT                   VQGMEMHAGPTPMPIRKDALYAASHLLQAVVEIANAHQPHGRGTVGEIHAYPGSRNVIP
FT                   GQVRFTVDLRHEDEATLATMDALWRQACADTAARHAVSVQCEQVQYFAPTPFHPDLVGK
FT                   VRDGAQRRGLPAMDIVTGAGHDAVYMAAVAPTAMIFVPCKDGISHNEIEDAQPAHLEAG
FT                   CNVLLDAMVARANAPR"
FT   misc_feature    complement(281836..282867)
FT                   /note="HMMPfam hit to PF01546, Peptidase family
FT                   M20/M25/M40, score 0.004"
FT   misc_feature    complement(282424..282447)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(282928..284661)
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="BPP1571"
FT                   /product="acetolactate synthase large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1860"
FT                   /db_xref="GOA:Q7WA22"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA22"
FT                   /protein_id="CAE36873.1"
FT                   /translation="MTTPALPERNGGQILMQQLRVHGARRVFMIPGESYLPCIDALNEH
FT                   RGAIDAIVCRQESGAAYMAEAYGKLTGEPGICFVTRGPGATNASIGVHTAYQDSTPMIL
FT                   FIGQVGNDFMEREAFQEIDYRRMFGQMAKWVAQIDRTERIPEFIARAFAVATSGRPGPV
FT                   VLALPEDTLWGRARVADMPRYRRARCLPGAADLARMVELLDQAERPFMLLGGTGWSAEA
FT                   IGQAAAFAERFELPVGTAWRRLECFDQRHPNAAGHVGWAMAPELRQRIAGADLVLAVGT
FT                   RMGEATTEGYTVIESPLPRQRLVHAYPDPNELGRVFAPTLGIVADPAGFAAALDALRPG
FT                   HRASRAQAVRAAHDEYLATLAPLPSPGPLNLDSAAAYVNQHIPADACITVGAGNYALYP
FT                   HRYRQFSGPGTSLAPTVGSMGYGLPAAISAKLENPARTVVCYAGDGCFQMNMQELGVAL
FT                   LQELGVALQYRVGVVVLVFNNGIWGTIRAHQEREFPGRAIALDFQNPDFTQFVRAYGGY
FT                   GEAVERTEDFGPAFERARAFAEREQLPALLEIRYEADGIAPGQTLTEIHQAAQAQAAGV
FT                   Q"
FT   misc_feature    complement(283015..283572)
FT                   /note="HMMPfam hit to PF02775, Thiamine pyrophosphate
FT                   enzyme, C-terminal TPP binding domain, score 6.5e-24"
FT   misc_feature    complement(283594..284088)
FT                   /note="HMMPfam hit to PF00205, Thiamine pyrophosphate
FT                   enzyme, central domain, score 1.1e-08"
FT   misc_feature    complement(284122..284643)
FT                   /note="HMMPfam hit to PF02776, Thiamine pyrophosphate
FT                   enzyme, N-terminal TPP binding domain, score 3.9e-49"
FT   CDS_pept        complement(284658..285599)
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="BPP1572"
FT                   /product="citrate lyase beta chain"
FT                   /EC_number="4.1.3.6"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1861"
FT                   /db_xref="GOA:Q7WA21"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA21"
FT                   /protein_id="CAE36874.1"
FT                   /translation="MTPISNPGGQRRPASLRRSWMFVPGLLEQAQAAGLASGADALVAD
FT                   LEEFTAPADRPAARRRIVALLAQCRAAGVIGAVRINKLEEDGLDDLRGIMAGAPDAIFL
FT                   PHAESAAQIAALDRAISACEAEAGLAPGSTEIVPTLESALGVTRACEILTASPRVSACL
FT                   LAAEDLTASLGGAERGPDGIELHALRARFLVDCVAAGCLPIDCPFNYRDPAAQQADLLW
FT                   ARRIGLKSKCAVFAEQVPAIHAAFTPDADRVAAARDLAARFEAQRDGRDAGGARVDPPD
FT                   YNTARRLLARHAEFEQWAARAARPRESQGEQS"
FT   CDS_pept        complement(join(285596..286555,286555..286875))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1573"
FT                   /product="putative membrane protein (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1862"
FT                   /db_xref="PSEUDO:CAE36875.1"
FT   misc_feature    complement(join(285613..285678,285859..285924,
FT                   285988..286047,286093..286149,286165..286230,
FT                   286291..286356,286393..286458,286489..286545,
FT                   286567..286632,286663..286728,286765..286830))
FT                   /note="11 probable transmembrane helices predicted for
FT                   BPP1573 by TMHMM2.0 at aa 15-37, 49-71, 81-103, 110-129,
FT                   139-161, 173-195, 215-237, 242-261, 276-296, 317-339 and
FT                   399-421"
FT   misc_feature    complement(286001..286477)
FT                   /note="HMMPfam hit to PF00597, DedA family, score 1.3e-06"
FT   misc_feature    complement(286789..286875)
FT                   /note="Signal peptide predicted for BPP1573 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.782) with cleavage site
FT                   probability 0.234 between residues 29 and 30"
FT   CDS_pept        complement(286879..287361)
FT                   /transl_table=11
FT                   /locus_tag="BPP1574"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1863"
FT                   /db_xref="GOA:Q7WA20"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA20"
FT                   /protein_id="CAE36876.1"
FT                   /translation="MLGRISHALSGLSKAIAALAVALLAALITYVVFERFVMHTTPHWA
FT                   EELPRLVLVWAAFIGGVTCSHERTHLMAGLLPFVVRNPRALAICDRVNQALIIVGLAAL
FT                   GYAGWQLAELTMDQTLPALDVSAGTVYLALPVACAITIVVHLAQLFQPADPVAAKD"
FT   misc_feature    complement(join(286915..286980,287026..287076,
FT                   287263..287316))
FT                   /note="3 probable transmembrane helices predicted for
FT                   BPP1574 by TMHMM2.0 at aa 15-33, 95-112 and 127-149"
FT   misc_feature    complement(287287..287361)
FT                   /note="Signal peptide predicted for BPP1574 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.973) with cleavage site
FT                   probability 0.895 between residues 25 and 26"
FT   CDS_pept        complement(join(287362..287805,287805..288413))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1575"
FT                   /product="putative exported protein (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1864"
FT                   /db_xref="PSEUDO:CAE36877.1"
FT   misc_feature    complement(join(287410..287805,287805..288254))
FT                   /note="HMMPfam hit to PF03480, Bacterial extracellular
FT                   solute-binding protein, family 7, score 8.1e-96"
FT   variation       complement(287803..287805)
FT                   /note="CTC in parapertussis; CTTCACC in pertussis"
FT   misc_feature    complement(288258..288323)
FT                   /note="1 probable transmembrane helix predicted for BPP1575
FT                   by TMHMM2.0 at aa 30-52"
FT   misc_feature    complement(288267..288413)
FT                   /note="Signal peptide predicted for BPP1575 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 49 and 50"
FT   CDS_pept        complement(288519..289238)
FT                   /transl_table=11
FT                   /locus_tag="BPP1576"
FT                   /product="GntR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1865"
FT                   /db_xref="GOA:Q7WA19"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA19"
FT                   /protein_id="CAE36878.1"
FT                   /translation="MGSFQAVAPTRLYRMIADQIAGRIRAGDFPAGGRLPAERELAEQL
FT                   QVSRASVREALIALEIEGYVEVRVGTGVFVAAPRADGDYGVAPAPQPGHTDIGPFDLLD
FT                   TRLLLEPECASLAAQKASPAQIAAISSAHAAMSLSDSPGAHDQAFHGAIAAACGNAALA
FT                   AAISHIWHLSATSPVFSRLEQHFVTTKVWEAAEREHERILAAIVDRDPIRARHAMHDHL
FT                   VGILARLREDFGSGAIR"
FT   misc_feature    complement(289014..289193)
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 1.3e-24"
FT   misc_feature    complement(289062..289136)
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT   CDS_pept        complement(289355..289738)
FT                   /transl_table=11
FT                   /locus_tag="BPP1577"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1867"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA18"
FT                   /protein_id="CAE36879.1"
FT                   /translation="MKPAIHLKRAYEAAAPADGRRVLIDGLWPRGLRKDALPLDDWIKD
FT                   LAPSAALRQWFGHQTPRWPAFRERYLAELRGPSHQAQLRALLAQAGAGPLTLVYGARDT
FT                   EHNNAVVLREALLALAAGGRGAA"
FT   CDS_pept        289793..290275
FT                   /transl_table=11
FT                   /locus_tag="BPP1578"
FT                   /product="putative cytochrome"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1868"
FT                   /db_xref="GOA:Q7WA17"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA17"
FT                   /protein_id="CAE36880.1"
FT                   /translation="MRRFPGRMLKWLVLACGLATAAGLLAWRLAPSSDYIAPAAGQDRL
FT                   RGQAIYQANCAACHGARLEGQPDWRQRLASGRLPAPPHDASGHTWHHPDAVLLDIIRHG
FT                   MVPGRHAPDGYQSDMPAYAGVLSDAEIALVLAYIKSTWPSQVQQDQRAATQQMTPR"
FT   misc_feature    289793..289870
FT                   /note="Signal peptide predicted for BPP1578 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.304 between residues 26 and 27"
FT   misc_feature    289916..290218
FT                   /note="HMMPfam hit to PF00034, Cytochrome c, score 0.00041"
FT   misc_feature    289955..289972
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   CDS_pept        complement(290288..291985)
FT                   /transl_table=11
FT                   /locus_tag="BPP1579"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Salmonella typhi hypothetical membrane
FT                   protein YbjL or Sty0903 SWALL:Q8Z851 (EMBL:AL627268) (561
FT                   aa) fasta scores: E(): 3.7e-41, 31.81% id in 572 aa, and to
FT                   Yersinia pestis hypothetical membrane protein Ypo1326
FT                   SWALL:Q8ZGH1 (EMBL:AJ414147) (562 aa) fasta scores: E():
FT                   1.3e-41, 32.22% id in 571 aa"
FT                   /db_xref="GOA:Q7WA16"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WA16"
FT                   /protein_id="CAE36881.1"
FT                   /translation="MQAFVQFLGSNPYILLFLTIGLAVWVGKFSIKGYGLGAVAAAIVV
FT                   GCLVATVGAAYGVKFHLDEFAKSLLYYLFMYGVGLRVGPSFVNALNKESINYAILAIIA
FT                   PILGLAIVVLGTQFFGLPLGAAGGMLAGSQTMSAAIGSAEQAVSAGVLSLGSESPEQIS
FT                   AMIALSYGITYIWGTVGIILLCKYLPRIWGVDAKAAALEFEKAHGVPNVDDAGLTAFHP
FT                   FDLRAYRVENPESIGKTVQQFRTRFPQYQVVNVERGDQLLGPSAETVLQQGDVVALGGR
FT                   LEEMTANMGMLGPEVPDARALNIPLDQAEILVTNKEVTGRPLKTFRGSELAGQIQLQRV
FT                   ERSGVPLPIGLETTLQKRDVLFVTGLQPAVSKAGEIFGVIARHSSATDLLTLSFGMILG
FT                   FLIGLIEVPAFGAKVGLGNAGGLLLSGIIVSSISSRLRFFGNTPNAARNILEDLGLIGF
FT                   VAIVGINAGADLLTQLTGAIALKIFIVGFLASTIPPIIVWAIGFHIMKINPALLMGATA
FT                   GARSHSGPAREAAKEVGSSVPWLGFPVGYAVSGVLLTVFGYFAMVLAH"
FT   misc_feature    complement(join(290303..290368,290474..290539,
FT                   290570..290626,290690..290740,290753..290818,
FT                   291434..291499,291629..291694,291716..291781,
FT                   291821..291886,291908..291973))
FT                   /note="10 probable transmembrane helices predicted for
FT                   BPP1579 by TMHMM2.0 at aa 4-26, 33-55, 68-90, 97-119,
FT                   162-184, 389-411, 415-432, 453-472, 482-504 and 539-561"
FT   CDS_pept        complement(join(292090..292458,292458..293462))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1580"
FT                   /product="glutamate decarboxylase (Pseudogene)"
FT                   /EC_number="4.1.1.15"
FT                   /note="Similar to Lycopersicon esculentum glutamate
FT                   decarboxylase SWALL:DCE_LYCES (SWALL:P54767) (502 aa) fasta
FT                   scores: E(): 1.7e-73, 45.24% id in 431 aa, and to Oryza
FT                   sativa glutamate decarboxylase Gad SWALL:Q9AQU4
FT                   (EMBL:AB056062) (501 aa) fasta scores: E(): 2.1e-74, 45.47%
FT                   id in 431 aa"
FT                   /db_xref="PSEUDO:CAE36882.1"
FT   misc_feature    complement(292416..293408)
FT                   /note="HMMPfam hit to PF00282, Pyridoxal-dependent
FT                   decarboxylase conserved domain, score 1.1e-37"
FT   CDS_pept        complement(293886..295619)
FT                   /transl_table=11
FT                   /locus_tag="BPP1582"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa3465 SWALL:Q9HYE1 (EMBL:AE004767) (571 aa) fasta
FT                   scores: E(): 1e-126, 60.62% id in 574 aa, and to Rhizobium
FT                   meliloti putative transport transmembrane protein R00235 or
FT                   Smc02910 SWALL:Q92SW7 (EMBL:AL591783) (551 aa) fasta
FT                   scores: E(): 5.8e-68, 38.94% id in 529 aa"
FT                   /db_xref="GOA:Q7WA15"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA15"
FT                   /protein_id="CAE36883.1"
FT                   /translation="MLQAPASAPEDLPRASAEAAPPPSRPGVLAPFGYPAFRMIWIANL
FT                   FANLGIWAQSVAAAWIVTEAQSGPLIVAMIQVAAALPLVALSIVTGVVADNHDRRKVML
FT                   VGMGLELVVGTLITALAFLGLLHPVTLIVAVFVVSIGSAIVTPAWQAAVSEQVPRQYVG
FT                   NAVLLNSVNYNVARAIGPAIGGVLLGALGAPWVFLLNCFCYGALIWAIWRWRRETPPRT
FT                   LPPERIYEGVVAALRFTEYSNVTRLVMMRAFSFGLSASALWALLPVLAHEHDNGSASLY
FT                   GYMLGALGLGAIAGSLGIRTVQRRLGVSRLISVAAALLALGLIALGVTENLWVVFPALL
FT                   LSGSCWIAVLATYNATVQLLVPDWVKARALTLYQTAIFGGLALGSFIWGHFAGSMGTRG
FT                   AMAAAGVALLFTVALLYRSRLPDHVDDKCLSVLPRAALPAGQSDFDARHGVVLVSIEYR
FT                   IAAERARAFIDAAGPLRLMRMRNGADQWQLFRDLEDAERWSEMFVVDSWLQYLRMNDRM
FT                   TLADKMAIDAAQAFHSGPNPPQVTHAVSYISVSAAGGRGHAAPPAPAGPAQAAMGPVTA
FT                   D"
FT   misc_feature    complement(join(294372..294422,294453..294518,
FT                   294558..294623,294636..294701,294723..294779,
FT                   294810..294875,294984..295049,295161..295226,
FT                   295248..295313,295344..295409,295431..295496))
FT                   /note="11 probable transmembrane helices predicted for
FT                   BPP1582 by TMHMM2.0 at aa 89-111, 118-140, 150-172,
FT                   179-201, 238-260, 296-318, 328-347, 354-376, 380-402,
FT                   415-437 and 447-464"
FT   CDS_pept        295810..297354
FT                   /transl_table=11
FT                   /locus_tag="BPP1583"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   transmembrane protein Rsp1524 or Rs04801 SWALL:Q8XPW2
FT                   (EMBL:AL646085) (505 aa) fasta scores: E(): 5.5e-61, 39.96%
FT                   id in 498 aa, and to Rhizobium loti two-component system
FT                   histidine protein kinase Mll4698 SWALL:Q98DH8
FT                   (EMBL:AP003004) (535 aa) fasta scores: E(): 7.2e-20, 28.91%
FT                   id in 505 aa"
FT                   /db_xref="GOA:Q7WA14"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA14"
FT                   /protein_id="CAE36884.1"
FT                   /translation="MALSRPARLLSRIGMVTALGIVAALGIVIAVASILAQDRQQVWER
FT                   EARSARNVLQALAGEFERTVTAYDLVIRGVIGDLAQPAVAAMGPEALHRLLFQQGARPD
FT                   NLAVLLVLDERGEVILDSRTAVVAPRNRSRRDYFQAHVDNPQAGLFISKPYRSRNRNGE
FT                   LSIALSRRLAHPDGSFAGVVVAAVSLSYFRDRVVQLNVGPRGSMTLFRDDGIVISRKPY
FT                   VEAQIGVDLSESANVSRFPREGRGAFVGTAILDGVERLYQFERVGKLPLIMVVALSTDD
FT                   MMTPWRRHAWVLAGAVLLLCALLVALLAALERELRRRRNAEAELAQLARIDTLSGLLNR
FT                   RAFAQVLALEWEAALRGRTPLALLLVDVDHFKAYYDCYGRSASDVLLRRVADAVRDCVP
FT                   YAANVVARHGADEFVVLLPGMGLRSAAWLAERVRARVLGLAVPHRGNRGGVVSVSIGCT
FT                   AMTPLAGSEAAVLVERADAALYLAKSRGRNRVERIGDPSTAGQGAEREMAQEPGGS"
FT   misc_feature    295810..295917
FT                   /note="Signal peptide predicted for BPP1583 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.995) with cleavage site
FT                   probability 0.677 between residues 36 and 37"
FT   misc_feature    join(295846..295914,296674..296742)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP1583 by TMHMM2.0 at aa 13-35 and 289-311"
FT   misc_feature    296782..297276
FT                   /note="HMMPfam hit to PF00990, GGDEF domain, score 1.2e-43"
FT   CDS_pept        297459..298010
FT                   /transl_table=11
FT                   /locus_tag="BPP1584"
FT                   /product="putative RNA polymerase sigma factor"
FT                   /note="Similar to Rhizobium loti RNA polymerase sigma
FT                   factor Mlr0407 SWALL:Q98MW7 (EMBL:AP002994) (183 aa) fasta
FT                   scores: E(): 6.8e-32, 54.74% id in 179 aa, and to
FT                   Agrobacterium tumefaciens Ecf family sigma factor PrtI or
FT                   Atu1485 or Agr_c_2739 SWALL:AAL42491 (EMBL:AE009107) (168
FT                   aa) fasta scores: E(): 6.3e-17, 41.93% id in 155 aa"
FT                   /db_xref="GOA:Q7WA13"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA13"
FT                   /protein_id="CAE36885.1"
FT                   /translation="MTSDSPTFPVAAQLPALRAYARTLTRNPHDAEDLLQEALTRAYER
FT                   RHTLRADGNLRAWLMAIVHNVFASEWRRRQAAPAQAAPLHDMEDAAAVAPPQEHSVRLA
FT                   QIERAFMQLPDDQRAALHLVTIEGMAYQEAADALQIPIGTLMSRLGRARAALRRFEDGM
FT                   GEAAADRRARFRIVGGRDAA"
FT   misc_feature    297513..297680
FT                   /note="HMMPfam hit to PF00776, Sigma-70 factor (ECF
FT                   subfamily), score 8.2e-13"
FT   CDS_pept        298015..298806
FT                   /transl_table=11
FT                   /locus_tag="BPP1585"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium loti hypothetical protein
FT                   Mlr0408 SWALL:Q98MW6 (EMBL:AP002994) (257 aa) fasta scores:
FT                   E(): 4.9e-19, 44.04% id in 252 aa, and to Agrobacterium
FT                   tumefaciens transcriptional regulator PrtR or atu1484 or
FT                   agr_c_2736 SWALL:Q8UFB4 (EMBL:AE009107) (258 aa) fasta
FT                   scores: E(): 0.0097, 28.4% id in 264 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA12"
FT                   /protein_id="CAE36886.1"
FT                   /translation="MTEIDLNAYVDGQLDPARRIEVEDFLSRHPEEAMRVMADLRQRDA
FT                   LRWALGASQQAPADGADTPTAVHTRRLARRLERGLVRRGLDDRLRQAAAAVLLVAVGWA
FT                   GHVGYAARYPDMRHVVAATAPSFVEDAVQAHRTAKVRAAMASQPRVPHLDADELLRATG
FT                   VRVPALPASWAVRDVQVFPGRTGPSVEMEVEAAGLGRLWVFAAREPAHAAEAAPVVSRF
FT                   QDAPIAYWQQGQWAYAITGDLPDAELGRAAGQMTVAMLATP"
FT   CDS_pept        298895..299614
FT                   /transl_table=11
FT                   /locus_tag="BPP1586"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa1170 SWALL:Q9I4G7 (EMBL:AE004547) (244 aa) fasta
FT                   scores: E(): 2.3e-41, 52.54% id in 236 aa, and to Ralstonia
FT                   solanacearum hypothetical transmembrane protein Rsc0556 or
FT                   Rs04909 SWALL:Q8Y1Y1 (EMBL:AL646060) (232 aa) fasta scores:
FT                   E(): 1.7e-33, 48.85% id in 219 aa"
FT                   /db_xref="GOA:Q7WA11"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA11"
FT                   /protein_id="CAE36887.1"
FT                   /translation="MLEFFQTLSWAAVFQIILIDILLGGDNAVVIALACRNLEPKQRMQ
FT                   GILWGTAGAIGLRVVLIAFALTLLTVPYLKIVGALLLWVGVKLLIPEDDAHGNIKGGTS
FT                   IAAAVKTIIIADFVMSLDNVIAIAGAAQGAAQEHQLGLVIFGLVVSVPIIIWGSTLVLK
FT                   LIDRFPMVVTFGAALLGWIAGGMLVTDVVVVERFGEVSGVAKIAAEVAGALLIVGLGRW
FT                   FARRKAAAAPQTARESA"
FT   misc_feature    join(298925..298993,299030..299098,299207..299275,
FT                   299312..299380,299408..299476,299495..299563)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPP1586 by TMHMM2.0 at aa 22-44, 57-79, 116-138, 151-173,
FT                   183-205 and 212-234"
FT   CDS_pept        complement(299793..301004)
FT                   /transl_table=11
FT                   /locus_tag="BPP1587"
FT                   /product="probable two-component response regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   two-component response regulator Pa3947 SWALL:Q9HX69
FT                   (EMBL:AE004813) (392 aa) fasta scores: E(): 1.8e-57, 44.83%
FT                   id in 397 aa, and to Ralstonia solanacearum probable
FT                   two-component response regulator transcription regulator
FT                   protein Rsc3387 or rs06101 SWALL:Q8XU07 (EMBL:AL646075)
FT                   (403 aa) fasta scores: E(): 2e-26, 32.39% id in 392 aa"
FT                   /db_xref="GOA:Q7WA10"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA10"
FT                   /protein_id="CAE36888.1"
FT                   /translation="MNLPDILVVEDHPAHRLVVVHALRALGYTRILEAADGNEALRRLN
FT                   EHGQVGIAICDIKMSGMDGAQFLRVAARRQLLGAVIISSDVSSDLIAAVLDMAALIGLR
FT                   VLGDLAKPLDAQRLKALLDRHEAERQRARANAAPTASRQPPAPPAREVARALAAGQIVP
FT                   YFQPKVDLLTLRPCGAEVLARWRHPDLGVLGPASFLEALKEQDLLDRLIWHLTDAALGQ
FT                   ARLLATAGATQDLALNFETSQLGSAELLPTLAQALRKHALPASIVTIEVTENGLLDAPA
FT                   ATLENLVRLRLMGCTVSIDDFGTGFSSMQRLCHLPFNQLKIDASFVRRLPGDARSESVV
FT                   AATLAMAERLGITVVAEDIENPPQHQALLQLHCRQGQGYLFARPMSGPDYARWLDGAAS
FT                   AAAG"
FT   misc_feature    complement(299838..300563)
FT                   /note="HMMPfam hit to PF00563, EAL domain, score 2.9e-72"
FT   misc_feature    complement(300615..300995)
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 5.6e-12"
FT   CDS_pept        301318..301827
FT                   /transl_table=11
FT                   /locus_tag="BPP1588"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium leguminosarum hypothetical 14.7
FT                   kDa protein SWALL:Q9AE37 (EMBL:AJ310723) (135 aa) fasta
FT                   scores: E(): 0.0057, 28.82% id in 111 aa, and to Rhizobium
FT                   meliloti hypothetical protein R02424 or Smc01516
FT                   SWALL:Q92N19 (EMBL:AL591790) (137 aa) fasta scores: E():
FT                   0.0024, 33.67% id in 98 aa"
FT                   /db_xref="InterPro:IPR016772"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA09"
FT                   /protein_id="CAE36889.1"
FT                   /translation="MVLRGALVAQTSALAWAREDRAALEASLPGLPRRRVLARRLDFLM
FT                   ERVQSLLRARSGGTPGPALMVDASAKSVLCVGAGGAAARAARAAIERAGGRFLHHDGEV
FT                   GDAAGLEASLVSADLVICQTGCVSHGAYWRVQDHCKRTGKQCVLVEQPAALNIVRVRRP
FT                   ADAPQD"
FT   CDS_pept        301954..302745
FT                   /transl_table=11
FT                   /locus_tag="BPP1589"
FT                   /product="putative transmembrane regulator"
FT                   /note="Similar to Pseudomonas fluorescens transmembrane
FT                   regulator PrtR SWALL:Q9KIN0 (EMBL:AF228766) (242 aa) fasta
FT                   scores: E(): 0.0013, 31.12% id in 241 aa, and to Rhizobium
FT                   loti hypothetical protein Mlr0408 SWALL:Q98MW6
FT                   (EMBL:AP002994) (257 aa) fasta scores: E(): 2.1e-21, 39.04%
FT                   id in 251 aa"
FT                   /db_xref="GOA:Q7WA08"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA08"
FT                   /protein_id="CAE36890.1"
FT                   /translation="MKGGPADPIADVELDAYIDGQLDSARRADVEAFLARDARAAARVS
FT                   ADLRLRDALRQGATRHGAGARDAHTRALADRLQAAHARRRVARRARRLLAVAILVAAGW
FT                   AGHAALTAWTPAEPAGDAGVQVFLDEAMRAHRTAQLRAGMRSQPAAPRLDRAELARQAG
FT                   VPLPAWPWDWLPRDVQVFPSRGGPAVEVALLAGRAGPISLYGAPGGAGPDSAPRMARGA
FT                   GAEALFWWRRGAWVYAVIGALPEAALRPLAQRLADAPLVHE"
FT   misc_feature    302230..302298
FT                   /note="1 probable transmembrane helix predicted for BPP1589
FT                   by TMHMM2.0 at aa 113-135"
FT   CDS_pept        302939..303376
FT                   /transl_table=11
FT                   /locus_tag="BPP1590"
FT                   /product="putative universal stress protein"
FT                   /note="Similar to Brucella melitensis universal stress
FT                   protein family Bmeii0245 SWALL:Q8YDD2 (EMBL:AE009663) (148
FT                   aa) fasta scores: E(): 3.2e-18, 46.3% id in 149 aa, and to
FT                   Agrobacterium tumefaciens hypothetical protein Atu0496 or
FT                   Agr_c_878 SWALL:Q8UI04 (EMBL:AE009019) (160 aa) fasta
FT                   scores: E(): 9.1e-19, 48.96% id in 145 aa"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA07"
FT                   /protein_id="CAE36891.1"
FT                   /translation="MYQHILIPIDGSDLANTAIDKGLALAKALGARVTVLTVVEPYPHM
FT                   AAEAVQLGGLRKEYEKQVHARASEWLEPAGAKAAAAGVPCELLKRDADMAFRAIVETAA
FT                   ERGCDLIAMASHGRGGVAAVLLGSQTQKVLAHSQVPVLVYR"
FT   misc_feature    302939..303370
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 7.4e-14"
FT   CDS_pept        303477..304466
FT                   /transl_table=11
FT                   /gene="astE"
FT                   /gene_synonym="aruE"
FT                   /locus_tag="BPP1591"
FT                   /product="putative succinylglutamate desuccinylase"
FT                   /EC_number="3.1.-.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1176"
FT                   /db_xref="GOA:Q7WA06"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA06"
FT                   /protein_id="CAE36892.1"
FT                   /translation="MNTPTPVSTDYLRAHQFLGLQPGPRLLVLGAVHGNEVCGTRAIER
FT                   ILAELESGALAITRGQLTLLPVTNPLAYRKGERQGDRNLNRNLRVCATPTDYEDRIGNA
FT                   LCPLLQAHDVLLDLHSFHTGGQPFAMLGPRDNQEALEPFAHAREEARLVAHLGPRRVVE
FT                   GWMQAYERGVRRRREQNPGAPAALLDAAYGVGSTEYFRAHGGYGVTLECGQHDDPAAPE
FT                   VAYRAIRQTLALLGLADIALEPPRRDFETLCLVDVVDREADGDAFARPWASFDPVRQGE
FT                   LVGTRADGRQVLAPRDGYVVFPNPRALAGNEWFYFAVASDRLGEDAGN"
FT   CDS_pept        304550..304918
FT                   /transl_table=11
FT                   /locus_tag="BPP1592"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1175"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA05"
FT                   /protein_id="CAE36893.1"
FT                   /translation="MSKSIVLTLAAVALATQAGLAQAQYVGPSSNQQMSVKELLDTARD
FT                   DAVVTLRGKLVKQLSDDTYLLDDGTGRVQVEIDRHLFPPNQPVDANTLVEVSGEFDKEV
FT                   IGTSEVEVKALRILGAAK"
FT   misc_feature    304550..304618
FT                   /note="Signal peptide predicted for BPP1592 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.656 between residues 23 and 24"
FT   CDS_pept        complement(304884..305603)
FT                   /transl_table=11
FT                   /locus_tag="BPP1593"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1174"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA04"
FT                   /protein_id="CAE36894.1"
FT                   /translation="MGRRARRPGSGRRFFGHGGYDPRHGDLIRLPLHFYKFPAAELPGA
FT                   RPGPTLYRLASEHAMEIAALTWSTPLARLAPVPPRTSAAPPSHDWPHAAPSVRPHGAAG
FT                   PAAAPADLLRDLHAQARMARAVAAYQAEQAARQTAARSPCAAQGLGDIDCLMVLQAYRV
FT                   AMPMRRCRTCRECRPRRNAAARPWARSRGPALPISKYVDKSGSYRQKLRNNLKKRDAAC
FT                   KQPTVAAIWPRRGCAAP"
FT   CDS_pept        305672..307264
FT                   /transl_table=11
FT                   /locus_tag="BPP1594"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1172"
FT                   /db_xref="GOA:Q7WA03"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA03"
FT                   /protein_id="CAE36895.1"
FT                   /translation="MPMPFEWMTDPTAWLGLATLIVLEIVLGIDNLVFIAILADKLPAH
FT                   QRNRARMIGLTLALLMRLGLLASIAWVVTLTAPLFTVWGAQISGRDLILILGGLFLLFK
FT                   GTMELHERVEGNAHAGGGGRTQYAAFWQVIVQIVALDAVFSLDSVITAVGMVQDLSIMM
FT                   TAVVVAMIVMMVASRPLMAFVARHPTVVILCLGLLLMIGFSLVAEGLGFDVPKGYLYAA
FT                   IGFSILVEACNQLARRNLARGAHALGRRQRAAHAVLRLLQAGREGRAHPEEVAALVADT
FT                   GEGPLFAPEESTMIERVLAMGERDVRSIMVPRADMVWLDVRDPRHVVLEKFALGHARLP
FT                   LCAGDPGNVLGVVHLRDLLPRLSAPGPVDLVDAARPAAYVSETTPIPQLLQQMRDLRQH
FT                   LLLVVDEHGVCVGLATPLDVLTAVAGELPDAGDADPPSASRLPDGGWSLDGRLAVEEVA
FT                   RLLQAPDLRRDYPDATLAGCLLRASGAIPEEGQGMDWRQWRFEVERRVGPRIERVRATR
FT                   RVEALADELAGPA"
FT   misc_feature    join(305714..305782,305828..305896,305909..305977,
FT                   306071..306139,306152..306220,306239..306307)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPP1594 by TMHMM2.0 at aa 15-37, 53-75, 80-102, 134-156,
FT                   161-183 and 190-212"
FT   misc_feature    306599..306760
FT                   /note="HMMPfam hit to PF00571, CBS domain, score 1.9e-05"
FT   misc_feature    306782..306943
FT                   /note="HMMPfam hit to PF00571, CBS domain, score 1.9e-06"
FT   misc_feature    306986..307228
FT                   /note="HMMPfam hit to PF03471, Transporter associated
FT                   domain, score 7.3e-11"
FT   CDS_pept        complement(307279..307857)
FT                   /transl_table=11
FT                   /locus_tag="BPP1595"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1171"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA02"
FT                   /protein_id="CAE36896.1"
FT                   /translation="MSLIEIRKRTLIVETTYHENGPAPAQPLKLAASCAVIRNPYAGRY
FT                   EPDLMPFMAELRSLGTLLATELVDTLGKDNIEVYSKAAIVGVDGEMEHGAVWHEAGGWA
FT                   MRSVLGEPKAMVPAVKAVATAGYRMMVPVHYIHASYVRSHFNSIEIGIQDAPRPREILF
FT                   ALVMGTGARVHARLGGLTKEAVSVHDGQR"
FT   CDS_pept        complement(307882..308835)
FT                   /transl_table=11
FT                   /locus_tag="BPP1596"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1170"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA01"
FT                   /protein_id="CAE36897.1"
FT                   /translation="MFKPLFATAALALAIGQATAAYPERPIRMVVPFPPGSITDVVARS
FT                   LGQGMAAELGQPVVVENKPGANGIIGTQDVVKAQPDGYTLVVVGVSTAASGVSLFKNLP
FT                   YDPARDLTPIGAVAETPYLLVGGQDVAGKTVADLYDYGRQHPDKLTYAYGSGSAQVFGA
FT                   KLAAMGDITVTPVPYRGGPQALTDVIGGTVDLTFTDLANGLQQARAGKVKVYGVSTPGR
FT                   FALTPDIPTLNESGAPGFDLTVWFGLMGPAGLPPAVTERLAGALDKALAAPELTQTYAR
FT                   QGLSVKTQGPAAFGAFVRSEIEKWAGIVKETGIAPQ"
FT   misc_feature    complement(307894..308712)
FT                   /note="HMMPfam hit to PF03401, Uncharacterized protein
FT                   family, UPF0065, score 5e-82"
FT   misc_feature    complement(308434..308457)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(308776..308835)
FT                   /note="Signal peptide predicted for BPP1596 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.904 between residues 20 and 21"
FT   CDS_pept        complement(308875..309792)
FT                   /transl_table=11
FT                   /locus_tag="BPP1597"
FT                   /product="putative oxidoreductase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1169"
FT                   /db_xref="GOA:Q7WA00"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA00"
FT                   /protein_id="CAE36898.1"
FT                   /translation="MMQTLGFVGLGMMGLPMLENLAGDERWQILAYDRSPAPFERLAGH
FT                   PAWGKRLRAAAGLQELAACDAVITMLPNSAITNAVVLGGDGQPGLIDLLESGAAIVDMG
FT                   SSNPADTRLLSEQLAARGLTLIDAPVSGAVAKASTGTLAIMAGAAEADLRRVRPILERM
FT                   GAAIIHTGAVGSAHAMKALNNYVYAAGLLAVSEAMVIARRMELDLEVFTDVLNASSGRN
FT                   VASETKLRQFIIPGTYNGGFALALMAKDLGTAQSLQALTGVQADQLALCAELWRQALAQ
FT                   LPGGADNTEIHRFLAQRTPATEPA"
FT   misc_feature    complement(309268..309789)
FT                   /note="HMMPfam hit to PF03446, NAD binding domain of
FT                   6-phosphogluconate dehydrogenase, score 1.1e-05"
FT   CDS_pept        join(309914..310612,310615..310842)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP1598"
FT                   /product="LysR-family transcriptional regulator
FT                   (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1168"
FT                   /db_xref="PSEUDO:CAE36899.1"
FT   misc_feature    309947..310126
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 4.5e-19"
FT   misc_feature    join(310196..310612,310615..310818)
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 3.9e-40"
FT   variation       310613..310614
FT                   /note="CG in parapertussis; (-) in pertussis"
FT   CDS_pept        complement(310850..311596)
FT                   /transl_table=11
FT                   /locus_tag="BPP1599"
FT                   /product="putative adolase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1167"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Z9"
FT                   /protein_id="CAE36900.1"
FT                   /translation="MPPSAPTDSARSLYQDTAVAALRDDLALALRAAAHHGLGEGVCNH
FT                   FSVALPGQAGAFLLNPRGLMWSEVRAEDIVLVDAAGNKLAGRHEVEPTAMFIHAAIHQV
FT                   AGKACVLHTHMPYATALTLTEARMLDTTLSQNAMRFHGRVAADRRYNGLALDAAEGERI
FT                   ARAMDGADIAFLGNHGVVVCGERIDYAFDDLYYLERACCAQVLAESTGRPLVPVDAALA
FT                   ASVAGQARSERLQSTLFFEALRRALG"
FT   misc_feature    complement(310892..311539)
FT                   /note="HMMPfam hit to PF00596, Class II Aldolase and
FT                   Adducin N-terminal domain, score 8.8e-07"
FT   CDS_pept        311957..312862
FT                   /transl_table=11
FT                   /gene="ldcA"
FT                   /locus_tag="BPP1600"
FT                   /product="putative muramoyltetrapeptide carboxypeptidase"
FT                   /EC_number="3.4.17.13"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1166"
FT                   /db_xref="GOA:Q7W9Z8"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Z8"
FT                   /protein_id="CAE36901.1"
FT                   /translation="MAPASAIAGAADEAAEWLLERGYEPQVMPAARARLAPPFDYLAGD
FT                   DAARLADLHAAFADPAVGAVWCLQGGFGSWRVLDQIDYGLLRRHAKPFIGYSDVTALHL
FT                   AIQRYAGFVTFHGPMLAQDLLAGRQAPTEQALLDMVSGRLGAGSWIAAPPQARLATLAS
FT                   GVATGRLIGGNLALLAALTGTRYAIDARDGILFFEDVNEALPRVDRMLAQLRRAGAFDG
FT                   VRGVLVGSFTRLLGVPGDGEAAQAALYPLVREHFQARGIPVLAGWPSGHGDPNLTLPLG
FT                   ARVTLDAGRGALRLEQPVAV"
FT   misc_feature    312155..312844
FT                   /note="HMMPfam hit to PF02016, Uncharacterized protein
FT                   family UPF0094, score 1.5e-61"
FT   CDS_pept        complement(312938..313060)
FT                   /transl_table=11
FT                   /locus_tag="BPP1601"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1165A"
FT                   /db_xref="GOA:Q7W9Z7"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Z7"
FT                   /protein_id="CAE36902.1"
FT                   /translation="MLLTLYFLAWPVVSAAVLLVLIVTLWRDIRDARATGKSMI"
FT   misc_feature    complement(312983..313048)
FT                   /note="1 probable transmembrane helix predicted for BPP1601
FT                   by TMHMM2.0 at aa 4-26"
FT   CDS_pept        complement(313089..314987)
FT                   /transl_table=11
FT                   /locus_tag="BPP1602"
FT                   /product="sodium/solute symporter"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1165"
FT                   /db_xref="GOA:Q7W9Z6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Z6"
FT                   /protein_id="CAE36903.1"
FT                   /translation="MCLDACLTPDLADRDPVGRACDRAYVIDRPVFRSAMGNCRPSHFR
FT                   GNGTHAAMNGESCAQRGKRTHKMQESEFFQLSGTTAVLLLVAFYGATFLMSLMIGQKKE
FT                   NVDGYMVSNSSVGFGLSAASMIATWIWAASFYASATSGFKYGLSGPIHYGFWGALMILF
FT                   IYPFGKRFRQLAPKAHTLAEVIHARHGASSQMIMAVSNIVGSCISLMVNFTAAGALVSV
FT                   LSPLSFIQGVLIAGLGVLSYTLWSGFRASVMTDFAQLVAMILAAVIIIPLIFFNAGGPD
FT                   MLQANMWRLSSEQADFFSTTAILEQGAPYFVAVLAYAIGNQTIAQRLFAVREDLIKPTF
FT                   LTATIGYGAVVIGLGMLGLLALFVGLEPVNGNMNNIIPQMASTYLPPVGIALFFILVVG
FT                   SLSSTADSDLAALSAIVMTDIYAKNLAGGRPDPRRMLWWGRATMIVATMVGVIFASLRL
FT                   DILVMLVFVGALWGAIVFPVIASFYWDRVSNSAFFWSVISAVVLFTIVRFELVPIEGAV
FT                   AVFYEICAAIGGGVVIGLMSFAFFGRVTALTLGTLATLFLLPCFVGTLREYIVLLGSLT
FT                   AYGVSTVVCVALSLRNQERFDFSLLAERVTSFHYEKARMMGAKPAAPAAQPQPARG"
FT   misc_feature    complement(join(313218..313283,313299..313349,
FT                   313371..313436,313449..313514,313536..313601,
FT                   313614..313679,313794..313859,313905..313970,
FT                   314031..314096,314157..314222,314244..314309,
FT                   314328..314393,314487..314552,314583..314648,
FT                   314688..314753))
FT                   /note="15 probable transmembrane helices predicted for
FT                   BPP1602 by TMHMM2.0 at aa 78-100, 113-135, 145-167,
FT                   198-220, 226-248, 255-277, 297-319, 339-361, 376-398,
FT                   436-458, 462-484, 491-513, 517-539, 546-563 and 568-590"
FT   misc_feature    complement(313491..314663)
FT                   /note="HMMPfam hit to PF00474, Sodium:solute symporter
FT                   family, score 1.5e-06"
FT   CDS_pept        complement(315221..316666)
FT                   /transl_table=11
FT                   /locus_tag="BPP1603"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1164"
FT                   /db_xref="GOA:Q7W9Z5"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Z5"
FT                   /protein_id="CAE36904.1"
FT                   /translation="MPPSRHLPPITALLSFRLNQLAQAGAGLPHPTRAIAVAAILINVF
FT                   MATLESAIANTALPAIAADLGVSEASSIWVISAYHLAMVAALLPIASLGEIIGHRRISM
FT                   AGLVLFTLASLACGLAPSLPWLIAGRLAQGVGAAGILGVALAMTRFVYPREQLGCGLGL
FT                   NALVVSLSLAAGPTAASLILSLGSWHWLFLINVPLGLALGVCALPPTPRSARRYDAVAG
FT                   LLCALFLALLVYTLNAYAHDVGAGGNTAYALATLAMLALLLRRQSGRGAPMLATDLLRR
FT                   PIFALSAAATLGAFAAQTLAFVALPFMLQSLLGYTQVQTGFLITPWPALAALSAASAGA
FT                   LSDRHPPGLLGGIGMAVLAAGLLSLVALPAAPDAFDLGWRMALCGAGFGFFQAPNMRAM
FT                   LADAPPERSGGASGMTSSSIMLGQSLGAALVAGLFTLRGAAAAPAALWLGVAFAVIAGI
FT                   ASLLRLRHAAAAGAGARLDLTRV"
FT   misc_feature    complement(join(315281..315346,315554..315619,
FT                   315641..315706,315752..315817,315878..315934,
FT                   315950..316006,316043..316108,316121..316186,
FT                   316208..316273,316286..316351,316373..316438,
FT                   316484..316549))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BPP1603 by TMHMM2.0 at aa 39-61, 76-98, 105-127, 131-153,
FT                   160-182, 186-208, 220-239, 244-263, 283-305, 320-342,
FT                   349-371 and 440-462"
FT   misc_feature    complement(316595..316666)
FT                   /note="Signal peptide predicted for BPP1603 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.798) with cleavage site
FT                   probability 0.491 between residues 24 and 25"
FT   CDS_pept        complement(316820..317728)
FT                   /transl_table=11
FT                   /locus_tag="BPP1604"
FT                   /product="probable short-chain dehydrogenase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1163"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Z4"
FT                   /protein_id="CAE36905.1"
FT                   /translation="MTGAAPTILPAVPARGDDRPALAGENVPRIEPTPANLATGARSMN
FT                   QVATQSSLAGRTALVTGASRGIGRAIALALGRCGATVAVHYNAAREQADEVVQAIGAAG
FT                   GRAWALRADLAHPDGAGALARDLRASLREQTGDEGLDILVNNAGVSLRARLPEVSPQDF
FT                   DRIIQVNLKTPFFLIQHLLPLLRDGGRIVNVSSMGTRAAYPEMSVYAPAKAGLEALTLL
FT                   LASDLGARGITVNAVLPGATATDMNTRARDPAMADALARDIALGRVGQPEDIADIVAFL
FT                   ASDQARWITGQRIDATGGQRL"
FT   misc_feature    complement(316829..317569)
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 2.7e-71"
FT   CDS_pept        complement(317725..318609)
FT                   /transl_table=11
FT                   /locus_tag="BPP1605"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1162"
FT                   /db_xref="GOA:Q7W9Z3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Z3"
FT                   /protein_id="CAE36906.1"
FT                   /translation="MFMDMRFLHSFVTVAESGSIADAARRLGLAPTTLAQQIRALEADL
FT                   GSRLLTRAGRTVRPTVAGARIVDRARELLRGERDLRSAASDTGLPAGPMRLGATPTALM
FT                   GLVPPLLRRWMRAHPDIQIYIEPGTSSVLLERVMAGQLDAAILVHPNFELHKTCAWSLI
FT                   REERLVLLAPSALRVGNALRVAAREPFIQYDRKVVAGKMADEYLRAHGVRPKVQFELDG
FT                   IEHISALVAEGFGVSVLPDWPTLGPADARVRRWPLPDPCPSRQVGMVWLRSSVRSPLAQ
FT                   AFHAYLGAAAGAP"
FT   misc_feature    complement(317734..318351)
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 8.3e-40"
FT   misc_feature    complement(318418..318597)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 1.1e-17"
FT   misc_feature    complement(318463..318555)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   CDS_pept        318709..319833
FT                   /transl_table=11
FT                   /locus_tag="BPP1606"
FT                   /product="putative racemase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1161"
FT                   /db_xref="GOA:Q7W9Z2"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Z2"
FT                   /protein_id="CAE36907.1"
FT                   /translation="MAIIKSIEVCVARVPMDKVTYLSNRTVVDRHYGLVKVRSADGVEG
FT                   IGFCYVGNQAGEIFRVAVEQLLGPVLIGRDSLAVEGLWREMYQEALLQGRMGTVMRALS
FT                   ALDIALWDLNARAANLPLHKYLGAVELDSVAAYASGGYYVEGKTAGQLGEEMASYVELG
FT                   FKAVKMKTGRWSPQGEQSRVRAAREAIGEDVELMLDCNNGWVDTVQAMEYLRRMEPYNP
FT                   YFIEEPFSPDDVESHARLARLTRIPVATAEIGYGRWYHKQLLDMGAAAILQTDAAVCGG
FT                   ITEWKRIAAMAAGYGIQMCPHWFHDVHAPLAAATPNARYVEFFWDDQVLNFRRLVDRQL
FT                   EHKDGRVILHQTPGLGFGFDENAVARYGRWTTES"
FT   misc_feature    318721..319089
FT                   /note="HMMPfam hit to PF02746, Mandelate racemase /
FT                   muconate lactonizing enzyme, N-terminal domain, score
FT                   7.6e-19"
FT   misc_feature    318925..318966
FT                   /note="PS00213 Lipocalin signature."
FT   misc_feature    319102..319812
FT                   /note="HMMPfam hit to PF01188, Mandelate racemase /
FT                   muconate lactonizing enzyme, C-terminal domain, score
FT                   2.7e-23"
FT   misc_feature    319129..319152
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        319879..320844
FT                   /transl_table=11
FT                   /locus_tag="BPP1607"
FT                   /product="putative lipoprotein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1160"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Z1"
FT                   /protein_id="CAE36908.1"
FT                   /translation="MMKLRAACALAAALACGAVLAQDLGGKPLTLVVPFAPGGNADIVA
FT                   RSYAVPMARLIGATVVVDNRGGGGGGAIGTAIVAKAPADGSTLLSATPGQLGTLPHMFK
FT                   TGYKSADFVPVGVVSKTSIALVVKHDDARFKTTEEFIAYARRNPGRLNVGHAGPGSPNH
FT                   LAMLQFENATGTRFTPIAYKGSGPALIDLLSGQIDVIFDQVSSSLPHLKAGKLSALLIL
FT                   GPTRDPSIGQVRTLKEAGLPEFDASTYIGVLAPKGVPAETVAKLTSVIRQVADDPAFDS
FT                   KLREIGSGAFYADPADFARILQADEDLAKAMIQQGRLIDG"
FT   misc_feature    319879..319941
FT                   /note="Signal peptide predicted for BPP1607 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 21 and 22"
FT   misc_feature    319894..319926
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    320008..320832
FT                   /note="HMMPfam hit to PF03401, Uncharacterized protein
FT                   family, UPF0065, score 6.6e-65"
FT   CDS_pept        320837..321691
FT                   /transl_table=11
FT                   /locus_tag="BPP1608"
FT                   /product="putative 2-pyrone-4,6-dicarboxylic acid
FT                   hydrolase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1159"
FT                   /db_xref="GOA:Q7W9Z0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Z0"
FT                   /protein_id="CAE36909.1"
FT                   /translation="MVERARLAEGGGWDCHFHVFDASRYTLAAGSAYQPEDASLAAFRG
FT                   VCRARGIGRAVLVHPSVYGADHSSYEDALAANGDWLRGVAVVYPDEATTPDARIEHWDL
FT                   LGTAGTRINRLFPGAPQHPERIVERVKPFGWHVQVLTDIVEDIGLVRRIAARDVPVVVD
FT                   HFGHHPHAQLLRSAGWQDLLALVREGAAWVKLSAPYRVGAQGPAWPGAQALVDQLVQAN
FT                   PRQLVWGSDWPHPPDHRHPFPAPDQAAIGATIAQWLPDAQLRRQVMELNPLRLYGGTRA
FT                   AGR"
FT   CDS_pept        321797..322207
FT                   /transl_table=11
FT                   /locus_tag="BPP1609"
FT                   /product="putative dioxygenase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1158"
FT                   /db_xref="GOA:Q7W9Y9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Y9"
FT                   /protein_id="CAE36910.1"
FT                   /translation="MFSHVTVGVSDLARAGRFYDALLQPLGLRQRQTQPDGGPPSLCWV
FT                   RAGTSLPRFFAYMPFNGRPPSPGNGAMVAFLAQTPEQVDRAHAAGLAAGGSDEGAPGPR
FT                   ARYGPGYYGAYLRDPDGNKLHVVHRSGPAAAG"
FT   CDS_pept        complement(322204..323154)
FT                   /transl_table=11
FT                   /locus_tag="BPP1610"
FT                   /product="transposase for IS1002"
FT                   /note="transposase for IS1002 element"
FT                   /db_xref="GOA:Q7TT87"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TT87"
FT                   /protein_id="CAE36911.1"
FT                   /translation="MNNHKHARLTRLGRALLVNRVMQQNWTMRQASQAAGVSLRTGYKW
FT                   LARFRSEGLDGLLDRSSRPHRSPKACAPEQVEHFAQQRRQRLPLWRIAREAGRSLATVA
FT                   RYMERIGLSRLASLEPPAPVRRYERASPGELLHIDTKRLGRIRGVGHRITGDRAQNRNR
FT                   GIGWDAVHLAIDDFSRVSFARILDDEGGDQCAEFLRQATAYYASLGVRIDRVMTDNGSG
FT                   YVSRTFRAVCVELGIRHIRTRPYTPKTNGKAERLVQTCLREWAYARPYTSSAERQAALQ
FT                   PFIDRYNWCRPHSALGHQPPITRIPDVNNLLRIDT"
FT   repeat_region   322204..322232
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS1002 element"
FT   repeat_region   complement(322204..323244)
FT                   /note="IS1002 insertion sequence"
FT   misc_feature    complement(322237..322773)
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   6.8e-30"
FT   repeat_region   complement(323216..323244)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS1002 element"
FT   CDS_pept        complement(323241..323579)
FT                   /transl_table=11
FT                   /gene="csaA"
FT                   /locus_tag="BPP1611"
FT                   /product="protein secretion chaperone"
FT                   /note="Similar to Bacillus subtilis CsaA protein
FT                   SWALL:CSAA_BACSU (SWALL:P37584) (110 aa) fasta scores: E():
FT                   1.1e-19, 53.15% id in 111 aa, and to Brucella melitensis
FT                   protein secretion chaperonin CsaA Bmei0491 SWALL:Q8YIF3
FT                   (EMBL:AE009491) (115 aa) fasta scores: E(): 1.4e-24, 58.71%
FT                   id in 109 aa"
FT                   /db_xref="GOA:Q7W9Y8"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR008231"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Y8"
FT                   /protein_id="CAE36912.1"
FT                   /translation="MQLIDWTDFAKVELRVGRIVQALPFPEARKPAYILHVDFGAEIGV
FT                   KKSSAQVTHLYQPETLLGRLVVAVVNFPKKQIGPLQSECLVTGFHNAQGEVALCVPDRD
FT                   VPLGTKLL"
FT   misc_feature    complement(323250..323540)
FT                   /note="HMMPfam hit to PF01588, Putative tRNA binding
FT                   domain, score 2.4e-15"
FT   CDS_pept        323969..325543
FT                   /transl_table=11
FT                   /locus_tag="BPP1612"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Brucella melitensis Rtn protein Bmeii0904
FT                   SWALL:Q8YBJ6 (EMBL:AE009724) (530 aa) fasta scores: E():
FT                   2.3e-43, 31.21% id in 519 aa, and to Xylella fastidiosa
FT                   hypothetical protein Xf0470 SWALL:Q9PG32 (EMBL:AE003897)
FT                   (530 aa) fasta scores: E(): 3.6e-41, 31.55% id in 526 aa"
FT                   /db_xref="GOA:Q7W9Y7"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Y7"
FT                   /protein_id="CAE36913.1"
FT                   /translation="MYFPLRKALLTGLWTAAALGAVIGPSLLAVDMVREYGLRQQREQA
FT                   QVLAQRLLGRIGLTADRLLRIHRELVHTGGSSPCAPYSTYLMQQQVLRFPDVRAVAYVE
FT                   EGRVLCSSLGDTVTGVDLGPSDFTTGNRISVWNSAVLPAAPETPFRVFAKEGYAIIMER
FT                   ESTNQLGGAVPQAMAAVSFSGTPDDAIVWGELPRAWFKRARESNAFVDDKYVVAVQRST
FT                   AQGLVALGAVASSQGAEALQRLAILLVPLSAAAGLGLLVGAVILARRQFSLPQLIRSGL
FT                   RRNEFYMVYQPMVEVGTGRCVGAEALIRWRRRNGDLIAPDVFIDEAERVGLIGKITERV
FT                   FELVSSDVQRWRGRLGDLYISINVSAADMASGAAERLLSEMFARTGLTPSQVVVELTER
FT                   ALLHSDEAVAAIKIIRKMGGRVAIDDFGTGYSSLAYLTSFEVDGLKIDKRFVDAIGRDA
FT                   PSSSVSVHIIEMAKSLGLRVVAEGVETAGQQRFLSEHGVDYAQGWLFGRPMPLNELLAM
FT                   ARRPPPG"
FT   misc_feature    join(323990..324058,324698..324766)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP1612 by TMHMM2.0 at aa 91-113 and 327-349"
FT   misc_feature    324773..325507
FT                   /note="HMMPfam hit to PF00563, EAL domain, score 1.3e-94"
FT   CDS_pept        325703..327361
FT                   /transl_table=11
FT                   /locus_tag="BPP1613"
FT                   /product="probable methyl-accepting chemotaxis protein"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   methyl-accepting chemotaxis transducer transmembrane
FT                   protein Rsp0255 or Rs03711 SWALL:Q8XT60 (EMBL:AL646077)
FT                   (529 aa) fasta scores: E(): 1.7e-67, 44.15% id in 530 aa,
FT                   and to Yersinia pestis putative methyl-accepting chemotaxis
FT                   protein Ypo1644 SWALL:Q8ZFP9 (EMBL:AJ414149) (526 aa) fasta
FT                   scores: E(): 1.4e-56, 40.78% id in 532 aa"
FT                   /db_xref="GOA:Q7W9Y6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Y6"
FT                   /protein_id="CAE36914.1"
FT                   /translation="MRRNLPVTGHEFVLQDDQYLISKTDLKGRITYCNPAFIAISGFSR
FT                   EELLGQPHNIVRHPDMPEDVFADMWATLQARKPWLAVVKNRHKSGGFYWVLANAMPVIE
FT                   AGNVTGYASVRVKATQAQIEAAEHFYAQVESGRMGGHGLRHGQRVPRGWRRAARALAFP
FT                   LRKGVRPALLRLAAAMCGLAAIPTYFAIGAMPPEAAPYGWGAYALGALGAVLAAMALGG
FT                   RFGRQLRNAEEVARQIAAGNLVNEVDSGVGGEMRNLYFYLDIMRKSLIGISTEVIGKTS
FT                   EHVHTISRLREDSQGLAARTEAQSAALQDTASSVEQLAETVTRNAESAGVAARLTQESS
FT                   EVAAQGGAVVGELVATMQGLDASSRKMAEIVSVIEGIAFQTNILALNAAVEAARAGEQG
FT                   KGFAVVAAEVRSLAQRTAQAAKEVKVLIDDSVGRMSTGSAQAGRAGETMRELVQSVERV
FT                   TALMAEISTASGEQSTGVAQISSAVHRMEEVVQQNVSMVGELTHVAEHLGQESGSLVEA
FT                   IGVFRTPGAGARAIGMPEQAPRRAPARTLLLAEHP"
FT   misc_feature    join(326210..326278,326297..326365)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP1613 by TMHMM2.0 at aa 203-225 and 232-254"
FT   misc_feature    326309..326515
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 0.00016"
FT   misc_feature    326576..327274
FT                   /note="HMMPfam hit to PF00015, Methyl-accepting chemotaxis
FT                   protein (MCP) signaling domain, score 1.8e-75"
FT   CDS_pept        327710..329137
FT                   /transl_table=11
FT                   /locus_tag="BPP1614"
FT                   /product="putative membrane protein"
FT                   /note="The C-terminal region of this CDS is similar to the
FT                   C-terminal regions of many including Ralstonia solanacearum
FT                   probable transmembrane protein Rsc0375 or Rs03343
FT                   SWALL:Q8Y2G1 (EMBL:AL646058) (972 aa) fasta scores: E():
FT                   3.7e-20, 34.85% id in 307 aa, and to Anabaena sp.
FT                   hypothetical protein Alr3170 SWALL:Q8YSB9 (EMBL:AP003592)
FT                   (1021 aa) fasta scores: E(): 9.4e-20, 30.6% id in 366 aa"
FT                   /db_xref="GOA:Q7W9Y5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Y5"
FT                   /protein_id="CAE36915.1"
FT                   /translation="MAISDANRGGAPGAAPGPDPAHILHELAGLMAISPGRDFLDELVN
FT                   RAVQRLGVDYAWVVLHGAKGEHARTVLSANCRMRWNGAESYLATGQSALAGVLSHATQY
FT                   VCARDLERHVPGDLALRRLGAQACVAHALRDESGLQRGHVAFVFSEPLADPAIYVSALS
FT                   ACAAFTERAVLALDAERKARQEALQLASRYQALFEKAPVLINAFDARGKCILWNLECER
FT                   KFGWSMEEVNNHPEPLALFYPDPQTRARVVASVSQAPGRAFEEWHPVTRAGKVLSTLWS
FT                   NIVLESGTIVNIGLDITERKRAELALTRLATIDSLTDCWNRAEILKILRQEITRLRQHP
FT                   DQPLAVVMLDLDHFKQLNDLHGHLVGDAALRYFSDQLRSNLRGTDFVGRIGGEEFLALL
FT                   PGCDGDAALAMADRLRAALRNDPFTTEGQAAPLSVSVGIAFATPEDTAVSDVMRRADTA
FT                   LYEAKRRGRDRAVVYFG"
FT   misc_feature    328628..329116
FT                   /note="HMMPfam hit to PF00990, GGDEF domain, score 1.2e-60"
FT   CDS_pept        329205..330176
FT                   /transl_table=11
FT                   /locus_tag="BPP1615"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative membrane
FT                   transport protein Sc8f11.16C SWALL:Q9KZG2 (EMBL:AL353864)
FT                   (325 aa) fasta scores: E(): 6.2e-07, 30.03% id in 293 aa,
FT                   and to Pseudomonas aeruginosa probable Mfs transporter
FT                   Pa2701 SWALL:Q9I0E1 (EMBL:AE004698) (529 aa) fasta scores:
FT                   E(): 0.0055, 34.35% id in 195 aa"
FT                   /db_xref="GOA:Q7W9Y4"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Y4"
FT                   /protein_id="CAE36916.1"
FT                   /translation="MQRLQASLERRQVGIYFAAMALGAVLAWHRPGLQVGEATLNLMLA
FT                   GMLLATFMQVPLAGWRATLPGMRFLGVLLSVNFVLVPALVWGLAALLPADPMIRLAVLL
FT                   VLLAPCIDYVVTFAQLGRADARALLAATPVLLCGQMLLLPLYLNVMLGSDAAALIRPGP
FT                   FVQAFVWLIALPLAAATGVQWAAARSAAWRGAASVVGLLPVPATALVLATIVAAVAPRM
FT                   ALAGEAVSRVVPVYLLFAVIAPAAGWLAARRARLAAPQARAVAFSAGTRNSLVVLPLAL
FT                   AVPGGVPLLPALIVAQTLVELCAELLYVRVFGRAGKDRAGEG"
FT   misc_feature    join(329241..329300,329328..329396,329409..329477,
FT                   329490..329558,329577..329645,329688..329756,
FT                   329793..329861,329889..329957,330018..330086)
FT                   /note="9 probable transmembrane helices predicted for
FT                   BPP1615 by TMHMM2.0 at aa 13-32, 42-64, 69-91, 96-118,
FT                   125-147, 162-184, 197-219, 229-251 and 272-294"
FT   CDS_pept        complement(330189..330494)
FT                   /transl_table=11
FT                   /locus_tag="BPP1616"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Y3"
FT                   /protein_id="CAE36917.1"
FT                   /translation="MPAKDVPYQSMNLLCAILPEGNTSNRVGRRLADLLVQDAQGRLYR
FT                   VERHRIEGGHPDLVCGIDYIYCRLAGGGVVRCIDEQTYELPDGTVAHVVPDSTLRS"
FT   CDS_pept        331388..332863
FT                   /transl_table=11
FT                   /locus_tag="BPP1617"
FT                   /product="autotransporter"
FT                   /db_xref="GOA:Q7W9Y2"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Y2"
FT                   /protein_id="CAE36918.1"
FT                   /translation="MNPFHHAPRRRAAHIHVLLLSMSALLWLPAAQAQYWSPGAQAGPH
FT                   NVGTDGVFDEDEEPGPRPRPPLPKEDLEALEDLFGSGDTPPEPPPAPPSPGPMAPNVPE
FT                   DASPHLPDHAGGDAMPPASPPAPPEARPKQPEARPEALPEAPPQAQPEAPPVVPPPAEP
FT                   PAARPPAVPPARPAGDAVYLPGTRTLTPTANAAVGTASAAQGLWQAEMNALGKRMGELR
FT                   LTPAAGGVWGRAFTQRQKLDNGVAREFRQTVGGFELGADTALAAAEGRWHVGAVAGYSQ
FT                   GSLKFRHGGTGDDDSVHVGAYATYIGNSGFYLDGIVRVSRFSHEFKVHDTQGRRVRGQY
FT                   RGNGVGASLELGKRFTWPGAWYVEPQLEVAAFRAQGADYTASNGLRIKDDGTNSMLGRL
FT                   GLHVGRQFDLGDGRVVQPYMKLSWLQEFDGKNTVRTNGVRHKNRLDGGRAELDLGVAAQ
FT                   LGKHGSLYGSYEYAKGSRQTMPWTFHIGYRYTW"
FT   misc_feature    331643..332857
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF03212, Pertactin, score 2e-173"
FT   CDS_pept        333292..334851
FT                   /transl_table=11
FT                   /locus_tag="BPP1618"
FT                   /product="autotransporter"
FT                   /db_xref="GOA:Q7W9Y1"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Y1"
FT                   /protein_id="CAE36919.1"
FT                   /translation="MNRATPCRGAVRALALALLGAGMWTLSPASTWALELPPPLTDEEL
FT                   RLVLPTGGMSLDDFKRGLEQAAPGSVATPAPPLPKVPVPGPAPGASPGAGSSPPGGSDV
FT                   PGGASSSPGEKPPAVADQGKGQGNGAGGGQPPQAGAGGANGLPPGGADPKPPAAAGGDA
FT                   GPKPPEGDGGDEGPQRPQGGGEQGGGEQDAPEVPPVAPAPPADNGVYEPGTHTLSAPAS
FT                   AAVSLASSSHGVWQAEMNALSKRMGELRLTPVAGGVWGRAFGRRQDVDNRVAREFRQTI
FT                   SGFELGADTALPVADGRWHVGAVAGYTNGRIKFDRGGTGDDDSVHVGAYATYIEDGGFY
FT                   MDGIVRVSRIRHAFKVDDAKGRRVRGQYRGNGVGASLELGKRFTWPGAWYVEPQLEVAA
FT                   FRAQGADYTASNGLRIKDDGTNSMLGRLGLHVGRQFDLGDGRVVQPYMKLSWVQEFDGK
FT                   GTVRTNGVRHKNRLDGGRAELDLGVAAQLGKHGSLYGSYEYAKGSRQTMPWTFHIGYRY
FT                   AW"
FT   misc_feature    333292..333390
FT                   /note="Signal peptide predicted for BPP1618 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.983 between residues 33 and 34"
FT   misc_feature    333664..334845
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF03212, Pertactin, score 2.5e-195"
FT   CDS_pept        335145..335366
FT                   /transl_table=11
FT                   /locus_tag="BPP1619"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0892"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9Y0"
FT                   /protein_id="CAE36920.1"
FT                   /translation="MGDVMQRGELAHWLNVVAENGEPGAPQIPVPEQFVTALTTLRCIE
FT                   RNAQGQLVVTEKGRLALHMEEPGALHRQ"
FT   CDS_pept        335499..335738
FT                   /transl_table=11
FT                   /locus_tag="BPP1620"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0893"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9X9"
FT                   /protein_id="CAE36921.1"
FT                   /translation="MQVTDWEGAMQHRDQEVLIDVSTAAMDTGGYGVLLTVTAEGGTEV
FT                   DAAFSYLGTCASLDEARDRAEAFAQDWLRENIYR"
FT   CDS_pept        335858..336976
FT                   /transl_table=11
FT                   /gene="pmi"
FT                   /locus_tag="BPP1621"
FT                   /product="putative mannose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0894"
FT                   /db_xref="GOA:Q7W9X8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9X8"
FT                   /protein_id="CAE36922.1"
FT                   /translation="MSAASFHTDLPALVAQLRQHFNTVIVPLWLERGFDAGLGLPCEAL
FT                   DAHGAPLPAQRYRAMACARQLYVFSRTDGAAAAAHAERLFSSLLRYFQNAAHGGWRHSV
FT                   DAQGQPLDDTQDLYTHAFVVFACAAYFSRTRDARARKTLLATVDVIEQRFRTRQGLYVA
FT                   ALSADWAQVVRGPAQNPVMHLTEAYLAAAGVVEPAWFAQTLGRLTQDVASTFLYAPRLC
FT                   IAEEPLDQPPRFEPGHQFEWYSLLHGAPDLFGDLELGSALQRGCAWVRQHGVDAHSHGV
FT                   AAVLDESGAVRDATQRIWAQTEYARYLALSGQWPELATQLRAFQARFLHQDGWHECLDA
FT                   QGNVSRADMPSTTPYHLATCYAALEDALAGQG"
FT   CDS_pept        337073..337288
FT                   /transl_table=11
FT                   /locus_tag="BPP1622"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0895"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9X7"
FT                   /protein_id="CAE36923.1"
FT                   /translation="MSVMCPACQAINAGSSGVEPHPRLGHQGFTNPSQKGREANREDHF
FT                   RCIECGAKWLRETDRWGVDLGFRLAP"
FT   CDS_pept        337482..337733
FT                   /transl_table=11
FT                   /locus_tag="BPP1623"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0896"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9X6"
FT                   /protein_id="CAE36924.1"
FT                   /translation="MVQKVLNGFAVVAFATQPEHGMPPRAFIQTAPMDGAGQAEPQVFE
FT                   IFLARRFRSAVEAMSAARNALDRVVSVDQDGVPAPLPD"
FT   CDS_pept        complement(337743..338126)
FT                   /transl_table=11
FT                   /locus_tag="BPP1624"
FT                   /product="putative ferredoxin"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0898"
FT                   /db_xref="GOA:Q7W9X5"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9X5"
FT                   /protein_id="CAE36925.1"
FT                   /translation="MTDSTPAVRVCAAADLVDGGLGVKVPVTDGAGQASAFFVRYRGQV
FT                   YGYLNRCAHVGVELDWENSFFTRAGDLIMCARHGATYEPDTGLCIGGPCRNGRLTALQV
FT                   DERPDAGGMAVYWLPSGKIQPRG"
FT   misc_feature    complement(337800..338111)
FT                   /note="HMMPfam hit to PF00355, Rieske [2Fe-2S] domain,
FT                   score 7e-08"
FT   CDS_pept        complement(338181..339998)
FT                   /transl_table=11
FT                   /locus_tag="BPP1625"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0899"
FT                   /db_xref="GOA:Q7W9X4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9X4"
FT                   /protein_id="CAE36926.1"
FT                   /translation="MMPSPSPTPAGRNSLDTLRTLAPFLWPADRPGLKARVVIAILCLL
FT                   AAKAAVVYVPILYKSAVDQLGGGAPGAVTVPLGLILAYSAARVLSLLFSELRDAVFARV
FT                   GQHAIRAVGLQIFRHLHALALRFHLARQTGGLTRAIERGTKGIQTLLTFLLFNVLPTLF
FT                   EIGLVCAVLWKMFDGWLALATGATVTLYLAYTLVVTEWRTRFRRQMNETDSEANTKAVE
FT                   SLLNYETVKYFGNEEHEAQRYDASLRRYERAAVRSQVSLSILNIGQAVIISAGLTLVMW
FT                   MAARGIAQGRYTLGDFVLVNTYLLQLYDPLSFFGFIYREIKQALIDMERMFELLGEGRE
FT                   IADPPGALALRLEGGAVEFRDVYFGYDPRRPILKGVSFRIPAGKTVAVVGTSGAGKSTL
FT                   ARLLFRFYDADRGAILVDGQDVRGVTQASLRAAIGVVPEDTVLFNDTIHYNIAYGRPGA
FT                   SDGEVQAAARLAHIHDLIMAMPDGYRTMVGERGLKLSGGEKQRVAIARTLLKNPSIFLF
FT                   DEATSALDTHTEREIQANLREVSQGRSTLIIAHRLSTIADADEIIVLGDGRVVERGRHQ
FT                   ALLAQGGIYAGMWARQQEATRPAAVALDD"
FT   misc_feature    complement(338298..338852)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   5.8e-62"
FT   misc_feature    complement(338475..338519)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(338808..338831)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(339066..339890)
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region, score 2.3e-35"
FT   misc_feature    complement(join(339156..339221,339405..339470,
FT                   339483..339548,339717..339782,339828..339893))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BPP1625 by TMHMM2.0 at aa 35-57, 72-94, 150-172, 176-198
FT                   and 259-281"
FT   CDS_pept        340055..340972
FT                   /transl_table=11
FT                   /locus_tag="BPP1626"
FT                   /product="probable oxidoreductase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0900"
FT                   /db_xref="GOA:Q7W9X3"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9X3"
FT                   /protein_id="CAE36927.1"
FT                   /translation="MGHGVIIRENVLQECRIFHPVRFVNTREGFMAQVPVLKLNDGNAM
FT                   PQLGLGVWQVPNDQAAASVKAALAAGYRSIDTAAIYGNEAGVGEGLRAAGVARKDLFVT
FT                   TKLWNDRHGYDEAQRAMDESLRKLGLAYVDLFLIHWPVAGSDKFVDAWRAMVAMKEDGR
FT                   ARSIGVSNFTIANLRRLVDETGVVPAVNQVELHPGFAQRELRAFHAEQGIATESWSPLG
FT                   QGAVMHDATLAGIAARHGKSAAQVTLRWHLQNGLIVIPKSVTPARIQANIDVFDFELSA
FT                   DEMADIDALPEGPRLGPDPATFTG"
FT   misc_feature    340169..340936
FT                   /note="HMMPfam hit to PF00248, Aldo/keto reductase family,
FT                   score 1.2e-128"
FT   misc_feature    340265..340318
FT                   /note="PS00798 Aldo/keto reductase family signature 1."
FT   misc_feature    340517..340570
FT                   /note="PS00062 Aldo/keto reductase family signature 2."
FT   misc_feature    340829..340876
FT                   /note="PS00063 Aldo/keto reductase family putative active
FT                   site signature."
FT   CDS_pept        341018..341998
FT                   /transl_table=11
FT                   /locus_tag="BPP1627"
FT                   /product="putative oxidoreductase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0901"
FT                   /db_xref="GOA:Q7W9X2"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9X2"
FT                   /protein_id="CAE36928.1"
FT                   /translation="MEYVRLGSTGLKVSRLCLGCMTYGEPARGNHAWTLDETQSRPFFR
FT                   QALDAGINFFDTANSYSDGTSEEFLGRALREYVPRDEVVVATKVFFPLRKEPNSGGLSR
FT                   KAIMREIDASLRRLGTDYVDLYQIHRWDYDTPIEETLQALHDVVKAGKARYIGASSMHA
FT                   WQFAKALYLADRHGWTRFSTMQNHYNLLYREEEREMLKLCRAEGVGVLPWSPLARGRLT
FT                   RDWAEGSARADTDDVLKRLYSATEQADRGVIDAVGEVAAQRGVSRAQVAMAWLLRQPAV
FT                   TAPIVGASKPGHLEDAVAALALRLTDEEAARLEAAYAPHPVAGFA"
FT   misc_feature    341036..341977
FT                   /note="HMMPfam hit to PF00248, Aldo/keto reductase family,
FT                   score 7.4e-73"
FT   CDS_pept        complement(341995..342207)
FT                   /transl_table=11
FT                   /locus_tag="BPP1628"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0902"
FT                   /db_xref="GOA:Q7W9X1"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9X1"
FT                   /protein_id="CAE36929.1"
FT                   /translation="MTPRQHFYFVWGMPIVLGALSVFGLLAALLGTGVWHWASWLALAW
FT                   LLVVIARFWIVPRERRPAPGPRRGG"
FT   misc_feature    complement(join(342040..342105,342121..342186))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP1628 by TMHMM2.0 at aa 7-29 and 34-56"
FT   misc_feature    complement(342127..342207)
FT                   /note="Signal peptide predicted for BPP1628 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.903) with cleavage site
FT                   probability 0.651 between residues 27 and 28"
FT   CDS_pept        complement(342204..343385)
FT                   /transl_table=11
FT                   /locus_tag="BPP1629"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0903"
FT                   /db_xref="GOA:Q7W9X0"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9X0"
FT                   /protein_id="CAE36930.1"
FT                   /translation="MSTASTIKTWYLVHKWTSLVCTLFLLIICITGLPLVFHHEIEHLL
FT                   DEGKPVAQVAEGTPEASLDTIVARAHALYPDEYIDYVFLDDEEPQVYVGFTPKLGQAVE
FT                   AGHAVRVDARTGDILHDGPKYSADRFSFMGIMLALHVDLYAGLAGELFLGLMGLLFVIA
FT                   IVSGVVLYGPFMKKLDFGTVRASRSNRLKWLDLHNLLGIVTLVWAFVVGLTGVINELST
FT                   PLFRLWQQTELQAMTAPYQGKPVPRPAELSAPQRAADTALAAVPDRALTGISYPGNAFG
FT                   SPQHYIVWLKGNTPLTSKLNTPVLVDGKTGELAAVARMPWYLTVLELSRPLHFGDYGGM
FT                   PLKIIWALLDLITIVVLGSGLYLWLARRKATDARVAELVRRHQQAAEPQRTPA"
FT   misc_feature    complement(join(342288..342353,342732..342797,
FT                   342861..342926,343272..343337))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BPP1629 by TMHMM2.0 at aa 16-38, 153-175, 196-218 and
FT                   344-366"
FT   CDS_pept        343549..344283
FT                   /transl_table=11
FT                   /gene="pphA"
FT                   /gene_synonym="prpA"
FT                   /locus_tag="BPP1630"
FT                   /product="serine/threonine protein phosphatase 1"
FT                   /EC_number="3.1.3.16"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0904"
FT                   /db_xref="GOA:Q7W9W9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9W9"
FT                   /protein_id="CAE36931.1"
FT                   /translation="MAPNLQYPAFLRLPRNPAGRDFAVGDIHGHFSRLEQALDECGFDP
FT                   RRDRLFSVGDLIDRGPDSEAAVQWLAHPWFYAVQGNHEDYAIRHVRTGLVDQDNWRSYG
FT                   GGWFLDAAPERQRAWAGAFAALPVVIEVATQAGPVGLLHADCPVRDWSRLEYFLQARPK
FT                   RARSVCQWSRERLASGDARGVDGIRAVVAGHTPVSEPVVLGNVYHIDTQGWRPHGYFTL
FT                   LDLSTLSAWPRPAQAGAPAARG"
FT   misc_feature    343603..344142
FT                   /note="HMMPfam hit to PF00149, Calcineurin-like
FT                   phosphoesterase, score 3.4e-09"
FT   CDS_pept        complement(344285..346969)
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /gene_synonym="ponA"
FT                   /locus_tag="BPP1631"
FT                   /product="penicillin-binding protein 1A"
FT                   /EC_number="2.4.2.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0905"
FT                   /db_xref="GOA:Q7W9W8"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9W8"
FT                   /protein_id="CAE36932.1"
FT                   /translation="MHVWLRKPIPPDAGLWCSALESAPMNTSSQSTKPPPPGGPRLFRK
FT                   SLLIKAGVAVAGLGAAGALALGLALALAWPSLPELHAMTDYRPRVPLRVYTADGVLIGE
FT                   FGEEHRNVLRADEIPQVMKQAVLAAEDDRFYQHGGVDWMGVARAVLTNMVKLSKSQGGS
FT                   TITMQVARNFYLSSEKTYSRKFYELLLTYKIEAELTKDQILELYMNQTYLGHRSYGFAA
FT                   ASRTYFGKPLSEVTPAEAAMLAGIPKAPSRANPLASLPRATARQQYVLGRMQTLGYLTP
FT                   EQVQEARAQTIVLRGSEGGPAHGFAIHGEYPAELVRQLMYSIYQDGAYTHGIDVYTTID
FT                   SKAQQAAYRAVRAGVLDYTRRAPYPGPQAQIDLPDGIEQDAQAFDEILDSVQDQAPDSD
FT                   DLLAGVVLSASPTSVTVARTATDIVTVDDKKALAIVARALAPNAKDALRIRRGSVVYLH
FT                   KNGDTWEIINMPALQAALVSMSPADGAISAMIGGFDFHRGSFNRVTQAWRQPGSTIKPF
FT                   VYAAALERGMTPATQVNDQPFMLTAEQTGSRAWQPKNDGNRYEPMLTLREGLYRSKNMV
FT                   SIRILQAIGPEYARDYLTRFGFEQARWPAVLPLALGAGGATPLQVANAYSVFANGGYRV
FT                   TPYLIDRVTDRSGKVLMQTTPVKAGDETARAIDPRTAWVIDDIMHDTTTKGTAARVYRT
FT                   LKRNDIAGKTGTTNDAVDVWFSGYTAQQTTTVWMGFDQPRSLGTNEFGSGLALSTWLDY
FT                   EQPTLKGTPQAPRAPRPQGLIVDNSEYYFSEFPPGQAVAALDLSSGDELTDFLNNMRPS
FT                   DGAPARVQQPGQPPAGSSSGGQPPIPPIPVPRADLPDGQATPASLPLGAPPAAASAPPA
FT                   APAHGGASAQPVTLPGRVGATPL"
FT   misc_feature    complement(344714..345640)
FT                   /note="HMMPfam hit to PF00905, Penicillin binding protein
FT                   transpeptidase domain, score 9.6e-20"
FT   misc_feature    complement(346190..346696)
FT                   /note="HMMPfam hit to PF00912, Transglycosylase, score
FT                   2.4e-88"
FT   misc_feature    complement(346751..346816)
FT                   /note="1 probable transmembrane helix predicted for BPP1631
FT                   by TMHMM2.0 at aa 51-73"
FT   CDS_pept        complement(347033..348946)
FT                   /transl_table=11
FT                   /locus_tag="BPP1632"
FT                   /product="putative peptidase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0906"
FT                   /db_xref="GOA:Q7W9W7"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W9W7"
FT                   /protein_id="CAE36933.1"
FT                   /translation="MLTLIKRTVLAAGLIGTTLGAAAQPPRAYPLKDFFRNPERGYFRL
FT                   ADDGKTLGFMQPVSIDGQPPRMNIYVQALADGVPAGEPRKLTSETARDISNFFWKGDDT
FT                   VLYQKDFGGDENFHVLAVNARTGQVADLTPYEGVRASIEDDLPDDPDHVLISHNRRDPQ
FT                   VFDVYRVNVRTGAAELVAQNPGNVVGWQTDHAGKVRAAITSDGLNTTLLYRDDEAAPFR
FT                   PLITTDYRVSVSPAFFTFDDRKLYALSNRGRDKLALVVIDPATPDVEQPVFEPDEVDLD
FT                   AAGYSRKRKVLTVASYQTDKPRHRFFDAETEALYARLARALPGYDFALQGWNRDEDTFI
FT                   VAAYNDRTPGSRYLYDARRDSLHKLADINPAIPEADMAPVRPVSYQSRDGLTIHGYLTL
FT                   PAGRAPRNLACIVNPHGGPWARDGWGYNPEVQFLANRGFCVLQMNFRGSTGYGRKFWEA
FT                   GFGQWGLKMQDDITDGVQWLIDQGIADPRRIGIYGGSYGGYATLAGVAFTPDLYAAAVD
FT                   YVGVSNLFTFMNTIPPYWKPLLAKMQDMVGDPVRDKARLEATSPALHVDRIKTPLFIAQ
FT                   GAKDPRVNKAESDQVVQALRQRGVEVEYMVKDNEGHGFHNDENKFEFYAAMEKFFTEHL
FT                   KP"
FT   misc_feature    complement(348878..348946)
FT                   /note="Signal peptide predicted for BPP1632 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.925 between residues 23 and 24"
XX
SQ   Sequence 348997 BP; 53509 A; 116515 C; 125463 G; 53510 T; 0 other;
     taaatacctt tgaactggat cttttcatta tgccggtttg gcgccacagt gacgctatcc        60
     attttttcgg ctgcccgcca tgtatctgcc cgcccatttc gccgaaaccc ggcccgagga       120
     acttgcccgc atcatccgcg cgcatccgct tggcatgctg gtcacccagg acgcccaggg       180
     gctggacgcc gaccacctgc cgttcgagtt cgatcccgac gccgggccgc atggcacgct       240
     gatcgcccac gtggcgcgcg ccaatacgct atggcagcgc tgtcccgacg gggcggcggt       300
     gatggtcgtg ttccgcgggg ccgagggcta tatctcgccc aactggtatc ccagcaagca       360
     cgaggcgcat cggcaggtgc ccacctggaa ctacgaggtg gtgcatgcgc acggtacgct       420
     ggcggtgcgc gacgacgagc gcttcgtgcg cggcgtggtc gcacggctga cgcgccggca       480
     cgaggcgggc gagtcgcggc cctggaagat gacggactcc acgccggagt acatcgatag       540
     catgctgcgc aatatcgtgg gcatcgaagt cgccatcacg tcgttggtcg gcaagcgcaa       600
     gctgagccag aacaaggacg agcgcgatcg cctgggcgcg gtccaggcgc tgcaggcgcg       660
     tggccaggac gcgctggcgc agagcatggc gcgggccgaa tgaagcgggc ccatcgctga       720
     gcccggcact gccatgtccc tgctggcctt tctgcttgcc gccgcgctgc tggccatcac       780
     gcccgggccc ggcatcgcct atgtggtcgc ccgcacggtg gccggcggcc gcgccgaagg       840
     actggcctcg tgcctgggca cggcgctggg cggcctggtg cacgtgctgg cggcggcgct       900
     cggcctgtcg gtgctgatcg ccgagtcggc gctggccttc agcttgctca agtatgcggg       960
     ggccgcctac ctggtgtacc tgggcctgcg catgtggctg agcccgcgcc cggcggcggt      1020
     gcgcgtcgtg gcgccgcagg gcgcgcggcg cgcgctggcc gagggcgtgt tggtcgaggc      1080
     gctgaacgtc aagacggcgt tgttcttcct ggcgttcctg ccgcagttcg tcgatcccgg      1140
     cgcgccgctg gcgccgcaac tggcgctgct ggggggcatc tgcgttacgc tcaatacctt      1200
     ggtcgatgtg atggcggtgg tcgctgccca tcgactgctg cgatccgagg cggctcgcgt      1260
     tgcgcgcgct cgcgtgctga cgcgcgtgtc gggaaccacg atggtgggcc tgggcgtctt      1320
     tctggcgctg gcgcggcgag actagcggcc ggcgccgctg gcgcgcgaca aggagatgcg      1380
     atggctgaca agcgtaccga aggatcagga aagggcggcg cgaaggctgc cggcaagggc      1440
     gggctgggcg aggtcgtgct gctgtctggc ggcaatccgc agatcgccaa gggctacggc      1500
     gatgcgcccg tgcaggcgta catcgcggcc atgccgggct ggaagcgcgc ggtcggcgaa      1560
     cgcctggacg cgatagtcga gcgcacggtg cccggcgtct acaaggccgt caaatggaac      1620
     tcgcccttct acggcttcga gggcgagggc tggtttctca gcttccattg catgacgaag      1680
     tacataaagg tcgcgttctt tcgcggcgct tcgctgcaac ccctgccgcc gggcgcgtcc      1740
     aagcagaagg atgtgcgcta cctggatatc tacgaagatg cgccattcga cgaggcccgg      1800
     ttcgccgact gggtggcgca ggcaagccgg ttgccgggcg agcggatgtg aaggcccgcg      1860
     gcccggacgc cgcgtagcga tcggcaggtg cctgtctccg accgtcctgg cgtcaagttc      1920
     atggcgcatg gcggggtgcc tgtccccgcg gggacaggca cctggcgtgt ggacattcca      1980
     agcaaacccg catcgggaaa agcatgatgg accgtcccgc ggccacgctc gtacgattcg      2040
     ttaaatcgat ttactaacgt cgtgagagag gccatgtcca agcaagccat gctcgatgcc      2100
     attgaggccg agcgcgaagt gttgatcggg ttcctgcagg agttcgtgcg ggcggcgtcg      2160
     cccaatccgc ctggcgacac gcgggccgcc gcggcggtga tccaggggtt cctgagcgcg      2220
     cgcggcgtgc cgaacgagct gcttggcccc caggagagca tgcccaatgt ggtcagcgaa      2280
     tgcgagggtg ggcgcgccgg tccgcggctg gtctataacg gccacatgga tgtgttcccg      2340
     gtgggcgatg gccatggctg gacgcgcgac ccgtggtcgg gcgatatcga ggaaggccgc      2400
     ctgcacggcc ggggcacctg cgacatgaag acgggaaccg ccgcctcggt gatcgcctat      2460
     gcctacctgt atgcgcggcg tgcgcagctg gcgggcagcg tggcgctgac cgcggtgtcc      2520
     gacgaggaga cgggcgggcg ctggggtacg cgctggctgc tggaaaacga cacgcgctgg      2580
     cgcggcgact gcgtgctcaa cggcgagccg agcagcctgg acacgatccg cttttccgag      2640
     aagggcacct tgcggttgaa gttcgaggtg ctggccgccg gcgcgcacgg cgcctacgtg      2700
     catcgcagcg aaagccccac ccgcatcgcg gccgcgctga tcggccgcct ggccgaagtg      2760
     gaggcgatcg agccgtccct gccggcggcg ctgaaggcgc acctgcagcg cgaggacgtg      2820
     cgccgcgcgc tcgacgtggc gatgggcgag ggcgcggccg acgtggtcac gcgcaccacc      2880
     ttgaacgtgg gcgtgctcaa cggcgggctg aagatcaaca tgatcccgga tcgctgcgtg      2940
     ttcgaggtcg atatccgcct gcccgtgggc accgagcccg acgtggtgct ggcccggctg      3000
     gagggcatcc tggcggagtt tccgcaggcc tcgatggaag tgcagcaatg gcacagcacg      3060
     ccgcccaacg tctgcgcgca cgatcatccc atggtggact tcatcgccga caatgcgcag      3120
     gcgatcgtgg ggcgccggcc ggtggccgtg ccatcgatcg ggtccaccga ttgccgctac      3180
     tggcgccgca gcggcgtgcc ggcgtacgtc tacggcccgg cgccgggccg catggcgatg      3240
     agcaacgagt cggtcgacct ggatgagttc atcgcggtcg ccaaggtcca tgcggcggcc      3300
     gggtgggatt acctgaacgg cgctgcctga gagcggccac ggccgcacac aacacaaggg      3360
     gaatgcatga tgagcaagac gggaaagatg gcggccgcgc tggccgcgct gtgcttgagc      3420
     gtgggcctgg ccggcgccgc gcgggcggag tcgacgctgc aggtggccct gttcaccagc      3480
     ctgaacagcc tggaccccaa cgtcacgacg ctgggcgagg agtatgtgtt caacgggctg      3540
     gtgttcggcg ggctgacccg catcgacgcc aactccaagg tggtgcccga cctggcggta      3600
     agctggacgc cgtcggccga tctgcgcgaa tggacgttca agctgcggcc cggggtgaag      3660
     ttccaccatg gcaagccgct gacggccagc gatgtggtgt tttcgttcca gcgcatcgtc      3720
     gacccggcga ccggctcgcc cggccgcacg cagctggagg tgatgaagtc ggtggacgcg      3780
     cccgatgacg ccacggtgca tttcaccctg acgcagccgt atgccgattt tcccggcttg      3840
     ctgaccggcc gccagttgcg cgtggtggcg caggatcgca tcgacaccat caagacccag      3900
     cccagcggga cgggcccgtt ccgcttcgtg cgctatacgc cgggcgacca gctcgagctg      3960
     gagcgcaatc ccgattacta cgacaaggac cgcatcaaga tcgaccgggt ggtgatgcgc      4020
     gtcatgcccg aggcggccgc gcgcgtggcg gccttgcgct cgggcagcat cgacatgatc      4080
     tggaacctgc cgctggagac cattccggac ctgaagaagg acgccgcggt agtggtggac      4140
     tcggtgccca gcgccagctg ggatggcatc gtgctgaaca actccaagcc gccgttcaat      4200
     gatgtgcggg tgcgccgcgc ggtgttcctg gcgctggaca agaaggagct ggtgaacttc      4260
     gcgctgttcg gcgagggctc gcccacccac agcccgatcg cgccgaccga tcccgcgttc      4320
     aacaaggata tcggctttgc ccccgacctg gcgcaggcca agcagttgct ggccgaggcc      4380
     ggctatgcca agggtttcgc ggtggacatc ttcgtgccgg cgggccggcc ttcgcgcgaa      4440
     cggctgggcg tggccgcgca gcagctgctg cggccgctgg ggatcaagct gaacgtgcag      4500
     cgggtgcctt acaaccgcta ttcggctggc gtggcgggaa tcgcgcccat gtatgtggat      4560
     ggctttttcg ccagcccggt gatcgacgcg gcgacgtcgc cctggttcta cagcacgggt      4620
     tcgtggaacg cgcgcatgtg gcatttctcg agcaagcgcg tggaccaggc gctggacgcg      4680
     gcgcgcgcca gcaccgaccg cgccgagcag atccgccact accaggattt ccagcgcgcg      4740
     ctcaccgagg aggtgccggg cgtgatcggc tacgtgacca atgtcgccac ggcctaccgc      4800
     gccgacatca agaactacca caccaatccc ttcctctggc tcgacctgta cgacgtcgag      4860
     aaaaccggcg gggcgcgctg agccatgtgg gcctatctcg tcaggcgact ggggcacgtg      4920
     gtgttcgtgg tcgcggccat ggcggtgctg atcttcctga tcacgcaggc catgcccggc      4980
     aacgtggcct acaccatcgc ggggcacttc gcctcgcccg aacaggtcgc cgccatcgag      5040
     gcccgcctgg gcctgaacga tccgctgtgg acgcagttct ggcgctgggc cggcgccgcg      5100
     ctgcacggcg acatggggca gtcgctggtg atgggccggc ccgtcggccc gctgatctcc      5160
     gcggcgctgg gccgctccgc gctgctggcg gtggcggccc tggtgctgac ggcggcgctg      5220
     ggcattttcc tgggcgtggt ggcggcggtg cgccatggcc gctggcagga ccggctgatc      5280
     ctggcgttct cgtggctgtc gatttcgctg ccgcagttcc tgatcgccat cgtgctggtg      5340
     ctgctggtgg ccggcacgct ggggtggctg cccgccaccg ggtatgtgga gctgtccgcc      5400
     ggcttcggtg cctggctgtc gcacctggtg atgccggtat gcacgctggt gctgggcctg      5460
     gtggcccacg tcaccagcct gcagcgctcc agcatgctgg agaccctgag cgcgccctat      5520
     gtgcgcgcgg cccgcgccaa gggcctgcgc gaacgcacgg tgctgtaccg ccatgccctg      5580
     cgcaacgcgc tgattcccac cgtgacggtg ctggcgctgg acttcggcat cctgatgggc      5640
     ggcatcgtgg tggtggagac ggtgttctcg tatcccggcc tgggccgcct gctcatcttc      5700
     gccgtggagc agaaggacct gcccgtgctg caggccggcg tgctcgcggt caccgtcatc      5760
     tatgccctgg ccaacctggc ggcggatatc gcctatgcca ttctcgaccc ccggatccgc      5820
     tatggaaatc tcgacaccca ttgaagccgg ccgcgcccgc gcgccgctgc ccatggccct      5880
     ggtcgtgggt accctgatgc tggcagccat cgtgctggtt tcgctgggcg cgccctggct      5940
     ggcccaatac gatttcgacg ccatggacgc cgccgcgcgc atgctgccgc cgtcgccgca      6000
     gcactggctg ggcaccgacg aattcggccg cgatgtgttc agccgcgtgc tgtatggcgg      6060
     caccacgtca atcctgctgg gcgtgtcggc caccgccctc agcttcgtcg tgggcgtgcc      6120
     gctgggcctg ctggcgggct acctgcgcgg ctggatcgac gacgcggtga tgcgcacggt      6180
     ggacatcgtc atttcggtgc cgccggtcat gctgggcctg ctcatcctgg cgtccaccga      6240
     gcccagcctg tggaaggcgg cgctggccgt ggggatcatc tacacgccca tcatgatccg      6300
     gctggcgcgc ggcatgacgc tgtcgctggc caacgaggag ttcatcaccg cagcccgcgc      6360
     gcggcgaggg gctggcctgg atcctgctgc gcgagatcct gcccaatgcc ttgccgcccc      6420
     tggtggtgga ggcgtcgctg cgcgtcagct tcgccatcct gctgggcgcg gtgttcagct      6480
     tcctggggct gggcacgcag ccgccgtcct cggactgggg cctgatggtg gccgaggcgc      6540
     gtccctacct ggagcgcgcg ccctgggtgg ccctgtcgcc cgggctggcg atctgcctga      6600
     ccgtcatcgc cgtcaacctg atgggcgaag gcctgcgcaa gcgcctggat gcgcgcggcg      6660
     agcaaaggaa ctgagatgca ccaagacact atcctgaata tcaagggcct ggaggtgcgc      6720
     tacggccgca accaggtgct gcatggcgtg gatctcgaat tgccgcgcgg cgcgtcgctg      6780
     ggcatcgtgg gcgagagcgg ctcgggcaag agcacgattg cctggacggt gctgggcctg      6840
     ttgccgcccg gcgcggcggt caccgccggc agcgtggcct tcgacggcga ggacatcacg      6900
     ggagaacgcg ccgccgggct gcgcggcgac cgcattgcca tggtgttcca ggacccattt      6960
     accgcgctca atcccagcct gcccgtcggc cgccagatca ccgaggcgct ggtcgaacgc      7020
     gggcgcgccg atgcccgcag cgcgcgcgcc gaagccctgc ggctgatgga cgaggtgcgc      7080
     ctgccgcgcg ccagtacgtt gctggacgcc tatccgcacc agttgtccgg cggcatgaag      7140
     cagcgcatcg tgatcgccac ggcgctggcc tgctcgcccg acttgctgct gctcgacgag      7200
     ccgaccaccg cgctcgacgt cacggtggaa gcccgcatcc tggatctgct ggacgagttg      7260
     cgggtgcagc gcggcctgag catggtcttc atcagccaca acatcggttt ggtcgagcgc      7320
     atgtgctcgc gcgtgacggt catgcacggc gggcgcgtgc aggaagccgg cgccgcgcag      7380
     caggtgctgt ggcatcccgc ccatgcctac acccgcaagc tgctggctgc cttgccgctg      7440
     ctggaaaagc gcgcgccggc cgtgccggcc gtcggcgcgc cgatcgcgcg cgtgcgcgac      7500
     gtgcgcctga cattccggcc cgcccatccg ctgggcggct gggccaggct gctgcgcctg      7560
     ccgcgcgccg aaggcgtggc ggccctggcc ggcgtgtcgc tggaactgcg gccgcgcgaa      7620
     gtggtgggcc tggtgggcga gagcgggtcg ggcaagtcga ccctgggccg ctgcctggtc      7680
     ggcctgcaag cgccggatgc gggcacggtc gagctgtccg accacgatgt gtaccgcgcc      7740
     agcccggagg tggcgcgccg gctgcggcgc cagtcgcaga tggtgttcca gaatcccgac      7800
     tcctcgctca acccgcgcca gcgcgtgggc gaggtgttgc gccgcctgct gcaattgatg      7860
     gggctggatc gccgccagca ggatcgccgc atggacgagc tgctggatct ggtgcgcctg      7920
     ccggcggcct acgccgagcg ctatccgcac cagctcagcg gcggggaaaa gcagcgcgtg      7980
     ggcattgccc gcacgctggc gctggagcct tcggtgctgg tgtgcgacga agccacttcg      8040
     gcgctggacg tgtcggtgca ggcgtcgatc ctggagctgc tcaaggactt gcgcgaccgg      8100
     ctgggcgtgg cgatgctgtt catctcgcat gatctggcgg tggtgtcgca gatatccgat      8160
     cgggtggtgg tgatgcgcca tggcgccatc gtcgagcagg ggcgcaccga tcaggtgctc      8220
     agcgccccgg cccacgagta cacgcggctg ctgctcgaca gcgtgccggc tttcgtggcg      8280
     cgccgcgcgc gggaggcggc cgtggcctga cagcggcctt tgcggggggc ggcgacgggc      8340
     gggccttgcc cctataatcc gacgcatgac tgagcacccg ggcgcatgac gccatgacga      8400
     ccaaggctac gggcaaccgc aaggtagtca agatcgtgga cgtcgccaaa gcggccaacg      8460
     tctcgcccgc ggtcgtctcg cgcattctca gcaatgacag caagctggtg gtgcgcgagg      8520
     aaacccgcgc ccgcgtgcag caggccatcg aggcgctggg ctacacgccc aacctgcagg      8580
     cgcgcggcct gcgcttgtcg cgctccaata cgctggccat gatcgtgccc gagctcaaca      8640
     gcccggtctt tcccgtaatc atccagggcg cccagcgcgc cgcctgggag cgcggctatt      8700
     cgctgctggt gggcggcatg ggcggcgagg aggaggaccc caaggtggcc gggcggctgt      8760
     tgcgcagcaa ccgtatcgac ggcctgctgg tgaccaccgg ccggcacgaa gcgcagatgc      8820
     tgcaggagct ggctacgctg aacgcgccgt tcgtgctggt caaccgctac ctcgacgatc      8880
     agcatcccta cgtcgaactc gacgagcgcg gcgcggcggc ggccatcacc cgccatttca      8940
     tcgaacttgg gcatcgccgc atcgccttcc tgggcggtct gcagcggcgg gtgggcgaac      9000
     gccgcgtggc gggctacgcc gacgcgctgg ccgaggcggg cctgccctgg gtgccgcagc      9060
     tggtggtcga cgccggctac tacaagcccg gcggcgagga cggactgcgc caattgctgg      9120
     cgctggacga gccgcccacc gcggtggtgg ccaccaacga gatcgtggcc gccggcgcga      9180
     tggcggccgc gcaccggcag ggcgtgcgca ttccgcgcga cctctccatc gccagcttct      9240
     ccgacggcat cgtggccgaa ctgctgagcc ccgcgctgac cgccgtgcgc tttccgctgg      9300
     agcgcatggg ctacctggcc accgccatgc tggtcgatat cgtcgagggg cggggcgcgc      9360
     cccaggcggg cctgtgcctg ccgcacgaga gcgtggtcgt gcgcgactcg accgcccggc      9420
     cgcccggccg caaggcgcgc gccgccactc gctaggcgcc gggccgcagg cccggacagc      9480
     gtgccgaaac cgtcaccctt gccctgggca gccggcccga ttcctggcat ttgcatgcct      9540
     ggacggacac ggctcgaatg gcacgcatgg cgcagccagg ggtcggaatc gtcgtaatcg      9600
     aagggttgtc agttggcatc ctgaacggat tgcctcaaac tgaaaaacac cgcatgacac      9660
     gttgcccgca tccagacaaa gacgtcgacg ccgcgctcaa gcatgccgag gcgcacggct      9720
     ggtacatccg gcgacggggc ggccatgcct gggggcgcat gtactgccca tgcaacgaca      9780
     gcgaatgccg ttgcggcgag ttctgcatca ccagcatctg gagcaccccc aggaacccgg      9840
     gccaccacgc gcgcgccctg cggcgcgtgg tggatgactg cgccaggcat cgccgggcgc      9900
     atgcgtgccg cagcaaggag taacccatgg aatacctctt caccctcaaa taccagctgg      9960
     ccgacgccga cagcgacctg gaccccttgg tcgagcgtct gggccaggcc ggttgcgacg     10020
     acgccctggt gggcatgggc ctgcccggcc gcctggcgct cgaattcacc cgcgaggccg     10080
     acagcgccga ggcggccgtg cgcagcgcgc tggccgacgt gcgccgcgcc atgcccacgg     10140
     cggcgctgat cgaggccgcg cccgacctgg tcggcctgac cgacgtggcg cagatcgtcg     10200
     gcgtgtcgcg gcagaacatg cgcaagctga tgctggcgca ccccgccacc tttccggcgc     10260
     ccatccacga gggcagcgcc tcgctgtggc acctggccga cgtgctgggc tggctgcagg     10320
     cccgcggcgg ctatccgctg gcgcaggcca cgctggatgt ggcgcgcatg gcgctgaagg     10380
     tcaatgtggc caaggaggcg cggcgcctgc cgcgctcggc cggcgccggc ctcgacgccc     10440
     tggtgggatg acttgccgcc tatggcctgg cgggtgcgcg cttgcggggc gagcgcggcg     10500
     ccacgcccgt tgacgccggc cgccggcggc tcaacgcgcc ggccgccgcc gccttgagca     10560
     gccgcctgaa ggtcgggcat tgcgcatggc tgggggcggg acaggcggcg gcatgccgca     10620
     gcccgcggct catggcctgc aactgcttga cggtggcgtc gatttcttcg gccttggcca     10680
     gcaatacctg ccggtccacc cgcggcgcgc cttgcggcga cagcatcgcg cgtatgtcgt     10740
     ccagcgacag gccgccggcc tggcccagcg cgacaagagc cagttgctcg agcaccgctg     10800
     gcgcatagcg gcggcgcgcg ccgggcgggc tgaccggcgc gatcaatccc accttgtcgt     10860
     agtaccgcaa tgtcgaggcc ggaacgccgg tgcgcctggc gacttcggca atatccatgc     10920
     aagacctcca ttgacttaaa gttgacttca acttctatca taggccttct cgatgaagag     10980
     ggtcaacgca caggagggga tatggcaccg caggagatgc tggcgcgcgt cgtgctggtc     11040
     ggcatgggcg ccacggccgt gatggacgtg tggacgatgg cactcaggcg cctgggcgtg     11100
     cccgtgctgg actatgccct ggcgggccgc tgggcgggcc actggcgcca tggccggttt     11160
     gcgcacgccg atatccggca ggcgccggcg gtgcgcggcg aagcggcgtt gggttggggg     11220
     ctgcactatg cgaccggcgt gctgttcgcc ggcctgctgg tcggcgtcgc gggccaggca     11280
     tggctgcggg cgccgtcgcc ggggccggcc ttggcggtgg gcgtggcgac cgtgctgttg     11340
     ccgtggttcg tgatgcagcc cgcgctggga gcgggactcg cttcgtcgcg cacgcccacg     11400
     ccgctcagga attgcctgcg cagcgtgctt gtgcacgcgg tctttggcct ggggctttat     11460
     ctggccggcc tggcgctggc ctggataggg cgctgaaccg gcgcccgcgc ggcgcatgtc     11520
     cgcgcgggcg cgcggatcat gccggcgggc cggtccgggt tccgctcgcc agcagcccgt     11580
     tgtgcgcgcc cagggcgggc gcgccgctga cgaagcgggc cggggtatcg gacaggcgta     11640
     tcggactggc cagcgtcgcg gccgtggcgg cgccggcggt ttcgggccgg cgcaccattt     11700
     cgcgcgccgc cacctgcgga tggcggagaa tgtcggcgta gctcagcacg gggccggcgg     11760
     ggatgcccgc ctcgcgcagg cgcgccagcc agtgttcgga cggctgcgtg gccagggcct     11820
     gttcgaccag ttcggccagg accgcgcgat gggccagccg ggccgtgttg tcggcgaagc     11880
     gtggatcgtt cttcagcgcg ggacggtcga gcaggtcgca ggttttctcc caaaggccct     11940
     gcgaggccgc gcccagcgca atggcgccgt cctgggtccg gaatatctgg tagggcgcgg     12000
     cgttgcgcga ggcctgtccc atgcgttcgg gattgtggcc cgtggccagg taatcggcga     12060
     cctccagcgg cgccatggcc agcgccgagt ccagcaaggc gacgtcgacc aattgccccg     12120
     tgccggtttg ctggcgcgcg gcaagcgcgg taagcacgcc gatggtggcg aacagggccg     12180
     tggaaacgtc gacgatggga atcggcagcc ggtgcgcggg gccgtcggtc gggccgcact     12240
     gcgcggccag gccggacatg gcctggatga ccaggtcgaa gccgccttcg cctcgcatgg     12300
     ggccggattg gccgaagccc gagatcgagc aatagaccag gcgcgggaac tccgcatgca     12360
     gggtcgcgta gtccaggccc aggcgcgcca tgacgcctgg ccggtagttt tcgaccagca     12420
     catcggcgct gccgatgagg tcgcggcatt gcgcgcggcc ggccggcgtg gagaggtcga     12480
     tcgtgacgct gtgcttgttg cgattgaaaa ggttgaagaa agcgctctgt ccatcgacga     12540
     aaggggaaga gtgccgctgg tcgtcgccgc cgccgggctt ttcgatcttg atgacttcgg     12600
     cgccgaagtc cgccagcatc gcggtgcaat agggcgccgc gatccattgg cccatgtcca     12660
     ggacgcgcaa gccttgcagt gctcccgtca ttgcactgct cccgccggct gcaatcgggc     12720
     gctgccctcg accgccaggg tcgagcgctc cttggcgtgc gcctcgtagc ggacctggtc     12780
     gccatcgcgc cagagggaga gcagcagggt ctcgcccgga tagaacacgc cgcgaaagcg     12840
     cgcggacagc gtggcgatgc catcggtgtc atacgccgcc agctcgcgcg cgatggcgtg     12900
     ctgcaccagg cccatcaggc atacgccgtg caggaaagga cgcgggtagc cggcctggcg     12960
     cgcggcggcg ggccaggagt gcacagggtt gacgatgccg tgcaggtcga acagcaacgc     13020
     ctgctgcggc aaggtcggct gttcggtctg gatgtcgggc gcgcgcgccg ggacggccgg     13080
     caggcgcgtc gagtcgtcgg gcggtccgcc gaagccgcca tcgccgcggc atatcgtcac     13140
     catggaaagc gtggcgtagt gcgtgccatt gtcggcgtcg tgcagcgtgc gctcggcgtg     13200
     cagcatcgcg ccgaactgcc ggcccttgtc ggtgatgcgc gtgacgcgca gctggctggc     13260
     gatgcggccg gcggcgggca gcggccggtg cgtcgcgata cgctgctcgc ccagcacgca     13320
     ccgggcccag tctatccccg tccagggctg gcgttgccag aagccggggt tggccagcac     13380
     cagggccatg ccgccggcgg tcttgggcgc gtcgccatag acgtactgca actggcgctc     13440
     gtccatcggg tcctggccat agcctgcgct cagggcatac aggctgcagt cccgcgcgcc     13500
     gtacgactgc gtctcgacgg gaaactcgtg cgctaacaat gcttgcacat tcacgaccgg     13560
     ctgctcctca gttgacggcc agattgaggc tctggacgat gggcttccac ttctggatgt     13620
     ccgcatcgat gacggcctgg aactgcgcca cgctgccgcc ctgcggcgtc atgcccatct     13680
     ccagcagctt ggaccgtacg tcgttgtcgg ccagcacggc cgcgacgtcg cggttcagct     13740
     gttcgacgat ggccgccggc gtgccggccg gggcgaccag gccgaaccag gccgaggcct     13800
     cgtagccggg caagccggac tcggcgatgg tcggcacgtc gggcagtttc gagaagcggg     13860
     tttcggagct cacgcccagt gcgcgcagtt tgccgccctg gacatgcggc agcgccgacg     13920
     agaggttgtc gaacatgact tgcacatcgc cgccgtagag cgcctgcagc ccgggcgcgg     13980
     aacccttgta ggggatgtgc agcatgtcga tgttcgccat gtgcgccagc agcgcgccgg     14040
     ccaggtgatt ggacgagccg ttgcccgacg acgcataggt cacgctgggc tgcgcctgcg     14100
     ccagcttgat gaggtcctgc agcgagtcca gcttgctggc ggcgttgacc accagcacgt     14160
     tgggcacccg ggtgacctgg atgaccggct ggaagtcctt ggccgcgtca tagcctggcg     14220
     cggagaagat cagcgggttg atggcgaact gcccgatcga ggccatcatc agcgtgtagc     14280
     cgtcgggccg gctgcgcgcc aggaaaccgg ctgcgatgtt gccgcccgcg ccggtcttgt     14340
     tctcgacgac gacctggcgc tcgtacttgg ccgacagctt gctggcgatg agacgcgcca     14400
     gcaggtccgt cgtgccgccc ggagcgtagg gcacgacgag ccggaccggt tcggcgggat     14460
     agggggcggc ggcggcgcca gccgacaggg ccgagacggc catgcccaaa gccagggcca     14520
     gtttgcggca aaacatgatg cttctcctta gctgattgca cttatagttt gaaggtccgg     14580
     tccagccgga cgatgtcgcc ccgatagacg ggcgttcctg cgtagatgat gcggcccgac     14640
     tcatcgcgca cgacgcgctt catgatgacg acgggcgcgc ccacggcgat atccagccac     14700
     ttggccagct ccacgtcggc ggcatcgacc tggatcattt cgaaggcctc cagcttgcgc     14760
     tgcggcagga gctgcggcag gacgtgcagc gcaatctcat ggcgaaagcg cttgggcgcc     14820
     ttgcggtaca cctcgcggtc gatgtagatg tcggccacgg tatagggaat gccctgggcc     14880
     tcgtgcacgc ggcgcatgta gaaataggcg tccgcgggct gtccgtgctg ggcatagtcg     14940
     gcggggcact cgacccggtc gcgttcggcc aggatgcgca cctggctggc gccccacagg     15000
     gcccgaatac cgctccagtc ctggtccagc ggaagctcca ggcctaccgg cgccacggcg     15060
     tcgtccagga cgaaggtgcc gacgccctgg cggcgctgga ccaggccgtt gcgctcgagc     15120
     aaggccaggg cctggcgcgc ggtgacgacg gcggtgttga actgccgggc caattgatcg     15180
     atggcgggca gccggtcgcc cgggcgatag tcgccggcgc ggatacgcat gcgcagcagg     15240
     tgcgccagat tgacatagcg tttgttcgaa ccgcttgcca gcaagtcgtc tttcacggtg     15300
     gccatgttca gatttcgccc ggtgttttcc atatcattcc gtaattctaa tattagaatg     15360
     acttggcagg caagggcgca ggtctgtcgc gtccgccggt ccggatgccg ggtcttgcgg     15420
     cggccaagat cgcccgctat gcgggcgcct tgcgcgcctg cctgggtggc cggtgggccc     15480
     tggcggtcag ttggccgtga tgccggccga ctggatcagg gcgccccagc gcgcggtctc     15540
     gcggttgacg aattcggtgg tggacggaag gtcctggtaa ttgatcaccc cgccggtctg     15600
     gcggattttt tccttgatgg cggggtcggc cagggttttc ttcagcgctg tgctcaaggt     15660
     ggccatggcg gcggccgggg tggccttggg cgcggcgagc accgtccacg aagtgacctc     15720
     cagctcggga tagcccagtt cggccaccgt gggcacatcg ggcaggtccg gaatccgcgc     15780
     atgggaggtg gccgccagcg cgcgcaggcg cgcggcctgg atctggccgg tggagttggt     15840
     ggcctggtcg aacatcatgt ccacgtggcc ggccatggtg tcgttgaggg ccggcgcatt     15900
     gcccttgtac gggacgtgca tcagccgggt gccggtctcg tgcatgaaca gggcgccgac     15960
     caggtgcgtg gaggtgccgt tgcccgccga cgcgtacgtc agcgcgtcgg gccgggcctt     16020
     ggcctgttct atcagttgcg gcaggctctt gagcgtggac tgctggccca ccacgatgac     16080
     atgcggcgtg tcgtagatgc gtcccaccgg cgcgagatcg cgttcgggct gcaacggcat     16140
     gttgcggtac aggtggctgt tgacgctcat cacgcccata ctgccgaaca gcagggtgta     16200
     gccgtccggc ctggcgcggg ccacggcctc ggcgccgata ttgccggcgg cgccggtgcg     16260
     gttctcgacg atgacggtct gcttgagctg gctgcccagg ccggtggcga ggatgcgcgc     16320
     gacgacgtcg ctgccgccgc cggccgagaa cggcacgatg agggtgatgg ggcgcgccgg     16380
     atacgcggcg tcggcttgcg cgtgcgcctg gccggccggc aagcatagcg ccagcgccgc     16440
     cagggcgctg tgcagcgcgg tgagtcgggg ttgcatggcg tctccttgga gagagtgggt     16500
     cgaacgggtg tctaggccag ccgcagcagc gcgagcagtg cggccgggtc gatggcgatg     16560
     ccgtgttgcg cggccagcct gcgcgccgcg tagcgccgct cgccgggcaa gcgttgctgg     16620
     ccgctgcgca acaacgcctg cgccagctgg tcgatgcgcg ccgcgaagcc gtggccggcc     16680
     gagcgcgccg ggtcgatgca caggaagaac tggccggtgc gcgaggtctg ggcggtgggg     16740
     tgggcgctgc gatcgacttc ccaggaaaag ctgccgccgg tcagcgcggc agccagtacc     16800
     tcgaccatca tggcgatggc cgagcccttg tggccgccga acggcagcag ggcgccgccg     16860
     tcgagcacgg ccgccgggtc gcgcgtgggt tgtccgtgcc tgtccacgcc cgcgtcgggc     16920
     ggcagcgtgt ggccatgctg ggccgccagt tgcacatcgc ccttggccat gacgctggag     16980
     gcctggtcga ataccagcgg gtccgcgccg gcgcgcgggc aggcgaaggc catgggattg     17040
     gtgccgtaca gcggggtggt gccgccatgc ggcgccatgt ggctgatgct gttgacggcg     17100
     gtcagcgcga tccactgctg gcgcgcgtag ggctcgacgt ccagccacag cgcgccgaag     17160
     tggtgcgagt tgcgcgtcag cagcacggcc aggccgtgct ggcgcacgcg ctcctcgatg     17220
     agcgggcgcg ccgcccgcag ggcgcattgg gcgaagccgt tgcgcgcgtc gacgatgatg     17280
     gtcgcgccgc tggcgtcgat gactgccggc tcggcgtgcc cgtcgaccca gtcggtgccc     17340
     agggtggcca catagccggc cacgcgatgc aggccgtggc ttcgggcctc gtcctgttcg     17400
     gccagggcgc aggtttgcgc cagtacggcg gcggtcgcgg cgctggcgcc ggcgcgctcg     17460
     aacagccgcg ccagcagcgc ggccagctgg tcggcgctca gccggcaggg cgcgcccgtg     17520
     tcggcgcagc gcgccaggtg gccggccagt tcgtcgtgcg atgcggcggg ggagatcgtc     17580
     atggtcgcag ccctcagaga atgccttctt cgcggtaggg ctggctggcc tgcacgcgtt     17640
     cgtagcccag cttcgacagg tcgaggctct ggaacgcgcc gtgcaccagc agttcggcga     17700
     tgccgcggcc ggcggcgggc gcgtgcatca tgccgtgccc ggagaaaccc gccaccgtgt     17760
     acagattctt caggcgcacg ttccaggcac cgatcaccgg gttgccgtcg agctcgttct     17820
     gttcgtacag gccggaccag gtgcggtggc acttggccgc ttcgagcggc gggaagtgat     17880
     gcgccacggc cggccagacg acgttctcga aatagtcgtg atcgacatcg aagttgaagc     17940
     cccggttttc gtcgccgttg accaggccgc cggaaaagcc ccggccttcg gagcggaacg     18000
     ccaggcggct gagatccttc acgtagggca ggggttcgat cgggttgccg cacgtgaagt     18060
     agtgttcgaa gcggcgcatc ggcacgaccg gcaggtgcat gccgaacagc tcggcgacct     18120
     ggcccgacca ggcgccggcg gcgttgacga aggcttcggc gtccagctgc gcgccgcttt     18180
     ccagcgtgac gcggcgcgcg cgggcgggcg tgacgtcggc ggccacgaca cggtccttga     18240
     gatacaccgc gcccagttcg acggccttgc gccgaaagcc ccacagcagg ccgttgggat     18300
     cgcaccagcc gtcttgcggc gtatgcgcgc cggcgcccag gtcgtcgaca tggatggagg     18360
     gaaagcgcgc cttcagttcg gcgggggtaa gcaggtcgac ctggcagccc atggcctgct     18420
     gccgcgccac gttgcgctcg agcatggcga cgcgctcggg cggcacgagg aacaggtagc     18480
     cgccttgcac ccagtcgacc ggcgcgggcc ggccattggc ggccatggtg ttctcgaagt     18540
     tcttgatgac gtccaggctg tagagcgaca tggcgatgtt ctcggggcag gtgaactgca     18600
     cccggcagcc gcccgatgaa cgcagcgccg aggcgaactc gtagctcgga tccggctcca     18660
     cgacgcagac ccgcgcggcc gggtcgcgcg ccagcacgtg gtaggccacg ctggagccga     18720
     tgatgccccc gccgatgatg acgatgtcgt actgctggac ctgcggctga ttcatggctt     18780
     gcacccgatt ccaatgttgg cgagaatgta tcctttattg gatccaatta aatcatggct     18840
     ggcggggccg cggtgttgcg ggaaaccctg atgcggccgg acagggagcg cgaggatgag     18900
     gcaggcattg tttctgggtt acggccggat gggcgcggcg ctgggcgaag cctggctgcg     18960
     cgccggtttg ctggcaggga tagacgcggt cgatccgggg cgcgatggcg ccggcctgcg     19020
     ggcgcgcctg gtgcgcgggg cggacgaatt gccggagcag gcctacgacc tggtggtgct     19080
     ggcggtgaag ccggccatgg cgcagcaggc cttgcgcccc gtgccgccgg cgcggctggc     19140
     gcgcgcctgc ctggtgtcca tcatggccgg cgtgccggcc ggcgcattgc ggcaggcgct     19200
     gcagccgccg cggccggtgg cgcgggccat gcccaatacg ccggtcatgg cggggcaagg     19260
     ctgcaccggg ctgtacggcg gcgacgatgt cgcgcccgcg cagcgcgccg cgatcggccg     19320
     cctgttcgag gccgtgggcg cggcgttctg ggtcgatacg gaagatcagc tgcacgccgt     19380
     gacggcgttg agcggcagcg gtccggccta ctaccatctg ttcagcgagg cgctggcgca     19440
     ggcgggcgag cagctgggcc tgccggccgc gctggcgcgc agcctggcgg cccgcacggc     19500
     gctgggcgcg gccagcctgc agtgcgagga aggcgccgat ttcgccgcgc tgcgccgcga     19560
     ggtgacctcg ccccacggca ccacccatgc ggcgatcgaa gtgttcgagc aggcgggggc     19620
     gctgcgcacg ctggtgcgcg atgcggtgcg gcaggcgcag gcgcgctcgc gcgagctggc     19680
     gcggccctag gcgggcggcg ctgcctcaga tcaggccatg ttccttgcgc agcacgtcct     19740
     gcgtgtgctc gatgtgcgct tcgagcaggt cgcgcgcgcg cttggccttg ccggcgatgc     19800
     atgcgtccag gatggcgcgg tgctcgttct ggggcgactt gcggcccacg gcataggact     19860
     ggtgcgcacg cagatggata tcgatgccgc gcaccaggtt ctcgatggtc ttgagcaggc     19920
     gcgggcggcc gctggggcgg tacaggcaca tatggaattc gaggttcagc tcgctccatt     19980
     cgcgcgggaa ttcgctggcg tcgtagcgcg cgatgatggt ctcggcttcc ttgaagaccg     20040
     cgggcgtcat gtgcggaatg gccagcacca gcgcgcgcga ttccagcccc acccggatgt     20100
     cgagcgtttc cagcagttcc tggaccgagc gcgacgcgac caccgagccc tggtgcggcg     20160
     cgtgcgtgac cagtccctcg gcttccagcc gcttgagcgc ctcgcgcacc ggtatgcggc     20220
     tgacgccgaa gcgcttggcc agcacctcct gcttgagctg cacgccgatg cccagcgagc     20280
     cgtcgaggat cagggcgcgc aactcgtcgg tcacgccatc ggcggtcagc gtcaagggtc     20340
     ctgcattagc gttggtcatg cctggtcaac ctggaagagc cgcgcggccg gatggccgtc     20400
     gaggatgggg gccgatcata cacaccgcgc gcggcccggc gggcggctgc gggggggtga     20460
     aacggcgtgg atattatttt ggatccatca taccacccgc gtcggcgctg cgtgacccgc     20520
     cgcgcagggt acggggtatc atcggggccg ccgtcagcga cactagaagg aagcgtgcca     20580
     tgaactccgc atctcgcctg aacatctcca gtacgtccga cgattggcgc ggcctggcgc     20640
     tgtcgaattt ccccctgtcg ccgttcgtgc tcgatggcga gctgttcgcc tcggtggaag     20700
     ggttcatcca ggggatcaag ttccgcgagg acgatccgcg ccgcgccact gcgttcctgt     20760
     ccagcggctg ggatgccaag cacctgggcg acacggtgga ccgcagcggg gcctattggg     20820
     gcggcgcgcg cattcggtac ggctcggccg aacaccacca gttgatcgag cgggccatcc     20880
     gcgcccgcat caagcaatgc gagggcttgc gtcgcacctt gcgggcgacc gagggcatga     20940
     ccctggtgca cgataccggc aagccggagg ccccgcatac ctcgctgccc gccacggtgt     21000
     tctgccgcat tctcgaaacg ctgcgccggg aaattctggc gcgcgcgcgg ccgtagccgc     21060
     ggcggctagg gctgcgtctc ggcgccgccg gccagggcct tgtagagcac gaccaggcgg     21120
     gtgcgcaggc gcccgtcgct ggccgtgagg tcgcggcgcg cctgcaggtc ttcgcgttgc     21180
     gcgtccagga cggccaggta gtcggtcagg ccgccgagat agcgcgcctg cgcccatgcg     21240
     cgggcctgcg cggcgctttc ggccttttcc cgcaggcgcg catattgcag ctgttcggcg     21300
     cgatagccgc tgagtgcgtc gtcgacttca tgccaggccc gcagcacggt ctgctggtag     21360
     gcgacggcgg cctcctgctg ctgcagttcg cgcagcgtga ccacgctgcg gcggcggccg     21420
     ctgtcgaaga tgggcaggtc cagcgacggc ccgatggacc aggtgcggct gccccagtcg     21480
     ccgaacttgc cgctctcgta cgattcgtag ccgaaccgcg cgcccaggcg gatgctgggg     21540
     tagaggtcgg cctgggccag gccgatgcgg gcggtggcct ggtgcaggcg cgcttcggcg     21600
     gcgcgccagt tcggacggca gccccagcgc gtagtcgggc agcggccgcg ccgggccgtc     21660
     gccttcgggc gcggccagct cgtcgcccag ttcgccgggc cgcgcgccga gcagcaggcc     21720
     caggcggttg ccggcctggg cctgctgctc cagccagcgc ggcaactggg cctgcaggcc     21780
     ggccagttgc gtgcgctggc gcgccacgtc gagatcggcg gccagcccgc cgcgcgctcg     21840
     cgcctggatg agcgacagtt gttcttgcag cgccgcgatg tcctggcgca gcagccgcgc     21900
     ctgatgctgc gcggtgcgca attcgaagta gttgcgcgcc acctcgctga ccaggctgag     21960
     ccgcgccgcg tcgtacagcg cggccgaggc cgccacgtcg gcgtcggcgg cctcgacggc     22020
     gcgccgcacg cggccccaca gatccagttc ccaggaggcg tcgaagccgg cctggtacag     22080
     ggtgtagggg tcgctgagca gttcggtgac ggcctggcga ttggccggcg cgatggtgtc     22140
     gagaatgcgg ttggcggcgg cgtcttcgct ctggcgctgg cgcgtgacgg ccgccgccgc     22200
     gtcgacctgc gggccgcgct gcgcggccac tgtccggcgt tgcgtgcgcg cctgggcgta     22260
     gcgcaaggct gcgctttgca ggtcggggct ggcggccagc gcgcgcgcct gcaggcggtc     22320
     cagcgccgga tcgccgaagc tgcgccacca ttgcgcggcc ggcgcgccgg ccgcgccggc     22380
     gtggcccgcc agttcgggcg ggccgccgtg ccacgacgtc cagtcggccg gggcggcggg     22440
     ggtgggcgcc tggtagtcgg ggccgacggc gcaggccgcc agcgcgcagg ccagcgcgat     22500
     gcagagtgcg gacaggggca ggcgggcgtg catggcgtgg ggcgggttca gacgagacgg     22560
     ttgcgaaaca gccacgcggc cagcggcagc gtgacggcgg cgacggccag catgggcagg     22620
     aagtcgatgg ccacatcgcg tacgccggcg ccttccaggt agacgcggcg caccaggtcg     22680
     acggcgaagc gcagcgggtt ggcccaggtc gcggcctgca gcgcctcggg catatgttgc     22740
     ctaccggcgt gatcaggccg gacagcagga tcagcggcat catcaggacg aaggtataga     22800
     ccatggcctg ctgcatattg gccgacagcg ccgagatcga caggccgatg cccacgctgg     22860
     cggtggtgaa cagcagcagc cccaggtaaa gcgtggcggg cgagccggcc aggggaatgg     22920
     cgaaccaata gcgcgtcacc agcaggatca gggtcgattg cgccaggccg atcaggatgg     22980
     cgggcacggc cttgccgacc aggatctcca gcgggttgag cggggtgacc agcaactggt     23040
     cgaaggtgcc ttgctcacgc tcgcgcgcca ccgaaagcgc ggccagcatg agagtctgga     23100
     tcatgctgag cgtggcgatc agcccgggca tgatgttcca gcgggtttcc aggttggggt     23160
     tgaaccaggc gcgcgtgctc atgcgcaccg gcggcgcgcc cacgcccggc agggcggcgt     23220
     tgtagccggc caccagcgtt gcgagatggc cggcggccat gccggcggtg gtggagttgc     23280
     ggccatcgag cacgacctgc atgggcgcgt cctggccggc cgccaggcgc cggtcgaagt     23340
     cggcggccag gtggatcacc agcagcgcct ggccgccgtc gatgacgcgg gcgatgtcgg     23400
     ccggcgcgcg cagggtcgcc acgcgctgga atacgccgga gccgtcgatg cgcgcggcca     23460
     gctcgaccgc gccggcgccg cggctctggt cgagcagcgc gtagggcaca cggttgaggt     23520
     cgtaggtggc gccatagccg aacagcaggc tttgcagcag cacgggggcg atcaggatga     23580
     cgcggttggc cggatccttg acgatggcca gcgtctcctt gcggcacagg aaggcgatgc     23640
     ggcgcagcat ggcggacagg cgggcgagca tagcgtgtca gtccagggat ttgcgcgtca     23700
     ggcggcgcgc cagggccagc agcgccacgg cgtagacggc caggatggcg cagttgcggg     23760
     cgatcagggg ccagttgtcg ccggccagga acgcggtctt caccagctcc atgaagtagg     23820
     tggcgggcag cagcgagccc acgaagcgga ttgccgccgg cacgttgcgc aggtcgaaca     23880
     gaaagcccga cagcatcagc gccggcagga agctgctgag cacggcgacc tggctggcca     23940
     ggaactggtt gcgcgtggtg gccgagatca gcaggccgat gcccagcgcc acgaccaggt     24000
     agagcatggc gctgagcagc agcaccgcca gcgaaccctg cagcggcacg tggaacagca     24060
     ggcgcgccgc ggccaggcac agccccagtt ccagcatgcc gacgacgaag taggggatca     24120
     tcttggccag caggatttcg gtggggcgca cgggcgtgac gaacagcgcc tccagggtgc     24180
     cgcgctccca ttcgcgcgcc accaccagcg ccgtcaggaa ggcgccgacc agggtcatga     24240
     tgagcgcgat caggccgggc accaggtacc aggtgctggt gttggcggcg ttgaaccaca     24300
     gccgctcgac catggtcacg ccgggcggcg gcgcggcgtg gccggcgcgg tcggcgcgca     24360
     ggcgcgctgc gtgcccgagc gcgccgtcga cgtagcgcgc cagggcggcg gcgctgttgg     24420
     cgtcggcgcc atgcagcagc aactgcacct gcgcgtcgcc ggcagccagc cggcgcgcga     24480
     agtcggcggg cacgcgcacg atgccctcga cctcgtgccg gcgcatcagc gtttcggcgc     24540
     tatgcatatc ggccagccag accggcgcca ggtagtccga gccggccagg ccggccagcg     24600
     cgtcgcgcgc ctggggcgag cggtcttcca gcacgaccgc gatcggcgcg ttgcgcaggt     24660
     ccagcgacag cccgtagccg aaaatcagga tcagcaggat gggcaggacc aggccaatgg     24720
     ccaggttgct gcggtcgcgc agcaactggc ggaactcctt gcgcacgagg ctggccagcc     24780
     ggggccagaa accgccggcg cctgcgcgcg ggctcatggc cgcgtctccc ggccctggcg     24840
     ggcgcgcgcc tgttcgacga tgccgatgaa ggccgtgttc atgtcgccgg cattgcccgc     24900
     ctggcggcgc accgcgtcgg gcgtgcccag cgccagcagc cggccggcgt cctggatggc     24960
     gatgcggtcg cagtattcgg cctcctccat gaagtgcgtg gtgacgatga tggtggtgcc     25020
     gtccagggcc agcgcggtga tgcggcgcca gaacgcgcgc cgcgccagcg ggtcgatgcc     25080
     gctggtgggt tcgtccagga acaggatctc gggttcgtgc agcaggccgg tggccatggc     25140
     caggcgttgc tggtagccgc cgggcagctc gccgctgcgc gcctgggcat ggccgcgcag     25200
     gccgaactcg tccagcacgg cgtcgatgcg ccggcgcagc gccgcgccgc ccagcccgta     25260
     gacgccgccg aagaaggcga ggttctcggc caccgtcagg ttgccgtaca gggcgaactt     25320
     ctgcgataca tagccgatgt ggcgccgcgc ccgcgccggc gcgttgcgca ggttcacgcc     25380
     ggccacccgc agctggccgc tgctggccgc acagcatgcg gaacgtggtg gtcttgccgg     25440
     cgccgttggg gccgagcagg ccgaagatct cgccgcggcg cacgctgaac gaggtgctgg     25500
     ccacggcggt ggacgcgccg aacttgcgca ccaggtcatg gacttcgatg gcgggctggg     25560
     ccgcgtccgg ggcgtcgctg gcgcgcggcg ccggcgggac cgggcgcggc gcggccgtgg     25620
     ccgcgggcgc gtcggccgcc aggcgcgcgc gcagcagcat ctgcacgccg tcttccaggc     25680
     gcgccggcgt ggcgtgggcc tgcgcgccgc cgagcagggc gcgcaggcgt gccgggtcgg     25740
     cgtcggggcg ctggatgtag cgcaccgcgc cgccctcggg cacggcgtcg atgatctgcg     25800
     cgctgtcgtc gagcaggcgc gcctgcaagg tgcgcgccgg cacgcctgcc ggcggcgcgg     25860
     cgagaaagca caggccctgg gccggctcgc gcaaggcctg cggcgcgccc tgcgcgagca     25920
     gcgtgccgcg gtacagcacg tggacttgcg cgcaatgctg cgcttcgtcg aggtaggcgg     25980
     tgctgaccag cacgctgagc cgcgtttgct cgaccagttg ctggacgatc tgccacagct     26040
     cgcggcgcga cagcggatcc acgcccacgg tcggttcgtc cagcagcagc aggtcgggcg     26100
     agcgcaccag ggtgcaggcc agccccagct tctgcttcat gccgcccgac agtttgccgg     26160
     ccggccgctc ggtaaagcgc gccaggtcgg tcatggccag caggcgcgcg tagcgttcgc     26220
     ggcgctcgcg cgcgggcacg ccgtgcaggt cggcgtacag gtcgaggttt tcctgcacgc     26280
     tgaggtcttc gtacaggccg aagcgttgcg gcatgtagct gatgcggtcc tgcaccgcct     26340
     ggggcgattg gacggcatcg atgcccagca cgcgcagcgt gccggcgtcg ggccgcatca     26400
     ggcccgcgat cagccgcagc aaggtggtct tgccggctcc gtcgggcccg accagcgcgg     26460
     tcagccggcc gcgcgcgacc gacagcgtca gcgcatcgag cgcgagcgtc tggccaaagc     26520
     gtttggacag gtcccgcgcc tcgatgacgg gcgcctcgtt catgcgccgg gctccgccgc     26580
     atcggccagg tccagccgca cggtggccgg catgcccaga cgcagccggt cctgcgggtc     26640
     gtcgacgcgg atgcggattt catacaccag gctggtgcgc agggtttcgg tctgcacggt     26700
     cttgggcgtg aactcggcca ccgacgagat atagcccacc tggccgtcga tggcgcggtc     26760
     gggctggctg tcggtgtaga cccgggcccg catgcccggc cgcacgcgcc ccaggtcggg     26820
     ttcggacagg taggcgcgca cccacttggg ctcggtcagc gccagcgtat agacggggcg     26880
     ctgcggcgag gccatgtcgc cgggctcgag caggcgcgcg cgcacgacgg cgtcggtggg     26940
     cgctttcagt tcggcctggg ccagccggtg ccgcagcagg gccagttcgg ccaggctggc     27000
     ctgccactgc gccgccgctt cggcgatgtc ttcgtcgcgc ggccccagca gggccagctg     27060
     cagcgccttg gcctgggttt cggcctgggc gcgcgctacc cgcaggcgcg ccgctgcgcg     27120
     gtcgatgtcc tgccggctga cggcgcgccc atcggtggcg cgggcggtgc cctgcaggcg     27180
     ctgcaggtcc tgctgcgcga gcgcggcgtc ggccgtcgcc gcgtcggcgc gcgcccgcgc     27240
     ctgggcgatc tcctgggggc gcgagccgtt gcgcaggcgc agcagggctt gttcctgcgc     27300
     gctggcgcgc gcctgggccc gttcggcctc gagttgcagg gtgcgggttt cctggcgcgc     27360
     caggacctgg ccggcgcgca cgcggtcgcc ttcctcgacc tgcatgtcgg cgatgcgttc     27420
     gctgttgtcg aaggccagcg ccacctggcg gatatcgaca ttgccataca gggtgaggat     27480
     gtcgtccggg ggttgcgcgc gggtcagcca ccatgccgcg ccggctatcg ccagcgcgat     27540
     ggccgccgcc gctgcaatca ggggtttctt catggtcggc gctcgcaccg gaggggtcga     27600
     tgggccgact atacattaaa ttcaaattga atttgaagta atttcgggtg acactagacc     27660
     gttctttcaa tgcaccgcca caccgatcac catgaccaga ccgcgccgtt cgctgcgggc     27720
     cgacggggcc agcacccgcg ccaggatcct cgaggcagcc ggccagctgt tcggccagta     27780
     cggctatgcg ggcgtggcca gcaaggccat ttgcgcggcc gccggcgccg acctggcggc     27840
     gatcaactac cacttcggca gccgcgacgg cctgtaccgc gcggtgctgg tcgaggggca     27900
     caagcatttc atcaatctcg ataccttgac ggcgctgacg caaagcgatc tgtcgccgcg     27960
     cgagaaactg tgcgccttca tcgacggcat ggtggcgggg ttgtgggagc aggactggca     28020
     cacgcgggtc tgcgcgcgcg aggtgctggc gccgtcggcg catttcgccg cgctgatcga     28080
     cgaagaggtg ctgcccaagt tccggctggt ggcgggcatc ctgggcgaca tcacgggctt     28140
     tgcgccgggc gatccggcgc tggcgcgttg cgccgtgagc atcgtggcgc catgcatgat     28200
     gctgatggtg gtcgaccgca atgcgcccag cccgccgcag caggtgctgg cgcagccggc     28260
     ggccgacctg gccgagcatc tcaagcgctt cgcgctggcc ggcctggacg cggtcagcgc     28320
     cgccgcgccg cgccgctgac gcctctgcta cattgacgcc accgcggccc cgctccgggc     28380
     ggccgcctgg aggggactat ggcaaaagag gcgtacaccg tcgggcccgt cttgtcgttt     28440
     cgcggcgtgg gaggcgcgcg ccagtggcgc gtgagcgcgc tgatcggcgt cccgcgcacc     28500
     gcgaaggcgc ccgcgctgcg cgtggaaggg cgggcctgtg ccgcgcccgt ggtgctgcac     28560
     cagaccgcgc gcgaaacctt cctgcgctac gacctcagct gcgacatgca ggcgcgcgag     28620
     cgcaaggtcg agttcggccc caggggcgga ccggcctggc atttcaccgt gcccgcgaag     28680
     ggcgccgcgc cgcgcctggc ctatgtgtcg tgcaacggct tttccgaccc cagcggcatg     28740
     cgcaagctgg tgcgcccgga aaacgccgta tgggcggacc tgctgtgcaa ccacgatcgc     28800
     gacttgcggc cggcggacta tctgctggac aaggaacagt tgtggcacga aacgcgtacc     28860
     catgacgaag gcctgcagcg cttccacctg ctgctgatgg gcggcgacca gatctatttc     28920
     gattcgatct gggagtacat cgcggcgctc aagcagtggg tgggcctggc gcgcgcgcag     28980
     cagctggaat tcaaggtcag ccaggcgctg gaagacgaga tcgaggcgta ctacttcggc     29040
     ctgtacagcc gccgctggct gccgccgtcg cgcgcgccat gggcgggcgc gcagcccagc     29100
     ctggacgccg ccgacgccat ggcccgcgtg cccaccatca tgatgtggga cgaccacgac     29160
     atcttcgacg gctggggttc gtacagcccg gccatgcagc gctgcgaact gttccagacc     29220
     ctgttcaggc atgcgcggcg cgccttctgg gtcttccaga tgcagcacgc gctggccgac     29280
     ctgccgcccc tgcaggcgat cgcgcgcgcc aatgtgctgc cgcaggatcc gcagtacgag     29340
     ggcatcgcct ggagccggca gctcaagcgc gaccggctgg cgctgccgct gctcgacggc     29400
     cagcccggct tcacctcggc ctatcggctg gggccgctgg cgctggtggc cgccgacctg     29460
     cgcaccgagc gatcgcgcac gcagatcctg ggcacgcagg cgtggaccgc gctgcagggc     29520
     tggctgcatg ggctcaaggg caaccggccg gcttcggcca cgggcggctg ccggcatctg     29580
     atcttcatgt cctcggtgcc ggtggcgcat ctcaagctgt cgctggccga aggcctgctc     29640
     gacacctttg gccaggacca tgtgctcgac agcaatgccg acgacctgaa agatcattgg     29700
     tcgcacgacg accacgaggg cgaacgcaag cgcctgctgg agacgctgat gcaggtcgcc     29760
     aacgagaagc tgctgcgcgt gtcgatcgcc tcgggcgacg tgcacgtggc ggcgtggggc     29820
     aatgcctacc ggcgcgacat cccgcccacg tcgaactggg cgcagatcca gcagttcacc     29880
     tcgtcggcgg tggtgcaccc gtcgctgctc ggcgtggccg agcgcctgtt cctgttcatg     29940
     ctcaacggca cggcggccca ggcgcagccc atcgacgtga acctgagcgt ggagatgatg     30000
     ctgtttcctg gccacaatcg ctatgtgatg ccggcgcgca actggctggc cttcgagctc     30060
     gacgccggca aggccggcaa gctgtgggcg agctggcgct gcgagaccga gacgggcttc     30120
     tccaaccatc tgcaggcggt gcagcccgcg cagggctgat cagatcatcg gcaggctggc     30180
     cgggcggggg ccgcgctcga acgcggcgtc caggtcggcg cagtcctgtt cgctcagcgc     30240
     caggcggccg gcggcggcgt tggccgccac gtgggccggg tcggccgcct tgggaatcgc     30300
     gaacacgccg ggctggcggg tgagaaaggc cagcgcgatc tggcgcggcg tcgcgccgtg     30360
     ggcctgcgcg atgcgcgcca gcacgcgccc gccggcgctg gctggcgccg ggaagtcgtc     30420
     gtggccgaac gggctgtagg ccaccacggc cacgccatgc gccgcgcacc aaggcatgac     30480
     cgcatgctcg atggcgcgct cgcgcaggtg gtagagcacc tggttgcagg ccagcttgcc     30540
     ggggccgacg atgtcctggg cttcctgcag gtcgtcgacg tcgaaattgc tgaccccgta     30600
     gctgcggatc ttgccttcgc gctgcagcgc gtcgaatgcc gcgaaggttt cttccagcgg     30660
     atgggcgccg cgccagtgca gcaggtagca atcgagatgg tcggtgccca ggcggcgcag     30720
     cgagcgttcg caggccgcgc gcgtgccggc gcgcgaggcg ttttccggta gcaccttgga     30780
     caccaggaaa acctggtcgc ggcggcccgc gatggcctcg cccaccaggc gttcggccgc     30840
     gcccgcgcca tacatctcgg cggtatcgat gtgggccatg cctaggtcca gcccgttgcg     30900
     cagggcatcg accgcgctgg cgcgcgcgct gttgtcgagg ttccaggtgc cctggccgat     30960
     ggccgcgact atgcggtcgg tggcgccgaa gcgatgctgt ttcatggtga ctccccgcgg     31020
     gcaagcccca agcgtagcag gccggcgcta gccgcgctgg cgcgccaggt gccggtacag     31080
     cgtgctgcga tggatgccga gttcgtgcgc ggccccggcg atattgccgc cgtggcgggc     31140
     cagggcctgg tcgatccggt gcaggctggc gtcgcgcagc gaggcgggcg ccgcgggcgg     31200
     ggccgccacg cccgggcgcg gcgcggcgcc gtcggccgcg tggacggcgg gcgcggcgat     31260
     ggcggcgggc aggtggtggc gatggatcag gctgccgggc ggatggaaca gcgccagcgt     31320
     gcgcagcacc gagcgcagct gccggtagtt gcccggccac gcataggcgg ccagcgcgtc     31380
     gagggcgtcg tcggccagcg tcaggccggc gggcgtgtcg tccagcgcgc gcaaggcggc     31440
     gcagataaag gggcgcaggt cgtcgcgctc gcgcagccgc ggcaagggga ccgcatagtc     31500
     gtgcaggcgg taatagaggt cggcgcggaa ctcgccggcg gcgatcatgg cgtccaggtc     31560
     gcggtgggtg gcgctgacca ggccgaagtt gaccggcacc gccttgtcgg cgcccagcgg     31620
     ctgcaccatg cgctcctgca gggcgcgcag caggcgggtc tgcagggcca gcggcatgtc     31680
     gccgatttcg tccaggaaca gcacgccgcc gtcggcttcg cgcagccggc cgcgcgcgcc     31740
     cagccgccgc gcgccggtat aggcgcccgg ctcgtagccg aacagttcgg cctcgatcag     31800
     gctttcgggc agggcgccgc aattgaccgc gacgaacgga ccgtcgcgcc agatgctgcg     31860
     gcggtacagg tgctgtgcgt agacttcctt gccggcgccg gtttcgcctt gcagcagcac     31920
     cgacaggccg ccgtcgagcg cgcgccgggc gcgttcgaag ccggcctgca gcgccggcgc     31980
     cagcgccggc agcgtttcct cgggcgcctg cgccggcacg gcgcgcggcg ggcgtggggg     32040
     cgcgggcagc gagcgcgcat gcccgccctg gcgcagcacg gcatggaagg gagcgccttg     32100
     cggcgtatgg acgcggccgg gcgtgcgcgc gacggcgcgc caatcgacca gccagccgtc     32160
     cagcggctgg tccagcagcg cgggccaggt ggcgcccagc agcgcgacgg cggcatcgtt     32220
     ggcgccgacg atgcgttcgt cctcgatcag cagcagcccg cgttcgaccg aatcgagcag     32280
     cgaggcctgc ttgtggaaga ccaggtacag gcagcgctcg ccggcctgct cgatgacgcg     32340
     gttggcaacc tggcgcgcgc acatgctggc caggctcagc gcataggcgt gcatgcgccc     32400
     ggcgtcgccc gagatatcca gcacgccgag gatgtcgccg cgcggcgaac ggatcggcgc     32460
     cgcgtggcaa ctgaggatct ggttgcgccg caggaagtgt tcggcgccgt gcacgcgcag     32520
     cgcggcggct tcgatcagcg ccgtgccgat ggcgttggtg ccgcgatggt tttcggccca     32580
     gctgaccccg ggccgcagcg ccatgtggtc ggcgcgctgc aggaaaccgg tattgccgct     32640
     tgcctgcagg atcacgccgc tggcgtcggc cagcagcacc aggctggagg cgctggccac     32700
     catgccggcc agggtttcga tttcgggctg ggcggcgcgc agcacgcagg cgtgctgctc     32760
     gaggcgttcc tgcaggtcgc cgtgacgcag ggcgacgggg tcgtcgtgca ggtcggcggt     32820
     ggcgctggcg cagcgctccc aggagcgcac gatgggagcg gcggcctgcg tggacggcag     32880
     gtgctggccg gatgcggaaa gctggtagcc gggcatgcgg tgtctccttg cgtgtcgcgc     32940
     gccgcgacgc gatgtcgccg ccggcaatgc cggcctgtcg caagatgcga caggccgctg     33000
     ttttttatag ggaaattatg catgaaaagc gcgtgcgcgc tggccgtcca gaggtaacag     33060
     ctcgtcgccg cgggctggca cggcgtttgc atgagcctga acggcgcccc atgcgcccgc     33120
     cgcgcgacgg caagcaatcg tcacggcgcc acaacgacat caggagacaa accatggatc     33180
     tatccgacct gaaaaaattg ggcctggatg tggcctaccc gttcaaggaa cagtacgaga     33240
     actacatcgg cggccaatgg gtgcctccgg taggcgcgga gtacttcgac aatctgtcgc     33300
     ccattaccgg ccagccgttt tgccgcgtgc cgcgctcggg cgcggccgac atcgaactgg     33360
     cgctggacgc ggcgcatcgc gcgcgcgccg cgtgggcgcg cacctcgccc gccgagcggg     33420
     ccaacatcct gctgcgtatc gccgaccgca tcgagggaca gttgccgatg ctggcggtgg     33480
     ccgagtcgat cgacaacggc aagccgctgc gcgagaccac cgcggccgac ctgccgctgg     33540
     cgatcgacca tttccgctat ttcgcgggct gcatccgggc gcaggagggc gccatctcgg     33600
     agatcgacgc caacaccgtg gcctaccact tccacgaacc catcggcgtg gtggggcaga     33660
     tcattccctg gaacttcccg ctgctgatgg cggcctggaa gctggcgccg gcgctggcgg     33720
     cgggctgcgt ggtggtgctc aagccggccg aacagacgcc ggcctcgatc ctggtgctgg     33780
     ccgaactgat cggcgacctg ctgccgccgg gcgtgctcaa cgtggtcaac ggctatggca     33840
     aggaggccgg ccaggcgctg gccaccagca agcgcatcgc caagatcgcc ttcaccgggt     33900
     cgacgccggt gggcaagcac atcctgcacg cggcggccga caacctgatc cccgccacgg     33960
     tggagctggg cggcaagaac cccaacatct tcttcgacga cgtgatggac cacgacgacg     34020
     agttcctgga caaggcgctc gaggggctgg ccatgttcgc gctcaaccag ggcgaggtct     34080
     gcacctgccc gtcgcgcatc ctgatccagg agtcgatcta cgagcgcttc atcgagaagg     34140
     ccatcgcgcg ggtgcagtcc atcaagaccg gccatccgct cgatgccggc accatggtgg     34200
     gcgcgcaggt ctcgcaggtg cagatggaca agatcctgtc ctatatcgat atcggccgcc     34260
     aggagggcgc gcaatgcctg accggcggcg cgcgcaacga catgctgccg ggcgggctgg     34320
     accagggttt ctatgtccag ccgaccatgc tgctgggcaa gaacagcatg cgcatcttcc     34380
     aggaggaaat cttcgggccg gtcgcggcgg tggccacctt caaggacgag gaggaggcca     34440
     tcgccatggc caacgacacg ttctacggcc tgggcgcggg cgtctggagc cgcgacggcg     34500
     cgcgggccta ccgcgtgggc cgcggcatcg aggccggccg ggtgtggacc aattgctatc     34560
     acctgtatcc ggcgcatgcc gccttcggcg gctacaagca gtccggcatc gggcgcgaga     34620
     cgcacaaggc ggcgctgtcg aattaccagc agaccaagtg cctgctggtg agctacagcg     34680
     ccaaggccct gggcttcttc taacccgggt gcctgtcccc gccaggggac tggcacccgc     34740
     cgactcctgg ggtgcctgtc tctgcatggg gactggcacc cgccgactcc cggggtgcct     34800
     gtccccgctg ggacaggcac caggatcccg acggggacag gcaccaggat ccccacgggg     34860
     acaggcacca gaattcccgc agggactggc gccccaggcg ccgcgctcac gccggcgcgc     34920
     cgggccagac ctggtggtcg cgcgggctgt cgatgcgata gtcggagtag ggcagcgaca     34980
     acaggccgtg gcccagccgg tgcgcggctt gcagcggacg gcgcggatcg tgcgccactt     35040
     cgcctctgcg gttgcccgcc ccgtgcacca tgccgacgaa ctgcgagtgg gtgtaacgcg     35100
     tgaactcctg caactgatgc acgatgccca gggccgcgcc agggtaggtt tcctcggagg     35160
     acacggccag cgccagccgc ttgcccgtca tgcgccgcag tacctcggcg tggcggggat     35220
     ggctggctga gtaataggtg aaagagcggt cgaagaaggc cttggcctgg gccgacatgc     35280
     cgtaccagta caccggcgtg cagagcacca cggcgcgcgc gggcaggaag tggtcgaaga     35340
     agagttcgcc gtagcggtcg tcggggcgcc gcgcatcggc ctctttctcg tcggtcagga     35400
     agcccgcgat gtagtcgtcg agaaacagca gcgtggcgac ggcgccggac tggcgcgcgc     35460
     cctcggccac ggcctgggcg agcagggcgc tgttgccgtc gcggcgcgga ctgccgacca     35520
     gcaccagcac ggggttgggg acttgagatg aatccatttt cattcctcgc taagcgtttg     35580
     ggtggggtga gcgttggcgc atggaaaatt tacggcttga ttgcctggct tggcgagtga     35640
     cgatgcctgc attaagatga attgaattca tctctgtcgt gaccccgcat gtttcatgat     35700
     ctaccgctgg gcgcgctgcg cgccttcgag gccgcggcgc gcctgctcag cttcaagggc     35760
     gccgccgccg agctgcatgt cacgcccacc gccgtgtcgc accagatccg cgcgctcgag     35820
     cagcggctgg gctttgcgct gttcgagcgc ctgccgcgcg gggtgctgct cacgcccaag     35880
     ggcgggcgcc tgttccagcg ggtgcatggc atgctgctgg atctggcgca gacgctggac     35940
     gcgctgcgtc cgcggccgag cacgggcggc ctgacggtgt cgaccacgca ttcgtttgcc     36000
     gcgctgtggc tggtgccgcg gctggggcgc ttctaccagg cgcatcccgg ctacgaggtg     36060
     cggctggacg cgaccagccg cctggtggat ctgctgcagg acgccagcgt ggacgtggcg     36120
     atccgctatg gcggcggcga ccgctcgggc cgccaccgcg gcctgcaggc cgcggccgtg     36180
     ctgcccgagc gcttcgccgt ctacggcgcg cccgccgcgg cggcccgcgc tgatctcggt     36240
     gcaatggcgc gattccaccg tgtacgagac cggctggcgg caatggtgcg aggcggccgg     36300
     cgtgagctgg ctggcgcgcg ccgcgccgcg cagctatgaa gaggaaaact acgccctgca     36360
     ggccgccatc gccggccagg ggctggtgct ggccagctcg gccatggtgt ccgacagcga     36420
     ggcgcgcggc ctgctggcgt gctttcgtcc cgacatcagc gtgcccgggc tgcgctatac     36480
     cgcgctgtcg gcgccgggcc gccagcggca cccgccggtg cgcgccttcc tggactggct     36540
     ggccggcgag ttcgagaccg cggcggtgcg cgggcgcccg gggctggccc catgagcgcg     36600
     ccggccgatc cgcgcctggc gcaattgcgc cgcatgcagc gttgggcgct ggcgctgctg     36660
     gcggccatga tcgccggctt cgtcgccagc cacctgatgg gcggacaggg cgcctgggcc     36720
     tgggtacggg cgttctgcga ggccgccacg gtcggcgcgc tggccgactg gtttgccgtg     36780
     gtggcgctgt ttcgccgccc gctggggctg ccgattcccc ataccgccat catcccggcc     36840
     aacaaggcgc gtatcggcga caaccttgcg gtgttcgtgc gcgatcattt cctcgatccc     36900
     gcgacgctgc tggaaaagct gcgcgtgttc gatccggccg cgcgcctggg ccattggctg     36960
     gccgacccgc gccagacccg cagcctgggc cagggcgcgc gccaggtggc gctgcaggcg     37020
     ctggacctgc tcgatgagca ggctgtcagc cgcgccatcc agggcttcgc cgtggcgcag     37080
     ttgcgccgct gggacgcggc gcgcacggcc ggcgaagtgc tggcgctcct gacccgcgac     37140
     ggccgccacc aggaattgct ggacgccgcg ctgcgccggc tgggcgacta cctcggcgaa     37200
     gaggatatcc gccagcgcgc ctgcgcgctg ctggtgaagt tcgcccgcaa ggaatggccg     37260
     cgcatcatcg ccgcggtgga tgtcatcggc tcggtggagg gcattgccga caacctggcc     37320
     gatcgcatgg cgcgcgccct ggtcgacgaa ctgcgcgatg tgctgtctcg cccggatcat     37380
     cccgtgcggc gcaactacga ggcgtgggtg gccgactata ttgcgcggct gcgcgacgac     37440
     cccgagctgg ccggccaggt cgaggccctg aagcagcgcc tgatcgacga cccgcgcgta     37500
     caggagtacg cgctggggct atggcgcgac atccatgcgg tattgcggcg cgacctgcag     37560
     gccgaggatt cggcgctggc gcgtcacctg gaggatgccc tgcaggcgct gggccaacgg     37620
     ctgtcgcgcg accccgagct gcgccgggcg gtcaacgagc atgtgctgga cagcgcgcgc     37680
     aagctgaccg acagcctgcg cagcggcgtg accgagcata tctcgcgtac cgtcaagaac     37740
     tgggacgagc gccacctggt gcgcgaactc gaactgagcg tgggccgtga cctgcagtac     37800
     atccgcttca acgggacgct ggtgggcggg ttgatcggcc tggccctgca tgccggcgtg     37860
     ctgctggtgc agcgggccgg cggctgagcc ggcgcgacgc gggcgcgctc aggcggcggc     37920
     cgcgtaagcc ggccggcgct cctggtaggc ctggcggata tggtgcgcca tttcctcgac     37980
     ggcctgcgag cgctcgccgg gcgcgatgta cagattgatg gcgtagtcgg gcagggccgg     38040
     caggccgctg gccgcgtcga gcacttgcag gtcggcgggg gccaccgaca acaggctggc     38100
     cgtgaccgcc aggtccaggc gcacggtggt caacgtggcg tcggcattgc cgttctcgaa     38160
     tacgctgcgc cagggaatgc gtccgccgtc cagcgcgtcg gccagcaccg gccggaaggc     38220
     gcaggcatcg ctgaccagtg acaccggcaa cgggttcttg cgccacgcct ggccgcccgg     38280
     ggcggccagc cacaccacgc ggtcgacggc caggcgctcg ccgcccgccg ccgcgccgat     38340
     gggctcctcg gccagcgtca agtccagctt gcggcgccgc acctgctcca gcagttcggg     38400
     cgaggtcgcc gagatcagtg aaatgtccac atcgggatag cgcagcgaat aggcgcgcag     38460
     caggcccggc aagtgcgtgc cgatcaggtc gtgcggcacc cccagccgca ccgcgccgac     38520
     gcagtcggcg ccggtcatgt gctgcatcag ttcgtcgttg atgcgcacca tctcgcgcgc     38580
     gcggcccagc aggcgcgcgc cgtcgccggt cagcgccgcg ccgctgcggc gccgttccag     38640
     caaggtgcgg ccgaacaggg cctccagccg ctgcaattgc tggctgaccg cgccctgggt     38700
     caggtgcagc agggcggcgg cggcggtcag gctgccggta tcgtggacgg ccaggaaggc     38760
     gcgcagcagc gcggtgtcga tattgcggct catgatttat taggattcgt aatactgggg     38820
     attataagaa ttcgatatcc taaattgatg cgtgtggcta tcgtacctct catcgctttg     38880
     tggagatagc catgcaaacc acgacatccc tgattgcctc ggtgcggcgc atcgccgcct     38940
     tttccgacgg cgcgcgcggc ggcaacccgg ccggcgtcca tgtggccgag gtgctgcccg     39000
     acgccatgac catgcagcag atggccgccg agatcggcta ttccgaaacc gtgttcgccg     39060
     cgccggccta tggcggctgg cgggtacgct atttcgcgcc ggaagcggaa gtgccattct     39120
     gcggccacgc cacgatcgcg ctgggcgccg tgctggccga gcaggagggc gacggcgtgt     39180
     tcgccctgac gaccaaccat gccaacataa cggtcgaagg gcgccgccag ggcggcctct     39240
     acagcgccgc gctgcaatca ccgcgcacgc gcagcgcacc cttggaggcg gccgtgcgcg     39300
     acgaggcgct ggccctgttc ggctacacgc ccgccgacct cgacagccgg ctgccgccag     39360
     cctacgccga ggccggcgcc gcccacctga tcctgccgct gaacagccgc gagcgcctgg     39420
     cggcgatgcg ctacgacctg gccgccggcc gcgctttcat gaagcgcacg ggcgtggtga     39480
     cgatcgcctg ggtccacgcc gagtcggcca cgctgctgca cgcgcgcaat gcgtttgcgg     39540
     ccggcggcgt gtacgaggat ccggcaaccg gggcggccgc cgccgcgctg gccggacatc     39600
     tgcgcgacag cggctggctg cgcgccgggg ccatcgagat cctgcagggc ttcgacatgg     39660
     gcgtgccggc gcggctaagg gccgagtacg gccccgagcc gggcagttcg gtgcgggtgg     39720
     ccggcacggc gcgtgcgctg gcgcgccagc ccgccctcat agattgacca gcgtcttgaa     39780
     cccgccgtag gccatgcgct tgaaatcgaa cacgccctcg acgcactgtt ccttcaggcg     39840
     cgggtcggcc atgaccgccg cattgatgcg gtcgcgctcg gcccggttcg ggtagacgat     39900
     ccaggcgaac accacggttt cgccctcgcg cgccgcggcc gaggtcttga acgacaccat     39960
     gccttcgatg tccaggtcgt cgcccgtgca ttcgcaatag gccagcgcgc catgctcttt     40020
     ccagatcgcg ccggccttgg tggccatctg ccggtaggtg tccagcttgt cgttgggcac     40080
     cgacagcagg aaaccgtcta cgtactgatc catggcattg ctcctgggtg gcaggggccc     40140
     cgcggccccc tggttggaat tggcactgta gcgggaaagc agggggttgc cgacggggga     40200
     ttgcgacatt gttgcgggtg gatcgcgaca ggctggccgc agtatgctgg gcgctatgaa     40260
     acgtctcgcc ctgctggtgc ccgaacgggc caacatcgca tcgctcgaga acgcccgcca     40320
     gggcttcctg gcggccaacg gcttcttgcg cgagcgcggc tgcgcgccgc gcttcgacgt     40380
     gcgcctggtg gcggccacgc cgtaggtgcg gctggatcac ggccgcatca ccgtgcaggc     40440
     cgacaccgtg ctggaggcgg tgggcgaggt cgacctgtgc gtcgtgccgc ccatccaggg     40500
     cgatccgcag ccggcgctgc aggaaaacgg cgcattgatc gactggctgg ccggctacta     40560
     caagaacggc ggcgaggtcg ccagcctgtg cgtgggcgcc gcgctgctgg ccgccggcgg     40620
     cgtgctcgac ggacagcgcg cggtggtgca ctgggcggcg cagagcgact tcggccgcct     40680
     gtttccggcg gtgcgctggg tcagcgaccg ggtcgtgctg gaggccaacg gcatctacac     40740
     cagcggcggc gcgttctcgg ccgcgcacct ggtgctgcac ctggtcgaca agtacaccga     40800
     tcgcgagacg gcgatctggt gcgccaagct gttccagctg gactggagcc gccagagcca     40860
     attgccgttc gtggtgttcg tggggcagaa aacgcatggc gatggggtgg tgcggcaagt     40920
     gcaggagcac atcgaggcca actacaccga gcgcctgacc gtcgagcagc tggcgcagcg     40980
     cgtggcgctg gggcggcgca cgctggagcg gcgctttcgc catgccaccg gcaacagcat     41040
     cgtcgagtac atgcagcgca tccgcatcga ggcggccaag aagcagctcg aaagctcgcg     41100
     caaatcggtc gccgaagtga tgtacgaggt tggctacaac gacaccaagg cctttcgcga     41160
     catcttcaac aagtactgcg gcatgtcgcc gctgatgtac aaggaaagat acctatgaca     41220
     caggagcctg tcccggcggg gacaggctcc tgctgaatcc tatgccgggg tggctgtccc     41280
     ggcggggaca ggctcctgct gaatcctatg ccggggtgcc tgtccccgtc gggacaggca     41340
     cccttgccgc aggtttcgct gcccatgcgg ggacggcctc ccggagggtc acttatggta     41400
     cggcttgccc ttgcgggcgg tgccggccat gtgttcgagc tcgcgctcgc tcatcgagtc     41460
     gtacatgtcg cgcgaggcgc ccttgaggtc gctcaccctg gattcgccgc gcttggccgc     41520
     gagcgccgcg ccggcggcca tttgctgggc tttggatttg gctggcatga tgtacctcct     41580
     tccagaaatg tcgatacggg aacggtgatt tcagcgtagc aactccgagc aaggggagct     41640
     gctacgaggg gtagcagcgt gcaagatgca atgtcccgcg tttccgggtc gtttcctcag     41700
     gagttcccgc atgcagattt cccgccattt tccgcgcctg gcccgccgcg ccgctctggc     41760
     gctatgcctg gccggcgccg cccaggtcca tgcccaggag gccgccgtgc aacgcaagag     41820
     cgactatccc tttgccgcca ccgtggcgcg cctgcaggat gccttgcgcg ccaagggaat     41880
     gacgatcttc gcggtcatcg accaccaggc cgccgcgaag caggcggggc tggacatgcc     41940
     gccgacccag gtggtggtgt acggcaatcc caaggccggc acgccgctca tgctggccgc     42000
     gcccgatttc gcgctggagc tgcccttgaa agtgctggtg cgcgagaccg cgtcgggcga     42060
     ggtgctggtg gtctaccatc cggccggcac gcgcgagggc atgctgggcc tgcccgccgg     42120
     gatggcgcag caactggccg gcgccgagcg catcgtcgac gccgcggtgc ggcgcgcgcc     42180
     ggccgactga gccgggcgcg ttacgccggg cgcggcagcg cgcccacgaa tccggccagc     42240
     gcgcgcgtca ccagctcggg ctggtccttg tgcggcgagt ggccgcagtc ctggatttcc     42300
     agcaggcggg tctgcggcgc caggcggcgg atgccgcgga tctgctccag cgtgccgtat     42360
     tcgtcgtcca cgccctgcat ggccagcatc gggcaggtga tggccggcag gtaggcctcg     42420
     atgttccatt gccggaaggc cgggtccagc caggtgtcgg tccacgatgc gaaggtcgaa     42480
     tcgacatcgt cgtggtagcg ggccaggcgg tcgcgcagcg tggtttcgcg gtaggcgcgc     42540
     agcgccaccg cgatgttggc gacggtaatg tcctcgacgt agatatgcgg cgcggctacc     42600
     gcgattccgg ccacggcgtc cgggcacaag gcggcataga gcagcgcgat gctggcgccg     42660
     tcgctgtggc cgaacaggac cggcttgtcg cgccgcgcat cgatgcccag cgccgcgaac     42720
     agcgcgggca gggcttgcgc ggcctgctgg tgcaggtagt cgatgggccg gctctcatcc     42780
     agcggacgga cggtcgagcg gccgtagccg tagcgcgaat agaccagccc gcggcatccg     42840
     gccgcatcgc agacgcgccg cggccagtcg cgccacatgg ccagcgaccc cagcccttcg     42900
     tgcaggaata ccagcagggg cgcatcgcgc cgctcaggcg cgagcagcgc atactcgatg     42960
     cgcatgggac ggtcggcgta atgcacgtcg gcgtattgcg cgggcacggc ggcggaagag     43020
     cgggcgggcg gcgtcatggc agggttttcc ggtgctgagg cttgcgctcc attgtgccag     43080
     tgccgccgcg gttacaaaaa acataaccat ttggttgaat aagacggcgg tcttctctaa     43140
     tgtaaccaaa tggttgaata tcaagctccc gccctggacc gcgtctttca cgccctgtcc     43200
     gaccccacgc gccgcgcgat gctgcgccgc ctggccgacg gggaacacaa tatccgcgcg     43260
     ctggccgcgc cgttcgccat gtcgttcacg gctgcctcca agcacctgaa ggtgctggaa     43320
     agcgccgggc tggtcagccg ccgcgtgcag gggcgctcgc acctgtgccg catcgatgcc     43380
     gcgccgctgg ccgccatcga cgagtggctg aagttctacg agcgcttctg gcataccagg     43440
     ctggacatgc tggagacctt gctgcgcgcc gacgcggcat cgtccgttcc ctcccacccc     43500
     gaccaggacc cgactccatg acctccccat cttctgcttt ccccgatggc cacggcgcgc     43560
     gcctggacgc gcaaagcatc cgcttcgagc ggctgctgcc cgggcccatc gaacgcgtct     43620
     gggcctggct ggccgacgcc gacaagcgcg cgcgctggct ggccggcggc gaattgccgc     43680
     ggcagcccgg gcagaccttc gagctgcatt tcaatcacgc cgcgctgacg gccgagaccg     43740
     cgccggcgcg ctacgcgcaa tacgaccggc ccatcgtcgc gcgccacacg ctgctgcgtt     43800
     gcgagccgcc gcgcgtgctg gcgctgacgt ggggcggcgg cgccggcgag gcgccgtccg     43860
     aggtgttgtt cgagctgagc gaggccggcg agcaggtgcg cctggtgctg acccacaccc     43920
     ggctggccga ccgcgccgcg atgctggatg tggcgggcgg ctggcatgcg cacctggcgg     43980
     tgctggccgg caagctggcc ggacaggcgc cgccgccgtt ctggaccacg ctggcgcagg     44040
     ccgagcagga ctacgagcag cgcctgtagc ggccggcgcg ccgttcaggc cgtggccggg     44100
     gcggctggcg cgcggcagga cagcaccgcg tcctcgaagc ggtcgaatac attgtcggcg     44160
     ccggccaggc ccaccaggcc ggcccgatgc agcttggcct tgacccgcgg gttggcgccg     44220
     ctgaggatga cccgcacgcc gcggcgctgc aggtcggtga tcacctcttc gagcgcctgc     44280
     aggccggtga tgtcgatgaa cggcacccag cgcaggcgga tgatgagcgt gcgcggatcg     44340
     gtgtgcgtgg ccgccagggc gcgctcgaag ttctcggcgg cgccgaagaa cagcggccct     44400
     tcgaccgcgt agaccagcac gtcgtccggc agcggcccgt agccgcggtg gcccagctcg     44460
     tcgcccagct cggccgggct ctgcgcctgc acttgcacgc tggacgccat gcgccgcagg     44520
     aagtgcagga tggcgatcac cacgccgatg ttgaccgcca ccaccaggtc ggcgaacacg     44580
     gtcagcacga aggtgaccag caggatggcg acgtcggcgc gcggcgcgcg cttgatcatc     44640
     ctgacgaagt gaggcgcgtc gctcatgttc caggccacca cgaacaggat ggcggccagc     44700
     gcggccagcg gcacgttttc ggccagcggc gccagcagca gcaccatcag cagcagggtg     44760
     atgcaatgca cgaccccggc cagcgggctg gtgccgccgt tgcggatgct ggtggccgtg     44820
     cgcgcgatgg cgccggtggc ggcaaaaccg ccgaacagcg gcgcgacgat attggccagg     44880
     ccctggccga ccagttcctg gttggaatcg tggcgggtgc cggccatgcc gtcggccacc     44940
     acggccgaca gcagggattc gatggcgccc agcatggcaa tggcgaaagc cgggccgatc     45000
     aattcgatga cgcgcgacac ggtgatctcg ggccactgcc agctgggcag gccctgcgga     45060
     atgccgccga aagcgctgcc tatggtggcc acgccgtcca ggcccagtac ggcctgcagc     45120
     gtggtggcca ccacgagcgc caccagcgga ccgggcacgc ggcgcaggta gggcaagcga     45180
     ttgttcagca gcagcagcgc cagcgacagc gcggccagcg cggtggtggc caggtgcagc     45240
     tgcggcaggc tgtgcacgag ctgccacagt ttttcatgga agtgcgtgcc ggccggggag     45300
     ggcaggccga agaagtcctt ccactggcct acccagatga tgacgccgat cccggcggtg     45360
     aagcccacga tgaccggcgc ggggatgtac ttgatgatgg cccccagccg ggccgcgccc     45420
     agcgccagca ggatgcagcc ggccatcagg gtggccagct gcaggcccgc cacgccatgc     45480
     tgggcggtga tgccggccag gatgacgatg aaggcgccgg tggggccggc aatctgtacg     45540
     cggctgccgc cgcacagcga gaccagcagg cccgccacga tggcggtata caggccttgt     45600
     tcgggcttgg cgccgctggc gatggcaaag gccatggcca gcggcagcgc cacgaccccc     45660
     acgatcaggc cggagacaat attgggcagc caatgggcgc gtcgcagcag gccggcgcgc     45720
     ttggcttcga gcagggcgat cacacgaagg tccaggcagg caacagaatg cggcatagta     45780
     gcctttcgcg cgcgcttggg ccatgatccg gcgcaaatgg ccgctcaact gagcagggcg     45840
     gccaccagat cgcggttggg cgcgggcgcg ccgtcgaagt ccagcgcggt ctgcagatgc     45900
     agcaggtgtt cgtccatcag ggcgcaggcg cgctcggcgt cgccgtcgcg cgcggccgcc     45960
     aggaaggcgt agtgttcctg cgacgagcaa ctggcgtcgt gggcgctctg gtacatcacc     46020
     gtgatgacgg cggtgcgcgc cagcagttcg tgcagcatgg cggtgagcac cgagttgccg     46080
     acgatctcgg ccagctgcag gtgaaagccg gccagcagct gattgcgccg ctgcacgtcg     46140
     ccctcgtgga tggcttcgcg ttcctggtgc agatgttgtt cgagccgttc gtagtcctgc     46200
     ggtgcggcgc aggcgacgaa ctcgcgcgcc agcgcggcct ccaggatgcg ccgcacggca     46260
     tagacctcgc gcgcttcgtg ggcgtccggc ttgctgacga aggcgccctt gtcgggcacg     46320
     atctggatca gcttgtcctt ggacagcatc agcaaggccg cccggatctt ggtgcggctg     46380
     accttgtaca cgctggccag cgcttcctcg cgcaggcgcg tgcccggcgg caggcggtgc     46440
     gacacgatgg ccgtggcgat cgcctgggag atgccctcgg cgctgaggtc ggtggagctg     46500
     cgcatcgtcg ttgctcctca catgcgcggc gcgcgaggcg tttgcgcatc aggaatgggc     46560
     ctggacaccc ggggcccggg ggctcgcgct cggcgagcgg cccgcgccgc caggaaagcc     46620
     gccatcgccc ggccccccgc ccggcatggg ccgggcgggg ggccgaagga cgaaggatgt     46680
     tgctattaaa cgtgatagcc caaaatttgt gtacaaattt gatcgtgcgc cggcccggag     46740
     tgtggcgcgc ccgctaattc cacaggtagc cgtggctggc atcgaaagcg gcgtagccgt     46800
     cggcgcagcg gtacagccgg tagcggccgg ccgcaccgtc ctggtgcaag gaagccggcc     46860
     agcccggcaa ggccagggcc ggcggcggca gccggccgct ggccggcgcg cagccgggcg     46920
     gctcgatgcg ggcgccgtcg ggcagcacga agcgggccgc gcggcggttg gtgtcgaggt     46980
     cgtgcgcctc ggcgatggcg ccggtgcgcg cgggcagcca tgccggcagc cagccgcgct     47040
     gtatcgcgcc ggccgcgcgc gcctcgtcga ggtcgcggta ttgcgtttgc acggcatcgg     47100
     agcaggcggc aagcagcagg ggcaggatca ggggcagggc gtacgcccgg gcaggcagcg     47160
     aggtcggcat ggcaggcagc ggggaagtgg cgtgacgggc acgagtgtgc aacaggcccg     47220
     caccgccatc cagcggccat tctcaatggt tgtcggtgga aatatccctg cctgcgcggc     47280
     gcgccgatac cgcggctcaa tcggcgcgat tgaaaagcat gccttgggac cggccgcggg     47340
     ggtctggcaa tatacccata ccttcgtcac gggccatcgc catgaatcaa ccctcgtcgc     47400
     ttgccgccga cctgcgcggc gcctggcacg cgcaggcgca gtcgcatccc ctgatcaccc     47460
     tcggattggc cgcctcggcc gccggcgtgg tcttgctgct ggtggcgggc atcgtcaacg     47520
     cgctgaccgg cgagaaccgc gtccacgtgg gctacgcggt gctgggcggc acggcgggct     47580
     tcgccgccac ggcgctgggc gcgctgatgg ccctggggct gcgcgcgatc tcggcccgca     47640
     cgcaggacgc gatgctgggt tttgccgccg gcatgatgct ggcggccagc gcgttctcgc     47700
     tgatcctgcc cggcctggac gcggccggga ccatcgtggg cccggggccg gccgccgcgg     47760
     cggtagtggc gctgggcctg gggctgggcg tgctgctgat gctgggcctg gactacttca     47820
     cgccgcacga gcacgaacgc accggccacc aggggcccga ggcggcgcgc gtcaatcgcg     47880
     tctggctgtt cgtgctgacc atcatcctgc acaacctgcc cgagggcatg gccatcggcg     47940
     tcagcttcgc caccggcgat ctgcgcatcg gcctgccgct gacctccgcc attgccatcc     48000
     aggacgtccc cgaagggctg gcggtcgcgc tggcgctgcg cgcggtcggc ctgcccatcg     48060
     ggcgcgccgt gctggtggcg gtggcgtcgg ggctgatgga gccgctgggc gcgctggtgg     48120
     gcgtgggcat ttccagcggc tttgcgctgg cgtatccgat cagcatgggc ctggccgccg     48180
     gggcgatgat cttcgtggtc tcgcacgaag tgattcccga gacgcatcgc aacgggcatg     48240
     agaccaccgc cacggtgggc ctgatggccg gtttcgcgct gatgatgttc ctggataccg     48300
     cgctgggctg aagccgcggg gcgtcagccg cgcccggcca ggcaggccga cagggcgcgc     48360
     tggtacgaat cgaccgagac gccggtggtc caggccgagg gcgtggccgg atcgtagccg     48420
     ctctgattca tggcttcgcg ccggcaggcc gcctcgccgg ccggctggcg ggtggcggtg     48480
     cgtgcgatgc cggcgccttg cggggccacc gggtagccgg ccaccgtgcc atcatcgaag     48540
     gcgggctggc catggccggc cggcgcgtaa ccggcgtctt cgtaggccgt gggcgggtcg     48600
     tagctgggcg ggtcgtacac cgtgctgtcg taggggctgg ccgcgtaacc gccaggggtg     48660
     gtgtaggtga tgccgccggc gctgtactgc gcggctggcg cgtagctggg ctgcgaactg     48720
     acggccaggt aggtgccggc cgccaccagc gccagcgcgc cggcgatcca ccagccatcg     48780
     gatgaactgc cgtgcgagtg gccgtagccg ccgtagtacc catggtggcc gtggtggccg     48840
     ccgccggcca ccgcctggcc gcaggccgcc gccatcatca gcgcgacgcc ggccaactgt     48900
     aaacgtctgg acttcatgtc ttgctcccga accgcccggt gggcgcgcaa cggcgcgcgc     48960
     aggaacggca ttgatactgt aacggctggc gcgcgggcgg tgcgcacgaa agtggtgtcc     49020
     agacgttagg ccggtttcag ccggtcacag cagcgatacg ccggcttcgg ggccgccgcc     49080
     ggcggtatcg ggctcggact gcggttcggg ggcgcgcacg gccggccgtt cgccgatctg     49140
     ctggcgccac atggcgtaat acaggccctt gccggccagc agttcggcgt ggctgccttg     49200
     ctccaccacg cggcctttct ccagcacgaa gatggtgtcg gcgtgcatga tggtggacag     49260
     ccggtgggcg atcaggatgg tgatctggcc ggcgcgccgg gacacgtcgc gtatcgtctg     49320
     ggtgatctgc tcttcggtca gcgagtccag cgccgaggtg gcttcgtcga agatcagcag     49380
     ccggggctgg cgcaccagcg cgcgggcgat ggacaggcgc tgccgttccc cgcccgacag     49440
     tttgacgccg ccttcgccga tggtcgtgtc cagtccggcg ggcgagcgcg cctgcacgtt     49500
     ggcgcaggac gcctggcgca tggcggcgac gatttcctcg tcggtgacat cgggcttgac     49560
     cagctgcatg ttctcgcgca gcgtgccgga gaaaagatgg gtttcctgcg tgacgaagcc     49620
     gatctggcgc cgggtcggat tgaagcgcag gtcgcgcgtc gagacgtcgt tgtaatagac     49680
     ctcgccgtgg tcgggcgcat acaggcccac cagcagcttg accagggtgg atttgcccga     49740
     gcccgacggc cccacgaagg ccacggtgtc gcccaggcgc gcctcgaacg acacgccgtc     49800
     cagcgcgttc tcggtggcgc cctggtggcg gaaccgcacc tcgccgaagc gcacgcgctg     49860
     gatcggtccg ctgtcctgcg ccgattcggg attgcgttcg accggccggg ccatcagggc     49920
     ggcgtagtgg ttcagcgagg cgtcggcctc gcggtacgcg aggatgaggt tgcccagttc     49980
     ctgcaagggc gcgaagatcg cgaccgagat gaactgcatg gcgatcagtt ccccggtgct     50040
     cagtacgtcg cgcaagatca gccacaggag ggcgaacagc accgacagct tgagcacgct     50100
     gagtatcatg ccctgcagga acgacagcag gcggatgcgt ttgaccttct gcatttcgag     50160
     cgcgaagatc tgctgggtct gcgcctgcag gcggcggatc tcggggtagg tcaggcccag     50220
     gctcttgatc agttcgatgt tgcgcagcga ctcggtgatg aagcccgagt tgcggttggt     50280
     ttcgcgcatg atggagcgtt gctggctgcg gatctggcgg ctgagcagcc cggtcagccc     50340
     gcccagcagc agcacgccga cgaagaacac cggtaccagc agccagtggc gcgtgaccga     50400
     gtaccagcac aggaaggcca cgccgacgcc ggcggcgaac gccgtgttga tgaaggcatt     50460
     gatgaagcgt tcgctgtcgc tgcgcacttt ctgcagcagc gacagcgttt cgccgctgcg     50520
     cagctcctcg aattcctgga agcgcagccg catgacctgg cgcaggccat cattgaagat     50580
     ctgcgtgccc agtttctgca ccaccaggcg cgtgacgtat tcctgcaatg ccttggccag     50640
     ccgcgacagt atcgccacgg ccagcgccag caggcccagc acgccggcga gcaactggtc     50700
     gccggtcttg ccggcgcggc cgatggcgta ttcgtcgatg atgcggccga agatgatggg     50760
     gtcgatcagc gccagcacct ggctggcggc ggccagcagc aaggccagca gcgccaggcc     50820
     gccatggggc cgcaggtagg tccagagcat gcgcattgtc ggggtctcgc gggcgaaagc     50880
     gggcccccag tatcccggca agcggggcgc ggcgcaacgg cgggcgcgcg gcggtgcggc     50940
     tagcggcgcg ccgccgcgat ctcgcgccgc atggcgcagc ggcgcgccgc cggcaggccc     51000
     aggctggcct cgcgcgccag gatggcctgc aggcgcacgt tgaggccgtc cgcttgcagc     51060
     gtggcgaaac ccaggcgcgc gtagaagggc tggttccagg gcaggtcgcg gaaggtggtc     51120
     agcgtgatgg cgggcaggcc ggccgccgac gcggcgtcga tggcggcccg caccagccgc     51180
     ccgccgatgc cgcggccctg catttcgcgc cgcaccgcca actcccagac atgcagcgca     51240
     tcggcggtgc gctccgcgac caggaagccc gccaatccgg cgccggggca ttcggccacc     51300
     cagctggtgc cggccgcgat ccaggcccgg tggtcctgct cgctcatgac ttcgtcggcg     51360
     gcgatccagg ccagccccgg ggcgtccagg aagcgctgcc cggcgctgcg ttcgatggcc     51420
     ggcagcaggg cggcgtcggg cgcctgggcg cggcgcacgg cgacggaggg cgtggcgggg     51480
     gcggatggca tggggcgcag tgtaaacccg gctatcatgg cggttttcca gatccggatt     51540
     gcgccatgcg cctgttgctt gccatcttcc tgccgttcac ggtgttcttc accatcggcc     51600
     gccccatcgc cggcatcatc tgcctgctgc tgcaaatcac cctgatcggc tggattccgg     51660
     ccgcgctgtg ggcggtctac gcattgagcc agttccatac cgaccgcaag atccgcgacg     51720
     ccgtgggcgg ccgcggctag cgccgccagg cgccggcgct atgccgcgcg gccgtcgtac     51780
     tgatgcacgg cgaccgcgtc caggtccacg tcgtccaggc agcggatatt gatcgccgcc     51840
     atcgcccggc cttgctggtc gacgccttcg ccatgggtgt ggatgccgca cgtgggacag     51900
     aagcggtgct tgatcaggtg gcggttgaag gtataggtgg cgatctgttc gtcgggcgtg     51960
     gccagccgca ggtggtcgcg cggcacgaac cacagcagcg cgcccttgcg ccggcatatc     52020
     gagcaattgc aggacatggc gcctgtcagt tcgccttcca cgtcgaatcg gatggtgccg     52080
     caatggcaac tgccgtgata gtgcatggtg cggggctcct gtgcgggtaa gggatcaatg     52140
     cgcgtcggcg gccggggcgc tcgcgccggg ctgcgggcgg cgcagcagca cgccggccag     52200
     cagcgcggcc agggcggcga acacggcgcc caccgcgaag gcagcgtgat agccgccgtt     52260
     gagcgccgtc agcacgtcgg cgccgccggc gcgcaggctg gcgctgcggc ccgccgccag     52320
     gctggccagc accgccaggc ccagggcgcc gcccatcatg aacgaagtgt tgaccacgcc     52380
     ggatgccagg cccgcttcgc tggggtccac atcgctcatg gcggccagca gcacggggtt     52440
     gaacgcgatg cccgcgccca ggcccagcag cagcatgccc ggcagcacgt cgacggcgaa     52500
     cgagcctgcg accggcgcgc gcgcgaacag cgccagcccc agcgccgcca ccagcaggcc     52560
     gcacaccagc ggcgcgcgga tgccgaagcg catcaccagc ctggccgaca gccccagcga     52620
     gaacgccgcc atgatgatat tggccggcag gaagcccagc cccacctgca tggccgtgta     52680
     gcccagcacc agctgcatgt agagcgccga gatgaagaac caggcgaaca tggccgcggc     52740
     ccacagcacg ccgacgatgt tggcggtggc gacgttgcgc agcgcgaaca gcgacagcgg     52800
     catcaacggc gccggcacgc gcgcctcgat gcgcaggaac agcgccagca gcgcgaccgc     52860
     cagcgccagc agcccgagcg attggggcga ggtccagccg gcctcgttgc cattgaccac     52920
     cgcgtagacg gccagcatca gcgaggcggt gatggctgcc gcgccggcca ggtccagccg     52980
     tggatggccc gtcgggccct ggctggccgg cagcagcggc aggcacagcg cgtagaccag     53040
     cgccccgatg ggcaggttga ccaggaagat ccagtgccag ctcagcgagc tggtcagcag     53100
     gccgcccagc aacacgccga tgctgccgcc gccggcgcag acgaaaccgt agacgcccat     53160
     ggcgcgggcg cgctcggccg gctcggtgaa cagcgtcatg atcagcgaca aggccacggc     53220
     cgagacgacc gcgccgccca ggccctgcac cgcgcgcgcg gccaccagca tggcctgccc     53280
     ctgggccatc ccgcaggcca gcgaggccaa cgtgaacagc gtcaggccgg cgaggaacat     53340
     gcggcgctgg cccagcaggt cgcccagccg tccgcccagc agcaggaagc cgccgaaggt     53400
     cagcatatag gcgttgacca cccacaccag cgacgcttcg gtaaagccca ggtcggcctt     53460
     gatggacggc agggcgacgt tgacgatggt cgtgtccagc acgatcatca gcacgcccag     53520
     gcacagcacc atgagggcca gccagcgctt gcgttcgtcg agagtgtggg gcatggatgc     53580
     gattcctgga ggtcagctgt tcatctggcc gccgctgatc atccacgccg tgccgtggcg     53640
     gtcgaccagc acgccgaaga tttcggccca gaaggttttc tgcagcggca tggtgacctg     53700
     gccgccctcg gccagcgcgt tgaagatgcg ctgcgcgtcg gagacggtcg ggtagacgag     53760
     cgacagcgaa aagcctttct tgccttcgta cgggcattgg ctgttgctgt cggaggccat     53820
     cagcagctgg tcatcgaggc gcaggcgcgc gtgcatgatc agatcgcggt cctgcggctc     53880
     gcagggcatc tcgggcgggc tttcgccgta ggtgatcaag gcgtccagct tgccgcccag     53940
     gatgcgctcg tacaggcgca tggcctcggc gcaatcgccg tcgaacatga gatacgcgga     54000
     aatttgcggc atggtgtcat cctccggaag gtggccacgc ctcgtggggt gggccttttg     54060
     aagtgctaat ttaatacagg ttagtcctaa attgctagta atttcaggac ggaacgcggc     54120
     gccgcggcgc acgtggcggg gcgatcgtgt catcataggc ccatggccga gattccatta     54180
     tttccattga gcaacgcctt gtttcctgcg ggcgtgctgc gcctgcgggt gttcgagatc     54240
     cgttatctcg acatggtcag gcgctgcatc gccgacggct ccgagttcgg cgtcgtggtg     54300
     ctggagcagg gcaccgaagt gcgccgcccc gatggccgcg aggtgctggc gcgcgccggc     54360
     accatggcgc gcatcgacca ttgggaagcg cccatgccgg cgctgctgga actggcctgc     54420
     accggtaccg ggcgattccg gctgcacgct tgtacccagg gcaagtacgg cctgtggacc     54480
     ggccaggccg agccggtgcc cgacgatgcg ccgctggaag tgccgccgga actggcgcgc     54540
     agcgcctcgg cgctggggcg cctgatcgcc cgcctgcagc gcgagggcgt gccgcctcac     54600
     atcatgccca tggccgcgcc gttccggctc gacgactgcg gctgggtggc cgaccgctgg     54660
     gccgagatgc tgtcgctgcc gccggccgac aaggcgcgtc tgctattgtt gccgccgctg     54720
     gacaggctgc gcgagatcga cgcggtgctg gccgccgacg ggcacgcctg agccaggccc     54780
     aacatgacgg gaaccatgac catccggatc gacgaagaac tgcgggccta catcgacccg     54840
     ctgacgcctg acgaatacgc ggcgctggag caaagcctgc tggccgaggg ctgccgcgac     54900
     gcgctggtgc tgtggggcga cctgctggtc gacggccaca accgccacgc catttgcagc     54960
     aagcacggta tcgctttcaa tacggtgcag aacacgcgcc tgcagtccat ggacgatgta     55020
     cggctatgga tgatagacaa ccacctgggg cggcgcagtg tgtcggactt ccagcgcggg     55080
     gtgctggccc tgcgcaagaa ggagatcctg gaaagccggc gccaggccgg cgcaggggac     55140
     gccgcgctgg ccggcggcga cgggcctgcg ccgctgacgc gccagacgct ggcgcgccag     55200
     gcgcgcctga gcagcacgac cctgggccag atcgagaaaa tccgccagca ggccgcgccc     55260
     gaactggtgc gcgcggtgca aagcggtgag atttccatca atgccgccgc ggcggtggcg     55320
     accttgccgg cgccgcagca ggcggccgcg gccgcgggcg ggcgcggcga gctgcgcgcc     55380
     gccgcgcgcc aggtgcgcga ggcgcgcctg ccggtacgcc gggcgtccga agccgaaccg     55440
     gcgcccgcgg ccgagccgcg cgtggtggac gactatcccg ccgaggtggc gcggctggac     55500
     cgcctggtgg cgcaactggc cgaagagcgc gacgccctga agaagaaagt ggttcagctg     55560
     accgtggcgc tggccgaggc gcgcgccaag ccgggcgact gagcgtcggc cggggccgtg     55620
     ccgcgcaagc gcgccgcgtc gcgcagcggc ggcgcgccgt acaggcggct gtattcgcgg     55680
     ctgaattgcg acgcgctttc gtagccgacc cggtgggcgg ccgcgccggc gtccagggtt     55740
     tcggccacca tcagccggcg cgcctcgtgc aggcgcagct gcttctggta ttgcagcggg     55800
     ctgagcgcgg tgacggcctt gaaatggtga tgcagcgacg acacgctcat gttgacggtc     55860
     gtggccaggt gttccacgcg cagcggctgc gcgtagtgcc ggcgcagcca gtcgatggcg     55920
     cgcgcgatct gcagcgccgt gccctcggcg cgcgcgatgt ggcgcagccg cccgcccatc     55980
     ggaccggaca gcaggcggta gtggatttcg cgctcgatca acggggccag caccgggatg     56040
     tcggccggcg tgtcgagcag gcgcgccagg cgcagcacgg cgccgagcaa gggctcggtc     56100
     aggcgcgcga gcgtcaggcc gcggcgcagc ggctggccgg ccggcggggc gcccagctcg     56160
     ctgatcaggc cggcgatgcg gtgcggatcc aggtcgagcg caaagcacag gtagggcgtg     56220
     cccggggtgg ccagcgtgac gcgcgaggcc accggcaggt cgaacgaggt cagcaggtag     56280
     tgcgaggtgt cgtattcgta gacgtcgtcg cccagctgca cgcgcttggc gccctgcgcc     56340
     agcagcgcca gcgacggccg gtagaagctg acgttcagtt cggtcgggct ggacgaacgg     56400
     tagaagttca ggcccggcag ggcggtcgcg gtgctgccgt cggccggcgt atgccgttcg     56460
     atcaggctgg ccagttcgtc gtggcgcggc ggcgggctgg cggatgggga gtcgggcagg     56520
     gcgctcatcg gtggggggcg ggctggactg gcatgcctat agcgtagcgc acaggcccgc     56580
     ctggatcacg ccggcgccgc cgggctggcg ggccttgccg gcggccacgc tggcggcggg     56640
     cggcagcggc gcgccgttct tgccggcgac gatctcggcc atgatggaca gggcgatctc     56700
     cggcggcgtg cggctgccga tgtagatgcc ggccgggccg cgcaggcgcg ccagttgcgc     56760
     cggcgtcagc ccgaaatgtt cgcgcaggcg cgccacgcgc cgcgcatggt tggcgcgcga     56820
     gcccagcgcg ccgacgtaga aggccggcgt ctgcagggcg tcgatcagcg ccaggtcgtc     56880
     cagcttgggg tcatgggtca gcgcgatgac ggcggtgcgc gcgtcgggcc gcgcggcgat     56940
     caccatgtcg tcgggcatcg ccgtggtcag cgccacgccc tcgacctgcc atccggcgcg     57000
     gtactcctgg cgcggatcgc tgaccgtgac gtcgaagtcc agcgcgatcg ccatttcgca     57060
     caggtagcgc gacagctggc cggcgccgac gaccagcagc cggtggcgcg gcccgagcac     57120
     gctggcaaag cccgcgccgt ccaggcgcgg ctcggcgtcg gcggcggcag gctccagcgt     57180
     gaccgcgccg tcggccaggc gcacgctgcg ccgcacggtc tggtgcgcgc gcagtcgggc     57240
     cagcaggtcc gcgagccggc tgtgcgcgcc cagcggctcg agcaccagct gcagcgtgcc     57300
     cccgcagggc agcccgaagc ggcgcgcctg ctcgccgtcc acgccgtagg tggccagcgc     57360
     cgggcgggcg ccggggcaca gcgcggcgat gccgcgctgg cggatctggt cgatcaggtc     57420
     gtcctcgatg cagccgcccg acaccgagcc ggccaccgcg ccatcggcgc ggatggccat     57480
     catggcaccg ggcgggcgcg gcgatgagcc ccaggtgcgc gccacggtca gcagcacggc     57540
     ggcctggccg gcgtccagcc aggactgggc agtctgcagc acgtacaggt cggcggcttg     57600
     catggcgatg ctcctcatgc cttgacggtg gtgcccagcg gcagcgtgcg caggcgctgg     57660
     ccggtggcct gggcgatggc gttggccagg gccggcgcca gcggcggcac gcccggctcg     57720
     cccacgccgg tgggcggctg cgtggacggc gcgatatgca cttcgacggc cggcatttcg     57780
     gccaggcgca gcaccgggta gtcgtggaag ttgctctgct cgaccgcgcc gtccttcagc     57840
     gtgatggcgc cgtgcagggc ggtggacagg gcaaagccga tgccgccttc catctgcgcg     57900
     cgcaccacgt ccggattgac ggccaggccg caatgcacgg cgcatacgac ccggtccacc     57960
     ttgagcgcgc cgtcggcggc aatggtcact tcgaccacct gcgccaccac cgagcggaac     58020
     gattcatgca ccgccacgcc gcggccgcgg cgcgtgcctg gcgcgccggc cgccagcggt     58080
     tcgcgccagc cggcgcgggc ggccgccagt tgcagcactt cgcggtggcg cgggtgcgcg     58140
     gccagcaggg ccaggcgata ggccaccggg tcctggccgg ccgccacggc ggcctcgtcg     58200
     atcagggttt cggcggagaa cgccgtatgc gtgtgcccca ccgagcggta ccacaggacc     58260
     ggcacgggca catcggtggg cgtatgcagc tccacctgca ggttgggcac cgcgtaggcg     58320
     aggtcggaca ggccctcgac cgagaccggg tcgacgccgt cgcgcaccca gtccgccagc     58380
     ggcgtgccca gcaggatcga ttggccggcc atgcgcacgt gcaccgcctg cagcgcgccg     58440
     tcggcgccga gcgccagccg cgcgcggtgc aggttgagcg gccggtagta gccggcgcgc     58500
     atgtcgtcct cgcgcatcca caccagcttg accggcgcgt tcaggccctg ggcgcgcgcg     58560
     gtgcgcgcga tggcgaccgc ctccagcagg tagtcggcat gcgagctggc gcggcggccg     58620
     aagctgccgc cggcgtacag ctgggtcaag gtgatgcgct cggccggcat gccgagatac     58680
     tgcgcgatgg cgcgctggtc ggccgtctgg aactgctcgc cgttccagat ctcgcagcgt     58740
     tcgtcgtcca gccgcaccag gcagttcagc ggctccatgg ccgcatgcgc aagatacgga     58800
     tacgtgtatt cggcctcgat gaccttggcc gcgcccgcga aggcggcgtc gatgtcgccc     58860
     ttgcgcgccg ccatgctgcc gggccggccg acggcctcgc ggtaccgggc caggatgtcg     58920
     gcgctgccct ggcggtaggc caggccctcg tcccactcga tccgcagcgc atcgcgcccg     58980
     gcccgcgcgg cccaggtatt ggtggccagc acggccacgc cggcgtggcg cagcgcagcg     59040
     ccgccgaagc ggaccacggc gcgcacgccg ggcaccgccc gggcggcggc gtcatcgacg     59100
     cgcgccaccg ccgcgcccag gcgcggcgca tgcgccacca ccgccaccag catgccgggc     59160
     agcttcatgt cctgcgtgta gagggcgctg ccgtcgctct tggcggcgct gtcgacgcgc     59220
     ggcaggcgat gtttgccgat cagccggaag cgggccgggt ccttgagcgg cacgtcctcg     59280
     ggcacgggcg agcgcgcggc ggcctcggcc agctcgccga agccggcgcg gcgtcccgag     59340
     gccgggtggc tgagcacgcc ctcggccacc tcgatcgtgt cggccggcac ttgccagcgc     59400
     tgcgcggcgg cttgcaccag catggcgcgc gcggtggcgc cggcgcgccg catgggttcc     59460
     cacgagtcga acatggcggt gctgccgccg gtgccctgca ggccgcccag cgcctggttg     59520
     ccgtagcgcg cgctgtcggc cggggcgccc tcgacgcgca cctggcgcca atcggcgtcg     59580
     agctcctcgg ccagcagcgt ggccaggccg gtataggccc cctggccctt ctccaggtgc     59640
     ttggccagga cggtgatccg gccgtcggcg ccgatgcgca cgaaggcgtt ggcggcgaaa     59700
     ccgtcgcccg cctgcgggcc ggcggccatg gcgcggcggg ccagcggcgg cagcgacagg     59760
     cccagcagca ggccgccggc gccttgcacg aaacggcgcc ggctcaggtt ctggatggcg     59820
     atgcgcatga tgcttgctcc ctcaggccag ggccgcggcg gcggcgtgga tggcggcgcg     59880
     gatgcgcacg tacgtggcgc aacggcagat attgccgttc atggcgtcgt cgatgtcgcg     59940
     gtcggtgggg gcgggattgg cgcgcagcag ggcggcggcg gacatgatct ggcccgactg     60000
     gcagtagccg cactgggcca catccagttc gcgccaggcc tgctgcacgg cctggccggc     60060
     gcggtcggcg gccacgcctt cgatggtgac gatgcggcgg ccggcgaccg cctacacggg     60120
     cgtgatacag gcgcggatgg gctggccgtc ggcgtgcacg gtgcaggcgc cgcatagcgc     60180
     catgccgcaa ccgtacttgg tgccggtcag gtcggccaca tcgcgcaggg cccacagcag     60240
     cggcatttcg ccgggggcgt ccagtacggt gtccttgcca ttgatattga gcgtcggcat     60300
     tgggggtttc cttccgatga gcgggggcgc gccctggcgg cgcgcacgac ccgcaaagaa     60360
     taggaaaccg aggcccgtgg cggcaatgcc gattgctgca ggattcttgc ttgatcctgc     60420
     gagagtgcgg ccccggcggc gccggggcca gcgggcatca gccgcagcgc agggcgctga     60480
     tgctgccgtt gccctccagg atgatgttca ggcggtgcgc gttgtattcc atggtcatga     60540
     cctggccggg cttgagcagg cgcatcgacc ccgagttcga gcgccgcagc gcgtcgttgc     60600
     cgaccgagtc cgaatatttc tgccccacca ggttctgcac cggctgggcg tcgcagtccg     60660
     ggccgctggg cgtcgttgcc gacccgggcg cggcgctgga ggaagtctgg ctggaggccg     60720
     gcgggctcga gtccgtccgg gtgccggagg cgcaggcggt caggtcggcc agcagtgcaa     60780
     tggggatcaa cttccagatc atgggcaact ccttaaaact gggaacagac ggaatgtcca     60840
     tgatagttga ggccgggcac ggttggggcg cgcgccgcgc gcgggcgccg ggccggctgg     60900
     acggcgcggc gccgacgcgg gatgatgcgc gctttggggc gcagccggag aaggcgcagt     60960
     ggacaaattc caggaggtaa gcctgttcct ggccgtggcc gaggcgcgca gcttcgccgc     61020
     cgcgggccgg cggctgggcc tgtcggcctc gaccgtgacg cgcgcggtgg cggcgctgga     61080
     ggcgcgcctg ggcatcctgc tgctggtgcg caccacgcgc cacgtacgcc tgaccgacgc     61140
     cggcgaacag ttcgcgcacg attgccgcgc ggtgctggac agcctggcgc aggccgagga     61200
     ggcggccgcc ggcgggcggg tccagccgcg cggcgaactg tcggtgacgg cgccggcgct     61260
     gttcggcgaa ctgcacgtga tgccggccat cgtcgattac ctgcgccagc accggcgggt     61320
     gcggctgcgc gccttgctgg tcgatcgcgt ggtgcggttg ctcgacgaag gcgtggatgt     61380
     ggcggtgcgc atcggccgcc tgcccgactc cagcctgacc gccatccatg tgggcgacgt     61440
     gcgccgcatc gtgtgcgcgg cgccggattt cctggcgcgc gccggcgtgc cgtcgcatcc     61500
     gggcatgctg ccgcgctatt gcacggtcag cgtggtgatg gaagggcaaa tggaccgctg     61560
     gcgctttgtc tgcgacggcc atgcccgcga cctggacgtg caggcgcaac ttaccgtgac     61620
     gtcgtcgcag gccgcggtgc gcgccgctgt gcagggctgg ggcctggcgc aggtggtgtc     61680
     ctaccaggcc gccggtgcgc tgcgcgaggg cgcgctgcag gtggttctgc gcgaattcga     61740
     gccgccgccc ctgccggtgc atgtggtgta tccggaaggg cgcaagggcg ccgccaaggt     61800
     gcgcagcttc gtggaattct gcgtggagcg cctgcgcgcc gaactggccg agctgccggc     61860
     ctgacggcgc tgccgtacca gcgggcacgg cattgcggcg gctgcaacac tgttttgcgc     61920
     cggcgccgcg cgggccgcgc ggcgggcatc atggcggttg ttcgatacga cattcccggt     61980
     gccttgatga gcgattcgct ggttttccat accgatctcc ctggcctggc cgacggcccc     62040
     tggcatggcg gcgagctggc catgcaggag cgcgccggcg cgcgcgaacg catggcgcaa     62100
     ttggggccgc gcgtcatccg cgactacatg ccgcagcagc atcgcgattt ctttgcccag     62160
     ctgccgttca tgctgctggc cacggtcgat gcgcaaggcg acccctgggc cagcgtgctg     62220
     gaggggccgc cgggtttcgc gcacagcccc gacgagcgca ccttgcgcct ggatgcctgg     62280
     cccgccggcg acgaccccgc gcgcgccggc ctggcgcatg gcgccggcgt gggcatgttg     62340
     ggcatcgagc tgtccacgcg gcggcgcaat cgcgtcaacg gccatgtcgc cgcgctggac     62400
     ggacaggggt tctgcgtggt ggtgacgcag tcgttcggca actgcccgca atacatacag     62460
     acccgccatg cgcgtcaggc cgcgcccgcg ccgcagccgg cgcgctggct ggcgggcctg     62520
     gacgcggccg cgcgcacgct ggtcgggcag gctgatacgc tgttcgtggc cagctacgcg     62580
     cgccaggccg gcccgcacgc ggtggacgtg tcgcatcggg gcgggccgcc cggcttcgtg     62640
     cacctgcgcg gcgatacgct gacgatgccg gatttctccg gcaatcgctt cttcaatacc     62700
     ctgggcaatc tgctggccaa tccgcgcgcc ggcctggtgt tcgtggattt cgcgcgcggc     62760
     gacttgctgc agctgtgcgg gcgcgccgaa gtgctggccg aggccggggc gcccgcggcg     62820
     tatccgggcg cccagcgcct gtggcgcgtc cacgtggagc gggcggtgcg ccggcccgcg     62880
     gcgctggggc tgcgggccgg gttcggcgag tatgccgcgc agctggcggc cgtggggcaa     62940
     tgggccggcg agccgccggc ctgaggcagg ctcagccttc gcggcgctgg cgcacggcct     63000
     gggccagctc ggccagcacc ggctcggtct gggcccagct caggcaggcg tcggtgatgg     63060
     acacgccgcg cttgagcggc acgccgggct tgagatcctg gcggccttcc tcgaggttgc     63120
     tttcgatcat gatgccgatg atgcggcggt cgccgccggc cagctgccgg gccaggtcgc     63180
     gcgccacgtc gacctggcgc gcgtgcgact tgttcgaatt ggcgtgcgag cagtcgacca     63240
     tgacctgctc gcgcaggccg gccttggcca gcgccgcaca gcaggcgtcg atggcggccg     63300
     cgtcgtagtt ggggccttgc ttgccgccgc gcaggatgac gtgggtgtcg tcgttgccgc     63360
     gcgtctcgaa gatggcggcg gtgcccatct tggtcatgcc catgaaggca tgcggggcgc     63420
     tggcggccac gatggcgtcg gccgccacct ggatgccgcc gtcggtgccg ttcttgaaac     63480
     ccagcgggca gctcaggccc gaggccagtt gccggtggct ggggctttcg gtggtgcgcg     63540
     cgccgatcgc gccccaggcg atcaggtcgg cgatgtattg cgggctgagc aggtccagga     63600
     attcggtggc gatgggcagt cccagggcgc cgatttccag cagcaggtgg cgcgcgcggc     63660
     gcaggccttc gttgatgcgg aaactgccgt ccaggcgcgg atcgttgatg tagcccttcc     63720
     agcccacggt ggtgcgcggc ttctcgaagt acacgcgcat gacgatgagc aggtcgtcgg     63780
     ccagcgtgtc ggtcgcctcc ttgagctggc gcgcgtactc catggcctgt tcgtggtcgt     63840
     ggatggagca ggggccgacc accaccacca gccggtcgtc gcggccgtgc agcacgtcgg     63900
     cgatgcgcgc gcggctgtcc tcgaccagcg cctgtagcgg cgccgatacc ggcagttcgt     63960
     cctgcagcag ggcgggcgaa atcaggggac gcacggcgcc gatgcgcacg tcgtcgatgc     64020
     gggtggtgtc ttgcgtcgcg tcggcctggc cggcctcgcg atcgtgcagc gggtcatcga     64080
     tacgggtcaa ggcaatttct ccggtgcgcc ccggcggcgc aacaggcaat tatcgcactt     64140
     tgccgcgcgg cgccaggggg ccgggccggc agcgacagcc gggcggcgcc gcggcgccac     64200
     ggttgggggg ctcagcggcg ggcgtccagg gccatgcgca ccgccaggcc ggccagcacc     64260
     gaacccatca gccagcgctg cgccaccatc cacatgggcc ggcgcgccag gaataccgcg     64320
     atggcgccag ccatgacggt gaacagcgcg ttgacgcaga tgctgatgcc gacctgggtg     64380
     aagcccaggg ccagcgactg ggtcaggacg ctgccttgct gcgggtcgat gaactgcggc     64440
     agcagcgaca ggtacagcac ggcgatcttg ggattgagca gggcggtgaa cagccccatg     64500
     gcgaacaggc ggcgcggcgg gctgggcgcc agggcgcgca cctggaatgg cgactgcccg     64560
     cccgggcgca gcgcctgcca ggccatgtac atcaggtaga tggcgccggc cacgcacagc     64620
     gcttcgtagg ccagcggcac cgccatcagc agcgccgtga tgcccagcac ggcgcacagc     64680
     acgtagaaca ccagcccgag cgccacgccg gccagcgaaa ccagcccggc gcggtagccc     64740
     tgcgacagcg agcgcgacac caggtacatc atgttggggc cgggcgtgag cgtcatgccc     64800
     aggcagatca gggcgaaggc aagcagttgg gtcggttcgg gcatggcggc acgcaaggtg     64860
     gacgcgcgga tggcgcgcgg ttatcactct agcgcagaac tgttgcgtaa cagggggaat     64920
     ttttggtgcc tgtcccggcg gggacaggca cacgcacggg cagacgccat gaaatcttgc     64980
     aggtgcctgt ccccgcagtg gggactggca agcaattggc gggtgccagt cccccagtgg     65040
     ggacaggcac ccgggggtta ggttgccgtt ctcatcgtga cgaattcctc ggcggcggtg     65100
     gggtggatgc cgatggtgtc gtcgaagacc tgcttggtgg cgccggcctt gagagccacg     65160
     gccagcccct ggacgatttc gccggcgtcc gggcctacca tgtggcagcc cagcactttc     65220
     tggctgtcgg cgtcgaccac cagcttcatc agggtctttt tctggctctg ggtcagggtc     65280
     agtttcatgg gccggaagcg gctttcgtag cgggtgaccc gaaatccgtg ttcgagggcc     65340
     tgctcggtgg tcaggccgac cgtgccgatg ttgggcaggc tgaagacggc ggtggggatg     65400
     aggtcgtagt cgaccttgcg gtactcctgc gggcggaaca ggcggcgcgc cacggccatg     65460
     ccttcggcca gcgccacggg ggtgagcggc acgcggccga tcacgtcgcc gatggcgagg     65520
     atggacggct cgctggtgcg gtattcgtcg tccacctcga tgtagccgga ctcggccagc     65580
     cgcacgccgg tgttctccag gcccaggtcg tcgagcatgg cgcgccggcc ggtggcgtag     65640
     aagacgcaat cggtttcgag caccgagccg tcggacagcg tgaccgccag cacgccatcg     65700
     gcgcgcttgt cgatgcgttc gacgtcggta ttgaagcgca ggtccaggcc tttcttgacc     65760
     agttcgtcgc gcaggtgctc gcgcacgctg ccgtcgaagc cgcgcaggaa cagttcgcgc     65820
     cggtagacct gcacggtctg cgcgcccagg ccattgaaaa tggaggcgaa ttccaccgcg     65880
     atgtagccgc cgcccaccac cagcacccgg cgcggcagct cgggcaggaa gaaggcgtcg     65940
     ttggacgtga tggcgtgttc cttgcccggg atgtcgggca cgaacggcca gccgccggtg     66000
     gccaccagga tgtgttgcgc gctgtggcgc tgcccgttga tttcgacggt gtgcgggtcg     66060
     acgatgcggg cgtggccttc gtgcagcgcg acgccgctgt tgaccagcag gttgcggtag     66120
     atgccgttca ggcgttcgat ttcgcggttc ttgttggcga tcagcgtggg ccagtcgaac     66180
     tccgggcggc ccgggttcca gccgaagccg gccgcctgct cgaagtcttc gtggaaatgc     66240
     gcgccgtaga ccagcagctt cttgggcacg cagcccacgt tgacgcaggt gccgcccagg     66300
     tagcggcttt ccgccaccgc cacgcgggcc ccgtagccgg ccgcgaagcg cgccgcgcgc     66360
     acgccgccgg agccggcgcc gatgacgtac aaatcgaaat caaatgccat gtctgtcggt     66420
     ccttccgcgg ccgtccgagg cggccgcgcg tgtaaacatc tggaagccgt attaaacaac     66480
     caaccgggcc gctctgcttg gcgggcgcgc cgaatcggat ataacagcag tcagcgcggc     66540
     tggatggccg gccgccatgc acgacgcacg cgtcacggaa cgagatgcag aacgaagaca     66600
     gttttttcgg ctcgctgggc gccatgctgg gcgcggtgat acgcgccatc gtcgatggcc     66660
     tgcgctatgt gttcggcggg ctggggcggg cgctgggcga tttcttcggt ggcctggcct     66720
     cggcgctggg catgagcccg tcggtgttca attttgcctt gctggtgctg ggcctgctcc     66780
     tgctgtggac cgcggtgcgc gccttcatgg ggcgcgccat cgtggccggg atcttctggc     66840
     tggtgctggc gatgctgctg ctgggcggcc tgatcggcta gcgcggccag ggcagggacg     66900
     gcgccatgct ttaccgcttc ctggccgatc tggtgctggc gctgcatgcg ctgttcgtgg     66960
     ccttcgccgt gctgggcggg ctgctggcgc tgcgctggcc gcggctggcc tggctgcatg     67020
     tgccggcggc cctgtggggg gcgggcatca tgctggccgg cgccgtctgc ccgttgaccc     67080
     cgctggaaaa ccattggcgc gcgcaggccg gccagcaggg ctacgaggac ggtttcatcg     67140
     cccattatct gttggcggcg atctatccag aggggctgag ccggacggcg cagaccgtgc     67200
     tgggcgcgct ggcgctggcc ggcaatgcgc tcgtctatgc ggcgctgtgg cgccggcggc     67260
     ggcgcggcgg aatcggccga tgagttatgc tggactgttt tgcaactcag gcgagtccca     67320
     ttcatgattg atctgtattt ctgggccacg cccaatggtt tgaaaataaa actcttcctg     67380
     gaagaggccg gcctgcccta taccgagcac ccgatcaaca tcggcaaggg cgagcagttc     67440
     cagcgcgaat tcctcgcgat cgcgcccaac aaccgcattc ccgccatcgt cgaccaggcg     67500
     ccggctggcg gcggcgcgcc gatctcgttg ttcgagtccg gcgccatcct gctgtacctg     67560
     gccgagaaga tcggccgctt catccccgcc gacgtgcgcg gccgcgccga agtcctgcag     67620
     tggctgttct ggcagatggg cgggctgggg cccatggccg gccagaatgg gcatttcaac     67680
     gtctatgccc ccgagaaggt gccgtacgcc atcgaacgct acacggccga aaccgcgcgc     67740
     ctgtacgacg tgatggaccg gcgcctggcc gagcgcgagt tcctggcggg cgagtactcg     67800
     atcgccgata tcgcctgcta tccctgggtc gtgccgcacg aggcgcacgg ccagaagatg     67860
     gcccatttcc cgcacctgag ccgctggttc gaggcgatcg ccgcgcggcc cgccacggcg     67920
     cgcgcctata aggaggccgg cgacagctac cggcccaagg cgcccatgtc ggacgaggaa     67980
     cgggccgtac tgttcggcca gccgggcgcg ccgcgctagg cggcgcgggc taggcctgga     68040
     tcggccgggc cagccgctcg atcagcggtt cgaacagctc ggccgaggtg ttgccgtagc     68100
     ccagcaccag tccggtgtcc tccggccgcg gcgcgatggc gaagccggac agcgcctgcg     68160
     gcgccatgcc caggcgcagc gcctgggcgg cgatggcgcg gtcgtccagc gccgcgggca     68220
     gccgcagcgt caggtgcagg ccgcagtggc cgcccagcac ttcgtgcggc acgcgcaggt     68280
     ggcgcgccag ggcggcgcgc agggcctgct ggcgctcgcg gtagagccgc cgcatgcggt     68340
     tgaggtggcg ggtgaactgg ccgctttcga tgaaggaggc cagggcccat tgttcgtggc     68400
     gatggccgcc gcgcagcatc tcggccagcg cctcggcggc ctcgtcggcc aggcccgtgg     68460
     gcagcaccac gaagcccagc cgcaaggacg ggaacatggt cttgctgtag gtgcccacgt     68520
     acagcacggg cgcatcgggc accaggccct gcatggccgc gatgggctcg ccctggtggc     68580
     ggaattcgct gtcgtagtcg tcttcgatga tccaggcgcc ggcgcggcgc gcctgctcga     68640
     tcagcgccag ccggcgcgtg acgggcagca cggcgccggt cgggtactgg tgcgacggcg     68700
     tgacatagat caggcgcggc ggcgcgtcgc gccaggcctg cggcggcgcc agcaggccag     68760
     cggcgtccac ccgcaccggc accacccgca tgtcgccgca gcgcagcgcc gtcttggcgc     68820
     cgcggtagcc ggggtcttcg acccatgcgg tgtcgccggc gttgcccagc agccgcacgc     68880
     acagcgccag cccttcctgg gcgccttcgg tgatgacgat ctggcgcgcc tcgcagcgca     68940
     cgccgcgcgc ggccgccagg taggcggcga tggcctggcg caggcgcggt tcgccggcgg     69000
     gttcgccgta gcccagcaag gccgcgggcg cctcgcgcag ggcgcgttcc agcgcgttgc     69060
     gccaggcgct ggcgggaaaa tggttgaggg ccggcgtgcc gggccgcagc ggcaggtagg     69120
     tgtcggtgcg cggcgcgctg gccttcagcg cggccaggcg ccgcgcggtc gggccggcgc     69180
     tggacgccgc ggacgcgcgc gccggcatgc ccgcgcgggc cagccccgct acccgcgtgc     69240
     cctggcggtc ggcccgcaca tagtcttcgg cggccaggtg ttcgtaggcc agcagcacgg     69300
     tgttgcgcga aatgcccagc tgctgcgcca gcgcgcggga agcgggcagg cggctgcccg     69360
     gcgccaggcg gccatccagg atggcgttct tgaagcgttg cagcaactag cgctgcaggg     69420
     gcaggcgcgc gccggccggc ggcgcttgct ggaggatcgc ggcaaaatcc atggctctat     69480
     caaaaaggcg gttcgtggca ctttttatca tgccacgaat cgcctatctt gatgccatgg     69540
     cgggcgcgcc gtggtggcgc gccgcccacc cgcaaaggaa gccgtccatg tcagcccgcg     69600
     tcaacgaatt cggtcaaccc atcggccagg ccatgccgca atggcaggcg cggccgcgtc     69660
     ccccgcgcga tcccgccgag ggccgctatt gccggctcga accgctcgac gccgcgcgcc     69720
     acggcgatga tctgtacgcg gcctttgcgg tgcccgacgc ggccagcggc tggacctatc     69780
     tgtcggccgg cccgttcgcc gaccgcgccg gctacgacga atacctgcgc aaggcggccg     69840
     acagcgccga tcccctgcac cacgcggtga tcgacctggc cagcgggcgc gcgatcggca     69900
     cgctgtcgct gatgcgcatc gatccggcca acggcgtgat cgaagtgggg catgtgaact     69960
     tcgcgccggc gctgcggcgc tcgccggctt cgaccgaggc gcagtacctg ctgatgcggc     70020
     gcgccttcga cgaactgggc taccgccgct acgaatggaa gtgcgacagc ctgaacgcgc     70080
     cctcgcgcgc ggccgcgctg cgcctgggtt tcctgttcga gggcattttc cgccaggcgc     70140
     tggtctacaa ggggcgtacg cgcgacaccg cgtggttctc catcatagac agcgaatggc     70200
     cggcgctgcg ggcggcgttc gagcggtggc tggcgccgga gaacttcgat gcggcgggcc     70260
     gccagcgcaa gcggctggat gcctgccgcc agccgtaatc ggtgcctgtc cccgccggga     70320
     caggcacccc gtcatacgcc atgaaatcag gcgccagtcc ccatgccggg acaggcaccg     70380
     gcattcctgc gggggcagcc ttatgtccgg cgccgcagct tctcgcgcag cagctcggcg     70440
     ccgctgacca gcgtgatgcc ggccagcacc agcaccgcgc cgatgacgaa gcccgagtcc     70500
     agcggctcgt cgaggatcag cacgccgaag gtgacgccga acagcggcgt catgaacgac     70560
     agcaccgcca ggcgggtggc gagatagcgg cgtagcagcc agaaccaggc caggtagctc     70620
     gacagcgcca cgaccaccga ctggaagccc aggctggcca gggccgcgcc ggaccagacg     70680
     ggcgcggcgc cgccgctggc gaaatgaaag gcgggcaggg ccagtccggc catcagcatc     70740
     tggtagaaca gagtcttggc cggcgccgcc tcggacagcg aggatttgcg gatcgccacc     70800
     gtggtggcgc cccaggccgc gccggccagc acgccgagca ggtcgcccag cagcatgccg     70860
     ggcacggccg cgtggccctt gcccaggaag gcggtggcga tgccgccgaa ggccaccgcc     70920
     acgcccagcc actgcagcgg cttgaggcgt tcgtcgggca gcagcagatg cagcccgagc     70980
     gccgtgaaga tgggcgcggt gtagaggaat accgccatgt gcgaggcggt ggtgtactcc     71040
     aggcccacgc cgaccagcag gaattccagc gcgaacagcg cgcccaccgc caggccgggc     71100
     cccagcgtgc cgtcgcgcaa cgcgcccagg ccttcgtggc gcagcaccac ccagatcagc     71160
     accaccgcgg cgaaggccga gcgcaggccg atctgcaggg tgggggagac atcggcggcc     71220
     accagcttga tggcgatctg ctggaagccc cagcagatgc acagcgccag catgacgtaa     71280
     gtggcgaaac cgtccagcgg acggcgcagc ggcgcggcgg cggccatggt catggcagtt     71340
     cggccgggta gctgtccagc gccaggctga tctgctggcg caggtcccag tcggccagtt     71400
     gcgcgctgac cggcccgtag taggcgccgt cgcgcgtgac gaacagcgcc ggcaggtgga     71460
     agacttcata gcgctgcacc agcccgccgt tctcgccggc gtcgatccag cacaggcggt     71520
     cgaccggcag gtcgaactcg ggcaggcgct ggcgcgccac gccgcaggtg gcgcaggtgc     71580
     ggctgtggaa gacaagcagc gacaggcccg gcgcatccag caggtaacgg tcggcggtgc     71640
     cgtcggtcag ttcgatctgg tccatgggga aactcggggg cgggccggct atgctaccgc     71700
     atcgccggcc cgccggccgc agctagcgcg acaggcggcg atcgagttcc agcacggttt     71760
     cgtacagcac gcgcgtgccg tcgagcagct gcgacggctc cagccactcc tcgggacagt     71820
     ggctgcggcc gttcaggcag ggcacgaaga tcatgccgat cgggccggtg ggcgccatgt     71880
     agacggcgtc gtggccggcg ccgctgggca ggcgcatcga ggcatagccc aggcgggtgg     71940
     cggcgtcttc gacggcatcc atcaccagcg gcgcgcaatc ggtggggtgg gcgcggctga     72000
     ccggcgccat tgcggccgac aggcgcagcg cggccagcgc gtccgccact tccgccatga     72060
     tggcctcggg aaacgcgtcc agcacggcgt cgctgtcgct gcgcacttcc agcatcagtt     72120
     cgaccatgcc gggcacggcg ttgggcgcgt tgggcgtcat ggcgatgcgg ccgatggtgg     72180
     ccaccacgta gtgcggcttg ccgctctgcg tgctggcgcg gcggtgcgcc gcgtcgatga     72240
     cgcgcgccgc gcccaccagc gcgtcgcggc ggatatccat gggcgtggtg ccggcgtggt     72300
     cgggctggcc gtgcacggtg atgagcacgc gccggatacc gacgatgttg gtgaccacgc     72360
     cgatcggcag gccgcggctt tcgagcacgg gcccctgttc gatgtgcagc tcgacgaagg     72420
     cggcggtctg gccggggccg cgcagcgggg cgcccagcgc gtccgggtcg ccgccgatgc     72480
     ggcgcagccc ctcggccagc gtctcgccat cggcgttgcg cgcggccagc atgtcgggcg     72540
     tcaactggcc gctcagcgcg cggctgccca cgcaggagat gccgtagtcg ctcggctctt     72600
     cggacaggaa gtcgatgact tcgaacgggt gctccagcgt cacgccctgc tcgtgcaggg     72660
     tgtgcgccac ttcgatgccg gccagcacgc cgatgatgcc gtcgaagcgg ccgccggcca     72720
     tcacggtgtc gcaatgcgag ccggtggcga tggggcggcg ggcggcgtcg cggccggggc     72780
     gcgtgcccgc caggttgccg ccggcatcca ggcgcaccgc caggccggcc gcctcgaatt     72840
     cggcgcgcag ccattggcgc gattgctcga acagcggcga gaaggcgcgt cgcgtccagg     72900
     gcacgtccgg caaggtcatg cgcgacaggg tttcgacgcg cgaccagagg cgctcggcgt     72960
     tcaggggagg aaatgtcgtg gtcatgggaa tgtcctgaaa agagagaagg gcggctaggc     73020
     gcgccgcagc agccccacgc ggtcgcggcg cagccagcgc tgcatcatga gcacggccac     73080
     cagcgccagg ccgatggcca gcccgctcca gacgcccacg ccgcgccagc cggcccagaa     73140
     cgccagcgcc gcgccgctgg gcaggcccac gccccaatag ccgagcgccg cgtacagcat     73200
     gggcacgcgg gtgtcgtgca ggccgcgcag catgccggcg cccagcacct gcgcgccgtc     73260
     gacgatctgg aagagggcgg cgaccgccag gtaggcggtg gccagccgca ggacctgggc     73320
     attggcgggg tcgccgatgt ccaggaaggc cgacaccagc aggccgggcg ccagcagcat     73380
     cagcgccgcg gcgatcgcca tgctgccgat gcccagcgag aaggcgcacc agccggcgcg     73440
     cgcgacctgg tcgggctggc gcgcgccgta cgcgtgtccc acgcgcaccg tggccgcctg     73500
     ggcaatgccg tagggaatca tgaacgtgac gctggcgatt tggatggcga tcgcgtgggc     73560
     ggccagctcc ggttcgccca gccagcccat caggaaggcc gcggcgttga agatggtgac     73620
     ttcgaacgcg gtggccgcgc cgatcggcag gccgagtttc cagaactcgg ccaggcgctg     73680
     ccagtccggt tgccagacgt cgccgaacag atggtagcgg cggaagcggc ggtccaggca     73740
     gaccacgccg accatgccca ggaacaggcc cagcgtggcc agcgcgctgg ccaggccggc     73800
     gcccaccagg cccagcgccg gcgcgcccag gttgccgaac accagcaccc agttgccgaa     73860
     gacgttcagc acgatcgcgg ccagcgcgat caggaaggcc gagcgcgggc gctgcagcgc     73920
     cgtcacgaac gagcgcagca ccaggaatcc caggaagggc ggcatggccc acatcagcgc     73980
     gcgcaggtag gcgccggcct gcgcggccag ctcggggggc tggtcgatgg ccagcaggat     74040
     ggcttcgccg tgccacagca gcaggcagcc cggcaccgaa tagatcaccg cggtccacag     74100
     gccctggcgc accgtgcggc gcacgtcgcg cacggtgttg ccgcgccggc ccagcgcatg     74160
     cgcgaccatc ggcgcggtgg ccgcgaccag gcccaggccg aagaattcga tggcggtgaa     74220
     caggttggcg cccagggcgc tggcagccag cgcctgtgat ccgagccgtc cgatgaagat     74280
     cacatcggta acagtcatgg ccatttgtgc cagattggtc agcaccagcg gcaggccgag     74340
     cgccagcgtg gcggcgagct cgcgcttcca ggcggcgcgg gctgtcgatc ggggcatgcg     74400
     ccctcccatt gattttgaat cgggatatta ccttttttcc tagggtaaac ccgggtttgt     74460
     ccccggctca tgcaactggc cgagttggtg gggccggagg tcgcaagtat gatgaggccc     74520
     attccaatgc tgctggcccg gccatgcccc ggccagcgtt gttacaccgc aggagaccct     74580
     accgatgaac aagccatccg aagtcaaacc cgtcgcgctc aacgtgcccg actatgtcaa     74640
     gcacagcggg ttgatcgcgt gggtggaacg gatcgctgcc ctgaccaagc cggaccgcgt     74700
     ggtgtggtgc gacggctcgc aggaggagta cgaccgcctg tgcgaacaga tggtccaggg     74760
     cggcacgatg cgccgtctca atccggccaa gcgcgccaac tcgtacctgg cgtgttccga     74820
     tccctcggac gtggcgcgtg tggaagaccg caccttcatc tgttccgagc gcgaggaaga     74880
     cgccggtccc accaacaact gggccgcccc gcaggccatg cgcgagacgc tcggcggcct     74940
     gttcgacggc gccatgcgcg gccgcaccat gtatgtggtg ccgttctcga tggggccgct     75000
     gggctcgccc atcgcccaca tcggcgtgga gctgagcgac agcccctatg tggtggtgaa     75060
     catgcgcatc atgacgcgca tgggccgcaa ggtctttgac gtgctgggca gcgacggcgc     75120
     cttcgtgccg tgcgtgcaca gcgtgggcat gccgctggcc gaagggcagc aggacgtggc     75180
     gtggccgtgc aaccccacca agtacatcgt gcactacccc gagacgcgcg agatctggag     75240
     cttcggttcg ggctacggcg gcaacgcgct gctgggcaag aagtgcttcg cgctgcgcat     75300
     cgcctcgacc atgggccgcg acgagggctg gctggccgag cacatgctga tcctgggcgt     75360
     gacctcgccc aagggccgca aataccacgt ggccgcggcg ttcccgtcgg cctgcggcaa     75420
     gaccaatttc gcgatgctga tcccgccgca cggcatggac ggctggaagg tcaccaccat     75480
     cggcgacgat atcgcctgga tcaagcccgg cccggacggc cggctgcatg ccatcaatcc     75540
     cgaggcgggt tacttcggcg tggcgccggg caccagcgag aagaccaatt tcaatgccat     75600
     ggccatgctc aaggccaacg tgatcttcac caacgtggcg ctgaccgacg acggcgacgt     75660
     gtggtgggaa ggcatgaccg acacgccgcc ggcgcacctg atcgactggc agggccagga     75720
     ctggacgccg gccatcgccg ccgagaccgg ccgcaaggcc gcgcacccga acgcccgctt     75780
     cacggcgccg gccgcgcagt gcccgtccat cgaccccgaa tgggaaaacc ccaagggcgt     75840
     ggcgatcgac gccttcatct tcggcgggcg ccgctcgacc accgtgccgc tggtcaccga     75900
     ggcgcgcaac tgggtcgagg gcgtctacat ggccgccacc atgggctcgg aaaccaccgc     75960
     cgccgcggct ggccagcaag gcgtggtgcg gcgcgacccc ttcgccatgc tgccgttctg     76020
     cggctacaac atgagcgact acttcgacca ctggctcaag ctgggccgcc gtctcgaaga     76080
     gaccggcgcc acgctgccgc gcatctactg cgtcaactgg ttccgcaagg gaccggacgg     76140
     caagttcgtg tggccgggat tcggcgagaa catgcgcgtg ctgcgctgga tgctgggccg     76200
     cctggatggg caggccggcg gggtcgacca ggtgttcggc atctcgccgg cctacggcga     76260
     tatcgactgg accgggctgg aattcagccc cgacaagttc gagcaggtca tctcggtgga     76320
     cctgccggca tggcgcgccg agctggcgct gcacgacgag ctgttcaccc agctggccgc     76380
     gcgcctgccc gaggatctgc cgttgacgcg taccgccatc gagcggcgca tggcggcctg     76440
     aggccggagc ggcgcggcgt ttcgccgccg cgccggcgcc gctttgcggc acaatcgcgc     76500
     catgaccttg acttccgacg acctgcgcca gatcgcggcg ctgacgctgg cccattacga     76560
     cgacaacgct gtctcgttcg aggtcggcac gcgcgaccac gacgtaagcc agaacatcgc     76620
     ggccctgctg cgccatatac agggcgatcc gccgtatgcc atcctggact tcggctgcgg     76680
     cccgggccgc gacctcaaga cgttcgcggc gctggggcac gcggccgtcg gcctggacgg     76740
     cgcggcgcac ttcgtggcca tggcgcatca ggccaccggc tgcgaagtgt ggcagcagga     76800
     tttcctgcgg ctggcgctgc cggccgggcg tttcgacggc atcttcgcca acgcgtcgct     76860
     gtttcacgtg ccgacgcagg aattgccgcg cgtgctgggc gagctgcgcg acacgctcaa     76920
     gccgggcggc gtgctgttct gctccaaccc gcgcggcggc aacgaagagg gctggtcgcg     76980
     cggccgctat ggggtgtggc atgactggga gtcgtggcgc gcgctgctgg aagcggcggg     77040
     cttccaggcc ctggagcact attaccggcc cgccgggctg ccgcgcgagc agcagcaatg     77100
     gctggccagc gtatggcgca ggtagcgggg ttcgcggccc tggcgcgcgc cgacgcgcgc     77160
     gtgctggtgc tgggcagcat gccgggcgtg gcttcgctgc gggcgcagca gtactacggg     77220
     catccgcgca atgcattctg gccgatcgcc gccgagctgt tcggcctgga cgccgcgcag     77280
     ccctatgccc accgcgtgca ggccctgcag cgggccggcg tggccctgtg ggacgtgctg     77340
     caggcctgcg agcgcccggg cagcctggac gccgccatcg tcgccgatag cgtgcgcccg     77400
     aacgatttcc aggccttctt cgcctcgcat ccgggcatcg cctgcgtggg cttgaacggc     77460
     gcggccgccg cgacgctgta tcgccgccac gtgctgccgc gcctgcacgg cctggcgcat     77520
     ctgcgctacg tggcgctgcc gtcgaccagc ccggcccatg cagcgatgga tttcgccgcc     77580
     aagctgcggg cctggcgcgc gatcgcgccg gcgtcatccg acccttcggc gtgtctgtcc     77640
     ccgtaggggg gaacgacgcc tgcggccagg gtgcctgtcc ccctgcgggg acaggcaccc     77700
     tgcggagaca ggcaccctgc ggagacaggc acctgcaaga tttcacggcg tctgcccgtg     77760
     cgtgtgcctg tccccgctgg ggcaggcacc gctggctatg ccaggcgtcc gtagatctcg     77820
     cgcgcctgcg cggcggtggc gatgggccgg cccagcacgc ggccagcctg cgcggcctgg     77880
     gccaccaggg cggcgttgcc cggcgcggtc gcgccgtcgc tcagcttgag gttgttctcg     77940
     aagcccaccc gcatatggcc gccgaacgcg gccgcggtgg ccacgcaggc gttctcttcg     78000
     cggccgaagg cgcacacggc ccagggcagc gatccgtcgt agacctcgag aaagggcagc     78060
     aggtcgcgcg gcgaggacac ctggccggcc gagtagcggc ccagcacgaa cagcaccgac     78120
     caggctcctt caggcgccag gccgcgcgcg cgcagcgcct gccacctggc cacgtcggcg     78180
     gcgtcgtaca ggatgatctg cgccatgatg cgttcggctg cgacccaggc caggaagtcg     78240
     gccagctcgc gttctggcat ctcgggcacg gcgatctcgc gcaggcccat cgaaacggct     78300
     tcggggcgca gttcgcgcac catggccatc tgctcggcgg cgcggtagac gccagccgct     78360
     tcgctggtga cctgcaccag cagttcttcg cccacggcct ggcgcaccgc cgccagcgcc     78420
     tcgcggtagg ccgccacgtc cagcgaatgg cggccttcgg gcgtgcgcac atgcatgtgc     78480
     atcatggccg cgccggcgtc caggcaggcg cgcgcctcgg ccgccagcgc cgccgccgtc     78540
     agcggcacgg cggggtggtc ggcggcggtc ttgtaggcgc cattgggcgc caccgtgacg     78600
     atcaggggcg agtcggccag cgcggcctgc gcgcccgcgg cgaacagcga cgggctcatg     78660
     gctggatctc cggcagctcg gcgccgagca ggtccagccc ggcgcgcagc aggcggtcgt     78720
     agcgggcgcg ctcggcggcg atggtctcgg gcgtccatgc atagaagccc gtgccggcct     78780
     tcatgccgtg gcggccgtcg gcggcgcgct cggtcaggca gcgcgccggc gtatcggcgt     78840
     tgcagaacgt tgggtacatg gtcgcgccgg cggccgcgtg cacgtcgatg ccggcatggt     78900
     cgcgctgcat gaccgggccg gcggccagga agcggaagcc gaaaccgaaa cgcaccgccg     78960
     cgtccacgtc ctcgggcgag gcgatgccgc ggtcgatgag atcgaaggct tcgcgcgaca     79020
     gggcgtgctg caggcggttg gccagaaagc ccggcaggtc ctgcgcgacc ctgaccggca     79080
     ccatgccgca gcggcgcatg aaggcgatca ggacgtcggc gcaggccggg tcgctggcct     79140
     cgcacagcac cacctcgacc agcggcacca ggtgcgccgg catgaagaag tgcaggccca     79200
     gcatgcgctc gcgcgtgggc aggccggcgc cgatggcgct gatcgggaag ctggagctgt     79260
     tgctggccag gatggcgtgg gccggcgcgc ggcgcgccag ctcggcgaac agcgcctgct     79320
     tgatgtccag gcgctcggga acgcattcga tcaccaggcc gaccgagtcc cattcgaccg     79380
     cgtccaggcc gggcacgacc gcgatgtgcg cggcgccctc ggcgcggccg gcctgcgcca     79440
     ggttgtcggc ggcgcggcgc ggcagcgcgg cggcgcgcgc ggcgtcgggt tccaccaccg     79500
     tggtgcggca cagcgcgcgc gccagcacca ccgccacgtc ggcgcccatg gtgccgccgc     79560
     cgatgacgac cgcatggctg gcgccgggac ggcccagcgc ggaatcggga gagctcatgt     79620
     tgttccttct cgcaggagtg ttcgcaatgc cagccagtgt agggaaacgg ctttgattga     79680
     tgaatcagat tttttggata gaatgatcga taaattagat cagtgaggcg ccgtgaagat     79740
     caatctgtcc atgcgcgata tcgagaccgt cctggtattg ggccgcacgc tcaatttccg     79800
     gcaggcggcg gcgcagctgc acctgtcgca atcggcactg tcgacccagg tgctgcgcat     79860
     cgaggaggcg ctgggcgtgc gcctgttcga ccgcaccacg cgcaccgtgc ggctgacggc     79920
     cgccggcgag gtgttcatgc agcaggccgc ctcgctgcag gtggcgtttc gcgaggccat     79980
     cgacgcggtc agcggcatcg ccagcgccga gcacggccag gtggcggtgg cggcgctgcc     80040
     gtcgctggcc gcgcgcctgc tgccgcgcgt gttgatggcg taccggcagg cccatcccgg     80100
     ggtggcgctg aaagtgcacg acacgctgtc gggcccggcg ttcgacctgg tgcgcgccgg     80160
     cgaggtcgac ttcgcgctga ccgcggccga tccgcagcag gcggacctgc actatgtgcc     80220
     catgatgtcc gacagcttca tcctgctgat cccgcaggac cacgcgctgg cgcgcggcaa     80280
     ggggccgctg cgctgggccg atacgctggc cgcgccgcac gtgtcgatgg tgcatccgag     80340
     cagcgtgcgc cagtacgcgg agtgggcctt cctgcagaac cgcatccgtt tccagcccgc     80400
     cttcgaggcc gagcacctgg ccaccatcgt cgccatggtg gagtgcggct tcggcgtggc     80460
     ggccctgccg gagatcgccg ccgccgcggt ggcgcacagc ggcatcgtcg agcacccgct     80520
     gaccgggccg gtggccgagc gctccatcgg cctggtgacc tcgcgcaacc gtaccttgtc     80580
     gccggcggcg gccgcgctgg tggcgcagct gcgcgagcac ctggccgcct cggcgtacaa     80640
     gcccgcgccg gcggccccta gcgcacgtac gacggcagca agagcgagat cgagggaaac     80700
     agcaccagga tcgccaggcg caccacgtcg ctgaccacga acggcatgac gccgcggaag     80760
     atcgtgggcg tggacacgcc gggcagcagt ccgcgcagca cgaacacatt catgccgaag     80820
     ggcggcgtga tgaagctgat ctcggtgacc accaccacga tgacgccgaa ccagatcagg     80880
     tcgaagccca ggctctgcac cagcgggtag aacaccggca ccgtcagcag gatcatggac     80940
     atgctctcca gcacgcagcc cagcacgatg tagatgacgc agatggccag gatcaccgtc     81000
     agcgggctga gctggtggcg ggcgaccacg tccagcaagt cctgcggcag cgaggtgaag     81060
     ttgatgaaat tggccagcat cagcgcgcct atcatcacca cgaagatcat gccggtggtc     81120
     ttggccgatt cgaccaccac gtccaggaag cggcgccacg tcatggcgcg ccggctgcag     81180
     gcgaacagga agctgaggaa ggcgccgacg ccggcggcct cggccggcgt gaacaggccg     81240
     ccgtagatgc cgcccagcag catgccgatc agcgccagca ccatccagac ctgccgcagc     81300
     gcgtgcaggg tatgcggcca ggtgctgcgc gggccgcgcg gccccgcggc cggatcgcgg     81360
     cgcaccaccc aggccaccgc cgccatgtag cacaggatcg ccagcacgcc gggcagcacg     81420
     ccggcggcga acatcttgcc gatgctctgt tcggtcagca ggcaatacac caccatgatg     81480
     atggaggggg gaatcagcac gcccagcgtg ccgccggcgg cgatcgaacc ggccgccagc     81540
     ttctcgctgt agcccatgcg gcgcatttcc ggataggcga ccttggccat cgtcgcggcc     81600
     gtcgccaggc tggagccgca gatggcgccg aaaccgccgc aggcggcgat ggtggacatc     81660
     gccaggccgc cgcgccggtg gcccagcagc gcgtgggcgg cggcgtacag ttcgcgcgac     81720
     atgcgcgatt cggtgacgaa gttgcccatc aggatgaaca gcggcagcac cgacagcagg     81780
     tactggaagc cgctttcgta gatcaccgag ccggccatgg cgtaggcggg cggccagccg     81840
     cgcagcaggc ccaggccgac gaagccgacc agcgccatgg cgaaggccac gggcacgcgc     81900
     atgaaaacca gcgccagcat ggcgcccagg gcggataggg attcaatcat cttgggtcgg     81960
     ttccggctgc gtagcggcag gcccgaccag ggccgccagc cggtaggcgg cgtccagggc     82020
     cagcagtacc gccatggcgt atacgaaggg tgccagggga atgttgagca tgggcgtcat     82080
     gtcgccgtag tcggcggtgc tctgcgcctt gcgcagcgcc acccaggcca ggcaggcgct     82140
     gaccgtcagc gccagcaggc cggccacgca gtcctgcgcg cgcagggtcg cgggcgagaa     82200
     caggtggctg aagctgtcga ccgtgatgtg gccgcgcgcg cgggtcacca gcgggatgct     82260
     ggcgaagatc accgccacca tcagcagctc gaccatctcg acggtgccca tgatgggacg     82320
     gttgagcagg tagcgtccgg tggcgtcggc caccgtcagc aggctcatgc cgcacaggct     82380
     gatgaccacg atggcgcgca gcagggccgt gacggcccgg tccaggatcc gcatggcgcg     82440
     cgctcagcgt tgctggtcca gctgcttgat ctcggcgcgg aacgacgcca gcgcggcggg     82500
     cccgtcgatg cccttggcct tggccgcgtc cagccatgcc tgctcgaacc ccttggtgcg     82560
     ttcgcgcacg gcctcgatca gcgcgtcgtc ggccttgacc agttcgatct cgccgccttc     82620
     gagcaccttg cgcgcggccg cgtcgtgcgt gtcccaggcg cgtccggcca gctcggccag     82680
     gtggcggccc gacaggcgca ccagcgtgtc ctggtcctgc ttggacaggc gcgcgaaggc     82740
     gtcgcggttg atgatgactg cgtgcgtgtc cgaatacagg ccgccgggga attcggtggc     82800
     gtgcctgatg atgctgtcca gcttgaacga caccagcgat tcggccggga agaacacgcc     82860
     gtcggccacg ccggtgctga gcagttcgta cgactcgggc gccggcttgg cgatgggact     82920
     ggcgcccacc gccttggcca cgtcggccgc catgccgccg ccgacgcgga tcttcaggcc     82980
     ctggaagtcg ccgatctgct tgaccggctt gctggtggtg aaggcgatgc ccgggccgtg     83040
     cgcgtagatg cccagcaggc gcacgccctt gtgctcgtcg gccttgagca ggtatttctc     83100
     gtaggtgtcc caggccgcga tggagcgcga ggtcgcggtg tcgccggaga acggcagcac     83160
     ggcgaacttg gtcagctgga agcgcccggg gtaataggcg tgcgagacga aggtcacgtc     83220
     gaccaggcca tcgcgcacgg cgtcgaagtg gccggccggg ttggtgaccg ccttgggcag     83280
     caggcgcagc gtcacgcggc catcggtggc cttgcggatt tcctcgcccc agggcatgag     83340
     gaagtccgcc acgaccgcat gggtgggcgg cagccagctc gacagggtga gctcgaccgg     83400
     cttttgcgcg atggcggggg ccgtgcccgc aaggccaagg gcgaacaggg cggcggcgag     83460
     ggtcttgtgc atcatgtctc cttgttttat gggatggccc gctcggcggc gggccgttgg     83520
     tgcgacagga tcaaggcggc gggccgacgg cccgctccag cagcgccggc aggctgctgt     83580
     cgtggcgaaa gcccgccgcc tgcgcggcat cgcattgcag gggcggctgg ttgccgaact     83640
     gcgcctcgat atccgggcgc ggcgtgtaac ttaccaacgg cgtggccgcg ccctggctgc     83700
     gcgcatcgaa ggcctgcacg atgtcgcgca ccgacacgcg tagcgccggc agcgtccagc     83760
     cggtgcgccc gccgggcggc ggcgcctggg cggtcagctc ggcggcgcgc agcaggttgt     83820
     ccacgcagca cggcagcgac atcagccaca gcgtggcctg cgggccgacc ggcatttcgc     83880
     aaggctggcc cgccgccagc gcgcgcagca gcgtgctgga gaaggccgac caggcgccgt     83940
     tgggcgccgg cgggcggggc gccacgccgg gcaggcgcac ggcgcgcccg cgcacgaagc     84000
     cgcgccgggt gtagtcggcc aacaggattt cgactgcctg cttctgcgcg ccatagctca     84060
     gcgccggcgc cagcggcgtg tcgtccgtga cgagcgcggg cagcggcgcg ccgtagacgg     84120
     cgatgctgct ggtgaacacc agtccgggcg agcggccctg gcggcgcagc tgctccagca     84180
     atcgcagcga tccttccagg ttgacgcgca ggcccagctc gaactccagc tcggcgcgtc     84240
     cgctggcgac gcaggccaga tggaacacca ggtccggcgg cggatcggtg atggccgcca     84300
     gcgtggcggg gtcggcgaag tcgccggcca cctggcgcac gcgcgggtcg gccggcgcgg     84360
     cgtcgaaggc caggtcgcac agcgtcagct gttcgagcgc gccatagccg ggcacgccgg     84420
     gcagggcgca caggcgctcg gccagggcgc ggccgatata gccgttggcg ccggtgatca     84480
     ggacgcgcat gccgcacctc cgctgccgca ggcggcgtcg taggcgccgc gccaggcctt     84540
     caggccggcg ctggccaggc cgcgcggcgt gtactcgcag cccatccagc cgccatagcc     84600
     gctttgcgcc agcaggcgca gggtggcggc caccggcggg ctggccggat cgggttcgtg     84660
     gcgcccgtcg gggccggcga actgcacgtg gcgcaccagc ggcagcacgc ggcgcagctc     84720
     ggcgtgcggg tccagccctt cgcgcaggtt gtgatagatg tcgaactgca ggccgacgtt     84780
     cggatggtcg accgcgcgga tgatgtcggc ggcctgctcg ggcaggtaat agaaatagcc     84840
     cggcatgtcg gcgcggttga gcggctccag ggtcagcgtg acgccggcct gggcggcgcg     84900
     cggcgcggct cgctgcaggt tgccgatcag cgtggcgcgg cattcgtcca tgccggcggg     84960
     cgccggcggc atgcccgcca tggcgtgcac gatgcggcag ccggtggcgc ggcacagcgc     85020
     cagcgcctgg tccagcgcgg ccccgaaatc ggcttcgcgc ccgggcacgc aggccaggcc     85080
     tttttcgccg gccgcgccca gcggcgtgtt gaccagcgcc agggccaggc cgtgctcgcg     85140
     cagctgcgcc gccaattgcg cgggcggctg gtcgtacgga aacaggatct ccactcccgc     85200
     gaagccgtct tcgcgcgcgg cggccatgcg cgcggccagc ggcaggccgg ggtacagcag     85260
     tgtcaggttg gcggccagtt tcatgcgggc tccctggtgg gcgcggcggg ccgttcgggc     85320
     cacgccacgc gcacgatgtc ggacaggtcg ccggggccca ggccgcgcgc ggcggcggtg     85380
     cggtagctgt cgagcacgcc ttgcagcccg cgcagttgcg tgccgctggc ggcggccagg     85440
     gcggccacgt tctccaggtt tttcagcatg gtctgcaggg cgcccagcgg ctggtcgacg     85500
     ggcgcggtca tgcgcggcac gaagatgcgc agcaagaccg aatcggccca gccgccggcc     85560
     agggcggtat cgagggcggc gacgtcgatg ccgttgcggc gggccagggc cacggcctcg     85620
     gcgatggcgt tgaccgtggt ggccacgatg gtctggttgc acagcttgcc gatctggccg     85680
     gcgcccgtat cgcccagccg cgtcacgcgg ccggcgtagg cgcgcagcca gggttgcgcg     85740
     gcctcgatcg ccgcggccgg cccgcccgcc aggatggaca gcgtgccggc ctgcgcgccg     85800
     gccacgccgc ccgagaccgg cgcgtcgatc catacgcggc cgctggcggc cagcaggcgc     85860
     gcggccagcg cgcgggtggc gtccggctcg atgctggagt ggtccaccag caggccgccg     85920
     gccacgtcgg ccacgccgtg cggcccgaac accgtggcct gcaccgcggc caggtcggtc     85980
     aggcacagca acaccgcctg cgcgcccgcc gccgcttcgg ccggcgtggc gcagaccacc     86040
     gcgccgtcgg ccgccagcgc ctgtgccttg gccgcgctgc ggttccatac gcgcacccga     86100
     tggccggccg ccagcagccg ccgtatcatc ggcgcgccca tcaggccggc gccgcagaaa     86160
     gccagggtgg cgctcattcg gcctccggcg tttcgtaagg ccaatcgacc tggccggagt     86220
     gggtgaccgc gcccaggcag gccgggcgca ccagcgcggc gtatttctcc agcgcgccgg     86280
     ccaggcgcgc ctgcggcggc gcctggtagg cggcgcggcg ccgcgccagc tcttcgtcgg     86340
     acagcgccac gtccagcgta tcggcctcgg cgtcgatgtg gatcatgtcg ccatcgcgca     86400
     gcagcgcgat ggggccgccg gcggccgctt ccggcccggc gtagccgatg cacaggccgc     86460
     gcgtggcgcc cgagaagcgg ccgtcggtca gcagcgccac tttctcgccc atgccctgtc     86520
     catacagggc ggccgtgacg ctgagcatct cgcgcatgcc cggcccgccc cgggggcctt     86580
     cgttgcggat gaccaggact tcgcccggct ggtaggcgtg cgtggacacc gcgcgcatgc     86640
     aggcttcctc gttctcgaac acgcgcgccg gcccggagaa tttcagcgac ttcaggccgg     86700
     cgatcttcag cagcgcgcca tcggggctga gattgccctt gagcacggcg acgccgccgg     86760
     tggggtgcag ggcctggccg caggcgcgca ccaccttgcc gtcgggcgcg ggcgtgtcgg     86820
     ccagggcctc ggccagggtg cggccgtcga gcgtcagcac gctgccgtcg atatggccgc     86880
     cgtccagcag cgccttgagc accaccggca cgccgccggc ctcgtgcagg tcgcgcgcca     86940
     gatagcggcc gccgggttgc aggtcggcga tcagcggcgt gcgcttgaac acccgggcca     87000
     cgtcgtccag cgtgaaggcg atgccggcct cgtgcgcgat ggcgggaatg tgcagggccg     87060
     cgttggtcga gccgccggtg gccgccaccg cggcgcaggc gttctccagg ctggcgcgcg     87120
     tcaccagctg gcgcggcagc gggccgcccg cggccagggc gcgcatcacg tgctcgccgg     87180
     cgcgctgcgc gatggccagc cgttcgctgt agaccgcggg catcatcgcc gaacccagcg     87240
     gcgacaggcc cagcgcctcg cccaccatgg ccatggtgtt ggcggtgaac tggcccgggc     87300
     acgagcccgc cgagggcgta caggtgcgct ccatcgcctt gagctcggcc gccggcatgg     87360
     tgccgtgctg tacccggccg acggcttcga tggtgtcgag gatggtgacc tggccgctgg     87420
     ccgcatggcc gggcagggtg gcgccgctgt acaggaacac cgccggcacg ttcagccgca     87480
     cgatggccat catcatggcc ggcagcgtct tgtcgcagcc ggcgaacgcc accagtgcgt     87540
     cataggcgtg gccgcgcacc accagctcga cgctgtcggc gatggtctcg cgcgacagca     87600
     ggctcatgcg catgcccgca tggttcatcg aggtgccgtc ggagatcgag atggtcgaga     87660
     agctgaccgg cacgccgccg ccggcggcca cgcccaggcg ggcgcggtcg gcctgcggcc     87720
     ccagcgccat ggagcagggc gtgttctcgc cttgcgtgct cacgatgccg accatggatt     87780
     tctccagggc ggcgtcgtcg aagccggtgg cgcgcaggaa ggcgcgatgc ggggtgcgcg     87840
     tcaggccttg ggtaaccatg cgggaacggt gcttatgcag ggacatgaat cggttccatg     87900
     gaaaaggcga agaagggcgg cgccggctag ggcatggcgg gctgcagcgc ctgcagcctg     87960
     tcgaaggccc agctgatgtc ctgcgccatg accgcgcgcg cgctttcggc gtcgcgccgc     88020
     gcgatggcgt cgacgatggc ggcgtgcagt tcggccgagg ggcgctcgtc ggaatgcatc     88080
     agctcgcgcg tggcgcgcag gtagggcccg gactgcagcc acaggctttc gatggtggcc     88140
     agcatcgagt ccgagcgcgc ggcgcggtaa atggtgaagt gaaagcgctg gttgttctcc     88200
     agcccggcct ggaccgacgc cgtatcgctg agcgacctgc cgatctggtc ggccagcgcg     88260
     cgcagctcgg ccagttccgg cgcggtgatg tgctcgaccg cccaggcggt gacatggccc     88320
     tcgatcagca cgcgggcgcg gcggatgtcc tccaggctgg cgcgcgagat caccggcacg     88380
     cgcaccgagc ggctcttcat cggttcgagc gcgcgctgcg tgaccagccg gcgcagcgcc     88440
     tcgcgcaccg gcatggcgct ggtgccgaac gcatcggcca gttcctggat gccgagcacc     88500
     gcgccggcgg cgtagtcgcc gcgcatcagg tggtcgcgca ggcggcggta gatggcttcg     88560
     ttgacggagg tatggacgag cggatcgggg tgggtgagcg caggcatttg atctttaatc     88620
     aaagattttt cgctacgcta ccgggccggg aggcaaggcc gccatagggg tttgcccggc     88680
     cgttgcgtgt caggacgagg cgttcaggcg ctggcgcgca gtccggcggc ggccagatag     88740
     gcgtcgcgcg aaggcagcag atggttgcgg cacagggcca ccagggcggc gcggtcgccc     88800
     tggcgcagcg cctggatcat ggcccagtgt tcctggcgtg cgcgctcgcg gtagccggcc     88860
     gcggccaggc tgccgaagcg gatcgggtgg gtgcggcgcg cgtattcctc gatggcctgt     88920
     tgcagcaccg ggttgtcgag caggccgaac aattcgcggt gaaaccgctg gttgctgcgg     88980
     aacacgcgcc gcgcgttgcc tgcggccacc gcggcgtcgt gctcgcgctg cacggccacc     89040
     agcgcggcca ggcgcgcctc gtccacgggc agggcgatgc gctcggccgc gcgcgtctcc     89100
     agcagttcgc gcaggtcgta caggtccatg acttcgcgcg ccgtgaaggc gcgcacttcg     89160
     gcgcccacgt tgcgcttgcg ctcgaccgcg ccgcgctgtt ccagctgcgc cagcacctgg     89220
     cgcaccgcgt gccgcttcag cccgaagcgc gccatcagtt cgtcctcggt caggcgctgg     89280
     cgcggaaaca gccggccgaa gacgatgtct tcttccagct gttccaccgc caggtccagg     89340
     tccagggcgt cggcgggcgg cgggtcggcg ggcagggcgg tcagggtcat ggcggctcag     89400
     cgaggcggca cggtttgctt gctggcgggt gcgcgcagga agtcgaagtc taccccctgg     89460
     tcggcctgcg tgaccgtgtc gaggaacagc ttgcggtagc cccgctcggc ctgcggccgt     89520
     tcgatcggct gggcggccgc gcgctgcgcc agctcggcct cgctgaccag caggctgatc     89580
     tcgcgctggc gcaccgacag gcggatgcgg tcgccattgc gcacgtgggc cagcggtccg     89640
     ccgatggcgg cctcgggcgt gacgtgcagc acgatggtgc cggcggcggt gccgctcatg     89700
     cggccgtcgg atacgcgcac catgtccttg acgccggcgc gcgccagctt gcgcggaatg     89760
     ggcatgtagc ccgcctcggg catgccgggc gcgccggtgg ggccgatgcg cttgagcacc     89820
     aggatgtcgt cggccgtgac atcgagcgcg tcgtcgtcga tgcggcgcgc catgtcttcg     89880
     gcgtcctcga acaccacggc gcggccttcg tgctccatca gccgggcgtc ggcggccgac     89940
     tgcttgatga tggcgccgcc cggcgccagg ttgccgcgta gcaccgccag cccgcccacc     90000
     gggtagatcg gggcgtcgaa ggcgcggatc acctcctgcg cgaacggcgc gggcgcggcg     90060
     tcgagctctt cgcccagcgt gcggcccgag acggtgaggg cgtccaggtg cagcagcggg     90120
     cgcagttcgc gcagcagcgc cggcatgccg ccggccttgt ggaagtcttc catgtagtgc     90180
     tggcccgagg gcttgagatc caccagtacc ggtgtctcgc ggctcatgcg gtccaggccg     90240
     gtcaggtcga tgtcgatgcc caggcggccg gcgatggccg tcaggtgcac gatgccgttg     90300
     gtcgagccgc cgatggccag cagcacgcgc aacgcgttct cgatggcctt gccggtcagg     90360
     atgcgctcgg gcgtcaggcg cgccgcggcc atggccacgg cggtggcgcc ggtgcgttcg     90420
     gccacgcgga tgcggtcggc cgtgaccgcg ggcgccgagg cgccgccgct gatcatcatg     90480
     cccagcgcct cggtcaggca cgccatggtg ctggcggtgc ccatcaccga gcaggtgccc     90540
     acgctggcca ccagctggtt gttgacgtcg gtgatctcgg cggtgtcgat ttcgtcggcg     90600
     cggtagcggc cccagtagcg gcggcaatcg gtacaggcgc cgacccgttc gccgcggtgc     90660
     gagccggtca gcatcgagcc ggtcaccagc tggatggccg gcacgccggc cgaggccgcg     90720
     cccatcagct gcgcgggcac cgtcttgtcg cagccgccga tcagcaccac cgcgtccatg     90780
     ggctgggcgc ggatcatctc ttcggtgtcc atcgacatca ggttgcgcag gtacatgctg     90840
     gtgggctgcg agaagctctc gtgcaccgag atggtgggaa agtccaccgg cagcccgccg     90900
     gccagcatca cgccgcgctt gaccgcctcg accagctgcg gggcgttgcc gtggcagggg     90960
     ttgtagctgc tgccggtgtt gacgatgccg atgaccgggc gcgccagcgc gtcgtcggta     91020
     tagcccgcgc ccttgatgaa ggccttgcgc aggaacagcg aaaagccggt gtcgccgtag     91080
     ttggtcaggc ccttggacag gccgccgggc ggcttgccgc cttggtcgcg ctgggtcatg     91140
     gaacacctcg ataatattat tgataatcgt ggcggctatc atagccagcg cgcaatccag     91200
     gccgcaagcg aattccagga ttttctttat tgatctgtta tatagatcat tcaatagaaa     91260
     aatacgtatt catcaatcaa gaaatggcgc ctacactgcg gccaaagcga gcggggcgcc     91320
     tgcacccgct ccgtccagat ccaccacccg gcacacagga ggagaacatc catgtccgac     91380
     cgtcaatccg cgcgcctgcc gcgccgcgcc gccctctgtt ccatgctggc gctgtgcgcc     91440
     ggtttcgcgc tgcagcccgt cgccgcgcag agcgcctacc ccgaccgtcc gatccgcatg     91500
     atcgtgccgt accccccggg cggcgccacg gacgtgatcg gccgcgtgct ggccaaggaa     91560
     atgagcggtg cgctgggcca gtcggtggtg gtcgagaacc gcgccggcgc ggccggcaac     91620
     atcggcgccg acgtggtggc caaggccacg ccggatggct acaccatcct gatgggcgcc     91680
     atgaccagcc acgccatcaa cgccgtgctc taccagggcc gcgtgtcgta cgacatcgag     91740
     aagagtttcg cgcccgtggc catcgtgggc acggtgccgc tggtgttcgt ggtcaatccc     91800
     gccgtgccgg ccgattcgct gcaaagcctg atcgcgctgg ccaagtccaa gcccggctac     91860
     ctgaccatgg cgtcggccgg caacggttcg ccgcagcacc tggccggcga aatgttcaag     91920
     cgcgtggcgg gcgtggacct gctgcacgtg ccgtacaagg gcagcggccc ggccatgacc     91980
     gacctgatgg gcggccaggt gctcagcatg atcgagaccg tgccggcggc gcagggcaac     92040
     gtcaagggcg gcaagctgcg cgcgctggcg gtggcctcgg cgcagcgcgt cgaatcgctg     92100
     cccgacgtgc cgaccacggc cgaggccggc ctgcccaatt tccaggtcag ttcgatgttc     92160
     ggcatcgccg cgccggccgg cacgccggtc ccggtggtcg agcgcctgaa cgccgtgctc     92220
     aaggaagcgc tggccaagcc cgaggtgcag accgccttgc tgaaccaggg cgccatctcg     92280
     acctggacca cgcctgccga cgccgccgcg cgcatcagcg ccgagcgcca gcagtgggcc     92340
     accgtgatcg ccgaagccgg cgtgaaggcc gagtaagccc ggcagcgggt caggcggcgt     92400
     ccagccgctg cctgccccgc accaggtcgg cgcctttctc gccgatcagg atggccgcgg     92460
     cattggtgtt ggccgatacc atcgccggca tcaccgacgc atcgatcagc cgcagccggt     92520
     ccaccccgcg cacccgcagc tcgggcgggg tccaccaccg aggccgggtc gccgcccatg     92580
     cggcacgaac cgctggcgtg gaagaccgtg ccgccgcgcg tgcgcgcgaa ctgttccagg     92640
     tcggcatcgc cgcggatggc tgcgcccggc atgtattcct cgccgctcag gtgctggcga     92700
     aacgccggct ggtggtagat ctcgcgcagc agtttcaacc ccgccaccag caccttgata     92760
     tcgtgcgggt cggtcaggta gttggcgacg atgcgcggcg cctcgaacgg gtcggcgctg     92820
     cgcagcgcca ccgtgccgcg cgacagcggc cggcactgcg tggccgacgc cgaaaagccc     92880
     gagaagccat gcagcgcgtc gccgggcttg tccaccgaca acggcatcac attgaacagc     92940
     acgtcggcgc gcccgtcgcg cgcgtgctcg ctgcacacca tgccgcccac ctggccggcg     93000
     cccacggtca gcggaccatc ctggcgcagc agccagcgcg cccatgccca gcatcttcag     93060
     gggcttgcgc acgtcgtcgt tgagcgagag cggatgcttc agtttgacga tgacgcgcgc     93120
     ctggtagtgg tcctgcagat tgcggccgac ttccggcgca tccacctgca aggcgacgcc     93180
     gtggcggcgc agcagttcgg ccgggcccac gcccgacagc tgcagcagct gcggcgattg     93240
     cagcgcgccg gcggccagca gcacctcggc gtcggcctgc gtccgcaccg gctggccgcg     93300
     ccggcgttcg tccacccatt ccacgccgcg gcagacgccg ccgtcgatca gcaggcgcgt     93360
     gacgcgcacg ccggtcagca cggtcaggtt gggccggccg cgcaccggat gcaggaacgc     93420
     ggtggcagcg ctgcagcgcc agcgtccctt gagggtgagc tggtaattgc ccaggccgct     93480
     gtcgcgcgcg ccgttgaaat cgggattggg gtcgaagccg gcctgcagtc cggcctcgac     93540
     ccagtcgcgg cacagcgggt ggtcgttgcg caggtccgag acgcacagct cgccggcgcc     93600
     gccgtggtat tcgctcgcgc cgccgctgta gcgctcggac ttgcggaagt agggcagcac     93660
     gtcgcgatag ccccagccct gcgcgccggc gcgcgcccag tcgtcgtaat ccgcgtgctg     93720
     gccgcggatg tagatcagcc cgttgatcga actggagccg cccagtacgc ggccgcgcgg     93780
     ccagacgatg gggcgctcgc ccgtctcggc ctggggctcg accggaaact gccacgagaa     93840
     gcgcggatcg tagatcgagc ggaagtaccc caccggtagg cgcagccaga agttgcggcc     93900
     ctcgccgccg gcctccagca gcagtacgcg gcaggccggg tcggcggtga ggcggttggc     93960
     cagcacgcag ccggccgagc cggcgccgac gatgatgtag tcatacgaag cgcagagggc     94020
     gggcggcatc ggatcctggg cgcgctcagg cgcgcacggc ctccaggtag ggtttgggat     94080
     cgaaatagcg ctcggccggc accggctggg cgatgttggc gctttgcacg aagaagtcgg     94140
     tgacctgctg cagccacctg gtcaccgtgc cgtcggcata gcgctggcgc cattcggccg     94200
     cggtgaaata cttcgacgcc ttgaactgct ctttcaggtc cggcagcggg acttgctggt     94260
     agtggttctt ctgcaaggcc accagagcct cgtcggtatg cgacagcagg tagtcgttgg     94320
     tctcggccca ggcctggatc agggcattga tgatcttggg gttcttgtcg tagtagtcgt     94380
     tgcgcgccgc ccagccgccc acgatggccg cctcggggta gaaggtcgag gcgtcgagca     94440
     gcttgcgcgc gccgggcagc ttctggcgga tggtcacgtc gaacggcacc cacagcgcca     94500
     ccgccggcac cgcgcccgaa atgaacgagg tgacggcctc ggccatgcgc tggttgacga     94560
     tctgcacgtc cttgccggcc tgcaggccga cgctgcgcag ggcgcggtcc aggaacacgt     94620
     gcgcggtggt gccggtggtg gtcgagatct tcttgccctt gaggtcggcc agggtcttga     94680
     tgcccgcgtc gtcgcgcacc cacagctggg cggtggcgta ttcgatattg ttgaccagga     94740
     ataccttgcc ttgtccgcgc gccgggaagt tcgacaccac cgcgccggtc gagagcatgt     94800
     ccaggctgcc gcctatcatg gcctggaaca gttccaggcc ggtggtgaac tggatcagtt     94860
     ccaggtccag cccgtgcttg gcgaacgcgc cggtctgctg cccggtccag atctggccgt     94920
     cgacggccgg cgtatgcaga tagccgacgc gcaccttgtc gcgggcgcgc gccagggagg     94980
     ggatgccgat gccggccatg gcggccgcca gggcgccggt cttgagcaag gttctgcgct     95040
     gcgggttcat catggtgtgg ctcctcgagt gggcttcaat cggacaggcg cacggtctgg     95100
     cgcgcctgct tggcatactc ttccatgacc agcgcgcgga tgtgcgagcg cagctcgcca     95160
     aagcgcgggt cctcgtgcag gttctcggcc cgggggtagc cgaacggcac gtcgatgatg     95220
     gtgcggatgc gcgccggccg cgcggtgacc accacgatgc gcgacgacag gtagatggct     95280
     tcctcgaccg aatgcgtgat cagcatgacg gtcttgccct cggtcatctg cacctgcagc     95340
     agcaggtcct gcatggccga gcgggtttgc gcgtcgagcg cgccgaacgg ctcgtccatc     95400
     agcaggaact gcggcttgac cgcataggcg cgcgccagcg ccaggcgctg gcgcatgccg     95460
     ccggacaggt gcttgggata gtggtgggcg aagtcgctca ggcccatcag ggtcatgtag     95520
     cgctggcaga tctgcgcccg ttcgccggcc gccacgcggt tgctgcgcag gttcaggccg     95580
     aaggcgatgt tctcgcgcac cgtcagccac gggaacacgc cgtattcctg gaagatcacg     95640
     ccacggtcgg gcccgggccc gccgaccggc tggccgtcga gcagcacgcg gccggcggtg     95700
     ggctgcacga agccgcccac cagtcccatc atggtggtct tgccgcagcc cgaggggccg     95760
     atcaccgaga cgaactcgcc ctggcggatt tcgtaattga tgccgtcgag cacgcgcatc     95820
     ggaccgtcgg cggtcgggta gtccacgcag acatcctcga agcggatgcg cacgtcggag     95880
     gcgggagtcg cgctcatgca gggtctccgt ggtcggtcag gcgatgcggt cctgccaggc     95940
     caccagccgg cgcgcggccg cgcgcagggc gaggtccatg gccagggcga tgaagccgat     96000
     gcagatgatg ccgacataga tgatgtcgag ctggaagaac gaggaggcgt cctggatcag     96060
     cgcgcccagc ccctgttgcg ccgcgatcag ttccgaggcc accagcgtgg cccaggccac     96120
     gcccagcgcc acgcgcagcg cggtcagcat gtgcgggatg gtcagcggca cgatgacctt     96180
     gcggaagatc tcgccgtcgg tcgcgcccag cgtcttggcc acgcgcacga agatcgggtt     96240
     gatctgcgag atgccctcgt acatgacgat gacgccggcg aagaacgagg cgtagaacag     96300
     gatggcgatc ttggccgtct cgccgatgcc gaaatacacg atgaccagcg ggatcagcgc     96360
     gatggggggc agggcgcgga agaagttgat gaccggatcg atgaagctgc gcacgccgcg     96420
     gtaccagccc agcacgaagc ccaccggcac cgccagcagg gtgcccaggc agacgcccac     96480
     gaacacgcgc tgggtggaca tgaggatgtc gtgcggcagg cgcgcctgca tcagggccac     96540
     gaaccgcgtc cagacttcgc cggggctggg caccagggcc gggctgacca gcccgctggc     96600
     gcgtatgccg taccagagca gcacgatcaa caaccacggg gccaggacca gcagcgcacg     96660
     catgagcgcg gatcgacgct tcacgtttcc tccttgggga ttggcaggca gcggcttgct     96720
     cttattatga tcagatcgta ccatagacca tacgttaagc aaataaagaa ttccgctgag     96780
     cttatggcca tcaatttcca cgacagtccc atcccgcgct acctgcaatt ggctgacctg     96840
     atgcgccagc gcattgcccg gggccagtgg ggccaggggc accgcctgcc gtcgctggag     96900
     gaactggtgg cggagttcgg cgtggcgcgc gtgacggtgc gccaggccat cgacgtgctc     96960
     acgcgcgagg ggctggtgtc gccgcagcag gggcgcggca ccttcgtcac cggcctgccg     97020
     cccaacgacc gctggctgca ggtgcagacc acgctggccg agctggccaa ggtctaccgc     97080
     gacaccaagc ccaagatcgt caacatcgac gaaaccatca ccaatccgcc gctgaccgcg     97140
     caggatggcg tggcggccga gcgctatgtc tacatgcgcc gcgtgcacga gcgcgaaggg     97200
     cggccgtatt gcgtcatcaa tatctacctg gacgaacaga tcttccgccg cgatccggtg     97260
     cgctaccgca acgaaaccgt catcccgctg ctggtgtccg acccggccct gcgcatcgcc     97320
     cgcgcgcacc aggtgctgac catcggcacc gccgacatgg aagtcgccgg ccatctgcag     97380
     gtgccggtca atacgccgat tgccgaagtg cggcggctgt tcctcgacga ggccggcaag     97440
     gtggtgtacc tgagcgaagt ctcgtatcgc ggcgatttca tccacctgga aatgaacctg     97500
     atcccctgag gacgccatga cacgcgatgc cgctccgatc acgcccgcgc gggtgcgcgc     97560
     gcatgtgttc cgctatccgg tcagcacgcc ggtcaagacc tcgttcggca ccatgcacga     97620
     ccggccggcg gtattggtcg aggtcgagga cagcgatggc gcggtgggct ggggcgaggt     97680
     ctggtgcaac ttcccggcct gcggcgccga acaccgcgcc cgcctggtcg agaccgtgct     97740
     ggcgccgctg ctgaccgcgc gcgcgttcgc cgatccggcg caggccttcg cccatctcga     97800
     ggcgcgcacc gcggtgctgg ccatccagac cggcgagccc ggcccgctgg cccaggccat     97860
     cgcgggcctg gacatcgcgc tgtgcgacct ggccgcgcgg cgcgccggcg agccgctgtg     97920
     ggcctggctg ggcggcagcg gcgatcgcat cggcgtgtac gccagcggca tcaaccccga     97980
     aaatcccgag gacgtcgtgg cgcgcaaggc ggccgaaggc taccgcgcct tcaagctgaa     98040
     ggtgggcttc gacgatgcgc gcgacgtccg caatgccctg catgtgcgcg aactgctggg     98100
     cgcggccacg ccgctgatgg ccgacgccaa ccagggctgg gacctgccgc gcgcgcgcca     98160
     gatggcgcag cgcctggggc cggcgcagct ggactggctg gaagagccgc tgcgcgccga     98220
     ccgtccggcc gccgagtggg ccgagctggc ccaggccgcg cccatgccgc tggccggcgg     98280
     cgagaacatc gccggcgtgg cggcgttcga gacggcgctg gccgcgcgca gcctgcgcgt     98340
     gatgcagccc gacctggcca agtggggcgg tttcagcggc tgcctgccgg tggcgcgcgc     98400
     cgtggtcgcc gccggcctgc gctattgtcc gcattacctg ggcgccggca tcggcctgca     98460
     ggcgtcggcg catctgctgg cggccgtgcc gggcctggcc agtcccggcc tgctcgaagt     98520
     cgacgccaac gacaacccct tgcgcagcct gcttagtccg gcgctggcga ccctgcacga     98580
     aggccgcatc acgctgggcg gcgcgcccgg gctgggcgtt acgcccgacc tggcggccct     98640
     gcgcgccgcc tgcgccgctc gctgaaggcg cccggcctcg ctagcgtcgc gccggcgctg     98700
     cagcggggaa cgcctcctca tacagcttgc cgagccagtc cacgaatacc cgcacgcggg     98760
     gggacaggtg gcggtgcgag ggatacagcg cggacaccgg caagtccggg ctcggccaat     98820
     cgctcagcac ttcgaccagc cgtcccgcgc gcagatcgtc ctcgacgtga aagcgcggca     98880
     actgaatcaa gccacagccg cgcagcgcac agacgacata gttctccgcg tcgctgaccg     98940
     atatccagcc attgagcgcg aacgcccgga tctcgccgcc gatgcgcagt tccagcggat     99000
     agtccacggc cgcgctggcg gcgaagaatt tcacgacccg atgcgccgca agttcgtccg     99060
     ggtggcgcgg cgcgccgaag gcggcgagat attcggggct ggcgcaaatg acttgcggca     99120
     tgacggccag ccgccttgcc accagggacg agtcgcgcgg attgcccgcg cggatcacgc     99180
     aatcgatgcc ttccctgacc agatcgacca gcctgtcgcc gccgctgacc gcgaggtcga     99240
     tgccgggata gcgcgcccgg aaatcatcga ttcgaggcag gacgattttg gtggcgtgcg     99300
     tgctgtgcat gtccacgcgc agcaggccgc gcggattgga agcgacgcgc tgcagcgaag     99360
     actgcgcatc gtccagttcg ctgagcacat ggacgcaccg ctcgtagaac gcctgcccgt     99420
     cgggcgtcgc gcgcacgtgg cgcgtggtgc ggtccagcag ccgcgcgccc aggcgggcct     99480
     ccagttgctt gatcgcatgc gtggcggtgg cgcggggaat gtccagcgcg gccgcggcgc     99540
     ggctgaagct gcccagctcg acgatgcggg tgaacagttg cagggagtcg aagcgatcca     99600
     taggcctgat tgttgtccat gcttgaattt agattccaat ccgcatgcat ttattcatca     99660
     attttaaacg tggacaatgg gcgccatgtc ctgcctttcg acctggagca cctcaatgaa     99720
     catggatata tccaaggccg ccatcgtcac gggcggctcg cgcggcatag gcagggccat     99780
     tgccgcgcgg ctggccgccg atggctttgc ggtcgtcgtc aactacgccg gcaatggcgc     99840
     caaggcccac gcaaccgtgg ccgccatcga atcggccggc ggcaaggcca tcgccatcca     99900
     gggcgatgtc ggcaagccgc aagacgtggc gaacctgttc gcccaggcca gggcagcctt     99960
     cggccgcatc gacgtggtcg tcaacagcgc cggcgtgatg ccgatggcca gcatcgatgc    100020
     cgccaatctc gacgccttcg accaggtcat cgccacgaac ctgcgcggcg ctttcctggt    100080
     gctggcccag gcggcggcca acctcggcga cgatgggcgc atcatcgcgc tgtcgaccag    100140
     cgtgatcgcc aagtcgttgc ccggctatgg gccctacatc gccagcaagg ccggcgtcga    100200
     gggcctggtg catgtgctcg ccaacgaatt gcgcggccgc aacatcacgg tcaacgcgat    100260
     cgcgcccggc ccggtcggca ccgacctgtt cttcaacggc aagagcgagg aagccgtcgc    100320
     cagcatcgcc aggcaggcgc cgatggagcg catcggcatg ccggacgaaa tcgccgccgc    100380
     cgtttccttc ctggccggcc cggacggccg ttgggtcaac gcgcaggtgc tgcgcgtcaa    100440
     tggcggcttc gcctgatcca ggcggatcga aagggggcgc cgcatgcggc gagggcgcgg    100500
     gacccaaggc gttggcctgt cccgcgcccg cccatgcaaa acccgccccg aggggcgggt    100560
     gtgcgggggc gctgggcgct ggcctgctta cttgccggct tgcaggcgct tttccatgcg    100620
     cgccgcgcgg tccggcgagg acgggtgcga gctgaacatg ctgctctcgc cgccgtcgag    100680
     ctcggccagc ttctggaagg ccgtcaccag gcccttgcgg ttcatcttct tctcggtgag    100740
     caggtcgaac gagaagtcgt ctgcggcggt ttcctgcgac tgcgagaact gcgcgttgat    100800
     gaatttctcg gtcatctcgc ccagttgcga agcgctcagc gaagccacca cgctgttgcc    100860
     ggcggcgccg gcggcctggc gcgcggcgct gaccgcgtag gcggtctgca tggccttctt    100920
     ggtgtggccc agcgcgacgt ggcccatttc atggccgatc acgccgcgca gctcgtcgtc    100980
     gttcatcagg tccatcaggc cggtgtagac gcgcacgcaa ccgttgccca tggcccaggc    101040
     gttgacgtcc tcggtcatgt agaccttgta gttgaccttc tgtccgttga gcgtcatgtt    101100
     gccgaagccg cgcatcagct tggtcaggcg cacgctgtac ttgttgccgg ccggggcgat    101160
     cttcgattcc tggtcgcttt gcttgcaggc ggcgtccgac agctggatga tgtcggcgtc    101220
     ggaaagattg gccgccttgg ccatgtcgga gcccgccgaa agcaggctgt tggtgtccat    101280
     gctcttcatg ctggcgcagc cggccagcag caggctggcg gccagggcgc cgccgagcag    101340
     tttcgtcttg ctcttcatca tgcattcctc tttcttcgaa gccgagtttg ggcgggagcg    101400
     cgttcgtccg gcaggtgcgc gcgccgtccc gaggcggcgc gcttcctggc tcgcggccca    101460
     ggccggatcg aaagttcgcg ggctagactg taattaccag tgacggatgg acgggtgtta    101520
     ttgattttca aactgcaaca gaatgccagt gcaatgacgc ggtaatgtcg gcgcgggcgc    101580
     cgcctggccg cataatcgac gcttgcgccg cgccgcggcc ggcgccttgc ggagcacacc    101640
     atgcaagcca acctgactgt catcaccctg ggcgtggacg acctggagcg cgccctgcgc    101700
     ttctaccgcg acggactggg gctgccgacc gccggcatcg tgggccggga gttcgagcac    101760
     ggcgcggtcg tgttcatcga cctgcaggcc ggcctgaagc tggcgctgtg gccgcgccgc    101820
     agcctggcgc acgataccgg cctgccgctg gcgccgccca gcgccacgga actgagcctg    101880
     ggccacaacg tgaccagccg cgccgaggtc gacgcggtga tggcgcaggc cgcccaggcc    101940
     ggcgccgcca tcgtcaagcc ggccggcgac accttctggg gcggctacgc cggctacttc    102000
     caggacccgg acgggcacct ctgggaagtg gtccataacc cgcagcttgc gccggcgggc    102060
     tgagcggagg ccgtcccggg gcggcgcggc gaatcgggca taatgcgacc ggccgcatat    102120
     ttccagcggt tataaggggc ccgcgcgcca ggcgcgggcc ccgtcccatt ccatcgaagc    102180
     cgccatgccg tcccgttccg cgcagtcctc ctccaacgtt ctgcggcttg ccgcggcaca    102240
     ggcgctggcc ggcgccaaca cgaccgtggt gtacgccacc gccgccatca tcggcgaggc    102300
     gctcgcgccg tccaaatcgc tggcgacgct gccgatttcg gtattcgtgg tgggcatggc    102360
     cgccagcacg ctgccggccg gcgccgtggc gcaacgccac ggccggcgcg cggcgttcat    102420
     gctgggcacg ctgtgcggcg tgctgctcgg cctgctggcc gcgctgggca tctacctgga    102480
     atcgttcgcg ctgttctgcg ccgccatggc cttcggcggc gcctatgccg ccgtggtgct    102540
     gacgttccgc tttgccgccg ccgagtgcgt cgaaccgcac cgcaaggccc gggccctgtc    102600
     gaccgtgctg gccggcggcg tgctggccgg cgtgctcggc ccgcaactgg tgtcctacac    102660
     catggacgcc tggagcggcc atgttttcgc cggcacgtac ctggcggctt cggcggtggc    102720
     ggtgctggcc gccgtggtgc tgggcggcgt cgacctgccg cggccggcgc gcgccgccgc    102780
     cgcgggcgga cggcccctgc gggtcatcgc gcgccagccg cgcttcatcg cggcggtggt    102840
     gtgcggcgtg gtgacctaca tgctgatgaa tttcctcatg acgtcggcgc ccctggcgat    102900
     gcgcatgcat ggcctgtcgc agcacgcctc caacctgggc gtgcaatggc acgtcatcgc    102960
     gatgtacgcg cccagcttcg tggccggcgg gctgatcacc cgccacggcg cggtgccggt    103020
     ggtcgcggcc ggcctgctgc tgaccgcggc cgcggccgtg gtcggcctgg cgggcatgga    103080
     cgcatggcat ttctgggtgt cgctgacgct gctgggcgtg ggctggaatt tcggcttcgc    103140
     cggcgcgtcg gccatggtgc tggaatgcca tctgccgcaa gagcgcacgc gggtgcaggc    103200
     cgccaacgat ttcatcatct tcggcaccat ggtggtgggc tcgttcgtct cgggcgatct    103260
     gctgatgcgc tacggctggg aagtcgtgtg ctggctggcg ctgccgccgc tggccgtggc    103320
     cgcgttcgcg ctgcgctggt tcaagccgct gccggccggc gccgcgggca gagcctagca    103380
     gggatcacac cgcctggcgc aggcaggcga tgaaatgggc cgtatgggtg ccatgcacgc    103440
     cgtcggcccg ccacagcatg ccgatggggc cgccgctgcc cagcgtcagc ggcaggatgc    103500
     gcagcacgcc ctggcgctgg aagtgctcgg ccagccggcg cgacatgggc gcgatcatgt    103560
     ccgagcggtc gagcagggcg acgttggtct gcaccgaggt cgactccacc gcatggcgcg    103620
     gcaggggctg gccggccacg gcgagttcca tttccagccg catgcgcagc ggcgtgccct    103680
     gttgcggcga gatccacgga taggcctgcg cgtcctccca gctgatgcgc cggcggccgg    103740
     ccagcggatg cgcgcggccc gccaccaggc agaccggttc gtcgtacagc gtctcgcagc    103800
     ggacatcctc gggcatggca acctcttcca ggcgcccgac gacgatatcg aaatccccgt    103860
     tgcgcaggcc cggcagcagc agatcgatcg aggcttcgat cacgctgacc agcacgtccg    103920
     gataggcggc gcgaaagcgc cggatgcttt cgggcagcac gaccggcccc accaccggcg    103980
     agaaacccac cgacagatgg cccgcgaaac cgcttgcgat gtggtctacc gcggtacggg    104040
     cgcgttcgag ccggccgatg atggcgcgcg cgtgcgcctg cagttcgcgc gcgcaggccg    104100
     tcggcgtcac gccgcgcggc tcgcgcacga acaggcgctg gccgatgtcg gcctcgaggt    104160
     ccttgagcca tttcgacagc gcgggctggc tgatgccgta ttcgatggcc acttcggtca    104220
     ggttgccggt ttcgcacagg cgtatcagca ggcgcaggtg gcggggccgc agccggtcga    104280
     tccagttcgt gagcatgggc gtcggatatg acataactaa tgggttatgg aattctaata    104340
     tcttttcatt tttcatttat gtttagggca cgcacaatcg ggcctcgtcg tgtacttatg    104400
     tccggcttgc gccgcacctg ccatgtccca gcccaatttc ctgctgttca ttaccgacca    104460
     gcaccgcgcc gatcaccttg gtgcctacgg caattcgcag atccgcacgc cggcgctcga    104520
     cgccctggcg cggcgcggct ggctggccga gcgcttctac gtcgcctcgc ccatctgcat    104580
     gcccaaccgc gccaccctga tgaccggccg gatgccttcg gcgcacgggg cgcgccacaa    104640
     tgggattccg ctgtcgcagc gcgccaccac cttcgtcgag cgcctgcgcc aggccggcta    104700
     tggcacggcg ctggtgggca agtcgcacct gcagaacatg acgggcaacg gtccggtctg    104760
     gccgcgcccg caggatccgc ccgccgaggg tgaggcctgg gcgcccgagc cgggcgacta    104820
     cgaccaggag tgggggccct tgtggcgcga ggatccggcc catgacctgg ccacgccgtt    104880
     ctatggtttt tcgcaggtgg acctggcggt cgaccatggc gaccgggtct gggggcatta    104940
     ctggcgctgg ctgcagcgcg agcatccgga ggtcgcggcg caggccgggc ccgaccatgc    105000
     gctgcccgcg cccggcttcg aactggtgcg ggcagggcag gcctggcgca cgcgcgtgcc    105060
     cgaatcctgt tcgaccacgg cctacctggg ccgccgcacc atgcaggccc tggacggcta    105120
     cgcgcagcgc ggacagccgt tcttcatcca gtgctcgttt cccgatccgc accatccgtt    105180
     cacgccgccg ggcaagtact gggacatgta ccggcccgag gacgtcgaac tgcccgcgtc    105240
     cttccatgcc agcgcggccg ccggcaggca gcccccgccg cacgtgcagt ggatgtacgc    105300
     gcagcgcgac agcggccgcg ccgtcaagca cacgccggcg atgttcgcct gcaccgagcg    105360
     cgaggcgcgc gaggcgatcg cgctgaacta cggctcgatc tcgcacatcg accacacggt    105420
     gggcgaagtg ctggcgcatc tgcagcggct gggcctggcg gacaacaccg tggtgatctt    105480
     caccagcgac cacggcgact acctgggcga ccaccagctg ctgtggaaag ggccggtcca    105540
     ctaccagagc gtcatccgca ccccgttcat ctgggccgat ccggccggcg cgcaaggcgc    105600
     gcgcagcgac gcgctgtgct cgaccaccga catcgcgccc accatcctgg cgcgcgccgg    105660
     cctgctgccc tacaacggca tccagggcgc cgatctcggc gcgctgatgc gcggcgagca    105720
     ggccgcgccg cgcgaggccg tgctgatcga ggaagaaggc cagcgcgtca tgttcggttt    105780
     cgacaagcgg gtgcgcatgc gcaccctgca gaccggccgt taccgcatga gcgtctatca    105840
     cggcgtgtcc tggggcgagc tgtacgacct gcgcgaggat ccgctggaat tgcgcaacct    105900
     gtgggacgag ccgggcagcg ccgcgctacg gcaggacctg ctgttccagc tcgcgcagaa    105960
     cctgatcggg catggcgaga ccagccccca tccgaccgcg ctggcctgac cgccaggcaa    106020
     gcgcgccaac agaattcgag gagacaagac atgcgtattt tccaagccct gcgccacgcg    106080
     gccctggccg ccgccctgag cctgggcgcg gcggcggccg ccaccgccgc ctatcccgac    106140
     aagccggtgc ggctggtcgt caacttcacg ccggccggtc cgctggacct gctggcccgc    106200
     ctggtggccg agcgcgccag ccgcgagctg ggacagaccg tcatcgtcga gaatcgcgcc    106260
     ggcgccggcg gcaatatcgg cgccgacgtg gtggccaagt ccgcgcccga cggctatacg    106320
     ctgctgatca ccaccgatac gctggccacc gtcaatccgt tcgtctatgc aagcatgccg    106380
     gccgatccgt tcaaggacct gcagccggtg gcgctgaccg gcacgttcaa ccaggtgctg    106440
     gtggtccagc ccagcctggg cgtgcgcaac ctggccgact acatggccta tctcaggcag    106500
     cacggcggca cctacgcctc ggccggcaac gccacgcccg gccacctgac cttcgaaagc    106560
     ctgcgccagg cgctcgacct cgacgtcacg cacgtgcctt accgcggcac cgcgccggcg    106620
     gtcaacgatc tgctcggcgg ccaggtcgag gcgggctttc tggtggtgcc gggcgtgctg    106680
     cagcatatcc aggcgggcaa gctggtgccg ctggccgtct cgggcgcgca gcgcgacgcc    106740
     gcgctgcccg acgtgccgac gatcgccgag tccggcctgg cgcaggtgcg cgacttcgac    106800
     accagcttcg gctatctgct gatggcgccc gcgggcgtgc cggacgaggc ggtccaggcc    106860
     tggcaacggg tactggccag gatctacgcc agcccggaat tcctcgagcg gctcgcggcc    106920
     ctggatatcg cgccgacctt cggcgacgcg cagcaggcgg cgcagtggat gcgcacgcgc    106980
     gcggcgcgct gggaaaaggt ggtggcggcg gcgggcatca agccgtaacg ccccgcctgc    107040
     ccggggcttc actccgtggc aggcaccttg cgggcgcgca tcagccggcc ccatgcgcgc    107100
     gcaaagccgc tggccgcgcc ggccagcacg gcaaagccca gcgcggccga cagccagccg    107160
     atgcgcgcga aaccgggaaa cgcgccgtac agccagccca ggctttgcga cagcgcgacc    107220
     atggcgaccg tgccgacgat ccagccggca atcagccagc gcgcccggcg ctggcggacc    107280
     ggcgcgaaac tgaggtggta cacgatgcgc gcgcagtaat acgcggccac ggccgccagc    107340
     gccgtcagga aaaccgacgc gtcggcgatg gcgccgctga attcggccga ttgccagctc    107400
     tcgccgatca gcagccactg gcggcgcagc gccggatagg gaatccaggt cgccacgccc    107460
     agcgcgcccg ccagccgcgc caggccggcg tagcacagcc agccggtggc cgccgccgcc    107520
     aggccggcca gccagaagcg caggcgttca tggcgcatca tcggcggttt ctcgcgggca    107580
     ggcggtacga atggcggggg gcaggcgggt tcaagagcgg catgggcggc atgggcggcg    107640
     gggtcggcgt tgcgcaaccg tatcggcgcg aacggcggaa atcaaccggg gggctgagtc    107700
     cggcctcatt ccatccgccg tctggatgag aaaaactata tcgtagagcg atatgaatta    107760
     attcttttgg attaggccgg cacgagaatc acgcgcggaa gggccgcaaa atcgtgctgc    107820
     ggaccaatta tttcatcgta atatcagcgc gttgcagcga tgctttcagt ttgaaagcag    107880
     accgtaagct aatcgtaaac ccggggtttt caagcaaaag catcgtgcta cgatctattc    107940
     cgttttcctg atggcggcgt tccggtcgca atccgttaca ccactctgtg ccccgttcgg    108000
     ccggtatcgt gaccatgtgc cgcgacgggg gcagcagcaa aagaaaggaa aggggcgaaa    108060
     tggaactgct gcaaaatctg gcgcttggct tttcggtagc gttcacgccg gaaaacctgt    108120
     tgtacgcgct gctgggctgc gtgctgggca ccctggtcgg cgtgctgccc ggcctggggc    108180
     cggtgcccac catcgccatg ctgctgccca tcacctatgt gctgccgccg gtggccggcc    108240
     tgatcatgct ggccggcatc tactacggca cgcagtacgg gggggcgacc acggccatcc    108300
     tggtcaacct gcccggcgag acatcggcgg tggtgaccgt gctcgatggc caccagatgg    108360
     cgcgcaacgg ccgcgccggc gcggcgctgg cgctggcggc catcggttcg ttcttcgccg    108420
     gcactgtcgc caccatgctg atcgccgcct tcgcgccgcc gctggccgaa gtcgccttca    108480
     agttcggccc ggccgaatat ttctcgctca tggtgctggg cctgatcggc gccgtggtgc    108540
     tggcgtcggg ctccatcctc aaggcggtgg ccatgatcat cctcggcctg ctgctgggca    108600
     tggtcggcac cgacgtgaac tccggcgtgg cccgctacga cttcggcatc cccgagctgc    108660
     aggacggcat cgacttcgcc atcgtcgcca tgggcgtgtt cggcttcgcc gaaatcctca    108720
     ccaacctgga acagaaggaa aaccgcgtcg acatcaccga caaggtcggt tcgctgtatc    108780
     cgaacaagca ggaaatgcgc gaagccgcgc cggccatcgt gcgcggcacc gcgctggggt    108840
     cgtgcctggg catcctgccg ggcggcggct cggtgctgtc ggccttcgcc tcgtactcgc    108900
     tggaaaagaa gctgtcgcgc aatcccgagc gcttcggcaa gggccatccg gccggcctgg    108960
     ccggccccga atcggccaac aacgccggcg cgcagacctc gttcatcccg ctgctgaccc    109020
     tgggcatccc gggcaacgcc gtgatggcgc tgatggtcgg cgcgatgacc atccacaaca    109080
     tccagccggg tccgcaggtc atgaccagcc accccgagct gttctggggc ctgatcgcct    109140
     cgatgtggat cggcaacctg atgctggtgg tgctgaacct gccgctggtc ggcctgtggg    109200
     tcaagctgct caaggtcccg taccgcatcc tgtacccggc catcctggtg ttctgcacca    109260
     tcggcgtgta ctcgctgaac tacaacgtct tcgacgtgtt cgtcaccgcc atcttcggcg    109320
     tggtgggcta tgtatggtcc aagctgaaat gcgagggcgc gccgctgctg ctgggcctgg    109380
     tgctcggccc catgatggaa gagaacttcc ggcgcgcgct gctgctgtcg cgcggcgact    109440
     tcctgacctt cgtcgagcgg ccgctgtcgg cctcgctgct gggtgcggcg gccctgctgg    109500
     tgatcatcgt ggcgctgccg tcgatccgca agaagcgcga cgagaccttc gtcgaagaag    109560
     aatgatcgca gcgtgaagtt gagtgattgc gggtgttggc gacggcaccc gttttttttg    109620
     gggtggccat gtttcgcatg gggcctggcg ccccgcgacg gcttacttgc gccgatacgc    109680
     cggcgaatcg aaatagctca gcagcgtacg cagcagcggt ccgaccgagc gcagttcctc    109740
     gacgtgcgcg gccgacagcg tatccagcgt gtgctcggcc agcggggtca gggccaccag    109800
     cacgcggcgg cggtcggcgt tgctgggaat gcgccgcacc atatccatgc gcgcgagccg    109860
     gtcgaccagt tcgccggcgc tgtgatggcg gatcagcagc cggtcggcca gttcgcctac    109920
     gctcagcgtg tcgtccgatg ccttgatggc cagcagggcc tggtgttgct gcgcggtcag    109980
     gccgctttcg gtggccgcgg cttcgctgaa ggccatgaag cggcgcagcg cgtagcgcag    110040
     gtccgccagg gcggcaaaat cggctttatc cagcttgcgg ccgcgtggcg gcgcggggct    110100
     gggggaagag gtctggacgt ctgacatggc aaggccggcc tatgatctgt acattttcga    110160
     ccgcgcgcca accgggcggg cgcgtacgca agaatcattc tagaagaaat ggggcagggg    110220
     cgttgtcagc ctgccgtcaa gcggcggcgt gccagggatc gacggcggcg agcccggccg    110280
     cctcgaacct ggccggatgg cgcgtggcga tggccaggcc gtgcgcggtg gcgatggcgg    110340
     cgatgcaacc atcgattgcg cacagcgcat ggcccgccgc cgcggcccgc atcatgacgg    110400
     cggcgtaggc atcggccgcg gccgtgtcga agggcaggac atggcccatg aacagcggca    110460
     ggacgcgccg ctcgaattcg tggcgcaagg cctcggcccg cttgccgcgc ggcaggcggg    110520
     ccagcccgag ctggatttcg gccgcgccgg gcgcggccag gtacagggtt tcgacgtgct    110580
     gggcatccag ccatgccgcg acggccgggt cgggggccgg ccgcagcggc tcgagcagca    110640
     cgtcggtgtc gagcaggatc attcgaagct ggccgggcga gcgggcgccg gattgcgctc    110700
     gatggtcagg tccatgccgc gcgcgccgcg gccgatgtgg ctgagcaggg tgcccagctt    110760
     gacgcggcca tcgggcagca cggcgttttc caggatggcg cggatctcgg cctcggtgct    110820
     gcgcccatgc gtggccgcgc gtacgcgcaa ggcgcgatgc acttcctcgg gaacatttct    110880
     taccgtaatc gaagacacga cagcacctcc attttttgca tgcaatgatt tcattttagc    110940
     aaaatgcaat cattttggca atggcgcggc ttcagcgctg ggcgtccagc cactggcgcg    111000
     ccgaagcgcc catccgctgc cggaaggcct tggacagcgc cggcacgccg gcaaagccca    111060
     gctcgggcgc gatgcgcttc atggggtggc cggcgcgcag catggacgcc gccaggctca    111120
     gccgccaatc ggccaggtag gccgcgggcg tgacccccgt cgccgtcttg aacgccgcgg    111180
     caaaggcgct gcgcgacatg cccgcgatat ccgccatccg cgtcaacggc caggcctggc    111240
     ctggagcgcc gtgcaacgcc gccagggcct tggccaggcg cgggtccgac aggcccatga    111300
     tcagtccgtt gctcacgccg acctgggccg ggtggtcgag catccagcgc agcagctgga    111360
     tcagcacgac ctcgaacagg cggtcggcca ggacgcgcga accgcaacgc acctgatcgg    111420
     cctcggcgaa cagcaggtcc agcgcgggcc gcaggccggc caccgcgtcc agcggcacgc    111480
     agacgaccgg cggcagcgag cgcaccagcg gatgacggtc gccgccttcg aaatccagcg    111540
     tggcgcaggt caagtcgggc ccctcggcgg gcgggttgat gaactcgtga tgcaagggac    111600
     gcgggtagaa cagcagagtg ggctcggcca gccgcaggcg cggcagcgcg gtttcgcccg    111660
     ggcggtggcg cacttccata tcgccgcggc gcaatacgtg caggaaggcg cgcccgggct    111720
     gcgcctcgaa gcggtggtgg ccgcacagcg tgccggcgtg gagcagggcg gtgcgaacgc    111780
     ggaagcgttc cagcagggcc gacagcctgt ccacgggcgc cggcgcggcc gaggttttag    111840
     acgatttgga aactttcatg gacgaaactc gattttttgt ccagatattc tacgtacgat    111900
     gggctggtcc gtcacggcgg accttatccc taccgtttcc aggagcaagc catgtcacgt    111960
     gttctcctga tcgatccctc ccaggccggc gccgagcgcc aggcgatcct ggcgcagatc    112020
     caaggcgcgt tcggcgccac gccgaatatg ttcaaggccg tggccaactc cgccgcggcg    112080
     ctcaagagca tgtgggaggc ctttggcgcg ctgggcggcg gcgtcattgc cgcgcggctc    112140
     ggcgagcaga tcgccgtggc ggtggccaac cgcaaccgct gcgaatactg cctggccgcg    112200
     cacaccgcgc tgggccgcaa ggccggcgcc agcgccgggg acatggcggc cgcgcaggac    112260
     ggccgttcgg ccgatccccg cacggcggcg gcgctgcgct tcgcgctgca gctggtcgag    112320
     gcgcgcgggc aggtcggcga ggccgaggtg caggccgtgc gggccgccgg tttcagcgac    112380
     gaggaaatcg tcgagatcct tgcccacgtg gcgctcaacc tgttcaccaa ctatgtcaac    112440
     gtcgcgtttg ccgtcccggt agactttccc aaggtcgcgc tgcgccaggc agcctgagcg    112500
     tcgcgccggc ccgcggcgcc gcgccgcggg ccgcgtccat tccccaggag ccgccatgtc    112560
     ccgccacgaa gccctcgcca ccgttaccgc gccgcccttg caggtggacg catggctcaa    112620
     taccccgcac ccgctggagc tggcccggct gcgcgggcag gtggtggtgc tgcacgcctt    112680
     ccagatgctg tgcccgggct gtcttgcgca tggcctgccg caggccgagc gcctgcaccg    112740
     cctgtttcgc gacgacggcg tggtggtgat cggcctgcat acggtcttcg agcatcatgc    112800
     ggtcatgggg cccgaggcgc tgcgggtttt caatcacgag taccgctgga gctttccgat    112860
     cgggatcgac cgccccgatc ccgagggcga catgccgatg accatgcgcg cctacagcct    112920
     gggcggtacg cccagcctgg tgctgctgga ccgccgcggg cggatccgcc tgcaccacct    112980
     gggccggctc gacgacctgg ccctgggcgc ggcgatcggc cggctgctgg ccgaggacgc    113040
     cgagcccgcg ggcgcgccgc cggcgtgacg tccgggcgcg ccatgcggta gcctatgcgg    113100
     gaggcccggc cgcgcgccgg ccgggcgttc gcgacaggag gcgatggcat gaccggcaag    113160
     acggcattca ggatcggcga ccacgtggcc tggaactccg aggccggcca ggtgtcgggc    113220
     accatcatcg ccatccacac gcgggacttc gattacaagg ggcacacgca tcgcgcctcg    113280
     cccgaccatc cgcagtacga aatcaagagc gacaagaccg atcacatcgc cgcgcaccgc    113340
     ggcgaggtgc tgcggcgcgt gcgcgcaaag ggcggggcat gaggccgccg tttcatacta    113400
     taggccattc caaccgcagt ctcgaggcct tcgtcgcctt gctggaggcg gccggcatcg    113460
     agctcgtggt cgatatccgg accgtaccgc gctcgcgcgc caacccgcag ttcaaccagg    113520
     acgcgctgcc cggttcgctg gacgggcgcg gcatcgccta tgaacacctg gccgcgctgg    113580
     gcgggctgcg gcccagatcg cgcacggtgc cgcgcgaggt caacggctac tgggacaacg    113640
     acagcttcca caactacgcg gactacgcgc tttcgcaggc cttctatgcg ggcctggagc    113700
     atctcgttgc gcgcgggcgc gcacagcgca gcgccgtcat gtgttcggag gccgtgtggt    113760
     ggcgttgcca ccgccgcatc gtggccgacc atttgctggc ccggggggag accgtgttcc    113820
     atatcatgga agcgggccgc atcgatccgg ccagcctgac gccgggcgcg ctcgtgcgcc    113880
     cggacggcat ggtggtctat cctggcgcgg acgccgctgt gcgcccgccc atgccgtgat    113940
     gtggctacaa ggcgcggcgc cgactagaat gagtgccagc ccgaccgcag accttgccaa    114000
     ccgcctatag agacccatgc ctcagaacaa tccggaacca caggccgtcg tcagtccgat    114060
     cacacgcagc gccattttcc tcgtcgccac tgtcggcgcc gacaacgaag ccgccgacaa    114120
     ggtccgcgcc ctgtgcggca agctggccga cctggcgcgc gccgtcggca agcgggtgcc    114180
     ggccggcaat ctttcctgtg tatgcggttt cagcgccgcg ggctgggacc gcctgttcgg    114240
     ccagccgcgg ccggccgagc tgcacccctt tcgcgaattc agcgccggcg agcgccgcgc    114300
     tccggccacc ccgggcgacc tgctgctgca catccgcgcc gagcagatgg acctctgttt    114360
     cgagctggcc acccatgtga tggcgcagct gggcgacgcc gtcaccgtgg tcgacgaagt    114420
     gcacggcttt cgctatttcg acctgcgcag catggtcggc ttcgtcgacg gcaccgaaaa    114480
     ccccaccggg cgcgaagcgc tggatttcac cctggtggac gacgccgatc cggatttcgc    114540
     cggcggcagc tacgtcctgg tgcagaaata tctgcacgac atggatggct ggaacgcgct    114600
     gtccgtcgag acccaggagc gcatcatcgg gcgcaccaag ctgtcggaca tcgaactgga    114660
     cgaggccgtc aagcccagca actcgcacag cgccctgacc acgctcgaag aaaacggcca    114720
     ggaaatcaag atcctgcgcg acaacatgcc gtttggccgg cccggctccg gcgagttcgg    114780
     cacctatttc atcggctatg cccgctcgcc cgcgcccatc gagcaaatgc tcgagaacat    114840
     ggtcgtggga cgcccgccgg gcaactatga ccgcctgctc gacttcagcc gcgcggtgac    114900
     cggcggcctg ttcttcgcgc cttcggccga cctgctcgaa gcgctggccg aacgcgaccc    114960
     gcaagacacc gacggcagcc ggcttgaccc cgcgccggcc gcgcgcgcgc cgcatgacgg    115020
     ctcgctgaac attggctccc tgaaaggaaa cccccagcaa tgaacaacct gtatcgcgac    115080
     ctggctccca tttccgccgc cgcctgggcg caaatcgaag aagaggtggc gcgcaccttc    115140
     aagcgttcgg tcgccggccg gcgcgtggtc gatgtcaagg atcctggcgg cttcggcctg    115200
     gcggccgtgg gcaccggcca cctgcgcggc atcgccgcgc cgcagaaggg cgtcgacgcc    115260
     aagctgcgcg aagtcaaggc cctggtcgag ctgaccgtgc ccttcgagct gcagcgcgac    115320
     gaaatcgacg ccgtcgagcg cggcgccaac gatgccgact ggcagcccgc caaggacgcc    115380
     gccaccgaac tggcgtatgc cgaggaccgc gccattttcg acggctacaa ggccgccggc    115440
     atcgtcggca tccgcgaggg ttcgtccaac agccggctcg aactgcccac ggacgccgcc    115500
     gactacccgg cggccgtcgg ccgcgccctc gagcagctgc gcctggccgg cgtggacggg    115560
     ccgtactcgg tattgctggg cgccgacgcc tacaccgccc tgagcgaggg cagcgacgac    115620
     ggctacccca ccatcgacca catcaagcgc atcgtcagcg gcgacatcat ctgggcgccg    115680
     gccctgaacg gcggctgcgt gctctccacg cgcggcggcg acttcgaact gcacctcgga    115740
     caggacctgt cgatcggcta ccagagccac accgacaagg tcgtgcgcct gtacctgcgc    115800
     gaaaccctga ccttcctcat gctcacgagc gaggcgtcgg tcccggtggc gcccaaggga    115860
     tagggcggac gcggcgggtc cggccgatgg ccaggcccgc cgcgctttcc ccccggccta    115920
     catgtggctg ggcagccaca aggccagttg cggaaacagc accaggatca gcacggccag    115980
     cgcttccacc agcacgaacg gcagggcgcc catggtgatg tcgcgcagcg agatctccgg    116040
     cgccaccccc ttgatgacat acaggttcag gccgatgggc ggcgtgatca ccgccatctc    116100
     gcacatgatg atcatgacca cgccgaacca gatcggatcc aggcccagcg acgtgatcac    116160
     cggaagcacg atcggggtcg tgatcaggat gatcgagacg atgtccagga acatcccgac    116220
     gatcagcagg aagaccagga tcagcagcag gatcacccaa tccggctggg ccagcgcagc    116280
     gacccaggcg atcagcatct gcggcgcctg caggcgcatc aggacatggc cgaacaacag    116340
     cgcggccgcc acgatcagca ggatcatgct gctggtgacg atggtggagc ggacgatctc    116400
     gcgcagcttc gcgcggtcca gttcgcggta gccgagcgcc accagcagcg cgccggccgc    116460
     gcccaggccc gaagcctcgg tcggcgtggc gatgcccaga tagatcgtgc ccagcacggc    116520
     gacgatcagc acaatggcgg cccatacatc gcgcagcgcc tgccagcgct cccgccacga    116580
     gaccttctgc gcttcgtccg gcgccaccga gggcttgatg cggctcaatc cgtacagata    116640
     aagcatcatc aggacgctga gcagcaggcc gggcacgatg gcggcgctga acagcttgcc    116700
     gatcgactgg ctggcgatct cgccatacag cacgaagccc acgctgggcg gaatcagcaa    116760
     ggccagcgaa cccgccgcgg ctaccgatcc gccggccagg ccagggtcat agcggcgctt    116820
     gagcatctcc ggaatggcga cgcggcctat ggtggccgcg ccggccacgc tgacgccgct    116880
     catggcgccg aagatggccg aggcccccac gctggcaatc gccaggctgc aacgcacgcg    116940
     gctcagccag gtgtagaaca aggtatagag gcgcgcgccg atgctggtgc gggccagcgt    117000
     ctcgcccatc aggatgaaca gcggaatgca gatcagcgag tagctggcga tgccgcgatg    117060
     cagcaccgac ggcacgacgt tcagcgccga ggcgccgccc accagataga tgccgagaat    117120
     gctgggcacg cccagcgcgg cgaaaatcgg gatgcccaat accagcagca ggccgaacag    117180
     cccgagtatc acggtcagaa tgagtacggc gtccacgggt catgcctccg ggctgggtgg    117240
     cgcaatggcg gcgttgccgt cgggatggtt cagcttgcac gcggcggcga tcgccaagag    117300
     cagcgcgccg accgcgatca gtccgtaggc gatccacatg ggaaaggcca gcagggacgt    117360
     cgagcggtaa ttgcgcgcca gtgccgtggc ggcgatctgg acgccggcat gcagcaggaa    117420
     gccgcagaac accagcacca ccagctcgcg aaacacgttc agcagccgct tgccgcgtcc    117480
     gcgcacgcgg atgctgagca tttccatgct gacgtggcgc tcgagcagat gggtccagcc    117540
     caccgaaagc caggtcacca gcagcaacag gtaaatgctg atctccacgg cgtggacgct    117600
     gggctgctgg agcacgtacc gcgcgatgac cgagtaaacg gtcagcagca tcatcagcag    117660
     caaggctgcc tgcgcgatga aaacggcggc ccggttggtt ccgtggccga tccgtgtcag    117720
     ccgatcaaga agcgatttca tgggggggat ccagatcgat aggcggtcat gtcgaaaggg    117780
     cctcagttcg cccgggtctt ttccagcagc tccaggtggc ggctggccgc gggctcctgc    117840
     gcgacccact cctggaccgc gggctgggtc gcggcgcgca tatcctgcaa ggcggcgggt    117900
     tcgatcgtgt acacagatac gccattcttc tcgaacttcg ccacgccctg ttcgatgtag    117960
     gcatacacct ggcggaattg ctcctcgtca cgcacctgcg cgccgcggcg gatgatgtcc    118020
     tggatatccg gcggcagcga atcgaacttc gccttgttca tcgacagcag cgaggtgtcg    118080
     atggccagcg tcgccagcga caggtgcttg accacctcgt gcaggctgcg tcccagcccg    118140
     gtgatcagcg ggcgcggcgt gccgtccacc accccgcggt ccaacgccag gtacagctcg    118200
     gacgacggca tgctggtggg cgagccgccc agcagctgga tcgcgcgcgc gtcggcggcg    118260
     ccggtcgtgg cccacacctt gcccttgaaa tcggcggccg tgcggaccgg cgcgcggcgc    118320
     gaatagatct ggtagggatc gataggcgcc aggccgagca cttcgatgcc atacttgtcg    118380
     cgcatttcgc cgcgtatgct cacatcgagc aggccggcct tggcggcgcg ctccaggtgc    118440
     gccgtatcct ggaacacgaa cggcatggtg aacagattca gcaccggcat ggcgccgctg    118500
     gcgtaggtcg agaccacggt ggtgatatcg atgtcaccgc gcgacagcgc cggcaattcc    118560
     tcgtagccgt cgaacagctg ggcggagtgg aaggccttga tcttcacgcg gccctggctt    118620
     tccttctcca catacgcgat gaaggtctcc agcggcttcc acatgtactc ataggaaggc    118680
     ggggcatagg tcgacagcgt cagttcgatc ggcttgtccg ccgcgccggc gttggccgac    118740
     agcgccagca gcacggccgg cagcaatttg gcgatccagg tcttgttcat gattgatgta    118800
     ctccgcagtg gcgctcaggc cgtcgggttg agaagcaggg gcaggagcgc gtcggtcggc    118860
     aggacttccg cgtacttgct cttgaggtcg atcaggttgc tgaggtgctg ggccgcggaa    118920
     cggtccgtga cggcgtcctg cgccacgaaa ggcggaaagc cgtgctgcat ggcgtcgacc    118980
     gcgctggcgc gcacgcagcc gctggtggtg cagccggcga tcagcacggc gtcgcagccc    119040
     gcgtgcgcga gcatggcggc cagcggcgta ccgaaaaacg ccgaggcctg cgtcttgtgc    119100
     agcagcacgt cggtcgccgc gtcgtaatcc agtcgctcgt cgagtgcgca gcccgccgag    119160
     ccgcgtacca ggtccttcag cggcgggcac ttgcgatgaa aacagccgcc gtcgccatgg    119220
     ttgccgtcgt agcccaccac cgtgaacacc accggaccgc gtccgcgcat cgcctggatc    119280
     aggcgattgg cctgcgcgat ggcgggcgcg caatcgctgg ccagcggact gacgtccggg    119340
     tcggtgaaag cccgctggaa atcgatcacc accagggccg ggcgtcgccc gaacgggtgt    119400
     gaaccgatga aaccgcctcg ggcattgtcg aggtctagca tgaacgctcc tgatggaaag    119460
     tatgtgggcg tgccgcgccg cgggaccgga cccgccgcgc ggacagaaag ggatggcgga    119520
     aaacgcctag ccgtgggcct ggaccggcca ggccttgctc gggaagggcg tcaggcgcga    119580
     ggcgcgcgcg ttggagaggg caggaagcgg gcgcgcgcag gcgtgcgcgc gcctggccgg    119640
     gaggcgtctg gacagcatgg ctggcggcat ggccgccacg gctggtgacc gatatcccat    119700
     tgcatccccc gcgttctggt catgttcatg caagctgact gcatggcagc ttgcaaggca    119760
     cacgtgtgca ttaatgtttt gcggaagtct aggccgggat gaacgggcgg ggaattgggg    119820
     ttttccttag caagattgca tcaatagtat ttgcttatag ggatattgag cgcgatgctg    119880
     gtttgccggc gtgccgttgt ccggcttggc cgcctgtgcc atgtcggatt tgctttagtg    119940
     gaaaacagcc ttgaaaatgt acacgtatgc acttgtgtgc atgcgtcatc gacggccgcg    120000
     cggcggcggc ctggttcagg gttgggcgcc gcgttcgtgc cagagctgtt tgagccgttc    120060
     caggtcccgc acccagattt ccccgtaacc cagtccgacc aggccctggt tcgccaattg    120120
     cctgagttcg cggttgaccg catggcgcga cacgcccagc agggtggcca gggcgtcctg    120180
     ggtctgcgcc acggcgatgc cgcgttcgtc gtcgccgggc cgcccggccg tcagggcgcc    120240
     cagcaggcgc ggcagccgtt gcggcaggct gcgcagcgcc agttcgtcga tgatggcatg    120300
     ggcggtgcgt atgcggctgc acagcagctt gacgaagtag cgatacagtc cggggtcgcc    120360
     gtccagtatg tccaggaagg ccgcgcgcgg cagcagcagg atgtcggtct gctggtaggc    120420
     ccggctgtcg cgcagcatcc cgccgccgtc cagtaccgcc gcgacgcccc acaggccgtc    120480
     gaattccagc atcgacagcg cgaactcgtg gccgtcgtcg gaaaacgagc tggtgtggat    120540
     ggcgcccttg aggatgatca ccacgccggg ggcgggcgtg ccgcgtccgg ccagcagttc    120600
     gccatggtcc agccggcgcc attgggcgat ggcggcgaac gcggccagcg tcggttcggc    120660
     catgtgcccg aagcaggtat tggcgcgcag ttgcgccagg atcgccggcg ggtcccaggc    120720
     ggggagggcg gtcggattgg ctgcctggct cattgcttga ctgtgatggc gccgccgcag    120780
     gggcgcggga atgtaatgta gatcatattc gtggcccggg gcgcctccta gaatcatggc    120840
     gcatcagaca tcagacccta gtcgcgagga tatacatgaa gatcaagagc atgctgcttg    120900
     ccgtgctggc ggtatcgatg gccggggtat cggccgccgc gctgtcccag ggctttcccg    120960
     aacgggcgct gcgcgtcgtg gtgccctatc cgccgggcgg caccaccgat gtgctggtgc    121020
     gcctgctgca aaagccggtg gccgacgccg cggggcaatc ggtggtggtc gacaaccggc    121080
     cgggcggcgc gtcggtcatc ggcacctcgc acgtggcgca agcggccccg gatggctaca    121140
     ccgtgctggg cggcgacctg tcgatgctgg tcaacccttc gctgatgaaa gacctgccgt    121200
     atgacacctt gcgggatttc cgcggcgtca cgatgctggc gcgcgcgccg ctggtgctgc    121260
     tggtgcatcc gtcggtgccg gccaacaccc tcgacgagct gatcgcgctg gccaaggcca    121320
     ggccgggtac gctgaacttc gcctcgggcg gctacggcac ctcgacccac atggcgggcg    121380
     agatgttccg ccgcgccgcg ggcatcgatg tcgtgcatgt gccgtaccag ggcgtggcgc    121440
     cggccatgtc ggcgctgctg ggcgggcagg tgcagatgta tttcggcggc accacgacgg    121500
     gcctgccgca tatccagtcg ggcaagctgc gcgcgctggc ggtgacgggc gaggcgccca    121560
     gtccgctgct gcccgaggtg ccgaccttcg tgtcgcgcgg catccagggc gtgaacgccg    121620
     atacgtactg gggcgtctac gccccggcca ggacgcccga cgcggtcatc gagaagctga    121680
     atgcctatta caccggcgcc ttgcgcgacc ccgccgtgca acagcgcacc cgcgacctgg    121740
     gcctgaccct gatcggcaac agcgccgccg agcatacggc ccagatgaag acgatgattg    121800
     gcgattgggg cgccttcgtc aaggaagcgg acatccgact ggagtaagcc atggccgcca    121860
     aacaatccct ggtttgcctg accttcgatt tcgacgcgat ctcggtgtgg ctggcgcgcg    121920
     gcatggacag tccgacgccg gtgtcgcgcg gcgagttctg cgccgtggcg gccgaccgcg    121980
     tgctggactt gctcgaacgg ctgggcctgc cgtcgacctg gttcatcccc ggccatacct    122040
     tggccagcta tccggagcat tgccggcgcg tgcacgaggc cggccatgaa atcggccacc    122100
     acggctggac gcacgtcgcg cccaacctga tgacgcgcga ggaagagctc gacggcctgg    122160
     tgcgcgcgaa cgaggcgatc cgcgcgctga cggggcgggc cgcgcgcggc taccgctcgc    122220
     catcgtggga cctcagtccg cacaccctgg cgctgctgct cgagcacggc ttcgactacg    122280
     acagcagcat gatggggcac gactatctgc cgtatccggt gcgccaggga gacagttttc    122340
     ccctggacga acccgcggtg ttcggcgcgc ccacccgcct catcgaggtg cctgtcagct    122400
     ggtcgctgga cgactatccg cacttcgagt tcgtgcgcgc cgggcagagc gtcatccccg    122460
     gcctgatgaa tgccaacagc gtgatggaca actggatcga ggacttcctg tacctgaagg    122520
     agaacttcga ctggggcgtc atcacctaca ccttccatcc tttcgtgatc ggccgcggcc    122580
     accgcatgcg catgctcgag cgcctgctgc ggcgcctgat cgacgagggc gcgacgttcg    122640
     tgcgcatgga ggaagcggtg gacgcgtacc ggcaacggca ggcgctggcc gccggcgccg    122700
     catgaccaac gagggaaagg acgatgatgc agcactacta tgagcgcgac ggcgtgcgct    122760
     tgagctatta cctggacgac tataccgacc cctggacgca ggcacccacc ttgctgctgc    122820
     tgcacggcgc catggccaat gcccagcgct tctactcctg ggtgcccggc ctgagccgcg    122880
     attaccgcgt ggtgcgcgcc gacctgcgcg ggcatgggct gtccgacgtg ccgccggcgg    122940
     acaagccctt ggacctgcag gtgctgaccg aggacatcct ggccttgctc gatcacctgg    123000
     gctgcgagcg cgtgcacctg gccggcaatt cggccggcgg ctacgtgggc cagcatctgg    123060
     ccatgcagca cctgcaacgc atcgagaccc tggcgctgtt cggctcggcg ccaggcctgc    123120
     gcaacagcca ggcttcgacc tggctcgaac gagtggccga aaagggcttg cggcaattcc    123180
     tggccgacac catcgacgat cgcttccctc cggagctggt cggcacgccg cgctgcgagc    123240
     agttcctcga tgcgctgtcc gatcacgaca tggcctatat cggcaggttc gtcggctaca    123300
     tggcgcaaca ggagtggggc gatcaattgc accgcatcac ctgcccgacg ctggtggtga    123360
     ttccgggggc cggccgcatc ggcgccatgg acgcctacca gcccatgcgc gaccacctca    123420
     agcgggccga gatcctggtc tacgaaggcg agcggcacag catctgcgag tacctgccgc    123480
     aacgctgcgt agcggacctg cgcagcttcc tggcccgcca cggcggaccg gcctggcctt    123540
     gacccatcgc gctcgtcgac cttggcgtct gtcatgaaca tcgaacaata cgtgcagcag    123600
     gacggcctgg cgctgtccgc gcaattgcgg gccggcgcca ccgacccgca ggccctgatg    123660
     caatgcgcga tcacgctggc ccggcagcgc gccgaacccc tgaacgccct gtgctatccc    123720
     gactacgacg cggcgctggc gcgcgcggcg gcctggcggc cgacgggcgt gttcggcggc    123780
     ctgccgttcc tgttgaagga ctccggcctg gcctgcgacc gcctgccctc gagcatcggg    123840
     ctggcgctgt gcaaggacat gcgttttgcc gccaacgcca cgctggtgga acgcttcgac    123900
     gccgccggcc tgttgccctt tgcccgcacc accgtgccgg cgctgtgcat ggtgcccacc    123960
     accgaggcgc tcgtcaacgg cgggcccgcc cgcaacccct gggcgccgca gcgttcggcc    124020
     ggcggctcca gcggcggcgc cgccatcgcg gtcgccaccg gcgtggtgcc cctggcccac    124080
     ggcagcgacg gcggcgggtc gatccgcatt ccggcgtctt gctgcggcgt cttcggcctg    124140
     aagcccagcc gcggcctggt gcccctgggg ccggcgcgcg gcgaggcatg gggcggcatg    124200
     gcgggcgatg gcgtgctgag ccgcagcgtg cgcgacaccg ccgccgcgct cgatgcgatc    124260
     gccggcatgg agcgcggcgc tccctatgcg gcgccggcgc cgccggcagg cggctacctg    124320
     gccgctctgg cccggccttt cgagcggcca ttgcgcatcg gcgtgtggca gcatgcctgg    124380
     gacggcatcg aggtcgatcc ggcgtgctcg gcgacgctgg cgcaggccga ggccctgtgc    124440
     cggcaactgg gccacgccac cgaagccatc gccgcgccgc ccatcgacta ccaggccttc    124500
     gtgcgggcgc atatcggcat tctgtgcacg catatcgcgc tggccgtcga cgcccgcctg    124560
     gccgtcctgc ggcgcggcct gcgcgacgac gacctggagc cggccatcct ggacggctat    124620
     cggcgcgcgc gcggcatttc cgccaccgac tacgccggca tgatccaggc gctgcacgcg    124680
     gtgggccgcg ccatggcggc ctgcatgcag ggctacgacc tgctgctgtc gcccaccctg    124740
     acgcgcccgc cggtgccgct gggcgaaatc agcatggcgg acgacttcgt atcgtttcgc    124800
     cagaaggcgg cccgctacac gaccttcctg gctgtcatca acgcctcggg gcagccggcg    124860
     gccagcgtgc ccctgcatat cgacgggcag gggctgccca tcggcgtgca gctgatcggc    124920
     gccctgggcc gcgacgacct ggtgctgcgc ctggccgcgc agctcgagcg cgccgcgccg    124980
     tgggcgggac ggttcccgcc tgcggcaggc gcaggggcct gaacatggca ggccgcaccg    125040
     attgcgcgcc ggcggctggc aggctggcgg ggcgggtcgc cctgatcacc ggcgcggccg    125100
     gcggcatagg cagcgccgcc gcgctgcgct tcgcggccga aggcgccgcg ctggcgctgc    125160
     tggatcggcg ccccgacgcc atcgagcaac tggccggccg gatctgcggc cagggcgggc    125220
     aggcgatcgg cgtggccgcc gacgtgaccg acgacgacag cgtgcgccag gccgtacggc    125280
     gggcagtcga gcatttcggc aggatcgata cgctgttcaa ctgcgccggc ggatcggtgg    125340
     cgggcgatac ggcggtggac aaggtggacc tggcgctgtg gaaccgcacc ctgcgcctgg    125400
     acctggacag caccatgctg tgctgccgcc acgccgtgcc ggcgattgtg cgcgccggcg    125460
     gcggcgcggt cgtcaacatg tcgtccgggg ccggcctgcg cggcagcttc ggcgggcatg    125520
     cctacacggc cgccaagggc gcggtgattg ccctgacccg cgcgctggcc gccgaatacg    125580
     cgccgcatgg agtgcgggtc aacgccatct gcgcgggccg catccgcacc gaacgcatac    125640
     tgcgcaacct ggacgccggc gcaccggcgc aagccggcgc ggcgcaacgc tatccgtgcc    125700
     gcgagggcga cccgatcgac attgcccaca tcgcgctgtt cctggccagc cacgagtcgc    125760
     gcatgatcac cggcgaggcc atcgccgcca atggcgggta ctcggcgttc tgaggcagac    125820
     ccaaggcgct tgttgcggcg cggggagggc gcgcctgtcc ccgctgggac aggcacgccg    125880
     gaaacaaaaa agccctggac cacgtggcgt gtccaaggct tttccgtctg gtgtttggtg    125940
     gagcggagga ggatcgaact cccgaccttc gcattgcgaa cgcgacgctc tcccagctga    126000
     gctaccgccc caatgaagtc cgcaactata cacggattcc ggccgttttg gtagcggccg    126060
     gcggaaaatt ttcgccggct tgacgggccg ccaggctttc agggccgggc agggacgaag    126120
     ggccggccgc gcgggcgggt gcgcatgccg ggcgccaggc gcgtccaggg caggtcggcg    126180
     gggtcggcct gcatggggcc gggcgccttg gcgatcagca cggcgtgggc gatgggttcg    126240
     aagtcggcgc gaaagtgcac cgagctcttg acgaccagga tggcgaggtc ttcggggtcg    126300
     atgccgccca ggcggatgag gttgcggtcc agggtctggg atttgttgct gctgacgatg    126360
     acgcgcacgc cgcggtggcg caggcagacg gtggggccga ggtcggccgc catgccgtgc    126420
     atcatggggc cgtcgtagcg ggtcttgccg tcggactggt gttcgacgat gaattcggct    126480
     tcgcaggggg cgtcgccggc gacgccggac tggccgccca ggcgcagccg tacgcacttg    126540
     cccacgccgg cggccagggc ctgggcgacg gcctgggggt cgcacatgag gccgatggcg    126600
     gcgttgtcgg cgtccgcgtc gatgagggcg cgcagcatgc cggtggtgtt ggcgtcgccg    126660
     ccggcgccgg ggttgtcctg cgtgtcggcg atgaccacgg ggcggcgggc gccttgcgcc    126720
     agctgccggg cctggcggat ggcttcgtcc ggggcgagga agtcgggcgc ccactgggct    126780
     tcgagcccgg cgatgcggtc ggccagggtc tgcacggcgc gctcgacggc gtcgcggtcg    126840
     gggccgtggg cccagacgac tgggccgcac tcggggaaat cggcggccgg aaagcccagg    126900
     gcgcaggaca ggctggcgat gcccggttcg ctgcgctcga gctcggccag cagggcatac    126960
     acgccccggg cgggttcgag ctgggtgcac atgccgttga tgggaatgag gaacggcagg    127020
     cgccgcgcgg cgccatgcca gtgcttgccg gcctgcgcgc gcgcttgcag cagggcggcg    127080
     gcgcgcgcgc cggtgtcggc catgtcgacg tgcggatagg tgtgataggc caccagcgcg    127140
     ctggcatgcg ccagcatggc gcgagtcacg ttggcgtgca ggtccaggct ggcgacgatg    127200
     ggcgtggcgg ggccgacggc gtcgcgcagg cggcgcagga gttcgccttc gccgtcgtcg    127260
     tggtgttcgg tgaccatggc gccgtgcagg tccaggtaga cggcgtcgta gcggccggcg    127320
     cgggcggccg cctcgatctc gccggcgata cgctcgaagg cgtcgcgcgt gacgtgcgcc    127380
     gaggggctgg cgccggccca gaggacgggg tgcacgctgt ggccgtccgc cagggccgcg    127440
     ttcaggaagc cgccggcggg gatgttgacg gcgcgcagcg ccagcaggtc gtcgccgcgc    127500
     accagggcgg gaaagccttc gccgcgcagg aagttgtcat agccggcctt ggaaggcgcg    127560
     aaggtgttgg tttcgtgttg gaaaccggca accaggatat gcatgcttgc ctcccgggcg    127620
     tggggcgccg ccgcggcgcc gggcgtcagc cgaacgccag ggtggcgatg accggcgcgt    127680
     ggtcggacgg ctgttcgttg gcgcgcggcg ccttgtcgat gacgcaggcc acgcagtgcg    127740
     gcttgagcgc gtcggacagc agcacgtggt cgatgcgcag gccggcgttg cggcggaacg    127800
     cgaactggcg gtagtcccac cagctgaagg atttctcggg ctgctcgaac aggcggaagg    127860
     agtcggtcag gcccaggtcc agcagcgcgc ggaaggccgc gcgttcgggc tcggagacca    127920
     gcacctggcc ttcccatttc tcggggttgt gcacgtcggc gtcggccggc gcgacgttgt    127980
     agtcgcccag gatggccagg cgcggatagg tgcgcatttc ttcctcgagc cagtcgcgca    128040
     ggccgtcgaa ccaggccagc ttgtagacgt acttgtcgct gtcgaccgac tggccgttgg    128100
     ggcaataggc gcagatcacg cgcacgtcgc cggccgggct gggcagggtc acggccagga    128160
     tgcgctgctg cgggtcttcg tagcgcgggt tgttgcgcac cagcgcgaag ccgggctcgc    128220
     gcgagatgat ggccacgccg ttataggtct tctggccggc ccaggcggcg tggtagccgg    128280
     cctcggtaaa ggcgtcgagc gggaatttgt cgtcggtcag cttgagttcc tggatgcaca    128340
     gcgcatcgac cggattggcg gccagccagt ccagcacctg cggcaggcgc acattcaggg    128400
     agttgacgtt ccaagtcgcg agtttcacgg gttctcactg caaaagttcg gccaacggcg    128460
     gattttcgca gatttgggcc aggcgggcag gaaacgctca gcgcaacgcg tcgatgtagt    128520
     acatcccctt ggccagcaac acgatcgcca cgaggtggca gaacacgctc aggtgcagcc    128580
     gccgcgaacg ccggccgcgc aattggccgc gccggcgcca gcgcatggcg gcggcgaaat    128640
     ggcccaggac gctgagcgcc agcacgatct tcaggctgag cagcaggccg aagctgctgg    128700
     ccagcggctg ctcgagcgcg ccgcggtgct gccaggccat gccgatgccg gcgccgaaca    128760
     gcgccagcag cacccacggc atgatggcgc gggcgcggtt gccgatgccg cgctcgaccg    128820
     cgttcatggc ttcgcgcggc acttgccgcc gcacgctttc gaggatcagg acttcgaaga    128880
     agacggtgcc gatgaagacg aaggcggcca gcaggtgcag ggccagcagg atggggtagg    128940
     tcatgggcgg gaccgcacgg gcatggcggc ggcggttggt gcgcgcaggc gcgggcgcac    129000
     cagcaggggc gcgaaacgcc acaggtacag gacgaacgcc agcacccagg cggcggtggc    129060
     gccgtgcagc gcggccaggg tgtgcgggcc gggccagagg gcggccaggc gcagcgcggc    129120
     cgcgccgatg accaggaggt agcaggcgag catgaggcgg tcggtgcgca gcggccggcc    129180
     caggtggccc agggcggtgc gggtgatcat gccgatgatg agcaggccga agccggccat    129240
     gccgatgacg tgcgcaggcc acgcggcgcg cgcgatgccg cccgccgcgc ttgccgccgc    129300
     caccagcagg ccggcggcca ggcccaggta gccggtgtac aggatccaca gcaggggcac    129360
     gccgcgcgtg gcccaggggc gccaggacag ccattgcgcc agcgcgatca ggccggccgc    129420
     ggccagcgcc acggcggtca gcgcgccggc ctgcgccagc gtcgccgcca cggcgaccag    129480
     gccggcggcc agttgccatt ggccgctgcg cgtatgcatg gggatctgca ggccggcgat    129540
     ggcgcgcatg gcgaaaaagg gaatgatgcg gcgcgcgatc agcagggcga tcacggccat    129600
     gcacagcagg cccgcgttga agcgctgcag cagcaagggg tagtcgccgg cgcgggcggc    129660
     cagcagatac agggcgtcgg ccgcgcccag ccccagcacc agcaagggca cgccgtcgtt    129720
     gcgccggctg gcgccgcgcc ggtagatggc ccggcccagc gcggccgcgg cccaggcgaa    129780
     gaacagcagc tcgcaggcca cgccggtcca gaaggcggcc atgcccggca gcaggaaggc    129840
     ggcgcgggcc gccagccaca gcgcggccag cgcggccagc ggcgcgccgc gcagcgggtt    129900
     gacgccggtc caggtggccg cggcggtcag caggaagccc accgcgatgg cgccgatgaa    129960
     gccccacagc atttcatgcg catgccagat gacgcccgcc atggcgccgc ccagccactg    130020
     cggcgcgccg atccacagcg ccaccgacag cgcgccccag gccgcgccca ccaggtagag    130080
     cggacgaaag cccagttcca ggaaggcgcg ccattgcggc gcggcgcgtc cggcggcggg    130140
     ctcgtcgatt tgcagcagtt cagccatggg cgaggtccgt gggggcctgg tcggggctgc    130200
     ggtgcagctg atagccgtac cacaggcttt gcgcgatgcg gccggccatc aggcaggcct    130260
     gttcggccat ggcctggttg ggctgcgccg cggcggtggc gcgaaacagc cgcagccagc    130320
     gctcgaacag gcccgcgtgc aggccgggca gggccacgtg cctgggcatg ggcgtgccgc    130380
     gaaagcgtcc ggtgccgcgc agtatcgacg accagaagtc gaccagcttg gcgaggtgga    130440
     cgtcccagtc gtcgacatgg gtgttgaaga tcggccccaa ctcggcgtcg cgccgcactt    130500
     cggcgtagaa ctggtgcacc agttgcgtga tgtcttcttc ggtacagaga tcgggcgcgc    130560
     ccacgaggcc tctcctgcgg tttataagat gtatatataa tacatcttat ggcttaggca    130620
     tggggaagga agggctcggg ccttgacgca gcgcaagcgc ggcgctttct cttttacact    130680
     gggccgacgg gcatgcgccc gcgtattccg cagcccagcc gccatgatca cgccgccaga    130740
     ccatcccccc cgcatcgcca tccagtattg cacgcagtgc cagtggctgc tgcgcgcggc    130800
     ctggatggcg caggagctgc tttcgacctt cggcgccgac ctgggcgagg tggccctggt    130860
     gcccggcacc ggcggggtgt tccgcatcca ctacaacggc gcgccgctgt gggaccgcga    130920
     ggtcgacggc ggctttcccg aggccaaggt gctcaagcag cgggtgcgcg accatctcga    130980
     tccgggccgt ccgctcggcc atatcgacgg ccgtcccaag ccctaggcgg gcgcgctcca    131040
     ttcctcgggc aggccctggg tcagggtcga gacgaacgcg gcggtgcgcg catcgcgcga    131100
     ctgcgcgaag acttcgcgcg gcgtacccgc ctcgaccacc gcgccgccct ccaggaacac    131160
     cacctgctgg gcgatgctgg cggccagccg caggtcgtgg gtggccatca gcatggtcat    131220
     gccttcgccg gccagccggc gcagcacgtc caccacttcg atggccagcg acgggtccag    131280
     cgccgaggtc ggctcgtcgc acagcaagac gcgcggcgac gacgccagcg cgcgggcgat    131340
     ggccacgcgc tgctgctggc cgcccgacag cgtgaccggc caggcgtcgg ccttggcggt    131400
     catgccgact ttctccagca gctccatggc gcgcgcacgg gcgcgcggct tgtcccagcg    131460
     ctgcaccgtg accaggcctt ccatgacgtt gtcgatcacg ctctggtggg gaaacagctg    131520
     gaagttctgg aacaccatcc cggtctggcg gcggatgcgc tgcacggcgt cgcgcgccgg    131580
     gcgccgaccg tcgaacgcca gtgtttccgg ccccagccgc agcacgccgg cctcgggaat    131640
     ctccagcagg ttcacgcagc gcagcagcgt gctcttgccg ctgcccgaag ggccgatcag    131700
     ggccgtgacg ctgccctcgg gaatgacgac gtccacgccg tgcaataccc ggttgccgcc    131760
     gaagctcttg tctatgcctt gcagccctat catcgatgtt gctccgcgaa gacggcgtgc    131820
     tggccgaagc gtttttccag gtgcacctgc agcgaggaca gggccgaact gaacaccagg    131880
     tagatcagcg ccgcctcggt atagagaatg agcggctcgt aggtcaccgc cgcgatgcgc    131940
     tgggcggcct ggaagatttc gggcacggtc agcaccgccg ccagcgaggt gtccttgacc    132000
     agcgcgatga acgaattggc cagcggcggc accgccaccc gcgcggcctg cggcagcacg    132060
     gtgcggcgca tggcctggcc gcgcgtcatg ctcagcgaat aggccgcttc ccattggccc    132120
     ctggggatgg attcgatggc gccgcgaatc acttccgagt tgtaggcgcc gacgttcagc    132180
     gtgaagccga tcagggcggc cggcagcggg tcgagcacga tgccgacgct gggcaggcca    132240
     tagaagatca cgaacaactg caccagcagc ggcgtgccgc ggatcagcca gacgtagaag    132300
     cgcatcagcg ccacgatggg ccaggggccg aacagccgca gcagcgccac cacgaaggcc    132360
     agcgccaggc ccgcggcgaa cgacagcagc gtcagcggca cggtgaacat caaccccgcg    132420
     tgcagcaggg gccagaacga atcgagcatg agctgtagcc aggccggcac gatgggggct    132480
     cctgtgcgtt gcgggcgggg aggggcggcg ccgccgggcg gggccggcgg cgggctttac    132540
     tgggcggccg acaggtcggc gccgaagtac tgctcggaga tcttccggta ggtgccgtcg    132600
     gccttcagct cggccagcgc cttgttgatg gcggcctgca gctcggggtt gttcttgcgg    132660
     atcagcacgc ccgattcgct gaactccttg ctcttgtcgt aggctgccac cttgaccttg    132720
     gcgttgggct tttgcttctt gaagtcgaga aacgacaggt tgtcgttgac cgtggcctcg    132780
     acgcggcccg acatgagcag gtcgatggct tcgttgaacc cctgcaccgg caccacttcg    132840
     gcgccatagc tctgcgccag cttgccgaag ttgctggtca gggtattggc cgacttgcgg    132900
     cccttcaggt cggcgaacga cttgatggcc tggttgtcct cgcgcacgat cagcgcggcc    132960
     tgcgacgaga tgtaggggtc cgagaaatcg tacttggcct tgcgcgcatc ggtgatgccg    133020
     acctggttga tgacggcgtc gtagcgcttg acgtccaggc cggcgatcag cccgtcccac    133080
     ttgccttcga cgaactcggc tttcacgccc agcttctggg cgatggcgcg gccgatctcc    133140
     acgtcgaagc cggtcagctt gttgctggcg tcgtgatagc tgaacggggc gtaggtcccc    133200
     tcggtgccga tcttgatgac gccggccgcc ttgatggcgg ccaggtcgtc ggcctgggcg    133260
     gccgtgccga ccatggccag cggcaccagg ccggcaagca gcagtttgcg caaggagaag    133320
     ttcatggcgc gtgctccaca ggaagaggtg gacggggcgc agcgccccgc ggaactgagc    133380
     actctagcaa cgcgcctatt tttccacaaa gaataagaaa tcgtgaaaac ataagaaaaa    133440
     gcaatatacc cgggagcctg tccccgaacg gggactggct cccgctgact tctacttgcc    133500
     ggcgccctag gtgcccgtcc ccgctgggac aggcgcccgt ccccccgcgg ggacaggcac    133560
     cccgtcatca ggacgcctgg tgcctgcccg cgcgcagcag ccgcaagccg ttggcgacca    133620
     ccagcaggct ggcgccgacg tcggcgaaca ccgccatcca cagcgtggcc tggccggcca    133680
     tcgccagcac caggaacacc gccttgatgc ccagcgccag gacgatgttc tgggtcagga    133740
     tgcggtgggt ggcgcgcgac aggcgcacga acgtgccgat cttgcgcagg tcgtcgtcca    133800
     tcagcgccac gtcggcggtt tcgatggcgg tgccggtgcc ggccgcgccc atggcgaagc    133860
     cgatgtcggc gcgcgccagc gccggcgcgt cgttgatgcc gtcgcccacc atgcccacgc    133920
     gcagggccgg atccagcttg gcctcgacgg cgtccagctt gtcctgcggc agcaggtcgc    133980
     cgcgcgcctc gtcgatgccg gcctgggcgg ccaccgcctg ggcggcgcgg gtgttgtcgc    134040
     cggtcagcat gagggtgcgc acgcccagcc ggtgcaggtc ggccacggcg gcggcgctgc    134100
     tggccttgag cgtgtcggcc accgcggcca gcagcaggac gcgctgcccg tcggccaggg    134160
     cgatggcggt cttgccggcc gcttcatagg cgtcgatgcg ggcctcgata tcgggcgtgc    134220
     tgacgcccag ctcgcgcatc aggcggcggt tgcccagctg gaagcgctcg ccgccgatct    134280
     cgccctgcac gccgcggccg ggcagggcgg cgaaaccgtt cacctcgtcc agcggcgcgt    134340
     ccagggcgtg gtcggcctgg gccagcgcgc gcgacacggg gtggtccgag cgcgccgcca    134400
     ggctgaccgc ggcgcgcagc gccgggcgcc cgcccgcgct ggcgtcgtgc agcagttcca    134460
     ggtcggtctg caccggcttg ccctgggtca gcgtgccggt cttgtccagc gccagccagc    134520
     gcagcttgcg tccttcctcc aggtagacgc cgcccttgat caggatgccg cgccgcgcgg    134580
     cggcggtcag gccgctgacc acgctgaccg gggtggaaat caccagcgcg caggggcagg    134640
     cgatgatcag cagcgccagc gcgcggtaca cggagtcgag ccaggcgtgg cccagcagca    134700
     gcggcggcgg cgccagcgcg accagcaccg ccagcccgac cacggccggc gtgtagatgc    134760
     gcgagaagcg gtcgatgaag cgctgggtcg gggcgcgcgc gccctgggcc tgttcgaccg    134820
     cgtggatgat gcggtccagc gtggtattgc cggccgccgc cgtgacgcgg tagtcgaacg    134880
     acccggaggc attgacggtg ccggcgtaga cgtcgtcgtc cgggcctttt tccaccggca    134940
     ggctttcgcc ggtgatgggc gactggtcga tcgcggaatg gccttcgctg atggtgccgt    135000
     cggcggcgat gcgctcgccc gggcgcaccc gcaccaggtc gcccgggcgc agtcgcgccg    135060
     ccggcacctc ggcccacgag ccgtccggct ggcgcgcggt ggcggtctgc ggcgccaggt    135120
     ccagcaggcc gcgcaccgca tggcgggcgc ggtccagggc gcgggcctcg atcagctcgg    135180
     ccacgttgaa caggaacatc accatggccg cttccggcca ttggccgatg agcatcgcgc    135240
     cggtcacggc gatgctcatc agggcattga tgttgaggtt gccgttgcgc accgcgatcc    135300
     agcccttgcg gtaggtcgac agcccgcagg ccaggatggc cgccagcgcc agggcggcgg    135360
     cgacatagac cggctggccg gtgaagtggg cgagctcgga cagcgccgcc agcaccccgc    135420
     cggcggccag caggcgccag ccgcgcgaag gcgcggccgc gccggccggg gtcgccgggg    135480
     cgtcgccggc caggggctcg ggcgtcatgc ccagcgagcg gatcgccgcg tcgatacgat    135540
     cgagcgcgcc gtcggcatgc agcacggtca gtacgcgctg catcaggttg aagtcgagct    135600
     cgtgcacctc gggcaggctg gccagcttct tgcggatcag cgtttcctcg gtggggcagt    135660
     ccatctgccc gatgcgcacc cgcgtgacct gctggccggg accgggctgc caggccgggg    135720
     cggccgcggg cgcggccggc tggccgtgcc catggccgca gcaggccggg atgccatggt    135780
     cgtgggcatg gtcgtgcccg gcatggtcat ggcctgcgtg gtcgtggccg tgggcgtccg    135840
     tgcgttggcc agatggcgta tcgagggcaa ggtcgcgggt cgtggagggc atctggtacg    135900
     tcctttctgg atgttggacg catttcacac cctggagtta ctatagggtc aagcacccgg    135960
     atcaaggagc ccccatgaaa atcggcgaac tggcccgcac ggcgggcacc acggtggaaa    136020
     ccgtgcgcta ttacgagaag gaagggctgt tgcccgcgcc cgagcgcggc ctgaacaact    136080
     accgcagcta cggcgaggcc catgtcgagc ggctgcgcct gatccgcaat tgccgcgcgc    136140
     tggacatgac gcaggacgag atccgcaccg tcctggccct ggcggacaac cacgaggccg    136200
     gctgcgctcc gatcaaccag gtgttcgacg agcacatcgc ccacgtggac gcccgcatcg    136260
     ccgagctgac ccagctgaaa gcccagctgg gcgagctgcg ccagcgctgc gcctcggccc    136320
     gtccggacgc cgaggactgc ggcatcctgc acggcctgag cgagatgcag gtcgaagagc    136380
     gtcccgagcg ccacacccac ctcggctagc gcggcgatgc ccttggcgcg cggccgggaa    136440
     taggccggcc ggccccctgc gctgggctat gatgagaata tgttttcttc tcgtcgagat    136500
     tttccgcgcc tatgaccgta tctcccttgc acgcgctgac gtcgcgccgt tcgatgaagt    136560
     tcctgcgcgc gcccgcgccc aagcaggacg aactggagca aatcctgcag gccgccatga    136620
     gcgcgcccga ccatggcgcg ctgcgcccgt ggcggttcgt gctgatccgg ggcgaggcca    136680
     tcggccggct ggccgacctg gcgatcgagg cggtcaagcg cagcggcgac aagcgcatga    136740
     cgcccgagaa agagaagtcg gtgcgcgaat gggccgccgg cgtgccgctg ttcatcgccg    136800
     tggcgcagaa gatttcgcat gacaacaccc gcattcccga gcaggaacag ctgctggcca    136860
     ccggcgcggc ggtcatgaac atcctcaacg ccgcgcacat gctggggtac ggcgcgttct    136920
     ggagcacggg cctgggcact tacgtcgagg acgtgcagga cgcgctgggc ctggacgcga    136980
     tggactaccg cttcctgggc ttcgtggccc tgggcacgcc gggctgcgcg gtgccgccgg    137040
     cgcagcgccc ggatttccgc gagttcgtgt ccgaatggca gggcgtcacc gtctgagcgc    137100
     gtctgcgcgc gcggcatgta aaaacccggc gcgcaggccg ggtttttaca tggagcgggg    137160
     ccgtgtcagg cgccggcggt ctcggccagc acgcgctggg cttcctcgcg cacgcgctcg    137220
     ggggcggtgc cgccgatgtg cttgcgggcg gccaccgagc cttccagcgt cagcacctgg    137280
     tggatgtcct cgccgatgct gggatggtag gcctgcaggt cggccagcga caggtcggcc    137340
     aggtcgcagc cgcgctgctc gcagtcgcgc accgcgtggg cgacgatttc gtgcgcgtcg    137400
     cgaaacggca ggccgcgctt gaccaggtag tcggccaggt cggtggcggt ggcaaagccc    137460
     tgcagggcgg cggcgcgcat gttgtcggcc ttgaccttga tgccgccggc catgtcggcg    137520
     aagatggtca gggtgtcgcg cagcgtgtcg gccgtgtcga acaggccttc cttgtcttcc    137580
     tggttgtcct tgttgtaggc cagcggctgg cccttcatca gggtcagcag cgccaccagg    137640
     tggccgttga cgcggccggt cttgccgcgc gccagttcgg ggacgtcggg gtttttcttc    137700
     tgcggcatga tcgagctgcc ggtgcagaag cggtcggcca ggtcgatgaa gcccacgcgc    137760
     gggctcatcc acagcaccag ttcctcggaa agacgcgaga tgtgcgtcat gatcagggcg    137820
     ccggcggcgc agaattcgat gccgaagtcg cggtcggaga cggcgtcgag cgagttgcgg    137880
     cagacgccgt cgaagcccag cgtgcgggcc acgcgctcgc ggtcgatggg atagctggtg    137940
     ccggccagcg cggccgcgcc cagcggcagg cggttgacgc ggcggcggca gtcggccagg    138000
     cgctcggcgt cgcggccgaa catctcggca taggccagca ggtggtggcc gaacgtgacg    138060
     ggctgggcca cctgcaggtg ggtgaagccc ggcatgatgg tggcggcgtt ctccagcgcg    138120
     accgtggcca gcgcgtggcg cagctggcgc agcaggtcga ccagggtgtc gatttcgtcg    138180
     cgcagccaca ggcggatgtc ggtggcgacc tggtcgttgc gcgagcggcc ggtgtgcagg    138240
     cgcttgccgg cgtcgcccac gagctccacc aggcgcttct cgatgttcag gtgcacgtct    138300
     tccaggtcca gcagccactg gaacgagccg gcgtcgatct ccgagaggat ctgctgcatg    138360
     ccgcgctgga tgtcggccag gtcctgggcc gagatgatgc cttgcgcggc cagcatgtcg    138420
     gcgtgcgcca gcgagccgcg gatgtcgtgg cgcgccatgc gcttgtcgaa atcgaccgag    138480
     gccgtgtagc gtttgacgag gtcggaaacg ggttccgaga aacgggcgga ccacgcctgc    138540
     gccttgttgg cgaactggtc ctggctggag tgggaagtat ttgccatgat gcgggcaatt    138600
     atatagggcc ggcgcgcgcc gcggcggcgc cacggaacgg cgcgccggcc gacttgtcgg    138660
     ataatctgca ccatggcgct ttcaggagga tgcagtgctg ccgaaggaat tggagaacgt    138720
     ggtcgccacg ctggacaact atgtgccgga cacggcatgg ggccagacgc tggtcggcat    138780
     cggcgtgctg gtgctgacgg cgctgttcgt ccaatgggtg gtggcgcgcg tcgtgctgta    138840
     tttcgcccac cggctgctgg tgctgagcgg ccgcgaggac tgggaccgcg ccctgagccg    138900
     ccgccgcgcc taccagaact tctggtacgc ggtgccgttc gcggtggtct ccatgggcat    138960
     agaactggtg ccgcatgccg agcgcgcggt caccgtcgtg ggccggctgt cgcacgccgg    139020
     ggcctggatc tgcgtgttcg tggccttcag cggcgtgctc agcgcctggc aggataccta    139080
     ttcggccacc acgcgggcgc agacgcgctc gatcaagggc tatatccaga tcggtaagct    139140
     gatcctgtgc gcggtggggg cggtgctggt gctctccatc ctgctggacc gctcgccgct    139200
     gtggatgatc tccggcctgg gcgcgctgtc ggcggtgctg ctgctggtgt tcaaggacac    139260
     gctgctgtcg ctggtggcca gcacccagct cacgtccaac gacatgctgc gcatcggcga    139320
     ctggatcgag atgccgcagg ccaacgccga cggcttcgtc aaggacatcg cgctgcatac    139380
     cgtcaaggtg cagaactggg acaacacggt gaccaccgtg cccacctaca agctgttttc    139440
     cgaaagctac cgcaactacc gccacatgtt cgagtcgggc gggcggcgca tcaagcgcac    139500
     cctgcggctg gacgcggcca gcgtgcgctt catgaacgag gaagagggcg gacggctcaa    139560
     gcgcttcgtg ctgctgcgcg actacctgca ggccaaggag gacgcgctgc tggaggccaa    139620
     ccgccagctg ggcgaactgg ccgaggtgcc ggccaaccgc cgccgcctga ccaacatcgg    139680
     caccttccgc ggctatgcgc tggcctacct gcgccagcac cccgaggtgc gccaggacat    139740
     ggccatgatg gtgcgcatga tggagccgca gcccaacggc atcccgatcg agatctattg    139800
     cttcacggcc atcaccgcct gggtcgagta cgagcgcatc cagggcgaca tcttcgacca    139860
     tctgctggcc atcctgcccg agctggggct gcggctgttc caggagccct ccggctcgga    139920
     cctgggcaac ctggccggcg gcatgcgcga ggcggccctg cacgagttcc ggcgcgagca    139980
     ggtggccgcg ggcgaggcgc cgctggcgct gcgcggcgac ggcgccgcgc ccgtgcgata    140040
     atttttcttt ccctttttcc cattctggaa ccgtcgttca tgagccttgc ccgggttgga    140100
     atcgcgcaaa tcaacgcctg cgtcggcgat ctcgccggca acgcggcccg ggtgctgcaa    140160
     gcggcgcggc aggcggccgg gcagggcgcc gacgtgctgg tcacccccga gctggtcctg    140220
     accggctatc cgccggaaga cctgctgctg cgtccccggt tcatccagga gcagcaggcc    140280
     gtgttcgagc ggctttgcca ggacctggcc ggcctggccg gcctgcatgt ggtgatcggc    140340
     catgtgctgg cgcgccagga ccgcctgtac aacgccgcca cggtggtgtg cgaagggcgg    140400
     gtgctgggca gctactgcaa gcgcgaactg cccaattatt cggtcttcga cgagcagcgc    140460
     tatttctccg cccatggcga agccttcggc tttaccgtca agggcgtgcg cttcggcctg    140520
     aacatctgcg aggacatctg gttggagcgc gcgccgcgcg cggcggcggc cgacggggcg    140580
     caggtgctgc tggtgtccaa cgcgtcgccc tacaacaccg gcaagcagga agagcgcctg    140640
     tcggtggcgc ggcgcagcgt gcaggacacc ggttgcgccc tgatctacgc caacctggtc    140700
     ggcggccagg acgaactggt gttcgacggc gcgtcgttcg cgctggacgc gcaaggccgc    140760
     atgagcgccc gcctgccgga tttcaccgaa ggcgtgaatg tgctcgaggt cgatgcgcgc    140820
     ggcacggtgc gcccggtgac cgaacaggcc gccgtgcagc cctacggcct cgaagagcag    140880
     gtctggaacg cgctggtgct gggcgtgcgc gactacctgg gcaagaacgg ctttcccggc    140940
     gccatcatcg gcctgtcggg cggcatcgat tcggccgtgg tgctggcggt ggcggtcgac    141000
     gccgtgggcg cggacaacgt gcgcgcggtc atgatgccct cgcgctatac cgccgacatc    141060
     tccctgaccg acgccgccga catggcccgg cgcctgggcg tgcaatacga cgtgatcgcc    141120
     atcggcgagg tggtcgaccg cttcgaggcg gcgctggcgc cgcagttcgc cggcctgccg    141180
     gtcgacgcca ccgaggagaa catccaggcg cgcgcgcgcg gcaccttgct gatggcgctg    141240
     tccaacaaga ccggccggct ggtgctgacc accggcaaca aatccgaaat gaccaccggc    141300
     tattgcacgc tgtatggcga catggcgggg ggcttcgccg tcatcaagga cgtgcccaag    141360
     accctggtct accgcctggc gaactggcgc aaccagcgcc agcccatcat tcccgagcgc    141420
     atcatcaccc gcccgccgtc ggccgagctg cggcccgacc agaccgacca ggacagcctg    141480
     ccgccctacg acattctcga cggcatcatc gagcgctaca tggaacacaa cgcctcggcg    141540
     gccgatatcg tggccgccgg ctttccgcgc gaggcggtcg ggcaggtcgt gcggctgatc    141600
     cgcatcaacg aatacaagcg gcgccaggcc ccgcccgggc cccgcatcac gccgcgcgcg    141660
     ttcggccgtg attggcggta tcctgtgacc aacggattcc gcgagacggt ttgaggccgg    141720
     cgggcatccc attcagaaaa agccaggaca gcacaacgtg aaacaagtaa ccgccatcat    141780
     caaacccttc aagctggacg aagtccgcga agcgctggcc gaggtcggcg tcagcggcct    141840
     gaccgtcacc gaggtcaagg ggttcggccg ccagaagggc cataccgagc tgtatcgcgg    141900
     cgccgagtat gtggtggatt tcctgcccaa gatccgcgtc gaggtcgtgc tggccgacga    141960
     catggtcgat ccggccatcg aggccatcgt caaggccgcg cgcaccggca agatcggcga    142020
     cggcaagatc ttcgtgaccc cggtcgaaca ggccatccgc atccgcaccg gcgagagcga    142080
     cgaagaggcg ctgtaggcgt ccgcgccagg cgccgggccg ctaggccttg ccgccgccgc    142140
     gcgcggcaat gcgcgcgcgg ttgagcgcca gggcctcctc ggtcggggtc cagtcgttcc    142200
     agaacggcgc gggaatatcc gcaaagtcct cgcgcgtgac gccggcgaat gccggccgat    142260
     agccgcggcg ccgcatttcc tcgaccagcg cgcggtgccg cctggccaga tagcccaggc    142320
     gggtgtagaa gaacagcaga tggcccttgc ccagcgtgta ggcggccggc tgcaccagcg    142380
     cgccgcgcgc ggcggccttg tgcgccagcg cgaaaacccg cggcagttcg cggtattcgg    142440
     cgaccaggtg cgggccgctc agttcttcga cggggacaca attgatgcgg gtcaaggcgg    142500
     ggctcctgtg ggggcgcggc ggcggccatg acggccatcc ggccacgcat tagatcagaa    142560
     aggcagcgga gcgacggcag atggacaaga tacggctgga caaatggcta tgggcggcgc    142620
     gcttctacaa gacgcgcagc ctggcggtgc aggaaatcgg caagggcagg gtgcaggtca    142680
     acggccagcc ggccaagccg gcgcgcgagg tggcgccggg cgacgtggtg tgcatccgca    142740
     aggaagatcc gcccatccat gtgcgggtct gcgcggtcag cggcgtgcgc ggtccggcgc    142800
     cggtggcgcg gcagctgtac gaggaaacgc cggaaagcgc ggcggcgcgc gagcgggccg    142860
     ccgagatgcg gcggctggcg cccgagcccg ccatggatat cgtcgccggc cgtccgacca    142920
     agcgcgaccg ccgcctgatc gacaagtggc gcgacgctta ggacatcggc agggcggggc    142980
     cgggcgcctc gcgcagtgca gcggaattgt catcgcggat cgctaggatg cgggggggtc    143040
     atacccacgc caccacgcga tccggaggga atactggcat gcacgaaccg acgatgagca    143100
     agcgccgcct ggtgctgaag atgctgggcg gcgcgcccat gctgccgctg ggcgccgtgg    143160
     gcgcggccac gctgctggcc ggctgcaggg ccggcgccga cggcgcacag gccgccgcgc    143220
     gcggcgccgg gccgcgcggc gatttcgtga cggccgcgtt cacgtccatg gccgcgccgt    143280
     cgctggacgc gccggaaaaa atggccatca ccaccgtgga gtcgaccctg gaggtcagct    143340
     tcagcgacgg cggcaggcag acgttccagc tggggtacga accgttcttc atgaccggcg    143400
     acagcgtgcc cgatggccag ggcgcgaccc gggtcgcggg cggctatctc gatatccatg    143460
     gccgacccat catggacagc tcggtgccgg gcaaggcgcg ccagttcttc tccgactgcc    143520
     ccgacggcat gtccctgctg gccctgccgt cggcccgggt gccgggcgtc aagggcaata    143580
     cggtgttcgc cgtggtgcag ttcgagtacg cctcgcacaa ccagaagggc gagtccatgt    143640
     acggcctgct gccgtcgccc atcgcggtgc tgaccctggc gcaggatccg gccaccggca    143700
     ggctggcgct ggtcaagtac agcccggtcg ataccgcccc ggcccacggc ctgtggatca    143760
     cctgcggcgc gagcctgtcg ccgtggaaca cccatctggc cagcgaggaa tacgagccgg    143820
     acgcgaccac cgcgcgcgcc tcggcgcagt tccagggctt cagccgcaac ctgtacggcg    143880
     atgcggccaa ggccaatccg tatcactatg ggcacctgcc cgaagtggtg gtccacccgg    143940
     acggcaccgg caccatcagg aagcactatt gcctgggccg catctcgcac gagctgatcc    144000
     aggtcatgcc cgaccagcgc acctgtctga tgggcgacga cgccaccaac ggcgggctgt    144060
     tcatgttcgt ggccgaccgc aaggccgatc tgtcggccgg cacgctttac gtcgccaagt    144120
     ggcgccagac ctcgggcgag ggcccggggg ccggcacgct gggctggatc aacctgggcc    144180
     atgcccgcag cgccgacatc gaggcgctgg ccgataccct gacggcggcc gacatcatgg    144240
     acgtgcgcac cgcggatccg ggcgacccgg ccttcaaggc gatacgcgtc aacggcaagg    144300
     ccaactgggt caggctggcg ccgggccgcg agcaggccgc ggccttcctg gaaacgcact    144360
     gctacgcggc cctggcgggc ggcacgatgg cgttttccaa gatggaaggc accaccgtca    144420
     atgcgcgcga ccgcatcgcc tacagcgcca tgtcgcgcat cgagacctcg atggtggacg    144480
     gcacctcgcc cgacctgcgc gtgcagggcc ccgagccggg cgcggtgtac gcgctgaacc    144540
     tgcgcggcgg ccagcgcgat agcgccggca cggcgatcga cagcgagtgg gtgccggtgg    144600
     acatggcggc ggtgccggcc ctggtcggcg agaaactggc cgcgcccgac gccctgggca    144660
     accgccacca cgccgaccgc atctccaatc ccgacaacat caagttttcg gagaagctgc    144720
     gcacgctgtt catcggcgag gacagcaacg gccacgtcaa caacttcctg tgggcctaca    144780
     acgtcgacag cggggcgctc tcgcgcatcc tgtcgtgccc ggccggcggc gagtccaccg    144840
     gcctgcaggc ggtcgacgag atcaacggct ggacctacat caccagcaac ttccagcacg    144900
     ccgccgactg gggcggcgtc cacgccgtcg tgcgcgccac gctggacccg ctggtcaagg    144960
     ccaactaccg cgacggcttc ggcgcctcgg tggggtacat cacgataacg ccgtaactcc    145020
     cggtgcctgt ctccgccggg gtgcctgtcc cggcggggac aggctccctg tcggggatag    145080
     gcacctcgcc ccccgcgcac ctgccgcggt cagcctggcg cccagcgggc caggtccaac    145140
     gccagcgcgc cggcctgcaa tcgcccggcg atctcgtccg cgatctcggc ggccggccgg    145200
     cctgccgtga cgacgcggtg gccggccagg ctgccggccg cgcggaacgc atcgtgcatg    145260
     gtccgcacca tcgacgcctg cccgggcccg ctgcgctgct cgacccgcgc cagggcctcg    145320
     tccaggccga tatccagcaa ggcgtaggcg gccgggcagc gcgccgcctg caattgcgcg    145380
     gcgatgaggg gcaggaacca cggtccgaag atgccgtcca ggtagacgcg atagccgtcg    145440
     gcggcgaacg acgccgcgct gcggcatacc gcgcggatga ccgcggcgtt ctgagcatcg    145500
     gcctgggggc ggtagggcgg gatagggtgg gccggaaagc catagaacag gtcggacggc    145560
     aggtgcaggc cctgcgggtc ggcctgcgcc agcaggccgc acgcggtggt cttgcccgaa    145620
     ccgggcggcc ccgagacgat gacgatggga agcatggatg gattcctgga gacggtgtgc    145680
     acggtgatag tacgcgcaga tggggacggg cccggcctgg ccgcggccgt cagcggccga    145740
     acagcgcgcc gcactgggcg cagatctcgg cggtgacggc cagccgcgcg tggtcgcgcc    145800
     gctcgatcat gccgatggcg cgcaccgccg ggcccagttc ggcgggcagg ggcagcacgc    145860
     gcaactgcgg gctggcttgc cagttggcgc cgttgagcag cggcagcagg gtcacgccca    145920
     cctcctggcg caccagttcc accagggttt cgatggcgtt gagttcgagg aactcgttca    145980
     ggccgccgcc cagccggcgc acgatgcggt cgatctggcg cccggtgcgc tgggtgcggt    146040
     caaagcgcag gaacggattg gcggccagca cttcgcgcgc gtcggcgccg ggcgcgtggg    146100
     ggtgcgccag cacgaccagc ggctcttcgt acaggggcgt ccagcgcgtg ctggccatct    146160
     tgcggccggc ctcgaccacc agggccgcgt ccagctcgcc ggcctcgacc ttgccggcca    146220
     gttcgctggc cttgccggag aacacgcgca cgtccagcgc cggatgatcg cgcttcaact    146280
     gcgaaaccac cttggacagg gtgcccatgc acgacacgat ggcgcccacc gagaccgagc    146340
     cggccagctc gcccggcacg ttgcgtggcg ccttcaggtg gtcgtataaa tcaagcagcc    146400
     gcttgatctc cggcaccagt tcgcgccccg ccgcattcag gatggcgagg cgcccgccgc    146460
     ggtcgaacag ctcgcggccc agttcggctt ccagcgcgcg catctggaag ctgaccgcgg    146520
     cctgcgtcag cgccacctgc tcggccgctt ccgagaacgt gccgtgctgc gccaccgcca    146580
     ggaaggtacg caggaaccgt atgctactca taaaaatatt ttgaatgacg gaacaaaaaa    146640
     tcaaattgat ttaattagat cacgagagta acgtcatcgg gttcaacttg tgcccgcgct    146700
     atcgatagag atcatcagat gaaagccttc aattgggtca atccgtaccc gtccacccgc    146760
     attcccgtct tcgcccgcaa tgtcgtgtcc acctcgcacc cgctggcggc gcaggccggc    146820
     ctgcgcatgc tgctcaaggg cggcaacgcg gtcgatgcgg ccatcgcggc ggcggcgacc    146880
     atcgtgctgg tcgagccggt gtcctgtgga ttgggcggcg actgcttcgc catcgtctgg    146940
     gatggccggc aattgcacgg cctgaactcg tcgggcgtgg cgccggcggc gtggaatgtg    147000
     gagtatttca agcgcaagta cggcaccggc ccggacgggc tggccgtgca gcccaagcgc    147060
     ggctgggacg ccgtgaccgt gcccggcgtg gtggcgggct gggccgcgct gcacgagaag    147120
     ctgggcaagc tgccgttcga gcagctgttc gaacccgcca tcgagatcgc cgagcgcggc    147180
     tatacggtgc cgccggtggt ggcgcacaaa tgggccgccg cggccgccga gctgagcgag    147240
     cagcccggct acgcccaggc gttcatgccc gaggggcgcg cgccgcgggt gggcgagcat    147300
     ttccgcttcc ccgacgccgc gtacgcgctg cgccgcatcg ccgcctcggg cggacgcgac    147360
     ttctacgagg gcgagctggc cgagcgcatc gccgcgttca gcaaggagtg cggcggcgcc    147420
     atgacgctgg acgatctgcg caattaccgc cccgagtggg tcaaaccgat ttcccgctcc    147480
     taccgcggct acgagttgca cgagatcccg cccaacgggc agggcatcgc cgcgctgatc    147540
     gcgctgggca tctgcgagcg cttcgacctg gccgacatgc cggtcgattc ggtgcagtcg    147600
     cagcatctgc agatcgaggc catgaagctg gcgttctccg acctgtaccg ctatgtcgcc    147660
     gatccgcgca gcatggaagt cacgccgcag cagatgctcg acgacgcgta cctggacagc    147720
     cgggccaggc tgatcgaccc ggaccgcgcc acgcatttcg aggcggggcg cccgcatgcc    147780
     ggcggcacca tctacctgac ggccgccgac gagaacggca tgatgatttc gttcatccag    147840
     tccaactaca tgggcttcgg ttcgggcgtg gtcgtgccgg gcaccggcat cagcctgcag    147900
     aaccgcggcg tgggcttctc gatgaacccg gcctcggcca acgtggtgga aggcggcaag    147960
     cggccgttcc acaccatcat cccgggcttc ctgacgcgcg gcggcaagcc ggtcatgagc    148020
     tttggcgtga tgggcggcga catgcagccg cagggccatc tgcagaccgt catccgcatg    148080
     ctggactacc accagcagcc gcaggccgcc tgctgcgcgc cgcgctggaa ggtcaaccgc    148140
     gatttcacgc tggatatcga gtccaccatg aaccgcgcga cggtcgaggg gctgaggaac    148200
     ctgggccacc gcctcaaggc ggtggacgac ccgtacatgg acttcggcgc cggccagttc    148260
     atctggcgca tggcggaaag cgacaacgat ctcggctacg tggcggccag cgacagccgg    148320
     cgcgacgggc aggccgtagg cttctgacgc gcctgcgggc gcacgaccac caaggggaaa    148380
     tccacaacat gaccaagacc aagagcctga gcatgatgat gggcgcggcc gtgctggccg    148440
     gcgcgggcgg cgccgccctg gcgcaggacc tgcgcatcgg cctgcaggaa gacccggacg    148500
     tgctcgatcc gcaccgcgcc cgcacctatg tgggccgcag cttgaatgtc agcgtcttgt    148560
     tgtcctcgct gaaactccac gactgcgcca gctgcggcac gaactgcagc ttctcgtcga    148620
     tgtcgaccag cttgtcgcac aacgaggtga agacgatgcg caccgatgtc cagttccacg    148680
     atggcagcaa gttcgacgcc gcggcggcgc gcgccaatct ggagcgcgcc atgacgctgc    148740
     aggacagcat gcgcaagggc gaactggcct cggtcgagaa aatcgaggcg cccgatcccg    148800
     ccaccctggt gctgacgctc aagcgccccg acgccacctt gctggcgcag ttgtccgacc    148860
     gtgccggcat gatgctctcg cccaaggcct tcgagggcga cgcggccgcg gtgggccgca    148920
     agccggtctg ctcgggcccc tacaagttcg tcgaacgggt gcagaacgac cgcatcgtgc    148980
     tgcagaagtt cgaccagtac tacggcgcca aggattacca cttcgacaag ctggtattcc    149040
     tgcccattcc ggacaccacg gtgcgcctgt ccaatctgcg cgccggcggg ctggacatcc    149100
     tggagcgcat gaacccctcg gacgcgccgc aggtcaagaa cgacgccagc gtgcagttca    149160
     tgccggtgtc ggggctgggt taccaggagg tcttcttcaa tacgggcaac ggcaagcgcg    149220
     ccgagaccaa tccgttcaag gacaagcggg tgcgccaggc gctggccttg tcgatcgacc    149280
     gcgccatcat caacgaagtg gtcggcggcg gcatcttcga cccggccagc cagccgttcc    149340
     cgccggccag cccctatcac agcgacaagt tcccggtgcc caagcgcgat gtcgagcgcg    149400
     cccgcgcgct gctcaagcaa gccggcctgc agaaggtcaa ggccgagttc gccttcggca    149460
     acaacaccac gacgtcggcc atcgccgaaa tgatccaggc catggcggcc gaggccggct    149520
     tcgagctgag cctgcggccc accgaatacg ccgccatgct caacgaggcg caggccggca    149580
     acttcgagat gatcatgcgc ggctggtcgg gccgggtcga tccggacggc aacatctacc    149640
     agttcgtgac ctgcaagggc gcgctgaacg acggccgcta ttgcaatgcc gaggtcgaca    149700
     agctgctggc cgaggcgcgc accgtgcccg accaggccaa gcgcaaggcg atctacgacc    149760
     aggcccaggc gctgctgcag gccgacacgc acgatattta cctgtactac cagccgtggc    149820
     cgttcgtgct gggcaagaac gtacgcggct tcaagccgta cccggacggc atggtgcgcc    149880
     tgaagggcgt gacgctggcc aagtagcgac ggtgggggcg gccggctgcc gcgatcggcg    149940
     cggcgcgcgg gcgccgccgc gcccgttttt cggtggcgac catgttcaaa ctgatcctgc    150000
     gacgcgtcgt cgtggcgatc ccgacgctga tcctggtgtc gatgatcgtc ttcatgctgc    150060
     agaaaatcct gcccggcgat ccggtgctca cgctggccgg cgaggagcgc gatcccgcgg    150120
     tgctggacta cctgcgcgag aaataccgcc tcaacgaccc gctgccggtg cagtacggcg    150180
     cctgggtggc ccaggtgctg cagggcgacc tgggcaagtc catgcgcacc gacgtgccgg    150240
     tgctgaccct gatcgcgcaa aagctgccgg tgaccctgca gctggccgtg atggcgatgg    150300
     cgttcgcgct gctggtgggc attcccctgg gcatcgtcgc cgccgtgcgc aagggcacgg    150360
     cggtcgagat gggcgccaac atggccgcgc tctcgggcat gtccattccc aatttctggc    150420
     tgggcatcat cctcatcatg gtggtctcgg tgcagtggaa gctgctgccg gcctccggct    150480
     atgtctcgcc ggccgaggac ttctggcttt ccatcaagac catgctgatg ccggccctgg    150540
     cgctgtccac ggcgatcgcc gcctacctga tgcggcacac gcgttcggcc atgctggagg    150600
     cgctgtcggc cgattacgtg cgcaccgcgc gcgccaaggg cgttgcgccg cgcaaggtgg    150660
     tgctgcgcca cgcgctgcgc aacgcgctga tgcccatcgt gacgctggtg acgctgctgt    150720
     tcggcgaact gctggccggg gcggtgctga ccgagcaggt gttcaccatt ccgggtttcg    150780
     gcaagctgat cgtcgacgcg gtcttcaacc gcgactacgc cgtggtccag ggcgtggtgc    150840
     tgtgcgtggc ggtcggcttc atcgtcatga acctgctggc cgacatcctg tacatcctcg    150900
     tcaacccccg cctgaggcac gcatgagcgc acccatcgca agcgcgggca tggccgcgcc    150960
     gcgccgcgcc aaccgctcct ggggcaagtt ccgccgcaac cggattgcga tgctgggcgc    151020
     gctcatcgtg ctggcgttcg tcgtgctggc gctgctggcg ccctgggtgg ccagccacga    151080
     cccgttccag accagcttca tgaccatccg caaggcgccc tcggcggcgt tctggatggg    151140
     caccgatgaa ctgggccggg acattttcag ccgcatggtg tacggcgcgc gcgcctcgct    151200
     gatggcgggc atggtgtcgg tgctgatcgc cctggcggtg ggggtgccgt tcggactggc    151260
     cgccggctat ttcggcggct ggaccgacag cgtcatctcg cgcgccaccg aggcgctgct    151320
     ggccattccg ttcctgatcc tggcgatcgc gctggccgcc ttcctggggc ccagcctgac    151380
     caacgccatg atcgccatcg gcgtgtcggc cgcgcccaag ttcatccggc tcacgcgcgg    151440
     ccaggtgctg gccgtcaaga acgaggacta cgtgcagagc gcgcgcgccc tgggcgcctc    151500
     ggacctgcgc atcatcggcc gccacgtctt tcccaatgtc atgccgccgc tgatcgtgca    151560
     ggccaccatc accatcgcca ccgccatcat cgccgaggcc agcctgtcgt tcctggggct    151620
     gggcctgcag ccgcccaatc catcctgggg gtcgatgctc aacacggcca agaacttcat    151680
     gacccaggcg ccctggatgt ccatcttccc cggctcggcg atcttcctgg tggtgctggg    151740
     cttcaacctg ttgggcgacg gcctgcgcga cgcgctggat ccgcgccagg agaagtaggc    151800
     atggacgcca atcgtgtggt gcaggtcgac ggcctgagcg tgcgcttcaa caccccgggg    151860
     cgggtggtcc aggccgtcaa cgatgtgtcc ttccacgtcg accgcggcga gacgctggcc    151920
     atcgtcggcg aatcgggttc gggcaagtcg gtgacctcgc tggcgctgat gcggctggtc    151980
     gagtacggcg gggggcggct cagcgcgacc gacatgcgct tgcgccggcg cggcggcgac    152040
     gtgctggacc tggcgcgcgc cgacgagcgc accctgcaac gggtgcgcgg cgccgatgtg    152100
     gcgatgattt ttcaggagcc gatgacttcg ctcaacccca gtttcaccgc cggcaaccag    152160
     atcgccgagg cgctgcaact gcaccagggg ctggacgcgg ccggcgcgcg cgccgaggcg    152220
     ctgcgcatgc tggagcgggt gcgcattccg gaagcccgcg ccatcctgga ccgctatccg    152280
     caccagctct cgggcggcat gcgccagcgc gtgatgatcg ccatggcgct gtcgtgcaag    152340
     ccgcagctgc tgatcgccga cgaacccacc accgcgctga atgtcaccat ccaggcgcag    152400
     atcctgcagc tgatacgcca gctccaggag gaaatggaca tgggcatcat cttcatcacc    152460
     cacgatatgg gcgtggtggc ggaggtggcc gaccgcgtgc tggtgatgta ccgcggcgac    152520
     aaggtcgagg agggcgggtg cgacggcgtg ttcgccgcgc cgcgccatgc ctatacgcgc    152580
     gcgctgctgt cggcggtgcc gcggctgggc gccatgcagg gcaccgacca gccggcgccg    152640
     tttccgctgt tgcaggtcga ccagcaggcc ctggcgccgg ctccgcaggc cggcgcggcc    152700
     gaggtggaca ccgtgcgccg cgacggcggt ccggtgctga aagtgcgcgg gctggtgacg    152760
     cggttcgaca tcgccggcgg cattttcggg cggatcgaca agcgcgtgca cgcggtcgag    152820
     caggtcagct tcgagctgtt ccccggcgag acgctggcgc tggtgggcga gtccggttgc    152880
     ggcaagacca ccacgggccg ctcgctgctg cagctggtca agagccaggg cggcagcatc    152940
     gagttcgacg gccgcgacat cggggtgctg cgcggcgcgg ccatgcagtc gctgcggcgc    153000
     catatccagt tcatcttcca ggatccgttc gcctcgctca acccgcgcat gacggtgggc    153060
     gactccatca tggagccctt gctggtccac aggacggcca gcgggcgcgc cgcgcgcgag    153120
     cgggtgcgct ggctgatgga caagtgcggg ctgctgcccg aaatgaccga ccgctacccg    153180
     cacgagttct cgggcgggca gcgccagcgc atctgcatcg cgcgcgctgg cgctcaaccc    153240
     caaggtggtg atcgccgacg aatcggtctc ggcgctggat gtctcgatcc aggcgcagat    153300
     cgtcaacctg ctgctggacc tgcagcgcga gctgggggtg tcgtacctgt tcatctcgca    153360
     cgacatggcg gtggtcgagc gcgtcagcca ccgcgtggcc gtcatgtacc tgggccagat    153420
     cgtggagatc ggcccgcgcc gcgccatctt cgaaaacccg cagcatccct atacccgcaa    153480
     gctgatggcg gcggtgccga tcgccgatcc gcgccggcgc caccgcgagc gttcgctatt    153540
     ggtcgacgag attcccagcc cggtgcgcaa ggtgggcgac gagccggtgg tcgcgccgct    153600
     ggtgcgggtg ggcgaaggcc actacgtggc gcgccatccc gtgggcgtgt acgcctgagc    153660
     tcagcgccgc tccagcgcca gcttcaggcc gaaggcgatg aagacgccag cgctcaggcg    153720
     gtcgagcccg cgcgccaccg aggggcgcgc cagccagcgc gacaacggcc gggtggccgc    153780
     caccagggcg gcgaaccaca gcaggcccag cgcggcgtgc agcgcggcca gcagcaggct    153840
     gaatgccagc acgtccaccc cggccgggat gaattgcggc aggaacgtga cgtagaagac    153900
     gccgaccttg gggttgagca tgttggtcag gcagccgcgc cagaaccatt gcaaggcgcc    153960
     gccgccggcc ggcgcggccg gcagcatgcc gggggccgcg tcgccggcgc gccggcgcag    154020
     gctgcgggcc agcaggcgcg cgcccagcca gcacaggtag atcgccccgg cgatgcgcag    154080
     cgcgtcgtag gccagcgagg acgccgccag cagcgcgccc aggccgagcg cggcggccac    154140
     gccccaggcc aggcagccgg cgcatacgcc caggccggcc agcagcgcgc ggcgcggccc    154200
     gtcgatcgcc gcggtgcgca gcaccagggc ggtgtccagg ccgggggtga tggtgagcag    154260
     ggtggcggcc acggtgaagg ccagcagggc ggcaagaggc gtcatggcga gggacggagc    154320
     aggtgcggcg cgcaatcgcg cgggcagtta tcattgccgg tctttggcaa cccagcaact    154380
     ggatcaggca ctcttcatgg ccctgcgcgc aaccatttac aaggcggacc tgcatgtcgc    154440
     cgataccgac cgccactatt atgctagcca tggcctgacc atcgcgcgtc atccgtccga    154500
     gacggacgag cgcatgatgg tgcgggtgct ggcctatgcg ctgcacgccg acgaacagct    154560
     cgccttcacc aaggggttga gcgataccga cgagccggac ctctggcgca aggacctgac    154620
     cggcgatatc gaactgtggg tcgaggtcgg ccagcccgac gagcggcgca tcctcaaggc    154680
     ctgcgggcgc gccgccgagg tcgtggtgta ttgctacggc ggccatgcct cgcaggtctg    154740
     gtgggacggc gtgcgcggca agctggagcg cgcgcgcaac ctgcgcgtgg tctgcctgcc    154800
     cgcggcgcag accgaggcgc tggcgcagct ggcgcgccgc accatgcagg tgcatgtcaa    154860
     tatctccgac ggcgcggcct tcgtcagcac cgatgagggc caggtccagg tcgagccgca    154920
     atcctggcgc tgagggggta aagggtgcct gtccccgcgg ggacaggcac ctctgccgca    154980
     gcggggacag gcacccttgc cgcagcgggg acaggcaccc ctgccgcagc ggtgacaggc    155040
     gcccggggca gccacggcgc gccggatcag ccgcgcgcct tgcgttcttg ccaggccagc    155100
     agcagcagga cggcggcggc ggcgggaaag accgtcagat tgacgatgga ccagccgcca    155160
     tgggccagca gctggccgga cgagaacgaa gcggcggcca cgcagccgaa taccagcagg    155220
     tcgttgagcg cctggacgcg caggcgttcg tgcggctcgc aacagtcggc cagcatggct    155280
     ggtggcgccg atgaagccga ggttccagcc cacgcccagc aggaccagca cggcccagaa    155340
     atgcggcacg ctcaggccgg tcagcgagac gccggccgcg gccagcatca gcgccaggcc    155400
     cagcgcggtg accggcagct tgccgaaacg ctcgatcagc cggccggtga cgaagctggg    155460
     ggcatacatg gccagcacat gccattggat gcccagggcg gcggcggcga cgctgtggcc    155520
     gcagccgacc atggccagcg gggcggcggt catgaccagg ctcatcaagc cgaacgacac    155580
     cacgccggcc gcggccgcga tgatgaagcg cggcgtgcgc gcgatgcgcg ccaggggccg    155640
     gccggcctgc gccgcggcca ggcccaccgg caccgcgcgc agccggctga cgacgcccag    155700
     tgccagcagc gccagcgcgg cctgcgagac gaagctgccg gcaaagggcg cggcgggcca    155760
     caggttgcgg gtccagatgg cggcattggt gcccagcacc gccgccacca ggccggcgct    155820
     catgatggcc gaaatggcgc gcggccggtg ctcggggcgg accccgtcgg tgacggcgtg    155880
     gcggtagctc tgcacgtagg cgccgtacag gccggccagc gccgtgccgg tacagaacag    155940
     cgcgaaccgg ccgctccaga tgccccaggc ggccagcagg ccgcccagca ggcccagcag    156000
     ggcgcccaac tggtagccgc cgcgccggcc gcggcggcgc atcatggcgg ccgcgggcag    156060
     gatgccggcg gccaggccga ggttgtacag gctgaccggc agcgtcgcca gccccgggtc    156120
     gccggccagc atctggccca ccagcccgcc catcgagatg acgatggccg ggctggctcc    156180
     gcccagcgcc tgcgcacagc tgagcaggcg cgtgttgcgg cggatattcg gcgattcggc    156240
     ggtcgtggtc atgggcacct ggcgcgaaca gggcgcggca ggccgccgcg caaccctgat    156300
     tctgcgtcaa aaccgcccgc ggcgtcagcg cggcgcgaca ggcgcgcgcg ccagcgacca    156360
     gaaggcgggc aggaagcact cggccaccag cagcggctgg ccggcgcgcc agaaggcgga    156420
     gcggcgcgcc cacagcgccg gctcggggcc gccggccggc gcgcgcgcga tggcggtggc    156480
     atggaagggc acgccggcgg ccagccggcg gcatacgaag accgaacgat ggatgccggg    156540
     atcgtggtac agcatgtcgg ccagcgggcg cgtcagcagg cgccgcatgc cctgccagac    156600
     gccatgcgag gcgcgcagcg gcgtgaggct gcgcgccacg acgctgtcca cgccgtcgat    156660
     cgacatcagc acttcgcgca cccagaccgg gctttgcgcg gcgatgcgca tgccgtcggc    156720
     ctcgtcgcgg ggcgcgccgg tcgggtactc tgccagcacg cgcaggcgta cgtggcccag    156780
     ctggcgcagg ccggcggtga gcgcgccggg acggaacagc caatacttgc gcaagggatc    156840
     cagcgtcgag ggcgcggcgg gcagccagcc gcgcgcaagg ggaatggggg tggtcatggc    156900
     tgtgtattat gccaagccgg cgcggcgccc gtgaggcagg ctctacaata cgcgccatgg    156960
     aaaaagtacg catctccaag ctgatgtccg agcgcgggct ctgttcgcgc cgcgaggccg    157020
     acagctatat cgaacggggc tgggtgcgcg tcgacggcgt ggtggtgtcc gagctgggcg    157080
     cgcgcgcctt tcccgatcag gccatcacgc tggagcgcgc cgcggccgcg cgccagaccg    157140
     cgcgtgtcac catcttgctg cacaagcccg tgggctatgt atcgggacag gccgagaaag    157200
     gctacacccc ggcggtggcg ctgatcgacg cgcgctcgcg ccatgcgggc gaccgcgcgc    157260
     ccctgcgctt cgagcgtggc cagctgcagg gcctggccgt ggccgggcgg ctcgacatcg    157320
     actcgcaggg cttgctggtc ctcacgcagg atggccgtat cgccaagaag ctgatcggcg    157380
     aagactccga ggtcgacaag gaatacctgg tacgggtgca gggccgcctg tccgaggcgg    157440
     ggctggcgct gctcaaccac ggcctgtcgc tggacggcaa gccattgcgc cccgcccagg    157500
     tgcgctggca gaacgccgac cagctgcggt tcgtgctgcg cgagggcaag aaacgccaga    157560
     ttcgccgcat gtgcgagctg gtggggctgc gggtggtggg cttgaaacgg gtgcgcatcg    157620
     gccgggtgtc gctgggcgac ctgccggtgg gccaatggcg ctatctgcgc gccgacgaac    157680
     gcttctgagc gacgtaaccg tttcagtcga tttccaagcg gccgccgccg gcccggcgat    157740
     taacgcaaat ttaaaaacgc cgggttattc tggcctgcca gtgtcttgtt gctcagacgc    157800
     tccatcagga attccacgaa gatgcgggtc ttggccggca gcatgcgggt gtccgtgacc    157860
     gcgtagaccg ggaacggccc ggccagccaa tcgggcagga tgcgcttgag acggcccgat    157920
     tcgatgtcct cgcgcacatt gcccatgggc gccaggatcg cgatgccggc gcccagcgtg    157980
     gccaggttgc gcaccatcga cacgctgttg accgaaaagc ggttgcccgg ggtgatctcg    158040
     acgtggcgct cgccgctgtt caggggccag cgcgtgacgc ggcccgtgcc ggcgcggaac    158100
     tgaatgcatt cgtggcgggg caggtcatcg gggtgttgcg gttcgccgtg gcgcgccagg    158160
     taatcgggcg acgcatacag gtgggccggc agcacgccca gcaggcgggc gatgtgggtg    158220
     gagtcgggca gatcgccgat ttcgatcgac acatcgcagg tctggaaaac ccgctcggcg    158280
     tgctcggggc tggccaggtc caggtagaag gtgacctcgg ggtagcggcg cgagaactcc    158340
     gtgaacgcct cggacaggaa gtcggtgccg aagtcggccg gcatgttcac gcgcagcgga    158400
     ccggacggcg tctcgaccag gttctgcagc tcttcatggg cgatgcgggc ttcggccacg    158460
     atgcgctggc agcgctcgaa gtaaagctgc ccggcttcgg tcagctcgac ccggcgcgtg    158520
     gtgcggctga gcagcctcag gccgaccgaa cgctccagtt cggccacctg gcgcgacagg    158580
     gtggatttgg gaatggccag gttctcggcg gcgcggctga agctgagcgt cctggccact    158640
     tcgacgaaga gctccatgcc ttgcaaacgg ttcatggcgg atggtgagag ggcggaatat    158700
     gaaattgtcc catatttgga atgatgtttt cgaaaacaag ttgtttgttt ccaccgcggg    158760
     ataacgcaaa atgctcgttt tgcagcgcag caccaagccg gccggcaaac ccgcatggcg    158820
     gaggcggtgt gtttcctttt atgcgttgtg gcgcgcaacg ggtgcgcaca ggcatcccgg    158880
     cgcttggttt gaatggaaag gcaagctatg aagaataact atctggtcgg gcgcggcatc    158940
     gccgcgcttt ccttggcggc attgaccctg acgctggccg catgcggcaa ggaacagcag    159000
     gcggcgcagc aaggcgggca accgcaggtc ggggtggtca ccctgaaaac ccagtcggtg    159060
     gcgctgttca gcgaattgcc tggccgcacc gccgcctacc gcatcgccga agtgtgtccg    159120
     caggtcagcg gcatcgtcca gaagcgcctg ttcactgaag gcggcgaagt cgccgccggc    159180
     cagcagctct accagatcga tccggcgctg taccaggccg aggtcgacag ccggcgggcc    159240
     gcgctggcgc gcgtccaggc gcagctgaag accgccacct tgctggtgca gcgctacaag    159300
     ccgctggtcg atacgcgggc ggtcagccgg caggcctacg atgacgcggt cgccgcgcgc    159360
     gaccaggcct cggccgacgt cctggcggcc aaggctgcgc tggacaccgc gcgcatcaac    159420
     ctggtctata ccaaggtgct ggcgccgatc ggcggcatca tcggccgctc caacgtcacc    159480
     gaaggcgcgc tggtgacggc aaaccagagc gcggcggtcg cggcggtcca gcagatcgac    159540
     cccatctacg tcgacgtgac gcagtccagc gtgcagctgc tgcgcctgaa aagcgccctg    159600
     gacagcggtt tgctgcagcg cgaggctggc gagcagtcgg cgcgcgtgac gctgacgctg    159660
     gaagacggca cgcagtacga ccaggacggc aagctgcaat tctcggaggt caccgtcgac    159720
     ccgggcaccg gctcggtgct gctgcgcgcc gtgttcccca atccgcagcg caagctgctg    159780
     ccggggatgt tcgtgcgcgc ccggctggcc gagggcgtag cgtccgaggg cctgctggtg    159840
     ccgcagcgcg gcgtcacgcg caaccagcgc ggcctgccca ccgcgctggt ggtcaacgtc    159900
     gagaacaagg tcgaactgcg cacgctcaag accgaccgcg ccatcggcga ccaatggctg    159960
     gtgagcagcg gcctggccgc cggcgaccgc gtgatcgtcg aaggcctgca atccgtgcgt    160020
     ccaggcgccg aggtcaaggc ggccgaatgg agtccgcccg catccaaggc cgccgcgcaa    160080
     ccggccgccg cgaagtaagg gagttcccgc atgacaaagt ttttcatcga caggccggtg    160140
     ttcgcctggg tgatcgcgat tgtgctgatg atggccggcg cgctctccat cctgagcctg    160200
     ccggtcgcgc aatatccgaa catcgcgccg cccgccatca gcatcaacgt gacctatcct    160260
     ggcgcctcgg cccagaccgt gcaggacacg gtggtgcagg tcatcgagca gcagatgaac    160320
     ggcatcgaca acctgcagta tatctcgtcg gaaagcaatt ccgacggcag catgtcgatc    160380
     acgctcacgt tctcgcaggg caccaacccg gatacggcgc aggtgcaggt gcagaacaag    160440
     ctggcggtgg cccagccgct gctgccgctg gaagtgcagc agcagggcat ccgcgtcacc    160500
     aaggccacca agaacttcct gatcgtcgcc ggcttcgtgt ccaccgacgg caccatggac    160560
     aagtccgacc tggccgacta cgtggcctcg tacatccagg acccgatcag ccgcacgccc    160620
     ggcgtgggcg acttccagct gttcggcgcg ccatacgcca tgcgcatatg gatcagcccc    160680
     gagaaactgg tcaatttcgg cctgaccgcc tccgacgtca ccaccgcgat ccgcgagcag    160740
     aacgtgcagg tctcgtccgg gcagctgggc ggccagccgg cggtgcgcgg ccagcagctc    160800
     aacgccacgg tgatcggacc gtcgcggctg cagaccccgg aagccttcgg ccgcatcctg    160860
     ctcaaggtca atagcgacgg ctcgcaggtg cgcctgaagg acgtggccag catcgagctg    160920
     ggcgcgcaga cgtacgccat cgacagctat tacaacggca agcccgcctc gggcctggcc    160980
     atcaagctgg ccagcggcgc caacgcgctc gataccgccc aggcggtgcg cgagaccatc    161040
     aacggcctca agccgtactt cccgccgggc atggacgtgg tgtatccgta cgacaccacg    161100
     ccgttcgtca gcctgtcgat cgagggcgtg gtcaagacgc tgttcgaagc ggtgctgctg    161160
     gtcttcctgg tgatgtacct gttcctgcag aacgtgcgcg ccacgctcat ccccacgctg    161220
     gccgtgccgg tggtgctgct gggcacgttc ggggtgctgg cggcgttcgg ctattcgatc    161280
     aacacgctga ccatgttcgg catggtgctg gccatcggcc tgctggtcga cgacgccatc    161340
     gtggtggtcg agaacgtcga gcgcgtgatg gccgaggagg ggctgtcgcc caggcaggcc    161400
     acccgcaagt cgatgagcca gatcaccggc gcgctgatcg gtatcgccat ggtgctggcg    161460
     gtggtgttcg tgcccatggc gttcttcggc ggttccaccg gggtgatcta tcgccagttc    161520
     tccatcacca ttgtttcgtc catggtgctg tcggtggtgg tggccattgt cttcacgccg    161580
     gcgctgtgcg ccaccatgct caaacccatc ccgaagggcc accatggctc caagaagggc    161640
     tttttcggca ggttcaaccg caccttcgag cgttccagcc aggcctatgc caacaacgtg    161700
     gcccgcagca tggggcgcac caagcgcctg ttgctgatct acgtggtgat cctgctgggc    161760
     atggcttgga tgttcatgcg cattcccacc gcgttcctgc cggacgaaga ccagggcatc    161820
     ctgttcgccc aggtgcaggc gccggccggc gccaccagcg agcgcaccca ggccaccatc    161880
     gacgcggcgg tcaagtacct gctggaagac gagaaggagt cggtggcctc ggtgttcgcg    161940
     gtcaacggct ttagcttcgg cggccgcggg cagaacgccg ccatcctgtt catcaagctg    162000
     cgcgactgga acgaacgcaa gggcgccgag caccgcgccg ccgcggtggc cgcgcgcgcc    162060
     aatgccaagt tccgcgccga gttgcgcgac gcgcaggcgg ccgtgttcgt gccgcccgcg    162120
     gtgatggagc tgggcaacgc caccggcttc gacttccagc tgcaggaccg cgccggcgtc    162180
     ggccacgaga agctgctggc ggcgcgcaac cagctgctgc aagaggccgg cgcaagtccc    162240
     atgctggtgg ccgtgcgccc caacggcatc gaggacgcgc cgcagtacca gctggacatc    162300
     gaccgcgaga aggcgcgcgc gctcggcgtg tcgatcaccg agatcaacaa cacgctggcc    162360
     accgcctggg gctcgtccta cgtcaatgat ttcatcgacc gcggccgggt caagaaggtg    162420
     ttcgtgcagg gcgaggcatc gtcgcgcatg ctgccgcagg acctggacaa atggtacgtg    162480
     cgcaacaacg cgggcgacat ggtgccgttc tcggccttct cgtcggcgca atggaccttc    162540
     gggccgcaga agctgaaccg ctacaacggc gtgccgtcgt acaacatcca gggccaggcc    162600
     gcgccgggct acagctcggg cgacgccatg gccgagatgg agcggctggc cgacaagctg    162660
     ccgctgggca tcggctacga ctggaccggc ctgtcgttcg aggagcgcct gtcgggcgcg    162720
     caggcgccgg cgctgtacgc gatctcgctg atcgtggtgt tcctgtgcct ggccgcgctc    162780
     tatgaaagct ggagcattcc caccgcggtg atgctggtgg tgccgctggg cgtggtgggg    162840
     gccttgctgg ccaccctgac gcggggcctg tccaacgacg tgtacttcca ggtggggctg    162900
     ctgaccacca tcgggctggc cgccaagaac gccatcctga tcgtggagtt cgccaaggag    162960
     cactacgagg agggcgccag cctgaccgag gcggcggtgc acgccgcgcg ccagcgtctg    163020
     cgccccatcc tgatgacgtc gctggcgttc atcctgggcg tggtgccgct ggccatctcc    163080
     acgggcgccg gctcgggcag ccagaacgcc atcggcacgg gcgtgatcgg cggcatgctc    163140
     accggcacct tcctggcgat cttcttcgtg cccctgttct ttgtccttac cctgcgcctg    163200
     ttcaaggtca agcgcgcctc ggagaaccgc gaggacgacg acccgcatgg cggcgcccag    163260
     ccggccacgc acggaggaca gccgcaatga aacctgccgt catgagaacc ttgttgtccc    163320
     ttgccgtggc cacggccctg gccggctgct cgctggcgcc cacctacgag cgcccgcagg    163380
     cgccggtcga cgcggcctat ccgtccggcc cggcctacgg cgcgccgggc caggccgccg    163440
     cgggcgcgcc ggccgccgcc gacgtgggct ggcgcgactt cttcggcgac ccgctgctgc    163500
     aggaactgct ggcgctgtcg ctggccaaca accgcgacct gcgggtcgcc gcgctcaacg    163560
     tggaggcggc gcgcgcgcag taccgcatcc agcgcgccga tctcgcgccc agcgtgggcg    163620
     tgggcggcac cggctcggtg cagcgcaccc cggccgacct caacccgagc ggacaggccg    163680
     gcatcagccg cagctatcag gtcggcgcca gcctgtcgac ctgggagctg gacctgttcg    163740
     ggcgcatccg cagcctcagc gagcaggcgc tgcagctcta tctggcccag gacgaaacgc    163800
     gcctggccac ccagctgacg ctggtggccg agaccgccaa cgcctacctg accctgcgcg    163860
     ccgaccagga actgctggcg ctgacgcgcc agacgctggt ggcccagcag gagtcgtaca    163920
     agctgacccg ccagagctac gacctgggcg tggcgaccga actggacctg agccaggccg    163980
     agatttcgct gcgcaccgcc gagcgcaatc tgtcgcagta cacgcgcatg gcggcgcagg    164040
     accgcaacgc gctggtgctg ctggtgggcc agccgctgcc ggccgggatc ggcgcgcagc    164100
     tggaccaggc cgtggcgctg cccgatggcg tggtcctggc cgacctgccg gcgggcctgc    164160
     cgtcggatct gctcgcgcgc cggccggata tccgcgcggc ggagcaccag ctgcaagccg    164220
     ccaacgccag catcggcgcg gcgcgcgtgg cgttcttccc gcgcatcagc ctgaccggct    164280
     cggccggcac ggccagcgcc agcctgggcg gcctgttcga tgccgggtcg ggcgcctgga    164340
     gtttcgcgcc gcagatcagc gtgccgatct tcgcgggcgg ggcgctgcgc gccagcctgg    164400
     acctggccaa gatccagaag gatatcggca tcgcgcgcta cgagcaggcc atccagagcg    164460
     ggttccgcga ggtctccgac gcgctggccg gccgcggcac attgcaggag cagatccggt    164520
     cgcaggaact gctggtgcag gccaaccagc gcgcctacga cctgtcgcag cagcgttacc    164580
     agcagggcat cgacaactat ctcagcgtgc tggattcgca gcgttcgctg tatacggcgc    164640
     agcagacgct ggtcgagacg cggctggcgc gcctgtccaa cctgatccag ctctacaagg    164700
     cgctgggcgg cggctggtcc gagcgcacgg tggctgcggc gcaggccggc tgatcgcgcg    164760
     cggccgtcca aaacagacag gccggcaaga tgccggcctg tctgtttgcg cagtggcggg    164820
     ggtcaggcgc gcttcttggc gaccaggccc acgacgaaca acacgatgat cgcgccgacg    164880
     accgaaccga tccagcccgc gggttcgccc ggtgcgtacc agcccagttg ctggcccagg    164940
     aaaccggcga ccaccgatcc gatgatgccc aggatcgtcg tcatgatgta gcccatgttc    165000
     tggtctcccg gcatgatggc ccgggcgatc agtccgacga caaacccgac gatgatcatg    165060
     atgatgatgc tcatacgcgc gctccttcgt ggtggcgaaa tggtgcggcc atgataccca    165120
     tggccgtgcg cccgacgctg taacaacacg tacgaccgca ggggattgcc gcgcggtggg    165180
     gcgcaaaagc aacaaccgcg ccctggggcg cggtccggat cattgggtct gcgcgatgag    165240
     ctggcgcagg tccttgacca tggtgtcgat ggtgtccgtg tcggaggcca gcaggcgcgc    165300
     cttgccctgg ttgtcgaaga tatagacgcc gcggctgtgg gtgacgtcgt agatatcggc    165360
     gtcgtcgccc ggcttgggct tctcgatctg gtaggccaac cgatagcgcc gcgccaggtc    165420
     ggcgatctgc ttttcgttgc cggtcacgcc gatcgcgttg ttgttgaacg cattgacata    165480
     ggcctgcagg atgtccgggg tatcgcgatg cgggtcgacg ctgacgaaca ggatgcgcac    165540
     gtccctggcc tgctcgccca gttgctgcag caccgccgtc agttgcgcca tggtggtggg    165600
     gcagacgtcg ggacagctgg cgtagccgaa gaacagcaat accgtcttgc ccttgaggtc    165660
     gtcgctgctg acggtcttgc cgtgcgcgcc cggcaggctg aacttcaggt cgggcagatg    165720
     gcccttgacg ttgtacagcg accaatccgc cgaacgttcg ctgcacgccg ccagcagcat    165780
     caacatcgcc aggagcaggc cgcgccacgc gcggccggaa agaggtgagt acatggtaga    165840
     tacagccagg cgccgatgcg gcgcgcgcat gagtgggaag gacctgggga ttctaccgcg    165900
     tcggggcggg aggggcgcgg ggggaggggg gcagaggtgc cagtccgcgt ggggaggagc    165960
     gttggcagag gtgcctgtcc ccgcggggac aggcacctga gaggtcaggc ttgcatgccg    166020
     ctgtgccgca gcagggcgtc gatgcggggt tcgcggccgc ggaaggcgcg gaaggagtcg    166080
     gcggcggggc gggcgccgcc gacggcgagg atttccttgc gaaagcgcgc gccggtggcg    166140
     ccgtccagcg tggtggcggc cggctcgccc tggcgggcgg cttcctcgaa ggcttcgtac    166200
     gcgtcggccg acagcacctc ggcccacttg tagctgtagt acccggcgcc ataaccgccg    166260
     gcaaacaggt gcgagaagct gtggggcagg cgatgccacg cgggcgggaa cagcactgcg    166320
     acttcctggc gcacctgctg cagcagcgcc agcacgtcgg cgatgggcgc gccttgcggg    166380
     cggtcgtgca gcatcatgtc gaacagcgcg aactcgatct ggcgcacggt ctgcatgccg    166440
     ctctggaagt tgcgcgccgc caccaggcgg tcgtagagat cgcgcggcag cggctggccg    166500
     gtttcgacat gggccgacag cttctgcacc acgctccatt cccagcagaa gttctccatg    166560
     aactgcgacg gcagttcgat ggcgtcccat tcgacgctgg cgaacgccgc cgcgccgggc    166620
     tcgtccactt cggacagcag ggcgtgcagc gcgtggccgg tttcgtggaa cagcgtgatg    166680
     acgtcatcgt gcgtgagcag cgcggccttg tcgccattgg ggcgcgagaa gttgcaggtc    166740
     aggtaggcga ccggcgtctg cagatcgcct tgcacgctgc gtcggctgcg ctcgctgtcg    166800
     acccaggcgc cgctttgctt gccggcgcgc gcgtacaggt cgaggtaaag atgacccagc    166860
     gtcgcgccgg ccgggctttc gacccgcacg ccgcgcacgt cggcatgcca ggacgacacc    166920
     ggcacttcgc gcaggcgcac gtcgaacagc gtctcgatga cctcgaacag gcccgccagc    166980
     acgcgcggct cggtgaagta ctgcttgatc tcgtcttccg aataggcata gcgcgactcg    167040
     cgcagccgct cggcggcgaa gggcacatcc cagggctgca gctcggccag gcccagctcg    167100
     ccggcggcga aggcctgcaa ttcggccagg tcgcgttcgg cgtacggctt ggcgcggcgc    167160
     gccaggtcgc gcaggaagtc cacgacttcg gtggcgtcgc gcgccatgcg ggtctgcagg    167220
     cgcagggcgg cgaaggtggg gtactgcagc agcccggctt cgtcggcgcg cagctgcagc    167280
     agttcttcga tcagcggcga gttgtcgtag gcggcgtcgc catgttcgga cgcgacggtg    167340
     ccgtacgcgc ggtacagggt ttcgcgcagg gcgcggtcgc gcgcgtactg catgacgggc    167400
     aggtagcagg gcattttcag cgtcagcttc cagccggtgg cgccatcgtc ctcggccgcc    167460
     ttgcgcgccg cggccagcac gtcggccggg atgccgtcca ggcgcgcctg gtcgtcgacc    167520
     agcagcgacc acgcgtcgat ggcgtcgagc acgttctcgg agaacttctg cgatgcctgg    167580
     gcctcgcggt cggagatctc ggcgtagcgt tcgcgcgcgg ccccttgcag ctcgacgccg    167640
     ctgaggcgga agtcgcgcag cgccagctcg accacgcggc ggcgcaccgg cggccaggcc    167700
     gcgaaatcct cggcggcctg caggcgctgg tactggcgat acaggccttc gtgcaggccg    167760
     acccaggtgg agaactcggt gaccagcggc agcgcggcgt tgtaggcctc gcgcagcacg    167820
     ggcgtgttga ccaccgcgtt caggtggccg gccaccgacc aggcgcgcca caggcgctcg    167880
     gatgcgctgt ccaggggcgc caccacggcg tcccaggtgg cgggcagggc cgggtcggcc    167940
     gcgtgttcga ccgccgcgcg ggcgatatcc agcagggcct ggacggccgg cacgatgtgt    168000
     tcgggtttga cggcggcgta gtcgaccagg tcggcgaccg gcgcaagcag gggattctgg    168060
     gtcatgggct tgggaattcc gtggacgagc gggcgcggcc cgaagggcgc gcatgccatg    168120
     agagtgggga cggacgggcg gattgcaagg cgggcatgcc aggcgcggcg cgcctggctg    168180
     cgtggggcag ggccttacgc ggcagcgcgt tcggccgctt caaccgtatt gaccagcagc    168240
     atggcgatgg tcatggggcc gacgccgccg ggcaccggcg agatggcgcc ggccacttcg    168300
     cgggccgagg ccatgtcgac gtcgccgcac aacttgccgt cggcgccgcg gttgatgccg    168360
     acgtcgatga ccacggcgcc gggcttgatc atcgagccgt cgatcatgcc gggcttgccg    168420
     gtggccacca ccagcacgtc ggcgcggcgc gtctgggcgc ccaggtcgcg ggtcttggag    168480
     ttgcagatgg tgatggtcgc gcccgcctgc agcagcagca tcgccatcgg cttgccgacg    168540
     atattgctgg cgcccacgat gaccgcctcg gcgccgcgca gggccacgcc ttcggattcg    168600
     agcatcttca tcacgccgta gggcgtgcag gggcgaaaca gcggctggcc ggtcatgagc    168660
     aggccggcat tgctgatgtg gaaaccgtcg acgtccttct cggcggcaat ggcctcgatc    168720
     accttgtgcg cgtccatgtg cctgggcagc ggcagctgca ccaggatgcc gtggatggac    168780
     gggtcgcggt tgagcgcgtc gatgcgttcg agcaactggg cctcggtgag gtcggccggg    168840
     tattgctcct tgaccgaatg caggccggcc ttctcgcagg cggcgacctt gttgcgcaca    168900
     tagacttgcg aggcggggtc gtcgcccacc agcacgaccg ccaggccggg gcgcacgccc    168960
     ttggccgtca gcgcctgcac gcgctgggcg acttcttcgc gaatgcgctg cgacagggcg    169020
     gcgccgtcga tgatgcgtgc ggtcatgcgt gggcctcggg tttggccagg gccactttca    169080
     tcaggtctgc tacggtggtc acttcaagtt tttccatgat gttggcgcgg tgcgcctcga    169140
     cggtcttgat gctgatgccc aggtcgtcgg cgatctgctt gttcaagcgg ccggcgacga    169200
     tgcgctccag cacctgttgc tcgcgcgccg tcaggcgggc aagcatggct tcgtggtctt    169260
     tctgcgcctg gaacttgctg atccgctgca ccgcctgctc cagcatgcgg gccacgatct    169320
     cgcgcaggtc ggattcgttg aacggctttt ccaggaagtc cacggcgccc tttttcatgg    169380
     tcgacaccgc catcggcacg tcgccgtggc cggtgatgaa cacgatgggc agcggggcgt    169440
     tgcgggcgat cagctgctcc tgcagttcca ggccgctcat gcccggcatg cgcacgtcgg    169500
     cgatcagcac gccgatctgg ctggcgtcgt actcgtccag gaaattctcg ccgctggcgt    169560
     aggcgcgtac gcggtagccg ttggcttcca gcagccagcg cagggaatcg cgcacggctt    169620
     cgtcgtcgtc aactatgaat acggtgctcg acaggtgggg cgtgttcatg cgtgcaactc    169680
     ctcggactgg tcgttctgtg cctgcgactg gggcgtggcg cagggcagtg taaagcggaa    169740
     aatggtgccg ccggcaggat tgggatccgc ccacagacgg ccgtggtgcg actcgataat    169800
     ggtacggcaa atgttcagcc ccatgcccag tccttgcgac ttggtgctga agaacggttc    169860
     gaacaggcgc tccggctcgg gcagcccgtg gccgcgatcg accaccgcca cctcgatgtg    169920
     ctgctcgtgc gggatgacgg ccactttcag ctcgtcggac tcgctctttt ccatggcctc    169980
     caggccattc ttgagcaggt tcagcagcac ctgttcgatc aggatggggt cggccagcac    170040
     gtcgggcgcg ttcgagggca cgaagcgctc gatgcggatg cggcgcttgc gcgcgtcgat    170100
     ctcggcgaac ccgatggcgt tgtcgacgat gcggctgatc gccacccgct ggcggcgcgg    170160
     ttcgctgcgt ttgacgaact cgcggatgcg gctgatgatc ttgccggctc gctcggcctg    170220
     cgaggcggcc ttctccagcg ccggcagcag catgttgggg ctggtgtggc cggccttgac    170280
     cagcgccacc gcgcccatgc tgtagttggc gatggcggtc agcggctggt tcagctcgtg    170340
     cgccagcgac gaggccatct cgcccatggt ggtcaggcgg ctggtgagct ggatcttctc    170400
     ctgctgcacg cgcgaggctt cctcgtggac gcggcgctcg gtgatgtcgc gcgccacctg    170460
     catgcgcacg cggcggccgt cggtccaggc cagcatgcgg tggtgcacct cgaaccagcg    170520
     ctgcaccgag ggggcgagca cctccaccga ctcgtcggtg aagcggccgc gccgaccggc    170580
     cagcagctcg ttgtggccgc cggtctgggc gccgaacacg cgccggtagg tgcggttggc    170640
     gaacagcagt tccagtccgt cgtgggtgtc ggcggtgacc gagatggcgt cgtccaggcc    170700
     ttcgagcacg gtcatgaagc gttcgtgcgc ggcggtcagg gcctcgcgga tgcgcttggg    170760
     ttcggtgatg tcggtcatgg aggtcatcca gccgatctgg tcgccgttgg ggtcgagcag    170820
     gggcgagacg tacatgcgcg ccgtgaagcg cgagccgtcg cggcgctgcg cctcgacctc    170880
     cagcccgctg ctgggcgtct tgcccgaggt cagcacctcc agcgtgtgct ggtgctgctc    170940
     gtggcggccg ggcacccagt acggaaaggg cgggctgcgg ccgatcaggt cggcttcgtt    171000
     ccagcctatc atgcggcaga acgccggatt gacgtaggcg atgcgtccct ccatatccag    171060
     cacccgcatg ccggtggaca tggagttctc catcgcgcgg cgaaagcccg tctcggcgat    171120
     cagggcggcc tcggcctcgg agcgaaagcg cgtatagcgc cacagcatca gcaggctgat    171180
     cacgatgacg caggacagcg ccagcaccac ccagatcagc cgctgctggc gcagctcctg    171240
     gtcgatggtg acgaacatga cgctatcgtc gtggatgcgc tgcagccaga agaacacgcc    171300
     catcacacat atatagagga cgagcacgag cgccggcgtc agccagtaca cgccacgcct    171360
     gcgcgcgcgg gcgtggtcac ggaacgacat cggaatattg gacttgggcg ggctggacat    171420
     ggacttcttg ccgttggagc cggcatttta gagcctgttg cggcttgttg cttgccgggg    171480
     aaggggattt ccgcaataac tgtcgctaca gcggattttg tattatgaaa ttccgtaccg    171540
     caacatgaaa atttccttgc gacgggttaa tcttgctact tagaatgccg gcttcggcac    171600
     aatgcagccg tccgcaaccc acgcgtaaca tggtatccgg catccggcaa cccttgcgcc    171660
     ccgcacactg ataagccggg aagcggccag aaaccccaac aggagacaca cgatgtcctc    171720
     tttcgcccag gctggcgccc tagcggccgc caatgacgaa gacaccctcg agacacagga    171780
     atggctggaa gcattggccg ccgtcctcga ccgtgaagga ccgcagcgcg cgcactacct    171840
     gctggagcgt ctgatcgacg aggcgcgccg ttccggcgcc catatcccgt tctcgccgaa    171900
     caccgcctac gtgaacacga ttccgccggg gctggagcct gcccatcccg gcaacctgga    171960
     gctggaagcc cgcatccgct cgtacgtgcg ctggaacgcc atggcgatgg tggtgcgcgc    172020
     caacaagcac aacccgcccg acggcggcga cctgggcggc catatcgcct cgttcgcctc    172080
     gctggccacc atgatcggct gcggccagaa ccatttctgg catggcgaga ccgaagagca    172140
     cggcggcgac ctggtgtact tccagggcca tacctcgccg ggcatgtacg gccgcgcgta    172200
     cctggaaggc cgcctgaccg aggaccagct caaccatttc cgccgggaag tcgacggcaa    172260
     gggcctgtct tcctatccgc accccaagct gatgccggat ttctggcagt tccccacggt    172320
     gtcgatgggc ctgggcccgc tgatggccat ctaccaggcc cgtttcctga agtacctgca    172380
     tgcccgcggc atcgccgaca ccagcaaccg caaggtgtgg gtgttctgcg gcgacggcga    172440
     gatggacgag cccgaatcgc tgggcgccat cgccctggcc gcgcgcgaga agctggacaa    172500
     cctgattttc gtcatcaact gcaacctgca gcgcctggac ggcccggtgc gcggcaacgg    172560
     caagatcatc caggagctgg aaggcgactt ccgcggctcg ggctggaacg tcatcaagct    172620
     gatctggggc ggctactggg atccgctgct ggcgcacgac aaggaaggca tcctgcgccg    172680
     catcatggaa gaggccgtcg acggcgaata ccaggcgtac aaggccaacg acggcaagta    172740
     cgtgcgcgag cacttcttcg gcaagcatcc caagctgctg gagatggtcg cgcgcatgag    172800
     cgacgaggac atctggcgcc tgaaccgcgg cggccatgac ccccacaagg tctatgcggc    172860
     gttcgacgcg gccagcaagc acgccggcca gcccaccgtg atcctggcca agaccatcaa    172920
     gggctacggc atgggccacg tcggccaggc caagaacccc acccaccagc agaagaagct    172980
     ggagctcgac tcgatccgcg agttccgcga ccgcttcggc atcccgattc ccgacgacaa    173040
     gctggaagag ctgccgtact acaagccggc cgaagattcg cccgaaatgc agtacctgca    173100
     cgagcgccgc aaggcgctgg gcggctacct gcccaagcgc cgcgccaagg ccgacgagca    173160
     actgaaggcg ccggccctgg acgccttcaa ggccgtgctc gagcccaccg cggaagggcg    173220
     cgagatctcc accacccagg ctttcgtgcg ggtgctcaac cagatcctgc gcgacaagga    173280
     cctcggtccg cgcgtggtgc ccatcctggc cgacgagtcg cgcaccttcg gcatggaagg    173340
     gctgttccgc cagatcggca tctatgcgcc cgaaggccag aagtacaccc cggtcgacaa    173400
     ggaccaggtc atgtactaca aggagtcggc cgacggccag ctgctgcagg agggcatcaa    173460
     cgaagcgggc gcgatgagct cgtggatggc ggcggccacg tcgtactcca ccaacaaccg    173520
     catcatggtg ccgttctaca tctattactc gatgttcggg ttccagcgcg tgggcgacct    173580
     ggcctgggcg gccggcgaca tgcaggcgcg cggcttcctg ctgggcggca ccgccgggcg    173640
     caccacgctc aacggcgagg gcctgcagca cgaggacggc cacagccacc tgctggcctc    173700
     gaccatcccg aactgcgtct cgtacgaccc gacgttcgcc catgagctgg ccgtcatcat    173760
     ccagcatggc ctcaagcgca tggtggagga ccaggagaac gtctactact acctgaccgt    173820
     gatgaacgag aactacccgc agccgggcct gaccgccggc gacgaggaag gcatcatccg    173880
     cggcatgtac aagctgaagt cgcacggcaa gggcaagcag cgcgtgcagc tgatgggttc    173940
     gggcaccatc ctgcgcgaag tgatggcggc ccaggaactg ctggaagccg actggggcgt    174000
     ggcgtccgat atctggagcg tgaccagcct caccgagctg cgccgcgacg gcctggacgc    174060
     cgagcgccac aacctgctgc atccggaagg caagcagcag gtgccgtacg tgaccacgca    174120
     gctggccaag agcgaaggcc cgatcatcgc ctcgacggac tacatgaagt tgttcgccga    174180
     ccagatccgc ccgttcgtgc ccaaggaccg tacctacaag gtgctgggaa ccgacggttt    174240
     tggccgctcg gacttccgtt acaagctgcg cgagcatttc gaggtcgacc gccacttcgt    174300
     ggtgctggcc tcgctgcgcg cgctggccga cgagggcaag attccggccg ccaaggtcgc    174360
     cgaagccatc aagaagtacg gcatcaaccc gaacaaagcc aacccgcatc acgcctgagg    174420
     gtaaacagac atgagcaata tcgtggaaat caaggtaccg gacatcggtg acttcaagga    174480
     ggtggaagtc atcgaggtgc tggtatcggc gggcgacacg atcaaggccg agcaaagcct    174540
     gatcacggtg gagtccgaca aggcatcgat ggagattccg gcctcggccg cgggcgtggt    174600
     gaagtcggtc aaggtcaagg tgggcgacaa gatcgccgag ggcacggtca tcctggaagt    174660
     ggaggcggcc ggcgaggccg ccgccgcgcc caaggccgag caggcccccg aggccgccga    174720
     ggcgcccaag gccgacgccg cgaaggccga ggcgccggcc gccgccggcc cgatcgaagt    174780
     caaggtgccc gatatcggcg acttcaagga agtcgaggtc atcgaggtgc tggtcgccga    174840
     gggcgacacc atcaaggccg agcaaagcct gatcacggtg gagtccgaca aggcctcgat    174900
     ggaaatcccg gcctcggcgg gcggcgtggt gcagtcgctc aaggtcaagg taggcgacaa    174960
     ggtcgcgatg ggcacggtca tcgccgtggt gcagggccag ggcgcagccg ccccggccgc    175020
     caaggccgag gcgccggcgg cagccgagcc tgccgcgtcg gcttcggctt cggctccggc    175080
     cccggcgcag cggcccgccc cggccgccgc gctgcaggac gaagacctca agcccggcca    175140
     attgccgcat gcctcgccgt cggtgcgcaa gttcgcgcgc gagctgggcg tgaacctgag    175200
     ccgcgtcacc ggctcggccg cgaagggccg catcacggcc gatgacgtgc gcgcctacgt    175260
     gaagcaggcg ctgtcggccg gcgcgccggc tggcgcctcg ggcggcggcg atggcgccgc    175320
     gctggggctg ctgccgtggc ccaagatcga tttcaccaag ttcggcccca tcgaagccaa    175380
     gccgctgtcg cgcatcaaga agatctcggg cgccaacctg caccgcaact gggtcatgat    175440
     cccgcacgtc accaacaacg acgaagcgga catcaccgac ctggaggcgc tgcgcgtggc    175500
     gctgaacaag gaaaacgaaa aatcgggcgt caaggtcacc atgctggcct tcctgatcaa    175560
     ggcggtggtc gcggcgctga agaagttccc cgagttcaac gcctcgctgg atggcgacaa    175620
     cctggtgctc aagcagtact accacatcgg cttcgccgcc gacacgccca acgggctggt    175680
     ggtgccggtg gtgcgcgacg ccgacaagaa gggcatcctg gagctggccc gcgaaacctc    175740
     cgagctggcc aggaaggccc gcgaaggcaa ggtctcgccc gccgagatgc agggaggctg    175800
     cttctcgatc tcgtcgctgg gcggcatcgg cggcacgcat ttcacgccca tcatcaacgc    175860
     gcccgaagtg gccatcctgg gcgtgtcgcg ctcggcccac aagccggtat gggacggcaa    175920
     gcagttcgtg ccgcgcctga ccctgccgct gtcgctgtcc tatgaccacc gtgtcatcga    175980
     cggcgcctcg gcggcgcgct tcaacgccta tctcggccag ctgctggccg acttccgccg    176040
     catcgcgctg taacgggggc aatcgatgag caatatcgtg gaaatcaagg tgcccgacat    176100
     cggtgacttc aaggaagtcg aagtcatcga ggtgctggtc gccgccggcg acaccatcaa    176160
     ggccgagcaa agcctgatca cggtcgagtc ggacaaggcg tcgatggaaa tcccggcctc    176220
     gtcggcgggc gtggtgaaat cggtcaaggt caaggtgggc gacaaggtcg ccgagggcac    176280
     ggtcatcctg gacgtggagg cggccggcga ggccgccgcc gcgcccaagg ccgaggcccc    176340
     caaggccgag gcgccgaagg cggatgcacc gaaggcgccg gccgccaagg cgagcgcgcc    176400
     ggccgcggcc gcctacagcg gctcggccga cctcgaatgc gacatgctgg tgctgggcgc    176460
     gggccccggc ggctattcgg ccgccttccg cgccgccgac ctgggcatgg acaccgtgat    176520
     ggtcgagcgc tacgccaccc tgggcggcgt gtgcctgaac gtgggctgca ttccctccaa    176580
     ggcgctgctg cacaacgccg cggtgatcga cgaagcgcgc gcgctggccg cccatggcat    176640
     cagcttcggc gagcccaagg tcgacctgga caagctgcgc ggctacaagg acggcgtggt    176700
     cgccaagctg accggcggcc tggccggcat ggcccgcgcg tgcaaggtgc gcgtggccac    176760
     cggcacgggc gagttcgccg acccgcacca cctcacggtg accgacggcg aaggcaagaa    176820
     gcagaccatc cgcttcaagc aggccatcat cgccgccggc agccagtcgg tgaaactgcc    176880
     gttcctgccc gacgacgaac gcatcgtgga ctccaccggc gcgctgcagc tgcgcgccat    176940
     ccccaagaag atgctgatca tcggcggcgg catcatcggc ctggaaatgg gcacggtgta    177000
     ctccaccctg ggcgcgcgcc tggacgtggt ggaaatgctc gacggcctga tgcagggcgc    177060
     cgaccgcgac ctggtcaagg tgtggcagaa gatgaacgcg ccgcgcttcg acaacatcat    177120
     gctcaagacc aagacggtag gcgccgaggc ccgcaaggac ggcatctacg tcagcttcga    177180
     gggcgagggc gcgcccaagg agccgcagcg ctacgacctg gtgctgcagg ccgtgggccg    177240
     cagccccaac ggcaagaaga tcggcgccga gcgcgccggc gtggccgtca ccgagcgcgg    177300
     cttcatcgag gtggaccgcc agatgcgcac caacgtgccg cacatctacg ccatcggcga    177360
     cgtggtcggc cagcccatgc tggcgcacaa ggccgtgcac gaaggccacg tggcggccga    177420
     ggcggcccat ggcgagaagt cgttcttcga cgcgcgcgtc atcccgtcgg tggcctacac    177480
     cgatccggaa gtggcctggg tgggcctgac cgaggacgag gcgaagaagc agggcgtcaa    177540
     ggtcgagaag ggcctgttcc cgtgggcggc ctccggccgc gccatcgcca acggccgcga    177600
     cgagggcttc accaagctgc tgttcgacgc cgagacccac cgcatcgtcg gcggcggcat    177660
     cgtcggcacg cacgcgggcg atctcatcag cgaaatcgcc ctggccatcg aaatgggcgc    177720
     ggacatggtc gacatcggca agaccatcca cccacacccg accctgggcg aatcggtcgg    177780
     catggccgcc gaagtcgccg aaggcgtatg caccgacctg ccgccgatgc gcaagaagta    177840
     aggcgcgcgg catggcagca caagggcccc tcgcggggcc cttgtgcgtt ggcgcggcgc    177900
     attggccaac ggaagagggc ggggcgtggg caggcgcctg tccccgcggg gacaggcgct    177960
     cttgcgcgcg ccggacgcaa aaacgcccgg cgcggtgagg cggccgggcg tacgtactgc    178020
     catggccccg ggcgggttgt gcccgcccgg ggtgtgccga tgcttagcgc agcagcgaca    178080
     ggacgttttg cgggacttgg ttggcctggg ccaggaccga ggtgccagcc tgttgcagga    178140
     tctggttctt ggtcatgttc gacacttcgg tcgcgtagtc cgaatcttcg atgcgcgaac    178200
     gggcggccga caggttcgtg atcgtgttgt tcaggttggc aacggtcgat tcgaaacggt    178260
     tctggatcgc gcccagcgag ctgcgctgtt cgtccacggc cttcatggcg tcgtccagct    178320
     tggacagcgc gtcggcggcg ccgccggaca cggtgacgtt ggcgccggca gcgacgtcgt    178380
     tggtaccgac ggcggcttcc gcagcctgcg aggcgacggc acccagctgg tcgcccaggg    178440
     cggccttgcc gtccttgtcg aaggtcaggg cgtacgaggt catcgtgccg gcattgtcga    178500
     ccacgaccgc gtattgcggg ttggcggtat cgccgtacga gacgacgctg ccgtcgccta    178560
     cggcggcgcc agcggcctgt tcagcggccg ccacggcggc gtcgaaggtc acggtgtcgg    178620
     aagaagcgat ggtggtcgtg acggccgaca gcacgtcaaa gcccagcgcg ttgacggtgc    178680
     gagcctcgcc gttgaccgtg ccgcccggga cggtgcccac ggcgtcatac aggttccagt    178740
     tcgagttgcg atcgatcttg atatcgatcg tttcgttgtc cttggcgccg acctggatcg    178800
     acagggtcat gtcggtggcg ttggacttca ggaccttgat gccgttgaag tcggtctgct    178860
     cggcgatgcg gttgatttct tccaggcgct ggttgacttc ctgctggatc gagtcgatgt    178920
     ccgaagccga gttcgtgccg ttggaggcct gaaccgtcag ttcgcggatg cgctgcaggt    178980
     tgttgttgat ttcgttcagc gcgccttcgg tcgtctgggc gatcgagatg ccgtcgttgg    179040
     cgttgcgggc agcctgggtc aggcccttga cgttggcggt gaagcggttg gcgatggcct    179100
     ggccggccgc gtcgtccttg gcgctgttga tgcgcagacc cgacgacagg cgctcgatgg    179160
     cgctacccag ggccgattgg gacttgttca ggttgttctg ggcaaccagc gacaagtagt    179220
     tggtattgat gactgcagcc atgttgaggc tcccaagaga gaaaggcttc ttcaaaccgg    179280
     gcagctaggc cgcccatctg taacatcgga ctctcgcttg cacagcgccg cgatttcctt    179340
     tgttgcctgg attacggcag gtttgcgacg gacttaagca aaaaaagtga agttcggaaa    179400
     tgtgcggggg aatctggcgg caaagggcat gttcctgcgg ggacagacac ccgtgcggcg    179460
     cggacgggat gcggcaggcg ccagtccccc tgcggggaca ggcgcccgtg cggcggggga    179520
     gatggggcag gtgcctgtcc ccgcaggggg actggcaccg ttggcgcagc gctcggaaag    179580
     caggggcggg caccgggcag gcaggcgccg cgcggccatg gcatgcgcct ataccacctg    179640
     cgccaggtga tgggcggtgg gcaggcgggc ccaggcttgc tccttgaggc gggcgcggat    179700
     gcgggcggtg gggcctgggc gcgcagttgg cacacgcgcg cctcggtgac gttgagcacg    179760
     gcgccgattt ccttgaggtt caggccttgt tcgtagcaca gcgacagcag cagcttctcg    179820
     cgttcgggca ggccgtcgat ggcgtcgatg agggcgcggc gcaggtcgcc ggcgagcagg    179880
     gcgtcgagcg gatcggcatg ttcggcgctg ctttcagccc acgggctgtc gctgtcgccg    179940
     tcggtattga agtcttcgta gtgcaggatc tgcacgcctt gcgcatcggc cagcatgccc    180000
     tggtactcgg ccagcggcac gcccagctcc tcggcgatct cgccttcgct gggggcgcgc    180060
     atcaattcct gttccttgcg ctggatggcg gtttcgatgc ggcggctctt gctgcgcacg    180120
     ctgcgcggca gccagtcctg gctgcgcagc tcgtcgagca tggcgccgcg gatgcgcgcg    180180
     gtggcatagg tctcgaactg cgcgtcaggg ctttcctggt agcgccgcac ggcgtcgagc    180240
     aggccgatca tgccggcctg caccaggtcg tccagctgca cgctggaggg caggcgcgcc    180300
     aggagctgta gcgccagttt gcgcaccagc ggggcatatt ggaccaggct gtcttcgggg    180360
     ttgggcattc aggttctgtc tgcggatgtc tcgcgcgaac aaagctgcga acaggtgggg    180420
     tgttgctggg cggcgacagt ggcctggcgg tcaggccgct gggcgcggac cggttcgacc    180480
     ctgtcgtttc aaggggagat tgtcggcaaa tagccgcttt tcattcggag aagaacgcaa    180540
     ctttttgcac gtttatttac gaaattgccg acatcgaaat gcaaattatg taactcggcg    180600
     gtaactttac tggagataat ctgcaaaata tcaatgtttt gtcataaaag tcatagaaaa    180660
     tgacactatc catggtaaat tgcattcaaa ttgcgatgaa atgatatatt tcgcattaag    180720
     acgaaagcag gctggcgcgg ggttctcggg gcgcgccgcc tggagttcag ccccccggct    180780
     tgcctaagtc tcaggagtca tgtgtgaaaa cagccgatag ttccttgctc gcggatattc    180840
     gggaagtcaa tctttcgtat ctgttgctgg cccagcgcat gctgcgcgac gactatgccg    180900
     cgtcgatgtt ccgcctgggt ttcagcaatg aagtggccga tatcctgatg cggctatcgc    180960
     cggcccagct ggtgaagctg gccagctcca gctcgctgct gtgccgattt cgcttcgacg    181020
     attacagcct cctgtcggcc ctgacccagg acgtgctggg cggcgccctg caacaggcgc    181080
     acgccaccat cctgctggcg cgccagcctg tcgaagagct ggcctgagcg ccggctggat    181140
     agataggaac aagagggcgc aatggccacc aagagtgttt cgcaggaagc cgacgagatc    181200
     ctgcttgcca gttcgatgat cacgctgggc gcgcgtctgc aggtgctgca ggccgagacc    181260
     ggcctcagcc acgaccggct ggcgcggctg taccgcgaga ttcgcggctg ttcgccgccc    181320
     aagggcatgc tgccgttctc ggtggactgg ttcatgacct ggctgccgaa catccattcg    181380
     tcgctgttct acaacgtgta tacgttcctg aaccagcgca cctcgagcca gggcatccgg    181440
     gcagtgatcg acgcataccg cctgtacctg gagcacgcgc cggccgatgc cgccgagccg    181500
     gtgctcagct tcacgcgggc ctggatgctg gtgcggttct tcgacggcgg catgctgcag    181560
     ctgtcgggct gccgccagtg cggcgggcat ttcatcgccc acgcgcacga tccgcagacc    181620
     gatttcgtct gcgccatttg ccgcccgccg ccccgggccg gcaagacgcg cgcggcggcc    181680
     cgcgcgcgcg ccgggcagct cgccgcgccg gcgcggccgt gagcgcgcca gcttccaaat    181740
     aggccaaaag caccagaaaa ccccccataa cccgcgtttt tgcccgacgg gtcagggggg    181800
     atcattggcg tcggttctag acttcgttgg cagaggcctg atgtgttgat tgttatcggt    181860
     tatgcagtgg tcatcctggc ggtggtcggc agtttcatcg gcctgggcgg ccatctgggc    181920
     gcgctctacc agcctttcga gctgacgctg atcgccggcg cggccgtggg cgccttcatg    181980
     gcgggcaaca gccgcaagtc gctcggcctg gtcgccaagg cgatcccgga ggcgtttcgc    182040
     agctcgccct acagcaagga cgtgtacatg gagctgatgg cgcttctgta cgtgctgctg    182100
     aacaaggcgc gccgcgaagg gctgatggcc atcgaatcgc acatcgagga tccgctgtcc    182160
     agcccgatct tcaatgagta tccgcgcatc atgaaggatg ccaagctgat ggagttcatc    182220
     acggactacc tgcgcatcat gatcagcggc aacatgagct cgttcgagat cgaaacgctg    182280
     atggacgagg agatcgagac ctaccggcac gagcgcgaag tgcccaccca tgcgctgcag    182340
     caggtggccg acgccttgcc ggccttcggc atcgtggccg ccgtgctggg cgtgatcaag    182400
     gcgctggcgg cggtggacca gccgccggcg atcctgggcg acctgatctc caaggccatg    182460
     gtcggcacct tcctgggcgt gctgctggcc tacggtttcg tggcgccgat ggccgcccgc    182520
     atcgaacggc gcacctctga atcggtcaag gtgctcgaat gcatcaaggt gacgttgctg    182580
     gccagcatga acggctatcc gccccaactg gcggtggagt tcggccgcaa ggtgctgttc    182640
     tcggcggtgc gcccctcgtt cggcgagctg gaagagcatg tgcgccaggc caagagcgcg    182700
     gccaccggcc gcgcctgacg gagccgccgc atgagcacgg tcaacaatca ccgtgtggtg    182760
     atccggcgcc gcaaggtgcg ccgcggcgga caccacggcg gcagctggaa gatcgcctac    182820
     gccgacttca tcacggccat gatggcgttc ttcctcgtca tgtggctgat cagcatcgtg    182880
     ccgcgcgaag aactcaaggg catcgccgag tatttccgca tgcccctgcg ggtggccctg    182940
     accggcggcc ccagcagctc ggccgagacc agcgcgatcc ccggcggcgg gcaggacccg    183000
     ctgcgcagcc agggcgacgt gcggcgcgcc gagggcaacc gggtcgaggc ccagcccatg    183060
     ggcgacgccg agcggcgcga ccgccatcgc ctggaacgcc tgaaggtccg cctggagaac    183120
     ctgatcgagg aaagcccggt cctgaagaat ttccggccgc agctgctgat cgacatgacg    183180
     accgagggct tgcgcatcca gatcgtcgac aaccagaacc gccccatgtt cgccaccggc    183240
     agcgccgacg tgcagccgta catgcgcgac atcctgcgcg agctggggcc ggtgctcaac    183300
     gacctgccca acaagatcag catcgccggc cataccgacg cgtcgcagta cgcgcgcggc    183360
     gagcgcgcct acagcaattg ggagctgtcg gccgaccgcg ccaacgcgtc gcgccaggag    183420
     ctggtggccg gcggcatgca cgagggcaag gtgttgcgca tccagggcct ggcctcgagc    183480
     atgagcctgg ttaaagatga cccgtttgct gccgttaaca gacgtatcag tctggtggtg    183540
     ctcaatgcat cgacccagcg gcgcatcgag aacgagaacg ccgcggcggc cgatgtcaac    183600
     gcgcgcgacg cgcagggcgt cggcgcggcg ctggccggcc agttggcggc cagcggctcg    183660
     gacgggggcg ccaggtagcg atagggagag gcatgacggc aagaattctg gtggcggacg    183720
     attcggcgac gatgcgcatg atcgtgcagg ccgcgttgac gggggcgggt tggcaggtcg    183780
     tgaccgccag cgatggcaaa caggcgctcg aactggccca ggcgcaggct gtcgacctgg    183840
     tcgtcagtga ctggaacatg cccgtcatgg gcgggctgga cctgatccgg ggcctgcgtg    183900
     ggcaggcccg ctaccaggat ctgcccgtgc tggtgctgac caccgaggac gatggcgata    183960
     gcaaggccgc cgcgcgcgat ctgggcgtat gcggctggct caacaagccg ctcgatccgg    184020
     atgtgctggt cgatctggcg gcggagctgc ttggcgtggc gccaggcgcg tagcggtttc    184080
     tataggaagc atacgggtca tgagttcagg tctggacctc agtcagttct acgaaacatt    184140
     cttcgacgaa gccgacgagc tgctcgcgca gatggagcag ttgctgctcg agctggatgt    184200
     gggcgcgccc gacatcgagc agctcaacgc gatcttccgc gccgcgcatt ccatcaaggg    184260
     cggcgcggcc actttcggct gcttccagaa gctggccgga accacgcatt tgcttgagaa    184320
     cctgctggac gcgatccggc gcggcgagat gggactgcgc gccgacatgg tggacatttt    184380
     cctggaaacg aaagacgtgc tcaaaagcca actggacgcc taccgggcct ccgaagagcc    184440
     cgaagatgcc gtgttcgagc gcatttgcgc cgtgttgcgc cagctggcgc tggaaggcgg    184500
     acaggcgccg gcggccgcgg cgccggcgcc ggtagcggct tccgaacccg gcccggaacc    184560
     cgaacccgcg ccccagcccg ccgcggcatc gacggcggcg ggcctgccgt tgcgggtgcg    184620
     tttcagcaag gtctcggaca aggatgccca gtcgctgctg gaggaaatgg gcaacctggg    184680
     cgacgtgcgc gccagcgagc gcgccggcca gacgctgacg gtgtgggtcg acacgacctg    184740
     ctcgccggac gatatcgaag cggtgtgctg cttcatcatc gacgcggacc aactggaaat    184800
     cgcccgcgag gccgagccgg cccacgcgtc ggcgcaggcg gccgtagcgg ccgcgccgga    184860
     tgccgccgcc acgccggcgc cggttgccgc tcccgccgcg gcccaggccg ccgagccggc    184920
     gcgcgccgcg cgcccgagca tcgcgcccgc gcacgccgac aaggaatcga cctcgatccg    184980
     cgtcggcgtc gagaaggtcg accaggtgat caacctggtc ggcgagctgg tgatcacgca    185040
     ggcgatgctg gcgcagaccg cctcgacgct cgatccggtg ctgcacgatc gcctgctcaa    185100
     tggcatggag cagctcgagc gcaatgcgcg cgacctgcag gaagcggtca tgtccatccg    185160
     catgatgccg atggactacg tgttcagccg ctttccgcgc ctggtgcgcg atatcgccgg    185220
     caagatgggc aagcagatcg aactgcagac ctatgggcgg gccaccgagc tggacaagag    185280
     cctgatcgag cgcatcatcg accccttgac gcacctggtg cgcaacagcc tggaccacgg    185340
     catcgaaacg ccggacaagc gcgtggcggc cggcaaggag ccggtgggcc aactggtgct    185400
     ctcggcgcag cacaatggcg gcaacatcgt catcgaggtc agcgacgatg gcggcggcct    185460
     gagccgcgag cgcatcctca ggaaggccgt ggcccagggg ctgacggtca acgagaactc    185520
     gcccgacgac gagatctggc aactgatctt cgcgcccggt ttctccaccg gcgaccaggt    185580
     cacggacatc tccgggcgcg gcgtcggcat ggacgtcgtg cgccgcaaca tccaggacat    185640
     gggcggccac gtgcagctct ccagcgtgcc ggggcaggga acgaccacgc gcatcgtgct    185700
     gccgctgacg ctggccatcc tggacggcat gtcggtgcgg gtgggcgagg aaaccttcat    185760
     cctgccgctg aaccatgtga cggaatcgct gcagccgcag gccgaccaga tctattcggt    185820
     ggccggcaac gagcgcgtga tgcaggtgcg cggcgaatac ctgccgctgg tggaaatgca    185880
     ccgggtgttt tcggtgggcc aggcgcaggc cgatcccacc caggcgatcg ccgtcatcat    185940
     gcaggccgag gagcgccgct tcgcgctgct ggtcgatcac ctcgtcggcc agcaccaggt    186000
     ggtggtgaag aatctcgaat cgaattatcg caaggtgcct ggcatttcgg ccgccaccat    186060
     cctgggcgac ggcagcgtgg cgctgatcgt ggacgtattc gcgctggcgc gcgccaaccg    186120
     ggaaaagtgg tcccagcccg aagccattct gaattgacgg agagacatat catggcagcc    186180
     aaaccgcaca cccaggccac gcgcgcggaa gacgtgggca acgagttcct ggtcttcacg    186240
     ctgggcgagg aagaatacgg catcgacatc ctgaaagtgc aggaaatccg cggctacgac    186300
     gcggccacgg tcacgcgcat cgcgaacgtg ccgtccttca tcaagggcgt gaccaacctg    186360
     cgcggcatca tcgtgcccat cgtggacctg cgcatcaagt tcaacctggg cagcgtcgaa    186420
     tacaacgagc agaccgtcgt catcatcctc aacctggacc gccgcgtggt cggcatcgtg    186480
     gtcgacgggg tgtcggacgt gctgatgctc aacgcggccc aggtgcgtcc ggcgcccgag    186540
     ttcggcgcca ccctgtccac cgagtacctg accggcctgg gcacggtgga cgaacgcatg    186600
     ctcatcctgg tcgacatcga gaagctgatg accagcgacg agatggcgct ggtggagaaa    186660
     gtggcgtcct gacggcggtc agtccgcggg cggcgcgccg cccgtcgttt cgttcaacgc    186720
     ttgcagtcaa ggagtggttc ctgtcatgcg caagttcctc gcgaacctgt cgatacgcgg    186780
     cagcctgttg ggcgtgctgg cgttcttctc tttcatgctg gtcgtcggcg ccgccctggg    186840
     cgtgctgtcg ctgcgggtca gcaacgacac gttgcaggga gtcaagcaga cccaggatgt    186900
     cgccgacgcg atggatcgcg tcgtcaacag ctacaaggac gcgttcaacg gcctgggccg    186960
     cgccgcggcg tcgcactatg gcgcgatcgt gagcgcgatc ggccagccgg tgcaggtcga    187020
     acagggcctg ggcagcgagg cggcgggctt gctgcagcgc gccaaggctt cgctcaaccg    187080
     cgccgagacc gaatacgagt actacaaggg cctggctcgg ccggccagcg ccgccgacag    187140
     cctgaaagaa gtcgagaacg ccttcgaggc gctggtcggc caggggctcc atccgctggc    187200
     cgccgccttg gagaagggcg acatggccgg ctatcagtcg catgcgcaga acgtccttga    187260
     cgcgctggaa ggacgtttct cgggcgccat cgccgcgttc gacttctggc gcgccagcga    187320
     gctgctcgac gcccacgaag tggctgagac gcgctatcgc ttcgtgctgg cggccgtggc    187380
     cgcgggcggg gtgctggccg cgctgctggt gttttcgacc tatctgttcc tgcgccgccg    187440
     cgtgctgcag cctttgcgcg aagtaggcca gcatttcgac aagatcgccg cgggcgacct    187500
     gaccgcgcgg gtggatgtgc gcaacagcaa cgagatcggc cagctgttcg ccggcctcaa    187560
     gcgcatggag gaaagcctga cgcgtaccgt cgcggcggtg cgccgcgggg tagacgagat    187620
     caacgtgggt tcgcgcgaga tctcggccgg caacacggac ctgtccagcc gcaccgagga    187680
     gcaggcggcc tcgctggagg agaccgcggc ctcgatggag cagctggcct cgacggtcaa    187740
     gcagaatgcc gacaacgcgc gccaggccaa ccagctggcg ggagtcgcct cggacgtggc    187800
     cgagcgtggc ggttcggcgg tgtcggaggt ggtggcgacg atgcaggaca tctcggccag    187860
     ctcgcgcaag atttccgaga ttgtgtcggt gatcgacggg atcgcgttcc agaccaacat    187920
     cctggcgctg aacgcggcgg tggaagcggc gcgcgcgggc gagcagggca agggtttcgc    187980
     ggtggtggcg ggcgaagtgc gctcgctggc gcagcgcagc gcccaggcgg ccaaggagat    188040
     caaggtgctg atcgaggact cggtcggcaa ggtgggcacg ggctcgcagc aggtcgagcg    188100
     cgccggtgcg acgatgcagg agatcgtggc ctcggtcaag cgggtgacgg acatcatggg    188160
     cgagatttcg gcggcctcgg aagagcagtc cagcgggatc gagcaggtca accgcgcggt    188220
     gtcgcagatg gacgaggtaa cgcagcagaa cgcggcgctg gtggaagagg cggccgcggc    188280
     ggccggttcg ctgcaggagc aggcgcagcg cctggccgag gcggtcgcgg tgttcaggat    188340
     caatgccggc gaggtgatcg aagtgccggc gcaccaactg ggatcgaggc aggcgccggg    188400
     tgcgcgcgag acggcgctgg cgcacgatga cgcgctggcg ctggggcact gaggtcaggc    188460
     gtggcgacag caatgacgac gccggctttc agcgccgagc gccagttcga gttccgcgac    188520
     gcggacttcg cccgggtacg gcagatgatc tacgcgcgcg ccggcatttc gctgggcgcg    188580
     cacaagcgcg agatggtgta cagccgcctg gcgcggcgcc tgcgcgcgct ggggcagcag    188640
     gagttccgcg tctacctgga cgggctggag aacgagccgg ccgcgcccga gtgggaagac    188700
     ttcgtcaacg ccctgacgac caacctgacc gccttctttc gcgagtcgca tcactttccc    188760
     attctggccg atttcgcgcg ccagcgcggc gggccggtat cggtgtggtg ctgcgccgcc    188820
     tcgaccggcg aggagccgta ctcgatcgcc atgacgctgg tcgagagcct gggcgcgcgc    188880
     gcccaggcca gccagctgct ggccaccgat atcgacacca actgcctgca gcgcgcgcgc    188940
     gcgggcgtct atccgtacga gcgggtggcc aagctggacc cggcgcgcct gaagcgcttc    189000
     ttcatgcgcg gacgcggcgc caatgagggg caggtcaagg tgcgcgcgga gctggccgac    189060
     atggtgcgct tcgagacctt gaacctgctg gcgccgcact ggccgatcaa cgagaagttc    189120
     gacgcgatct tctgccgcaa tgtcatgatt tacttcgaca agccgaccca ggccaggatc    189180
     ctgcggcggt tcgtcccctt gctcaagccg ggcgggctgc tgtttgccgg gcattccgag    189240
     aatttcacct atatcagccg cgacttccgc ctgcgcggac agactgtcta tgagcaggcc    189300
     agcggcgagt tgccagtatg aagaagatca aggtcttgtg cgtggacgat tccgcgctgg    189360
     tgcgcggcct gatgaccgag atcatcaaca gccatccgga catggaggtg gtcgcgaccg    189420
     cgcccgatcc gctggtggcg cgcgaactga tcaagaagca caacccggac gtgctgacgc    189480
     tggatgtgga aatgccgcgc atggacggcc tggatttcct cgagaagctg atgcggctgc    189540
     ggcccatgcc ggtggtgatg gtgtcgtcgc tgaccgagcg cggcggcgag atcacgctgc    189600
     gggcgctgga actgggcgcg atcgatttcg tgaccaagcc caagctgggg atccgcgacg    189660
     gactgatcga gtattccgag gtgatcgcgg acaagatccg cgccgcctcg cgcgcgcgcc    189720
     tgcgcgcgcc ggcgccggcc ggccacgcgg cgccgctgcg cctgcgcagc ccgttcgcca    189780
     gctccgagaa gctggtgatc gtgggcgcat cgaccggcgg caccgaagcg atccgcgagg    189840
     tgctgcagcc cctgccggcc gacagcccgg cgatcctcat cacccagcac atgccggccg    189900
     gcttcacgcg ctcgttcgcg cagcgcctgg acgcgctgtg cgcggtgacc gtgcgcgaag    189960
     ccagcgacgg cgagcgggtg ctgcctggcc acgtgtacct ggcgccgggc ggcgagacgc    190020
     atatgcgcct gggccgcagc ggcgccaact acgtgatcgg gctgcaggcc agcgagccgg    190080
     tcaaccggca ccgcccctcg gtggacgtgc tgttccattc ggccgccgag gcggccggcg    190140
     gcaatgcgat cggggtgata ctgaccggca tgggcaagga tggcgcggcc ggcttgctgg    190200
     ccatgaaacg cgccggcgcg cggaccatgg cgcaggacga ggccagttgc gtggtcttcg    190260
     gcatgccgcg cgaggccatc gcgctgggcg cggccgacga ggtcatgccg ctggccgaca    190320
     tcagtgagcg gattctgacg cgtctgggcg accgcgggca tcgcgtttga cgccccggtc    190380
     ccaacggagc gggcgtccgg acattatttt cttggagttg agatggtaga taagggaatg    190440
     aagatactgg tggtggatga tttccccacc atgcggcgca tcatacgcaa cctgctcaag    190500
     gagctgggtt tcgagaacgt cgacgaggcc gaggacggcg ccatcgggct ggagaaactg    190560
     cgcaacggcg ccttccagtt cgtggtgtcg gactggaaca tgccgaacct cgacggcctg    190620
     gagatgctca agcagatccg cgccgacgcg gcgctgaagt cgttgccggt gctgatggtg    190680
     acggccgagg ccaagaagga gaacatcgtg gcggcggccc aggccggcgc caacggctac    190740
     gtggtcaagg cgttcacggc cgcgacgctg gaagagaagc tgaacaagat cttcgagaaa    190800
     ctcgccggct gaggtaccga atgaatgcga cggacactgg catgcaggca gacccgaccg    190860
     acctgatcca gcggatcgcc tcgttgacgc gcatgctgcg cgacagcatg cgcgagctcg    190920
     ggctggacca ggccatcaag gatgccgccg aggcgattcc cgatgcgcgc gaccgcctgc    190980
     gctacctggc gcagatgacc gagcaggccg ccaaccgggt gctgaacgcc atcgaggccg    191040
     ccggccccat ccaggacggc atggcgcgcg gcgcccaggc gctggacgag cgctggcagc    191100
     aatggtacga ccagccgctc gagctgccgc aggcgcgcgc cctggtgcag gacacgcgcg    191160
     ccttcctggc cgcggtgccg cagcacacgc agcagaccca ggcgaagctg atggaaatcg    191220
     tgatggcgca ggatttccag gacctgaccg gccaggtcat catgcgcatg atggacgtgg    191280
     tgggcgcgat cgagcgtgaa ctgctgcagg tgctgctgga caacgtgccg caggagcgcc    191340
     gcgacgaagc caattcgctg ctcaacggcc cgcaggtcaa ccccggcggc aaggccgacg    191400
     tcgtcaccag tcaggaccag gtcgacgacc tgctggccag cctgggcttc tgaccagggc    191460
     agggtgcctg tccccgcagg gacaggcacc gaatgggcgt ggcgcagggt gcggggcgcc    191520
     tgtccccgcg gggacaggca tccccacgcg ccggccgccg ccatcccgga ataacgccgc    191580
     tttcccccgc ttcttggctt atcgccgcgc gggccgtccg cctagaatct cggcgggcag    191640
     tccacaaccc gcatccgggc tgcaaacgaa gcgtcgagca tggccgaaga aagcgatctt    191700
     gaaaagtccg aagccgcctc tcccaggcgc ctggaaaagg cgcgcgagga ggggcagatt    191760
     gcgcgttcgc gcgagctggg cacgttcatg atgctggccg ccggcgtggt gggcgtatgg    191820
     ctgagcggtt cgatgctgta ccagggcctg accggcgtgc tgcggcgcgg cctggggttc    191880
     gagccgcggg tggcgcagga cccgggcgtg atggtcgagc aggcggtgca tggcgccggg    191940
     cgggcgctgc tgacggtgct gcccatgttc ggcatgctgg ccgtggtggc ggtgctgtcg    192000
     gcggtgctgc tgggcggctt tgtcttctcg accaagccgc tggagccgaa tttctcgaaa    192060
     ttgagccttt ggtcgggcat caagcgcatg ttttcggccc agaccgtggt cgaactggtc    192120
     aaggcactgg ccaaggccgc gctggtgggc ggggtggcgg tctgggtgat ctggcactac    192180
     cacgacgaca tgctgggcct gatgcacgtg gcgcccagcg ccgcgctgac cagcgccatg    192240
     tcgctggtgg cgctgtgcag cgccctgatc gtgggctcgc tgctgttcgt ggtgctgctg    192300
     gatgtgccct ggcagatctg gaaccatctg aagaagctgc gcatgaccaa ggaagatgtg    192360
     cggcaggaac acaaggaaag cgagggcgac ccccatgtga agggccgcat ccgccagcag    192420
     cagcgcgcca tggcgcgccg gcgcatgatg tcggaggtgc ccggcgccga cgtggtggtg    192480
     accaacccga cccattacgc ggtggcgctg aaatatgcgg acggcgcggc cggcgcgccg    192540
     cgcgtggtcg ccaagggcac cgggctgatc gccgcccgca tccgcgaact cgccgccgag    192600
     catcgcatcc cgacgctcga ggcgccgccg ctggcgcgcg ccctgcatca acacgtcgaa    192660
     ctgggacagg aaatcccgac ggcgctttat accgcggtgg ccgaggtgct ggcgtgggtg    192720
     ttccagctgc gcagctggcg tcccggactg ggacgcgagc cgcaggcgcc gacggcgctg    192780
     gccgtaccgg ccgaactgga cccgcacagc ccgcccgcca cccaaggagc ctgacgaatg    192840
     agcgcgctgc tctccatgct gaaaaccaac ggggccgcca acgccaagct gctggccggc    192900
     cccatcctca tcgtgctcgt gctgggcatg atggtgctgc cgctgcccac cttcctgctg    192960
     gacctgctgt tcaccttcaa catcgccctg tcggtgatga tcctgctggt ggcgatgttc    193020
     acgcgcaagc cgctggattt cgccgcattc ccctcggtgc tgctgtttgc cacgctgctg    193080
     cgcctgtccc tgaacgtggc gtccacgcgg gtggtgctgc tcaacggcca ccagggcccg    193140
     gacgcggccg gcaaggtgat cgaggcgttc ggccacttcc tggtgggcgg caatttcgcg    193200
     gtcgggatca tcctgttcgt gatcctgacc atcatcaact tcatcgtcat caccaagggc    193260
     gccgggcgga tcgccgaagt cggcgcgcgc ttcaccctgg atgccatgcc gggcaagcag    193320
     atggccatcg acgccgacct gaacgccggg ctgatcggcg aggacgaggc gcgcaagcgc    193380
     cgcgccgagg tggcgcagga gtcggatttc ttcggttcga tggacggcgc cagcaagttc    193440
     gtgcgcggcg acgccatcgc cggcctgctg atcatggtca tcaacgtgat cggcggcctg    193500
     atcgtgggcg tggcccagca cgacctgtcg gtaggcgaat cggcccgcgt gtacacgctg    193560
     ctgacgatcg gcgacggcct ggtggcgcag atcccggcgc tggtgatctc caccgccgcc    193620
     ggcgtggtgg tctcgcgcgt ggcgaccgac caggacgtgg gccagcagat cctctcgcag    193680
     ctgttctcca atcccaacgt gatgttcctg acggccgcca tcgtcggcat catgggcctg    193740
     atccccaata tgccgcacct ggcgttcctg acgctggccg cgctgctggc cggttgcggc    193800
     tggatggtct acaagcgcaa cctggccgcc gccagccagg cgcagcaacc cgccgagacc    193860
     gccgccgccc aggcgcaggc ggcggcctcc gaggcgacct gggaagacgt ttcgatggtg    193920
     gaccagctcg ggctggaagt gggctaccgc ctgatcccgc tggtcgacca tgcccagaac    193980
     ggcgagctgc tgcaccgcat ccgcagcctg cgcaagaaat tcgcccagga cgtggggttc    194040
     ctgccgccgg tggtgtacat ccgcgacaac ctggaactca agccgaacga ctaccgcatc    194100
     ctgctttccg gcgtggaaat cggtcgcggc gtggccatgc ctggccaatg gctggccatc    194160
     gacccgggcg gcgtggccat gcaggtcaag ggcacgccca ccaccgaccc ggccttcggc    194220
     ctgccggcgc tgtggatcga cagcggccag cgcgaccaag cccaggtggc cggctacacg    194280
     gtggtcgacg caagcaccgt ggtggctacc cacctgaacc acctgatgca ccgccacggc    194340
     gacaacctgc tgggccgcca ggaagtgcag gcgctgatcg aacgcatcgg acgcgaatcg    194400
     cccaagctgg tcgaggacct cgtgcccaag acgctgtcgc tcaccacctt gtagaaagtg    194460
     ctgcagggcc tgctggccga ggaggtgccg atccgcgaca tgcgcaccat cgtcgatacc    194520
     ctgtccgagc acgcgccgcg cctggcggcc ctggccgcca acgcgggcgg gcagcccgat    194580
     gtgcacgaac tggtcgcgct gacgcgccgt tcgctgggac gcgccatcac ccagcaatgg    194640
     ttcccgggcg aaggcgagct gcgcgtgatc gggctggacg tgcgcctgga gcgcgtgctg    194700
     acgcaggcca tggccaccag cggcggcctc gagcccgggc tggccgagac gctgctgcgc    194760
     gagaccgaag cggcgctggc gcgccaggag gcgcagggca acgctccggt gctgctgacc    194820
     tcgccgccgt tgcgcgcgcc gctgtcgcgc tttctcaggc accatctgcc gcagctgggc    194880
     gtgctttcca atgccgagat ccccgatgag cgcgtggtac gcgtgacggt gctcattgga    194940
     ggcaatggcg aatgaagctg agtcgtttcg tcgcggccag cagccgcgaa gtcatgcgcc    195000
     tggtgcgcga ggcgctgggc ccggacgcgc tgatcgtgtc caaccgcagc gtggccgagg    195060
     gcatcgaagt ggtggccacg ctggacgaga cgcccgccgc ggcgtcggcg acgccgttgc    195120
     ccgatgcgcc ggccgcgccg cccgccgaca tgcccgctgc ggacgcgccc gcgccgctgt    195180
     ccatggcgcg cctgcccgat gcgccgatgc ccgcggccat gccggccggc cgcgtctcgc    195240
     cggggctgga ggcgggcgtg caggccgcca tcgacgcgct gcgcggttcg ctggaaagcc    195300
     gcatggacgg gctgctgtgg agcacgcgcg aggggccggg ccgcgagccg gtgggcgccg    195360
     ggctgttccg cgccttgctc gaagcgggtt tcagcatgcc gctggcgcgc atcctgctcg    195420
     agcgcctgcc gcaggcgctc gacgccacgc aggcgctggc ctgggcgcgc aacgaactgg    195480
     tgacgcacct gccggtgctg cgccgcgagg acgacctgct ggccggcggc ggcgtgttcg    195540
     cgctggtcgg ccccaccggg gtgggcaaga ccaccacgct ggccaagctg gcggcgcgct    195600
     gcgtggcgcg cgaagggcgc gagcaggtgg ccatgctgac caccgacaat ttccggatcg    195660
     gcgcgctgga acaattgcag atctatggac gcctgatggg cattccggcc cattcggtgc    195720
     gcgacgccga tgagttgcgc gacgcgctgg gcagcctggg caaccgcagg atcatcctga    195780
     tcgacaccac gggcatcagc cagcgcgacc gccaggtggc ggggcaggcg gccatgctgt    195840
     gcaacgccgg caagccggtg cgccgcctgc tggtgctcaa cgcggccagc cagggcgaca    195900
     cgctggacga agtggcgcac gcctatcgca acggcgtggg cgaggacgtg gtcggctgca    195960
     tcatcaccaa gctggacgag gcctcgcggc tggcgccggc gctggatacg gcgatccgcc    196020
     accggctgcc catccactat gtctcctacg ggcagaaagt gcccgagcac atggccctgg    196080
     cgcgcgccga cgaactgatc gaccgcaccc tggccacgct gcagcgggtc aagccgctgt    196140
     atgcgcccag cgaggccgac ctggccgcct tgtgcagcgc ctctcgcgag caggcgcgcg    196200
     acgagccggc gcagcgccgc cagatgctgg ccgccacgct gctgggccag ggcggcgccg    196260
     ccgcgcgcga cctcgacggc gcgctggact ggctgcgcga cgatccggcc tgcgcgcagg    196320
     cgcgcggcca tggccggccc ggccacggcc cgggcgctgg gcgacgcggg gctggccctg    196380
     gcgcgccagg cctatcccgc cgccagcagc cgttatctgc tggccatgca cggcaaggcg    196440
     gcgctgcgcg ccgccggcct gccgcaggcc accttgctgt cggctttgct gatgagcgac    196500
     cgcggcgcgg cgctggccgc gcccgcccag caattgatgc tgcagcatgg cctgctggcg    196560
     gcgtacgcgc cgggcgaacc ggccggcgcc aatccgattc aggccctgct ggcgcgcacc    196620
     gactacctgt cgggcgcgct ggctcaattg ccgcacgtgc atgtgttcga cgccggctcg    196680
     gccccgccat ggcaggcgct ggccgggcag gacgccgggt ggctggcgcg ctgcgccggc    196740
     gccacgcggg tgcagcagga cctgtgtccc actttgctca gggccgtggc ccgcgggctg    196800
     ggatacctgc cggtgggtaa tgtggcggtc ccgggcaagg gcagcgcgcc cctggcgctg    196860
     tgggccggca gcgcggacgt ctcgctggcg gcgcgtggcc aggcgccgct tgcggtgcgc    196920
     atggtcagcg cgcgcctgct cgatccgtcc agcgggcgcc aggtggcgca gtggttcggc    196980
     ctgaccaacc tggccgccac gcaggccgat gcggccacgc tggcgcgctg gctggtgcag    197040
     tacgaacagg cgcgcggcgc tttccgctac atggcgcatg cctgggcggc gctgccgccg    197100
     gatgcgggcg atgccgcggc gctggccgcg cgcgcgctgg cggcgggaca gctgggcgcg    197160
     gcgtgctggc agctggaaca ccaggcgcag gccgccgcga tgcgccaggc cttgcccggc    197220
     ctgctggggc cgggcgcgcg caagacgccc gcgcggctgg cgcccgcggc cttgatgaag    197280
     ttgtttgcct tgctggagat ggccggctga aggccggccg ggccggatca ggtggcgacg    197340
     atggcgcggc ccgatgccgc gctggagtag ccgcgcttgc cgcggccctg ggcgtcatag    197400
     gtggcggccg cgccggtgcc ggcggcctgg cgcagggcgt cgagcgactc ttgcgtatgg    197460
     cgcaggttca ccgcgatcag ggtgccgttg cgctggttgt gctcgcgcgc ctgggcggcg    197520
     ttggcctgca gggcctgcca cagcgggccc agttcagggt gggcggcggc agccgcgtcg    197580
     gtgccggccg gaccgctggc caggccggcg tcgctcagca gggcgtcgcg ctcggcgccc    197640
     agctgcgcca ggtcgtcggc cagggtttcc ttgcgctgca ccgcggcctg cagcgactcg    197700
     tgcgcgcggc ggtccatcag ggcctcggtt tccgcttcca gggcgtggag gaactccacc    197760
     accagggcgt tttcgcgttc gaggcaggac ttcagggcgg cagaattcat ggcgggcagc    197820
     agcggtttac ttgagcaaat cgcgggcgct ggcgatcagg ctgtcggcga tgcgggtggg    197880
     gtcgatccgc aactggccgg acgcgatggc cgcccggatg gccgccacac gctcgacgtc    197940
     gatgtcgctg ccgccttcct gagccagcaa ttggcgcgag gccgggctga gcgccacttg    198000
     cgcgctgccc gaaccggcct gggcgccgcc gccataggct tgggccacgg cgtgctcggc    198060
     gcgtgcgccg accgcgttgg ggcccaccgg atggctggtc gaggattgga tcttcaaaat    198120
     attctccgct gcgcgggacc ggcccgatgg gggcgatccg cctggttatg cctgtgtaac    198180
     gacaccatgg gcgcaaactt tagggcacgg ggatggtagg gggccggtca tgtgtaacag    198240
     attttacagc tggatttcga ccagtccggc cgcctgcacg atgccgctga ccacctggcc    198300
     ggaggcggtg cgtacctgga ccgtcgcgct gggcggggcg ttgtccagcg cctggccttc    198360
     gctgctgacc acgaagccgt tgccgcgcgc ggtgatgcgc acgctctggc cgcgcgatac    198420
     cgattcggcg ctgcgcagcc cggcgccctt gatgggctgg cccgcggcga tgcggtgagc    198480
     ggggcgcatg ccgaggatgg cggccgcgtc ggtgatgacg cccgggggca gggccaccag    198540
     gtcgccgtcg cgggtggtca ggtcggccgc ctcgatggtc ttgcccggcg cgatctggcg    198600
     cgccgccacg tagtactggc ccggcacgct gacggtggcc tgggcgtaga ccgtccaggt    198660
     gcgcggcgcg acgcagcgca ggccgaccgt catgcgggcg cgtacccgca tccccgaggg    198720
     catgaagggc gtcagggcct cgcaggcgtc cagccggtcg gtgcgtagag ggtccagcgt    198780
     gatggatggc tcgccgggca gggcggccaa ttgctggcgc agatagcttt cggccgccgc    198840
     ggccagctcg gcgggatcct gggcgggggg ctcggccgcg gcgcgcggca tggcgcccgc    198900
     caggatggcc agcgccgcca ggcgcgcaat ggaacgggaa cggggcgatt tcatgatagg    198960
     caaattgtag aagggcgccg tgccgcgcaa tagccgaatt ggctcggaaa tggcgggttg    199020
     tttggctttt tgtggcggcc gcccgcaacc taagatgccg tcatgccaaa aagcgagcca    199080
     ggccgtgcgg ccggttttct tgggccaatc agttcgcaca ctatcgggac gcgccagatg    199140
     ctagaccggc taaacgagga tttccgcttt ttccagcaat cgatcgcgct gcgcgcgcaa    199200
     cggcaggaag tgctgtcctc caatatcgcc aacgccgaca cgcccaacta caaggcgcgc    199260
     gacttcgatt tcaaggccgc catgcagggc gcgctggagc agcgcatgcg cctgcccgac    199320
     acgaatctcg cgctgacctc ggcgcgccac attcccggcc aggcgaccac gccgtcgccg    199380
     gccgaactga tgtaccgcct gccttaccag cccagcctgg acggcaatac cgtcgacatg    199440
     gacagcgagc gcgtgcgctt cgccgacaac acgctgcatt accagagcag cctgcaggtg    199500
     ttgtcgggcc gcatccgttc gctgatgtcg gcgatccagg aataacggag tccagccatg    199560
     tccctgttga gcattttcga gatcgccggt tcggcgctga gcgcgcagtc ccagcgcatg    199620
     aacgtgtcgg ccagcaacat ggccaacgcc gacagcgtgg ccggccccga cggccagccg    199680
     taccgggcgc gccaggtggt gttccaggtc aatccgccgc ccggccaggc cttcggccag    199740
     gagatcggcg gcgtgcgcgt ggccggcgtg gtcgaggacc agtcgccctt caagaaaatc    199800
     tacgacccca agcatccgat ggccgacgca cagggctacg tgaacatgcc caacgtcgat    199860
     ccggtggccg agacggtcaa catgatcgcc gcctcgcgct cgtaccaggc caacgtcgaa    199920
     gtgctcaaca ccgccaagca gctgatgctc aagacgctga ccatcggcca gtcctgatcg    199980
     gcgcgcggac atcgcctgcg gcacgcatac cggagcattc atccatgacc accgtcaacg    200040
     aaaccacttc ccaggccggc ctggccctgg cgcaggccgg ctccaacagc gccgcccagg    200100
     gcatccagga tcaattcctg acgctgctgg tgacgcagct gcgcaaccag gacccgctca    200160
     acccgatgga gaacgccgag ctgacttctc agctggcgca gatctccacg gtggaaggca    200220
     tcaacaacct caagaacacc atgctcgcca tcagcgggca gatcgacgtg tcgcagtcga    200280
     tggacgcggt gtcgatgata ggcaagggcg tgctgatgcc gggcgacaag gtgtcgctgg    200340
     gcaccgaccc caacgacccc gcccagcgcg gcgccacgcc gttcggcatc gatctgcagg    200400
     gcgacgcgac caaggtgacg gtcaaggtgc tggatccctc gggcgccgtg gtgcgcacca    200460
     tggagctggg cgacctcaag accggtgtgc acacgctgca atgggacggc aacaacgacg    200520
     gcggccagcc gctggccgac ggcaagtatt cgatcacggt gagcgccagc gacgccgacg    200580
     cgaatccggt caagaccgag gcgctgacct acggacaggt caagagcgtg gcgtattcca    200640
     ccaacggcct gcgcctggac ctgggcctgg ccggccagat cagcatgctg gatgtgcgca    200700
     aggtcatcgg ggcttccggg tcggcatgac cccaaaccgg gccggccgcg cgctggcgac    200760
     tcacctcaac ttctgagagc tacgggacaa agacatggga ttcggacaag gattgagcgg    200820
     cctgaacgcc gcctcgcaga acctggatgt aatcggcaat aacatcgcca actcgggcac    200880
     ggtcggcttc aagtcgggcg cggcctcgtt cgccgacgtg tacgccagct cgcgcgtcgg    200940
     cctgggcgtg aaagtcagcg ccatcaacca gcgcttcacg gtgggcaata tttcgaccac    201000
     cggcggcgaa tacgacatgg cgatcgacgg cggcaagggc tttttccgcc tgaccgacca    201060
     gagcggcggg gtgttctact cgcgcaacgg cgagttcatg gtcgacaaga acttctacat    201120
     cgtcaacgcc cagggctttc gcctgaccgg ctatccggcc ggcggcgtgg gcgcccagcc    201180
     ggtggacctg caactgcctc aaggcaacat cgcgccgcaa gcgaccagca ccgcgggcct    201240
     gcagaccaac ctgaacgcca acgccaaggt catcgacccc aacgacacgc cggctgacga    201300
     tggcgcggtg gagctggacg gcacgaccta ccgtttcacc aacgcgagcg gcaccttcgc    201360
     ctgggtcgcg cccgcgccgc tcgacggcac ctacaacggc ggcgacatcg tgatcgccgg    201420
     cggcgcggtg accggcgacc ttgccagcca gccgggctac cagccctaca agccgctggt    201480
     ggccggcatc ccgttcgacc cgaccaatcc gctgtcgtac accgaccagg tgccgaccac    201540
     ggtctacgac tcgctgggca actcgcacca gatgatccag tacttcgcca agcgccccgc    201600
     ggtgggcacc gagagcgtgt acgaggtcta ttacgtgctg gacggccagc ccatgcaggt    201660
     caacggcggc gcctcgcaga cgctgaactt cgacaccgcc ggcaatctgc tcaaccagcc    201720
     gcccaccgcc caggtgacgt tcgccaaccc gggcggcaac gccgcgccgg ccgacccgct    201780
     ggcgatcacc gtcagctaca acggcgtcac ccagtacggc agcgatttcg cgcccaaggt    201840
     ggtgcagaac ggttactcca gcggcgaatt catgggcctg tcggtgggca aggacggcag    201900
     cctggtggcc aagtacacca acggcgagac gcagaccatc ggcaccctgg tgctggccaa    201960
     cttcaacaac gtgcagggcc tgcagccggt gggcaacaac gcctgggtgg agacgtccga    202020
     atcgggccag gccacgctgg gccagccggg caccaacggc ctggcgacca tcgccgggca    202080
     ggcgctggag gcctccaacg tggacatgag ccgcgagctg gtcaacatga tcgtggccca    202140
     gcgcacctat caggccaacg cgcagaccat caagacgcag gacgaagtca tgcaggtctt    202200
     gatgaacatg cgctaagcgc cggcacccac cagaatcgag aatagaaggc caggatggac    202260
     cggatcatct acaccgccat gaacggcgcg gcccgcattg ccgagcacca gacggtgctg    202320
     ggcaacaaca tggccaacgt caacacgccg gggttccgcg agcagatcgc gctgtaccgc    202380
     tcggtgccca tggccgacgg cacctcgctg cccacgcggg tctcgaccgt ggcgtccacg    202440
     cccggcaaca acttcgagat gggcaacatg atgaccacgg ggcgcgagct ggacgtggcg    202500
     ctggccgggc cgggctggtt cgcgctgcag acgccgcagg gcgaggccta tacccgcgcc    202560
     ggcgcgttgc aggtgggcgt caacggcctg ctgcagaccg ccaccgggca gcctgtgctg    202620
     tcggaccaga acgcggtcat cgaggtgccg gaccaggcta gcctgacgat cgcgtcggac    202680
     ggcacggtca ccgccatcgg cgcgggcgat ccgcccaaca acattctcaa cctgggccgg    202740
     ctgaagatgg tcaacccgcc accgcagcag ctggtgcatg gcgacgacgg ggtgttccgc    202800
     atgccgcagc agcccggcgg ccagcccgcc gcgccgctgc cggccgatcc gtcgcagcgc    202860
     ctgttgagcg gcgtgctgga gggcagcaac gccagcccca tgggcgccat ggtgggcatg    202920
     atccagaacg cgcggcggtt cgagatgcag atgcaggtga tacgcgaggc ggacaagaac    202980
     gccgagcgcg ccaacgggat tctggccgcg gccagctgat tatcaacgcg cgcgccgaag    203040
     cgccgcgcca ggagttttca tcatgatgcg ttcgttgtgg gttgccaaga cgggcctgga    203100
     aggccagcag acgtcgatgg acgtcatttc caacaacctg gccaacgtcc agaccaatgg    203160
     cttcaagcgg ggccgcgcgg tgttccagga cctgatgtac cagacgctgc gccagcccgg    203220
     cgcgcaggtc ggcgacgcca accagctgcc ctccgggctg cagctgggca cgggcgtgca    203280
     ggtcgccgcc acccagcggg tgttctcgca gggcaacatg aacaacaccg gcggcgaaat    203340
     ggacatcgcg atccaggggc gcggcttcct gcaggtaaag ctgcccgacg gcacgcaggc    203400
     ctacacccgc gacggctcgc tgcaggtcga tcagaacggc cagctgacca ctgccggcgg    203460
     ctatgtgatc cagccgccca tcaacgtgcc cgacaacgcg ctgtcgctga ccatcggcaa    203520
     ggacggcacg gtgtcggtca cctagcccgg cgcggccggc accaacgtgc agatcggcca    203580
     gctgcaggtc gccaccttca tcaaccccac cggcctgcag agcgtgggcg agaacctgta    203640
     cctggaaacc gactcgtcgg gaccggccaa cctgctgcag ccgggcatcg atggcgcagg    203700
     ccagatcctg cagcagtacg tggaaacctc caacgtcaac gtggccgaag agctggtcaa    203760
     catgatcacc acccagcgcg cctacgaaat gaacagcaag gcggtcaaga cctccgacga    203820
     aatgctggct cgcctgaccc aactgtgatg ctgaagaccg tattgcgcct gccggtctgc    203880
     gccgcgctgc tggcgctggc cgcgggctgc gcgatgattc cgcccgaacc ggtggtgacc    203940
     ggtccgctga ccgcgccgcc tccgccgccg ccgcaaccct cggcgcggcc caacggctcg    204000
     atctaccagc cctcggccta cggcaactat ccgctgttcg aggaccgccg gccgcgcaac    204060
     gtgggcgaca tcgtcaccat cgtgctggag gaaaagacca acgccgccaa gggcgtggcc    204120
     accaacacca gccgcgacgg ctcggccacg ctgggcgtgg cggccgcgcc gcgcttcatg    204180
     gacggcgtca tcaacgacaa gctggatacc gatatctcgg gcggcaatac cgccaacggc    204240
     accggcaaga gcagcgccaa caacaccttc accggcacca tcacgaccac cgtgatcggg    204300
     gtgctgccca acggcaatct gcagatcgcc ggcgagaagc agatcgccat caaccgcggc    204360
     agcgagtacg tgcgcttctc gggcgtggtc gacccgcgat cgatcaccgg cagcaatacg    204420
     gtgtcgtcga cccgggtggc cgacgcgcgc atcgaatacc gcagcaaggg cgtcatggac    204480
     gaagtccaga ccatgggctg gctgcaacgc tttttcctga tcgcttcgcc gttctgatca    204540
     tgacatttcc gacctcgcta tccgttttgc tgattccgct ggcgcgcgcc gtcctggccc    204600
     tggcgctgct gggcgcgggc gccgcgcatg ccgagcgcct caaggacctg gcctcgatcc    204660
     agggcgtgcg cggcaaccag ctgatcgggt acggcctggt cgtggggctg gacggcagcg    204720
     gcgaccaggt gcggcagacg ccgttcacgc agcaaagcct gaccaacatg ctgtcgcagc    204780
     tgggcatcac ggtgccgcag ggcagcaaca tgcagttgaa gaacgtggcc gccgtcatgg    204840
     tgaccgcgac cctgccgtcg ttcgcgcggc ccggccagac cgtggacgtg gtggtttcgt    204900
     cgatgggcaa cgccaagagc ctgcgcggcg gcacgctgct gatgacgccg ctcaagggcg    204960
     ccgacaacca ggtctatgcc atcgcccagg gcaacctcct ggtgggcggg gccggggcct    205020
     cggccggcgg ctccagcgtg cagatcaacc agctcaacgg cgggcgcatc agcaatggcg    205080
     ccatcgtcga gcgcgccgtg cccaccatgt acgcgcagga cggcacggtg tacctggaga    205140
     tgaacaacac cgatttcggc accacccaga acgccgccgc ggccatcaac cgccagttcg    205200
     gcgccggcac cgccatggcg ctggacggcc gcgtgatcca ggtgcgcggc ccgctggacc    205260
     cgtccatgat gccggcgttc atgtcgcagg tggagaacct gcaggtcgcg cgcgcgccgg    205320
     ccacggccaa ggtcatcatc aacgcgcgta ccggctcggt ggtgatgaac cgcacggtca    205380
     tgatcgagga ggccgcggtg gcgcacggca acctgtcggt gatcatcaat cgccagaacc    205440
     aggtgttcca gcccgacacg ccgtttaccg agggccagac cgtggtcgtg cccaacacgc    205500
     agatcgaggt gcgccaggac ggcggcgcgc tgcagcgcgt gaccaccagc gccaacctgg    205560
     ccgacgtggt caaggcgctc aacgcgctgg gcgccacgcc gcaggatctg ctggccatcc    205620
     tgcaggccat gaaaaccgcc ggcgccctgc gcgccgacct ggaaatcatc taaggcccgt    205680
     cgacccagcc atgtcattcg tcagctatac cccccgcccg ggcgtccagg aatcggtctt    205740
     cgacctgggc cgcctggccg acctcaagcg cgacgcggtc aaggcgccgg acggccagcg    205800
     ccagcaaacg gaagtggccc ggcagttcga ggcgctgttc ctgcagatga tgctcaagcg    205860
     catgcgcgag gcgacgccca aggagggcct gttcgattcg cagcagaccg agatgctgca    205920
     gggcatggcc gacgagcagc tggccctgca gctggcctcg ccgggcatcg gcctggcgca    205980
     ggcgctgctg gggcagatgc agcagggcca gccgccggtc ccggccgccg cggcagccgg    206040
     cggcgacgcc gcggcggccc gcgcgctggc cggcaccgcc gcgcccgcgc cgctggtgcg    206100
     cgaccttcgc ggcaactatg tacaaccgga ccctgcgccc aggcgcgagg tcaacgcgct    206160
     gctggatgtg ttgcgcagca accgggcgcg cgaccgcgcc atggcggcgg ccgagggcgc    206220
     gccctcgcac gtggtcgact tcgtgtcgcg catgtcgcgc gcggccaatg tcgcggcgca    206280
     gcaaagcggc gtgccggcgc gcctgatcct gggccaggcg gcgctggaat cgggctgggg    206340
     ccggcgcgag ctgcgccacg aggacggcag caccagttac aacctgttcg gcatcaaggc    206400
     gggcgccagc tggaagggca aggtcgtcaa tgtgatgacg accgagtacg tcgacggcgt    206460
     cgcgcagaag ttggtgcagc cgttcagggc ctattcgtcc tacgaagagt cgttcagcga    206520
     ctacgcccgc ctgatcggca acagcccgcg ctacgaggcg gttacccagg ccggcaacga    206580
     gatcgaggcg gcgcggcgca tccaggaggc cggctacgcc accgatccgc gctatgccga    206640
     aaagctgatc agcatcatgg gccagctgcg caccagcgtg gcgcgcgccg atttttccgg    206700
     cggcctctaa atattggcgg cgggctgccg ttaaccaggc atctgaaccg cgtgcggtga    206760
     attacggggc attgctagca tgaatctgta caacttggcg ctgaccggcc tgaacgcttc    206820
     gcaagccggc ctggagacga ccagccacaa catcaacaat gccacgacgg tcggctacag    206880
     ccgccagcgt gtcatcacct cgaccgccgg cgccggcgag accgggcagg gctttttcgg    206940
     ccgcggtgtg caggtggata ccgtgacgcg ccagtacgat agcttcctgt accgccagct    207000
     ggtcggcgcg caaggcagca gcgcccagct gagcacccac ctcgcgcaag tgtcgcaggt    207060
     gaacaatctg ttcggtgatc gcaccgtcgg catcacgccg gcgctcgcgg gcctgttcac    207120
     cagcaccaac gcggcggcca ccaagccggc cgatccggcc gtgcgcgccg acatgatcgg    207180
     caaggccaac agcctggtca cccagatcaa taccgcctac caggagctgg aaaaccagcg    207240
     caacggcctc aatacgcaga tctcgaccac ggtcgagcag gtcaacagct acctggagcg    207300
     catcaacgac ctgaacaagc agatcgtgat cgcgcgcggc aaggacgggc acgcgcccaa    207360
     cgacctgctg gaccagcgcg accaggccgt ctcggaactg aaccagctga ccggcatccg    207420
     cttctacgag cagggcgata cgttcaacat cacgctgcaa agcggccaga ccctgttgtc    207480
     gggcacgacc gtctatccgc tgcaggcggt gccctcggcc agcgatccca agcgcctggc    207540
     ggtggcctat acgctgccgt ccgggccggg caccaccatc caggtggaaa tgaacgacag    207600
     cgaggttacc ggcggccagc tgggcggcct gctgagtttc cgcagccagt cgctggacgc    207660
     ggtgcaggac cagctgggcc agctggccat cgggctggct atggcgttca acgcgcaaca    207720
     ccgcgagggc tatgacctgg acggccagcc gggcggcgac atgttcggcc tgcaggcgcc    207780
     ggcggcgatc cgcaattccg gcaataccag cacgggcgag tggcagtcgg cctataccga    207840
     cgccgacgcc atccgcgcca gcgcctatcg catccagtac gacggcgcca actacacggt    207900
     gacgcgcctg tccgatggca gcagcttcga cgtgacgccc agcggcacgc cgcccacact    207960
     gtcgttcgac ggcctgaccc tgaccggcag cggcacgccg gccgccggcg acgcctggac    208020
     gctgcagccg gcccgcgacg cggcgcgcga cctcaagcaa ttgatcagcg atcccagcaa    208080
     gctggcgctg gccgattcgg cgctcggcac gaccaacggc aacaacggcc tgaagctggc    208140
     cgagctgcag accgccaagg tgctgggcaa cggcagcatg agcctgaacg agatgttctc    208200
     gcagctcgtc aataacgtgg gcgtgcagac gcagcaggtc agcacggcca acacggcgca    208260
     ggccaacctg gtcaagcagc aggccaccgc ccacctgtcg gtgtcgggcg tgaacctgaa    208320
     cgaagagtac gtcaacctga cgatcttcca ggagcagtac caggccagcg ccaagatcct    208380
     ggatgtggcc agcacggtgt tcgacacctt gctgggcctg cgctgagcgc gacgctaaac    208440
     aagagattgg agttcgacga tgcgtttgag caccgcactg atttaccaga atggcctgaa    208500
     cggcgtgctg aaccaggaag ccgccatggc gcgcctgcag gagcagctct ccagcggccg    208560
     ccgggtgttg acgccggccg acgatccgct ggccgccgcg ctggcggtca acgtctcgca    208620
     gacgtccagc atgaacagca actacgacgc caaccgcaag caggccgagc aggcgctggg    208680
     cgcccagacc aatacgctgc agtcggtcgt caagaacatg caggaaatgc tcaagcgggt    208740
     ggtcgaggcc ggcaacggca ccatgagcga tgccgaccgc caggcgctgg tcatcgcgct    208800
     caagggcgcg cgcgaggaac tggtggggct ggccaacgcc acggatggca acggacagta    208860
     cctgttctcc ggctacaagg gctttaccca gccctacagc ttcgacgccg cgaccggcaa    208920
     ggtgacctat aacggcgacc tgggccagcg cggcatccag gtcgaccaga gccgcctgat    208980
     gagcggcggc gacgtcggca gcgacatttt caacagcgtc accagcggca cgctggccta    209040
     tatcgccgat gccggcgcgg gcaatgccgg caccggacaa tacagcgcgg tgtcgttcga    209100
     cggtccgcgc gccggcaact acgtgggccg cgatttccgt atcgagttca cgcgcgatgc    209160
     ggtgaccgac gagctgcagt actcggtgct cagcgacccg ccggtggtgc cgcccgaaca    209220
     gccgctgccg gccaatatgc cttactcgga gggctccgtg atcgacatga acggcgtgtc    209280
     gatcaagttg agcggccagc ccgaggcggg cgacgtgttc accgtggaga cgcccaagtc    209340
     ctggaagatg ggcgtgcagg gcgacgcggc caacaccgga tcggccacgc tgacgccggt    209400
     gtccctgccg gacgggctga ccggcaagaa cctgagcgtg gcgttcctgg acgacggcgc    209460
     cggcggcctg ctctacagcg tgaccagcac gccgccggac cccagcctgc ctgccaacgt    209520
     gccggtcaag ccgggcgatg tcatcgacat cggcggcctg aaggtcaagg tggacggcca    209580
     gccggccgcc ggcgacacat acgccgtgac cacgccgaag tcggccaacg tggacgtgtt    209640
     cgacacgctc aacgacctga tcggcgcgct cgatacgccc atcagcggcg atccgcaggc    209700
     cgccgcggcg ctggccaaca cgctggccac ggccaacaag aagctgaacc tgtcgctgga    209760
     caacgtgctg acggtgcagg cttcggtggg cgcgcgcctc aatgaactgg aagcgctggg    209820
     caataccggc gcgcagaagg gcttgtcgta cgtcaagcag ctgtcggacc tggaggacgt    209880
     gaacatctac caggcgacca gcgacttgct gttgcggcag gttgcattgc aggcggcctc    209940
     gctggccctg cagcgcatac agggaaacag cctgttctcg atgggtcgat agatccacgg    210000
     caggtctcgt agtcgggaaa tggcgcgcgc tcccctcgag gagcgcgtgt tcgatggaaa    210060
     gcggataaac atgtggtcga atttgaaggt acgcacctgc atcaccctgg tgctgggcct    210120
     gtttctggtg gcaatgctgg tgtccaacgc aatggcctgg ctgggcatga gctcgagcaa    210180
     cgacaagctg gagcgcgtca ataacgcgta ttcgaaccag gccgtgccgg cctacgaggc    210240
     ctacgtcatg ctgctgcggg cgcggctgaa catggtctcg tcgatgatgg acctgcagga    210300
     agggcggttg aaggagtcgg ccgatacgct ggcgcacgcg cagcgccagg ccggcgaagc    210360
     gcgcgagcgc ttcgaggcct tcctggcggt ggccaaggct tcgtcgggcg ccgaccgggt    210420
     cggcgcggtg gagacggcgt tccatgccta cctggaggtg gcggcgcgcc agatggaggc    210480
     catgcagaac cagaagctgg gcgagttcgt gcagctcaac ccgtccgcgc agcgcctgaa    210540
     cactgctttc gatacggcgg cgtcggcgta cctggaccgg atcgacacgg acaccgacgc    210600
     gctggtggac gatgcgcgcg ccgaacacct gcgcgccaat acggtaaccc tggtgttgat    210660
     tgtcctggcg ctggcgctgt gcgccggctg cggggtgttc atcggccgcg ccgtgctgcg    210720
     cccgctcaag gaagccggcc agcacttcga caggatcgcc gcgggcgacc tgaccgcgcg    210780
     ggtggatgtg cgcagcacca atgagatcgg ccagctgttc gccgcgctga agcgcatgca    210840
     ggagagcctg acgcgtaccg tcgcggcggt gcgccgcggg gtggacgaga tcaacgtggg    210900
     ttcgcgcgag atctcggccg gcaacacgga cctgtccagc cgcaccgagg agcaggcggc    210960
     ctcgctggag gagaccgcgg cctcgatgga gcagctggcc tcgacggtca agcagaatgc    211020
     cgacaacgcg cgccaggcca atcagctggc ggccagcgcc tcggacgtgg ccgagcgcgg    211080
     cggttcggcg gtgtccgagg tggtgacgac gatgcaggac atctcggcca gctcgcgcaa    211140
     gatttccgag attgtgtcgg tgatcgacgg gatcgcgttc cagaccaaca tcctggcgct    211200
     gaacgcggcg gtggaagcgg cgcgcgcggg cgagcagggc aagggtttcg cggtggtggc    211260
     gggcgaagtg cgctcgctgg cgcagcgcag cgcccaggcg gccaaggaga tcaaggtgct    211320
     gatcgaggac tcggtcgaca aggtgggcac gggttcgcag caggtcgagc gcgccggtgc    211380
     gacgatgcag gagatcgtgg cctcggtcaa gcgggtgacg gacatcatgg gcgagatttc    211440
     ggcggcctcg gaagagcagt ccagcgggat cgagcaggtc aaccgcgcgg tgtcgcagat    211500
     ggacgaggta acgcagcaga acgcggcgct ggtggaagag gcggccgcgg cggccggctc    211560
     gctgcaggag caggcgcagc gcctggccga ggcggtagcg gtgttcaaga tcaataccgg    211620
     cgaagtgatc gaagtgccgg cgcaccaatt gtccggctac gcggcgcccc tggtcgcgca    211680
     gtcctgaccg gcaccccgac gccgcggccg gctggccgcg gtccgggcca tccgtccgcc    211740
     agggcgggaa agcggcgatc cgccgcggcc agcgccgcgc cggatcgtct ttttacaggc    211800
     agcggccgcg cgggcggccc gcatgtccga gatgtgtagt tcagcagttc cacaggagac    211860
     tggcagtgcg cgttaacctc ccgatatatg acgtagagac caagctgcac gaggaccaat    211920
     acctgatctc gcgcaccgac accaaggggc ggatcgtcta tgcgaacccc gccttcgtcg    211980
     aggtcagcgg cttcgagcgc gacgaattga tcggcaaggc gcacaacctg gtacggcatc    212040
     ccgacatgcc gccccaggcg tacgaggacc tgtggcgcac cctgcaggct gggcagtcct    212100
     ggctgggagt ggtgaagaac cgccgcaagg acggcggttt ctattgggtg ctggccaatg    212160
     ccacgcctat ctatgaggat ggcgaggtgg tcgcctattt gtcggtgcgc gtcaaggcca    212220
     gcgacgagca gatcgaggcc gccgaagccg cctatgcgca gttgcgcgcc ggcacgctgc    212280
     gtggccggcg cctgtggcgc ggccaggtgg tgcccaccgg ctggcggcgg gtgctggccg    212340
     ccgccgcgtt tccgttgcgc ggcggtctga gcgcgcgcat gctgcgccag tcgctgctgg    212400
     cggcgctggc cgtggccggc gcgggcgccg ccgcgctggc gccctggtgg ccgcaatgga    212460
     gcggcgcgca ggccggcgcc gcgagcgcgg ccgtggcgct ggcggcgctg ggcgtgctcg    212520
     cgatgcagtg gcggctgcgc ggcgcggtgc tgcgcaccat ggaaggcgcg gcggacatgg    212580
     cgcgccaggt ggccgccggc aacctcacga cgcagatcgg cagcgacgcc aacgacgagg    212640
     tcggcaagct ggcgttctcg ctggacgtga tgcgcaagag cctggtcggc atcgcgcgcg    212700
     acgtgtacgg cggcatcgag ggcaccaccc aggctgccct gggcatcgcg cgcggcaacc    212760
     aggagctgtc ggcccgcacc gacgaccaga gcgcctcgct gcagaacacg gcggccagca    212820
     tggaagagct gacctccacc gtgcgccaga acgccgacaa cgcccgccag gccaatgacc    212880
     tggccgcgcg cagcatggac gtggcgcgcc gcggcggcga cgccgtcggg cgggtggtcg    212940
     ataccatgca cggcatctcg gacagctcgc gcaagatcgc cggcatcgtc aatatcatcg    213000
     agggcatcgc cttccagacc aacatcctgg cgctgaacgc ggcggtggaa gcggcgcgcg    213060
     ccggcgagtc cggcaagggc ttcgccgtgg tcgccggcga agtgcgcagc ctggcccaga    213120
     agagcgccca ggccgcgcgc gagatcaagg acctgatcga ggactcggtc agccgcgtca    213180
     ccgaaggttc cctgcaggcc gagcaggccg gcgccaccat gcaggagatc gtcgacgcgg    213240
     tgcgcggcgt caccgacatc atcggcgaaa tctcggtggc ctagcagcag caggccagcg    213300
     gcatcgaaca ggtcgacgag gccgtctcgc agatggatgg catgaccgtg cagaactccg    213360
     gcctggtgca gcaactgggc aacaccgtgg cgcaactcgg ccagcagtcg gccgcgctgc    213420
     gcgaaacgat acgcgtgttc cggatggcgc gcgaacaggg gtgagggcgg tgccgccgga    213480
     cgccgctggg tgccagtccc cctgcgggga caggcaccgc agggggtcgg cgggtgccag    213540
     tccctgcggg gacaggcacc gcaaggagtt ggcgggtgcc agtccccctg cggggacagg    213600
     cacccgaggg ggttacttgc ccgccaggcc gttggcgacg ttgttcatgg tgttcaggcc    213660
     ctgttcgaac aggcgctcga gaaaggggcc ggaatgcggc agcacgatgg ccagcagcac    213720
     caggccgacg atgaggctga cgggaaagcc gatggcgaac accgacagct gcggcgcggc    213780
     gcggcgcggt tgaggatgcc catggccagg ttgatggtca gcagggcgca gatcagcggc    213840
     agcgccagca gcaggccgga gacgaagatg gtcgtgcccc attcggccag gatcccccag    213900
     ccgttgcggt ccagcacgcc gaccgcgacc ggcagcgtgt cgaagctgcg caccagcgcg    213960
     ccgagcacca gcaggtggcc gtccagcgcc aggaagacca gcatcgcgac gatattgaac    214020
     agccgcgaga gcaccgcggt gttggcgccg gtggcggggt cgaagaacga cgcgaacgac    214080
     aggcccatct gcaggccgac gaattcgccc gcggtctgca ccgcggcgaa caccacccgc    214140
     atggacagtc ccagcgcgat gccgatgagt acctgctggc ccagcaggaa cagcccggcg    214200
     taggaactgg gcgggacggc aggcatgggg ccgatcgccg gcgccacggc gatcgtgagc    214260
     atgaaggcca ggccgatctt cacgcgcgtg ggaatggtgg actcggaaaa cagcggcgcg    214320
     gcgccgacca gggccaggat gcgcacgaac ggccacagga actgggccag ccagccgttg    214380
     agctgttcca tggtgaacgc aatcatggcg cggcgcggcc aggcgcgttc aggacaccag    214440
     catcggaatc tggccgatca gctggcggat gtagtcggtc agcaggccca gcagccaagg    214500
     gcccagcagc accagggtgc cgcacatggc cagcagcttg gggatgaacg acagcgtcat    214560
     ctcgttgatc tgcgtggcgg cctggaagat gctgatgacc aggccgacga tgagcgtgac    214620
     cagcagcagc ggtccggcca gcgccagggc gaccttgagc gcctggtagg tcatcgacat    214680
     cacggtttcg gcggtcatgg cggcctccct cgcgctattg gtagaagctc tgggccagcg    214740
     agccgagcag caggtgccag ccgtcggcca gcacgaacag catcagcttg aacggcagcg    214800
     ccacggtgac cggcggcacc atcatcatgc ccagcgccat caggacgctg gcgaccacca    214860
     ggtcgatgat gagaaaggga atgaagatgg taaagccgat ctggaacgcc gtcttcagtt    214920
     cgctggtgat gaaagccggg atcaggatgc gcatcggcac ctgggacgga tcttccatgg    214980
     ccggcaggtt ggccaggttg gcgaacaggg tgaggtcgtt ctcgcgggtc tggtgcagca    215040
     tgaagttgtg caggggcgag ccggcgcgct cgaccgcggt ttcgaacgga atgctgcccg    215100
     cggccagcgg ctggtaggcg tcggtgtaga ttttgtcgaa caccggcgac atggtgtaga    215160
     aagtcaggaa cagcgccagc ccgatcagca cgtggttggg cggcgacatc gcggtgccca    215220
     tggcgctgcg cagcagcccc agcacgatga tgatgcgcgt gaagccggtc atcatcagca    215280
     gcgccgcggg caggaacgac agcgaggtca tcagcagcag ggtctgcatg ctgagcgagt    215340
     aggtctccga gccattgggc ccgggcgtgg cggtcagggc cggcagggtg gcctgcgcca    215400
     gcgcgccgct gggccacagc gcggcggcgg ccacggcgac ggcggccatg gcgggccacc    215460
     agggcgcgcg cgggcgcgta tcggaaaaac ggaagctgat gctcatgacg ggcaagccta    215520
     gggcctgtct actcgatggc cgcgctgcag cgcctggccc agtttggcgg caaaggtgcc    215580
     ggccgcggcc ggcgaaggat cgggcagctg gccggccggc agggtgtgca gggtggtcaa    215640
     ctggttgggc gtgacaccca gcaccagcca ggttccttcg atttcgagca ccaccacgcg    215700
     ttggcgcggg cccaggctca tgccgccgac ctggcgcagc aaggcgccgc cgtggcgctg    215760
     gatcaggccc gagcgccgcg ccagccaggc cgaaaccagg atggccgcga tcaccagcgc    215820
     caggccgatg acaacgcgca ggacggcgga ttcggtcata aggcggcttt cagcggcggc    215880
     tgttcaagcg gttgatgcgc tcggacggcg tgatgatgtc cgtcaggcgg attccgtact    215940
     tgtcgtccac cacgaccact tcgccctggg cgatcaggta gccgttgacg aagatgtcca    216000
     tcggttcgcc ggccaggccg tccagttcca cgaccgagcc ctggcccagt tgcagcaggt    216060
     tcttgatggt caggcgcgtg cggcccagct ccaccgtcat ctgcaccggc acgtccatga    216120
     tcaggtcgat gtcggtgccc tggccggtct ccttggtggc cagcggcttg aagacggact    216180
     gcgcggccgg ctggacggcc ggctagacgg ccggcgcggc gttctgctcg gccagggcgt    216240
     cggcccagtc gtcctgcggc ttgaggccgt cggcctgggt gggcgcggcg gcgcgattct    216300
     gttcggcgag cgcatcggcc cagtcgtccg ccgccggggc gggcgcgccg gcgccggtct    216360
     ggtcgggccg ctcgttcgta tcagtcatgg tcgggggcct cgttggaatc ggtatcgtcg    216420
     taattgatca ggttttgcac gcgcagcgcg tatcggccgt tgaaaacgcc atagccgtac    216480
     tccatgagcg gtacgccgtc gacgtgggcg gtaacggtct cgggcacggc gatcggcagc    216540
     acgtcgccgg tcttcatgcg catcagctcg ccgatgctcg aagggatgtg gccgaattcc    216600
     gccaccaggt cgatgtcggc gctgcgcacc tggctctgta gctgctgcgc ccagcgctgg    216660
     tcgacttcct cgagcgcggt gtcctgcagc gggcgcgtca gcaggtcgcg caccggttcg    216720
     atcatcgagt agggcaggca gatattcagg tcgccgccgg tcgcgccgaa ttcgatgtga    216780
     aagggcgaca ccaccaccac ttcattattg ccggtgatgc tggcgaactt ggtgtgcatt    216840
     tccgagcgca cgtactcgaa ctcgatcggg tagaccgggt cccaggattt gccgtagctc    216900
     tccagcgtca ggttgagcag gcggcggatg atgcgctgct cggtcgtggt gaagtcgcgg    216960
     ccttccacgc gggtgtgata gcggccgtcg ccgccgaaca ggctgtcgat caccaggaac    217020
     accaggttcg ggtcgtaggt gaacagggcg gtgccgcgca gcggcttcat ctgaatcatg    217080
     ttcagattgc tgggcaccgg caggttgcgc tcgaaatcgg cgtacttcag gatcttgatg    217140
     gcgccgacgg tgatgtcggc gttgcggcgc atgaagttca gcagcacgtt gcgcatgtgg    217200
     cgcgcgaaac gctcgttgat gagctccagc gtctgcatgc gccggcgcac cacgcgttcg    217260
     ggcgagctga ggtcgtaggc gcgcggggcg ccggcctcgt cgccggccgg ctgcttctcg    217320
     tcgctttcgc cggtgactcc ggccagcagc gcgtcgactt cgtcctgcga aagaaaagcc    217380
     tcgtaggcca tgcttattgc accacgaatg ccgtgaacag cgcgtcggtc acgtactggc    217440
     cgtcaggcag cggcgagaac gggcgtttca ccgcctcggt gatggcgtgc gccatctcgg    217500
     tcttgccctg cagcgtctgg accgcctgcg gcgattgcga ggacagcacc atcaggatgc    217560
     ggctgcgcac ctcgggcatg tacttctcga tgcgctggcg cgtctgctcg tcgctgacgc    217620
     gcagcgtgat cccgacgtgc aggatgcgct cgctgtcggc gttctgcagc gtgacggtga    217680
     acgcttccag cgggatgaag atcggcgccg gcaccaccgg cggcgtcgcc ggcggcgcga    217740
     cgaactgcat gggcgttgcc tgcggctggc ccacgcccag ttgcacgggt acggccaccg    217800
     gcggctgcat gcgcttcatg aagtaccacg tgccggccac gctggcggcg accaccaggg    217860
     ccaggaccag cagcatgagc agcgggcgaa gcagccggcc ggcgccgccc gggcgcaggg    217920
     gaagggtcgt gcgcggcggc atggtggaag ttttggtcgt tgccatctcg atgtcgatgc    217980
     gtagtgccgc tatgaaacgg actttgatgg aattaaggca ttctgccgca attcacgccc    218040
     gcgctggcag gcgaaaaaca gggcgaaagc cgggtatctc aagctattgc tgcactgcgc    218100
     gcggccctca tgcgaaggtg tcgaccaagg catcggcgtt gcgcgccggc gtggcggcca    218160
     cgacgaccgt ctcgctgtcg gcgcccgctg cgctgccgcc cgacgcgccg gcgccgcggc    218220
     cttgctgctc ggcaaagccc tgctgcgcgg actggtcgcc gacactggtc tggcccagcg    218280
     agatgccggc ctgggccagc gcctgctgca gttgcggcaa ggcggcctcg accgcctggc    218340
     gcaccgccgc gtggacggag acgaacgcgg cgctggccac gccttcgtgc aggttgatgc    218400
     tgacccgcaa ggggcccagg tcgggcggat ccaggcgcag ttcggccgta tggtggccct    218460
     ggcgagcatc gtggctgatg gtgacgagct ggcggcccag gtcctggccc cattggctgg    218520
     atcccaccgg cgcggcgacc tccagcccca gcggctgcgc ggcggcgggc aggcttgcgg    218580
     gggccgggtt gccgacagcc tggcgcgccg caatgtgcgc ctgggccgcc gcgtgcaggg    218640
     ccgcgccgtg ttcggccgcg gccagcggtt gcggctgggc cggcgcggtg gcagggggct    218700
     cggccgcctc gccgccgtct tgcggcgtgc cgccggtcga cggcagcggg tgcggcaggc    218760
     tgggcgcggc gggcggcgtt gcggcggttt cggcggccgg cgcgttgggc gcgctggcgg    218820
     ccacggcggc ctgggccgca acggccggtt gcgcggcttg cggcagggct ggcggcatgg    218880
     ccggcgcggt atcggcgggc ggggcgccgg cggcggccgg cgcggccggc tggccggcca    218940
     gcagcgccgc gtgggcgggt tgccgggcgg cggcgcctgc cgcctgggtg gcggccgcaa    219000
     cctgggcgtt gacggcggcg gcttcggcgg cgatctccag ggcctgcagc ggcagcgcgg    219060
     gagccggcgc ggtttgcgcc gccagcgcgg ccagcgtggc ggcgtcggcg gccgtctcgg    219120
     cagcgggctc ctgctggccg tccaccggca aggccgcggt gtcgccgggc ttgccgggtt    219180
     tgccggcgcc ggccgggttc tgggtcgcgg ggccttgggc cggcgcgccg gcctgggcgc    219240
     cgggcgcggc aggcgtgccg gcttcgccgg gtttgccgcc ttgctggcgg gccagcactt    219300
     gcgagaagct gggacccttg ccggcggcgg ccgggccgcc ttgcgcggcc ggacccggcg    219360
     caggcgtcag ggcgggaatg ggcagggtag cggtcgtcat agcggctgtc ctgttacggc    219420
     tcatggatat cagaaacccg cctggcggcg taccagtcgg gcggagtatt catcgttgac    219480
     gcgttgctcg cgccgcgcct cgagcagagc ctgggtgcgc gattcgcgct gcgccagggt    219540
     gtcgaacgaa ttcagcttgc gcttttgctg ctgccagttg aggcgcccgt cgttcaggtg    219600
     cgcctcggcc cggtgcagga catggcgttg ctggccgatg gcatcgtcca gcgtggcgat    219660
     gaagcgctgg tagttatggc agtcggcggc cgacatgccc gactgcatgc gttgcaggta    219720
     gtcctggcga tagtcctgca gcatgttgaa ctgctgctcg gcgttgttgc gctcggcgct    219780
     caggcggccc agttcgcggg cggcctcgtc ggtgctgtcc ttggccaggc cgatcagcat    219840
     gtccagtggc aattggctag gcataggcct ccctcgtttc caggctgcgc tgcagttgat    219900
     cgatggccgt gccatagtcc acgctgtcgc cgatgttctg ctgcaggtac gcttccaggc    219960
     gcggatagcg cgcaatcgcg tcgtcgagct gcggatcggc gccggccacg tatgcgccga    220020
     ccgagatcag gtcgcggttg cgctggtagc gcgacaggat ctgcttgaag cggcgcacct    220080
     gctggaattg ctcggtcgtg atcagcgagg tcatggcgcg cgagatcgag gcttcgatat    220140
     cgatggccgg gtagtggccg gcctcggcca ggtggcgcga cagcacaacg tgtccgtcca    220200
     ggatggcgcg cgccgaatcg gcgatcggat cctgctggtc gtcgccttcg gccagcaccg    220260
     tatagaaggc ggtgatcgac ccggccttgc cgttggggct cggcgcgccc atgccggtgc    220320
     gttcgaccag cgccggcagc ttggcgaaca ccgagggcgg gtagcccttg gtggccggcg    220380
     gttcgccaat cgccagggcg atttcgcgtt gcgccatggc aaagcgcgtg agcgagtcca    220440
     tgatgagcag cacgtccagg ccctggtcgc ggaaatgttc ggccaggcgc gtggcatagg    220500
     acgcgccttg caggcgcagc agtggcgaga cgtcggccgg cgcggcgacc accaccgagc    220560
     gggccaggcc ttcggggccg aggttgtgct cgatgaattc cttgacttcg cggccccgtt    220620
     cgccgatcag gcccaccacg atgatgtcgg cgcgggtgta gcgcgccatc atgcccagca    220680
     gcacgctctt gcccaccccc gacccggcga acaggcccat gcgctggccc cggccgacgg    220740
     tcagcaggcc gttgatggcg cgcacgccca cgtcgagcac gctgtcgatg ggcgcgcgcg    220800
     acaaggggtt gatgggcagg gcggtcaggg gcgcctgttc ggcgccggcc agcgggccca    220860
     ggccgtcgag cggccggccc gcgccgtcga cgacgcggcc cagcatggcg ttgcccaccg    220920
     gcaggtggcg gcccacctgc ggcttggcgt tgccgttgag ttcggccttg cgcggcagcg    220980
     gcacgggccg ctgcacggcg ggctcggccg gcaccacgcg ggcgccgggc ggcaggcccg    221040
     agatgtcgct ttgcggcatc aggtaaagcg tgtggccgtc gaaccccacc acctcggcgt    221100
     cggcccagtg gtcatggccg cgcgccagct cgatgcggca ggcggcgccc accggcaggc    221160
     gcaggccggt ggcgtgcagc accagtccgg cagcgcgcgt gatgcggccg ctgaccagcc    221220
     agggctcggt cgaggcggcg cggatcgaac cgatctgcag ttgtgtctgc cagcggtcgg    221280
     ccaccggcac ggcggccgta tcggccggca gcggcagggc gggcgggttc acgcggtttc    221340
     ctcccaggcg gcgctgcggc ccagcgaggc cgccacgcgg cgccagcgcg cctgcagggt    221400
     ggcgtccaca tcgccgtagg cggtctcggt gcggcaaccg ccgcgcgtga tcgattcgtc    221460
     ggcctgcagc cgccagttgg cttcgttcag ttcgtcggcc agatgcgtgc gcaccagttc    221520
     caggtcgtcg ggatggaccc acaggcgcat ggccgcgccg gtggccggat tgatgtgcag    221580
     gacttcgcgc accgccgcca ccatcgtctc ggggtgctcc gccagggcgg tgcgcagcac    221640
     ctgcccggcg atatccaggg ccagcgtcag caggctctgg cccatgttgt cttccaggcg    221700
     cgcgaccgag gcggcgcagg cctgcgccag cgcgtgcagg cgttcggcct gctggcgggc    221760
     ctcttcgcgg ccctgcgcca gcccctcggc atggccttcg gcgcggcctg ccgccagtcc    221820
     ttgcgcatgg ccggccgcgt aaccctcgcg ctggccttgc tcctggccgg cctggtggcc    221880
     ggcggcatgg ccggcccgct cggcggtggc gcgccattcg cgcagcagct cctcggggtc    221940
     cggcgcgggc tcgggctcgg gttcgagcgc cgcgggttcg ggcgtctcgg cctcggccgg    222000
     ctcgtcgaac gacagcatct gccagcggcg ccaggcggcg ctgcggggca gggcggccgg    222060
     ctcgcgcgcg agggcctcag acataggcgt cgtccccttg cgtgcccagc acgatctggc    222120
     cgctttcggc caggcggcgg gcaatctgca ggatcttctt ctgctcgcct tccaccttgg    222180
     acatgcggat cggcccttgc gcctccaggt cttcgcgcag catctcggcc gcgcggctgg    222240
     acatgttgcg caggaacttg ttgcgcagtt cgtcgccggc gcccttgagg gcgaccatga    222300
     gggtatcgtt gtcgatttcc ttgaggatga gctggacggc gcggtcctcg acgtcgagta    222360
     ggttgtcgaa gacgaacatc tcgtcgatga tcttctgggc caggtcggag tcgcgctcgc    222420
     gcaggctttc gaccacggcc tcttcctgcg acgagttcat catgttcagg atctcggcgg    222480
     cggtgcgcac gccgcccatc ttgctgcgct tggcgccctg gccggccagc accgagttca    222540
     gcacgtcggt cagctccgag agggcggccg gctgcacgcc gccgaaggtg gcgatgcgca    222600
     gcatcacgtc gttgcgcatg cgctcgctga gcatggccag cacgctggcg gcgcggtcgc    222660
     gctccaggtg caccaggatg gtggcgatga tctgcggatg ctcgtcgccg atcagctcgg    222720
     ccaccgtatg cgggtccagc cagttcagcg cgtcgatgcc gctgccgcct tcgccggcct    222780
     ccaggatgtc ctcgatcagg ccggcggccc ggtcgctgcc cagcgccttg gtcagcaccg    222840
     tgcggatgta gtcgtccgag cccagcgtca cggccatgaa ctggtcggcc tcctggcgga    222900
     attcctccag caccaccgcc acgtcgccgc gcgtgacctg cttgaggctg gccatcgccg    222960
     cgcccacctg ctggacttcg cgcgcgctca ggtacttgaa gacctcggcg gcggcgtcct    223020
     cgcccagcga catcatcagg accgcgctgc gtgtcatgcc gtccagcggc tttccgtcat    223080
     ttttcatctt tgctcatcca cgaacgcagg accatggcga cagcgcgcgg atccttgccc    223140
     gccatgtcgc gggcgagctg caggttgtct ttgtagcggt tgacttcgcg ggtgcgcgcg    223200
     gcggcctgcg cttcgcgctc ggcttcctgg cgctgcgcgg cggccacttc gggatcgacc    223260
     tgcgggtaga agtagtcggt gaccaccggg cggatcttgc ggtacagcca gaaggccagg    223320
     atcaggccga acatccagcc cagcgccgtc ttgatcatgg cgatcagttc cgggtcgcgc    223380
     cacagcggca cggcgacagg cgtatcgttg aactggctgt tgaccaggtt cagcgagtcg    223440
     ccgcgcgctt ccgaatagcc catggcctcg cgcaccaggt tggtcagctt gttcagctcc    223500
     tcgggcggca gcgcctcgga ttcgccttcc ttgttgggca ggtagttcac caccaccgcc    223560
     accgacagcc gcttgagcat gctcaccggc tgcttgacgt ggctgatggt gcggtcgact    223620
     tcgtaattga tggtggcgtc gtggcggtcg ttgctcggcg ccgcggcgcc tggctgcgtc    223680
     tgggtggtgg tggcgccggc ggcctgttgc tgggcgcgct gctgctgttg ctgctgcggg    223740
     gtgccggcga cggcgggcgg attgacgatg ggcgcctgcg cgttggccgg cggctggttg    223800
     ctcagcgcgc cgggcacgcc ctgcgcggcg ttcggcccgg tctggcgcga atcgctggtc    223860
     tgctggctgc gcacggcggc ctggccgggt tcctagttgg gccgatagac ctcggaagtc    223920
     tcttcgcggc gggcgaagtc gatctcggcg ctggcctggg catgcacgtt gccggggccg    223980
     accagcgggt tgaggatggt caggatgcgc tcgaccgtgc gctgctccat ttcacgcacg    224040
     aagcgcaact ggtcggcgtc catgccgcgg ccttcgccca gcggcgccga caggagccgg    224100
     ccgttctggt cgacgatgga gacattctcg gcggtcagct cgggcacgct ggaggccacc    224160
     agccaggcca ccgccgacac ctgggcgtcg ctcaggctgc ggcccggata caggttgagc    224220
     agcaccgagg tggtcggggc ctggcggtcg cgcacgaaca gcgactggcg cggcatggcc    224280
     aggtgcacgc gggcgtgctg cacggtatgc atggcctcga tcgagcgcgc cagctcgcct    224340
     tccaggccgc gctggtagtt gatctgctcg gcgaactggc tggcgccgaa gcgggtgttg    224400
     tccagcagtt cgaaacccac cgaaccgccg cgcggcaggc cctggctggc cagctgcatg    224460
     cgcgtgtcgt agacccgctc ggcgggcacc agcagcgcgc tgccgttgtc gctgaagcga    224520
     tagggcacgt tcatctggcc cagcgccgag acgatggcgc cgccatcgcg gtcgtccaga    224580
     ttggagaaca gcaccttgta atcgggctcg cggctccaca tcgccaccgc cgccaccacg    224640
     gcgatcagcg ccgccgccgc cccaagcagg acaggtttgg gcagggcgcg cagtttctcc    224700
     agcacgggaa acctcgccag cagcgacgcg ctcagggttg cctgctggtt catcggcggc    224760
     tcccgctggc ttcgcggtgg ggataaacgt acgacatgga tgctcggggc aggttacgca    224820
     tgcaacgtgc tttgggtgtg ggagcgtgga ttatggatgg gccgcgcgca atcccaatgc    224880
     ccgaaaacaa ccgtcttttc ggcgctattt gatccgtatc gttcctgcgt gcgcggcacg    224940
     cggccgccgg gcgccatcca agccgggaag tggcggcttt tttggcgcct tttgcgccct    225000
     atgcgcaagc cctgcgcgcg atagtcttgc aacccaggat ccgcttattc cgcagaggta    225060
     tcgcaatggc tgtatcagga ctgtccggca tcgagagcat gctgtcgcaa atgcgcgccg    225120
     tggtgcgcgc cgcgcaaagc ggcggcgcca ccgaggccga actggcgcct gggccgtccg    225180
     gcttcgccgc cgagctgcaa cgctccatcc ggcgcgtgtc gcaggcgcag aatgccgcca    225240
     gcgaccaggc caaggcgttc gagctgggcg cgcccggcat ttcgctcaat gacgtgatga    225300
     tcgacctgca aaaggccagc ctgggcttcc agacttcggt gcaggtgcgc aaccgcctgg    225360
     tcgccgccta caaggaaatc tcctcgatgg cggtgtgacg ccggcgccgc ctcaggccgg    225420
     cgcctggggc gggcgggcgc aggtgtggcg caccgcgctg ggaaacagcg aaagcacggc    225480
     gatgctgccg tcgccaaagc gcagcgtgac cggactgtcc acgcagaaat ggatgcgcgc    225540
     cccgtcggcc gtctgggcgt gaaaggccag cggcggttcg tcctcgtcgg ccatgcgcgc    225600
     cagcatgacg gagtcggggc aggccaggtc gagcgggcgc cagaaaaaat acccgtcctt    225660
     ggcatccggc cccaggatgc gcaccggcca ggggcgctgg tcgatgccgg aaatcacgat    225720
     ctggcaatcg gggtggcgca gttcctgcag cgtgctgcgt atctgatcgg actgggtcag    225780
     aacgacgatc tggtcctggg ccgtcatgcg ccgtcctcag gcctgcggcg ccagcacttc    225840
     gggcagctcg cgcgcttcga gccgatatag ccaggccagc agctcggcca ccgccgtgta    225900
     gagttgcggc ggtatatggg cgtccaggtc cacctgcatc agcaggccga ccagttcgcg    225960
     cgattcatgt acatgcaggc cgtgttcgcg ggcggtgcgc acgatggtgt cggccagctg    226020
     gccgtagccc ttggcgacca cacgcggggc cgcttcgccg ccgtcatagg acagcgccac    226080
     ggcgaccggg cggctggcgt cgtcggcggc gggcggggcg ggcgtattca tgcttcgggc    226140
     agatcaaagc cgggcgcgcc aatcgcgtcg accgacagat tggtaagcgt caggccggcg    226200
     gccgacagtt gctggcgcag cgcgtcggcg gcggcgccga tctcggcggc gctgtccggg    226260
     gccacgacgt gcagcaccag ctggttggcc gccaggttca ggcgcgcctc gaccgtgccc    226320
     aggcgcggca ggttgagttt caggcgggtg gcccagtggg tgccgggctg gccggccgcg    226380
     tcatcgccat gctcgcgcgc gacctcccat tccatgggtg tgccgggcca ggcctgcccc    226440
     tgccatgcga gcatctgatt ggccagcaca tccagctgtt ggcgcaccag cagcgtggcg    226500
     tcctggtgaa tgccgggcac cggcgcgccg ggcgtatgcg tggcgggctg gcctggcggc    226560
     gcggcttcgg ccgcgggcag ggcgcgcgcc ggcgtcgcgt tttcgggcgc gcgtggcgtg    226620
     gcggccggct cggcgccggc ggcgggcagc cgcgcctgcg gttcggcctg caactgctgc    226680
     acgctgcgct tgccgaaggc caggtcgctc aggtgggatt catagaacag gccgctggcc    226740
     tgcagcgtct ggcgcaatgc ctgggccagt gccggcgcgg ccggcagcac ggcccggccc    226800
     gccagggcgg cgagcgtggc gggcggcgtc tgcgcgggcg tcctggcgct cgccgcgccg    226860
     gcctgcgccg cttccgggcg ggagggcgta ctcgcggcgc cgccggccgc ggcgctggcc    226920
     tgggcaggcg cgttgggggc ggccgcggca ggctggccgc cggcgggcgg gctggcgcca    226980
     tcctgggccg gcggcgtcca cagcggcgcg cgggcgctta ccgccggcgc ctggccggga    227040
     tactgcgcca gcagggcgag aatggtgcgc gcggtctggc ccagcgtggt cggtgcggag    227100
     gccgtcgtgc cggtgctggt ctgcaggccg cgggcggcca gcgccagcgc ggccgcggtc    227160
     ttggcgtcca cccccgcggc gccctggcgc gcgccgcgct cgccgccggt ctgtaccgcc    227220
     tggcgcggat cgcgcgtggc tgtctgggat gcgccggggc gggcggcctc gccgggttgg    227280
     gcgaccgcgt cggggcgtgc gccggatacc aggttggatt gcgccgacat cgtggtgccc    227340
     agtacggcgt cgagccgctg caccagaatg ctgcccaggg cgggcgggcc gacactcatg    227400
     tgccgttggc cttgccgcta taggtggcca gcagcgactg ctggcgtttc atgcgtccca    227460
     gcaggtcgct caggcgggcc agctgcggca gggcgaggtc gcgcaccgcc gcgtcgtttt    227520
     cgaggatgcg caccagcagg tcgaacttca tgccgcgggc ggcttcgtcc agcggctcgc    227580
     ccggttccag ctcgcgcagc cgctccacca ggcagacata ctcctggccg tggttcagga    227640
     ccaggtccca attgctggca ttggccgccg ccagcatcct gctggtcagg ttggcaatgt    227700
     cctggtaaat ctccaggacc ggggcatgct gcgttaacgc cgtcatagat ttctcgcgct    227760
     gggggcggct ggacaaaaag tgccttcctg gtttcaggcc ggaacggcag gcgcagggtg    227820
     gtcgaccgag gcctgccatg cttcggacag atccgccagc aagcggtccg cgatgtcgag    227880
     ctgttccttg tcggccttca ggttggcggt cagcagcgta cgggtaatgt agtcatacag    227940
     gcgcgccagg ttggccgcca cctcgccgcc ggcatcctgg ttcagcccca gcttcaatcc    228000
     ctcgtcgacg atgcggatgg ccttgccgat ggcctgtccg cgctcgacga tgcggccggc    228060
     ctcgagatgc aggcgggcct gggcgatggc ggcgcgcgcc ccggcataca gcaaggtgat    228120
     caggcgctcg ggggtggcgc tcatgacctg ggtttccagg ccgatatagc tgtatgactt    228180
     gacagagtag gagccggtgg ggcggcgcgc ggcgtacgtc atggctggct tacttcttgg    228240
     tgccggacag ggcggcgaac tgttgggaca ggtagttgct ggtgttgttc atctgcgtga    228300
     cgaagacatc gagctgcacg aactgcttgc ggtaggcctc gatggtcgcg gcgatgctca    228360
     gtttctggcg gtcgtactgg ttctgcagcg actcgagcgt ttcctccagg ccttcctggc    228420
     ggatcttgat cgagccctcg tcgccgagga tctgctcggt cgccagcttc accttttcgc    228480
     ccaggccgaa cggacccgag aaaatgcgcg ccacgtcggc cgggttgtcg cgcagggcgg    228540
     cttccagctt ttcggtatcg gtcttgagcg agccggtctt gggatcggtg gtgatgccaa    228600
     gctggctcag cgtgcgcagg gtgccctcgc cggtggccac gcgcagcgcc gcggcgatgg    228660
     ccgactggat gttgcgggtg gtgccgtcgc cggtcagggc gctctgtttc tccgccttga    228720
     cgtcgaatgc cgtcaggtcc gcgatggtgg tctgcaggcc gttgtaggcc ttgacgaaat    228780
     cgttgacggc cgtggcggcc acgctcgggt cgctggagac ggtcacggtc agcggcgccg    228840
     cggtctgctt ggtcagggtc agcgtcagcc cgtcgatggc ggtctcgacc gtattggtgt    228900
     cgctgaccac ggggatgccg ttgatggtca gctcggcctt ctgggcggcc agctgcaccg    228960
     tcagattgga ggcgccggcg ttggccgcgt cgaagtcgag aatgtccgcg acttcctggt    229020
     tgccgctcac cgtgatccgg gtgaccgcgg cttcggtgcc ttcggtcttg ttgttcagca    229080
     tcaggtagtg cttgccattg ccgtcgctga tgacggtggc gcgcacgtcc aggccgtcgg    229140
     tgccgttgat ggccttgacg atgccgttca gcgacgtgtc ctcgcccagc gtgacggtcg    229200
     tggtcgtgcc gtccttctgg acgatctcga tcgagccgcc cgtgccgtgc ttgtccgtgc    229260
     ggctgtccag ctcgcccgac tgcaggttct gcgcggtggc cagcttgtcg atgttgacgg    229320
     tgtattgacc cggcacggcg ccggccgcgg tcttcaccga cagcccgtcg ccggagacca    229380
     cggccttcac ggcgctgagc gtgtcgatgc tgccgagcgt ggcggcggcc ttctggacgg    229440
     cctcgaccgc ggcctggatc ttgctgtagg ccgaaatgcg cgtctcgtag ctcgcctggc    229500
     gcgcggtgat cagcgtcagt ttcttctctt cggctgcctg cagcttttcc aggatgccct    229560
     caagctccag gccggaggac ccgagagagg aaatggtggc catgtggtgc tccttctagc    229620
     tatgcgattc tgtcaaaaat tggcgccgcc tattggccgg gtaaaggcat aaggtcgggc    229680
     tatttccttg cttacgccgc ttttgcccca ttctggtgca cgcgcgcagc gcgatatgct    229740
     gcctcaggcc gtggtctcga cggcattgcc ctgcatcttg acgatcatct tggcgatgcg    229800
     tatcaccgcc tcggacggaa tggtgcgcag cacatccccc gtttcggcgt ccacgatcga    229860
     gaccaccacc tggtgcacgt ccgggtcgat ctcgaactgc agctgcgtgg accaggcctt    229920
     caactgcgca ttgatttcct ccagcgcccg gtccatcggc agcttgggcg cgccgtactg    229980
     gtcctgcgtg gcggattggg cgccgccgcc gttggcggcc gcggcggccg ccggctgtgc    230040
     ggggacaggg gcgggcgcgg cggaaaccag cgcgggcgcc gcggcgttga tagggcttac    230100
     ggccatgatc actccaacaa gcgataacgg gcgtcgaaag ggacgcgatg ggttttcgag    230160
     ggaaccttca gctaccataa cgacacgctt gcgccgaact ttagacccgg ggcgcttttt    230220
     ttggggccgg atccttttcc atcccgctgc gcgggtgtcc ccgcacgggg accggcaccc    230280
     gctggcttcc caggtgcctg cccgtgcggt gcgcctgtcc cggcgcagac aggtaccgtc    230340
     ttggtggtca agcgctcatg gcgtagacca gtgtgcctgt cccggcgggg acgggcacat    230400
     cctgccgcac gccatcgacg cttgagggcc aagaaggtat cggtccctgc cgggccgccg    230460
     cggcgccggg cgcgtcggga tttcgagtcc ggctccgcgt ttccgtccga aagaccccgc    230520
     gcgccgaggg cgcttgggga aaacaccaag gccacgctgc taaactgcgc cctgtttcga    230580
     tttgccttca tcgccatgtc cacctcccgc cccgacgcca gcgcagacct gcctgcctgg    230640
     ctgcagtacc tggaatccat ccacgccaag gccatagacc tggggctgga ccgggtgcgg    230700
     caggtggccg gccggctcga cctgagcctg gacggggtca agttcatggt gggcggcacc    230760
     aacggcaagg ggtccacctg cgccatgctc gaatccatcc tgctggccgc gggctaccgg    230820
     gtgggcctgt acacctcgcc ccatctcatc gatttcaacg aacgcgcccg catcaacggc    230880
     gaaatcgcca gcgacgcggc gctggtgcag cagttcgagg cggtcgaggc cgcgcgcggc    230940
     gatatctcgc tgacctattt cgagttcacc acgctggcca tcctgcgcct gttcgcgcaa    231000
     tcgcgcctgg acgccgtggt gctggaagtc ggcctgggcg gccggctgga cgccgtcaat    231060
     atcgtcgacg ccgactgttc catcatcacc agcatcgacc tggaccatac cgactggctg    231120
     ggcgataccc gcgagaagat cggcttcgag aaggcgcaca tctaccgcgc ggggcgtccc    231180
     gccatatgcg ccgatccggt gccgccgcaa tcgctgctgg accacgtgca ggcgatcggc    231240
     gccgacctgt ggctgctcgg ccgcgactac aactattccg gggaccgcca gcaatgggcc    231300
     tacggcgggc gggcgcagcg gcgcaacgcg ctcgcctatc ccgcattgcg cggcgccaac    231360
     cagctgctca acgcggccgc cgcgctggcc gcgctcgaag ccgtgcgcga ccgcctgccg    231420
     gtgccgcagc aggcggtgcg ggtggggctg ctgcaggcgt cgctgccggg ccgcttccag    231480
     atcctgcccg ggcagccgac cgtcatcctg gacgtggcgc acaatcccca tgccgccgcg    231540
     gtcctggccc agaacctcga caacatgggg ttccatccct atacgcacgc cgtattcggc    231600
     atgctggccg acaagaacgt cgatggcgtc atcgccaggc tgggcagccg ggtcgaccac    231660
     tggtactgcg ccggcctgcc gggcccgcgc gggctggatg ggcaggccct ggccgatcat    231720
     gtgcgccagg tgctgcccga ggcggaaggc gccgccgaaa cgcctaccgt gcaggcctgc    231780
     gccgaccccg ccgcggccta tgcggcggcg cgggaaaagg cgggcgaggg tgatagaatc    231840
     atcgtgttcg ggtcatttct cacggtggcc tccgtcctgc aggcgctggg ccgcaaaatc    231900
     taagcggatc gcgccagcgc aagggcggcg cgcaccggcc ccgcccgcaa ggaattctgc    231960
     tccatgggat tgttcactag caaagattcg gcctccgaga cgcagtcctc gcgaccgcgt    232020
     ccatccgtat ccagcgaggc gcaggccgcc gagctgcggg cccgggccag gcgccgcctg    232080
     gcaggcgccg tcgcattggt gctcgccgcg gtcatcgtcc tgcccatgat cctcgactcc    232140
     gagcccgtgc cggtcgacag cgacatcccc atccgcgtcc cggaccgcaa ttcggccttc    232200
     cagcccacgg tcaacgatcc gcaggccgcc gcgccgcagc cggaacagcc cgcgccgcag    232260
     gcgccggccg gcacgcccga ggcgggcgcg ccgcagccgc ccgcgctggc gtccgcgccg    232320
     ccgcagacgc cgcctccggg ccagacgccg gcccagcccc agacgccgcc cgcggcccag    232380
     ccgccggcca cgccgccgca gcaggccgcc acgccgccgg ccgcgcccaa gcccgaggcc    232440
     aagccggaac ccaagcccgc caagccggcg gcgccggcgc gctcggacga cggcgcgcgc    232500
     gcgatagcgc tgctggaggg gcgttcgccg ccgccggcgc agcccaagcc ggccgccaac    232560
     ggcaatttcg tgctgcaggt ggcttcctat accacgcagg ccgatgcgca ggcgcgccgc    232620
     ggcaagctgc accaggccgg cgtcaccaat gcattcgtcg agcaggcctc gatcaacggc    232680
     aagcaacagt atcgactgcg cgtggggccg ttcccctcgc gcgaggcggc ccaggcggcg    232740
     caggcgcgcc tgcgcacgct gggctatgac aacggtttca tcgccgcaca gtgaccggct    232800
     tcgatttcgt cgtcctgacg atcctggccg tgtcggccgt gctggggctg gtgcgtggac    232860
     tgctcaagga aattctgtcg ctgcttgcct atctgctggc gttcgtcgcg gcgatctggt    232920
     gggggcccac ggtctatgtc tggcttgaac cgtatatcga aaccgcgctg ctgcgcatgg    232980
     gcatcgccta tgccgtggtg ttcatcatcg tgctgctggc cgtcggcctg gtcaacatga    233040
     cgctcgccgc cctgatccgc accaccggcc tgacgccggc cgaccatggc ctgggcgcga    233100
     tgttcggcct ggcgcgcggc ctggtgctgg tgctggtact ggtggcgctg gcgggtttca    233160
     cgcccttgcc gcaggaagac tggtggcgcg acgccatgtt ctcgcactcg gccaccgagg    233220
     ccgtccggca ggtcaagtcc tggctgccgc cctcgctggc gacgtggctg ccttactgaa    233280
     ttcgcttttc gctttacgct ttatctacta ggaactcacc atgtgtggaa tcgtcggtgt    233340
     cattgggcgc gggccggtca accagctgct ctatgacagc ttgctgctgc tgcaacaccg    233400
     ggggcaggac gcggcgggca tcgccacgct gcagggcaac cacttcaaca tgtacaaggc    233460
     gcacggcctg gtgcgcgatg tgttccgtac ccgcaacatg cgcgcgctgc cgggcaccag    233520
     cggcgtgggc caggtgcgct atcccaccgc cggctccagc gccagcgagg aagaggcgca    233580
     gccgttctac gtcaatgcgc cgttcggcat catgttcgcc cacaacggca acctgaccaa    233640
     ctggcgcgag ctgcgcgagt cgctctaccg cgccgaccgc cgccacatca ataccaattc    233700
     cgattccgaa gtgctgctca atgtgctggc gcacgagctg caatcggccg ccagcggcgt    233760
     gtcgctcgac gatgacacga tctttcgcgc tgtctccgcg gtgcaccagc gcgtcaaggg    233820
     cgcctacgcc gtggtggcgc agatctcggg ctacggcatg ctggcgtttc gcgatcccca    233880
     cggcatccgg ccgctgtgca tcggccgcca ggagaccgag gaaggcgtgg aatggatggc    233940
     cgcctcggaa tccgtggcgc tagaaggcag cggttttgcc ttcgtgcgcg acgtcgagcc    234000
     cggcgaggcg atattcgtcg acctcgacgg ccgcatgacc agccgccagt gcgccgacaa    234060
     tgcgcaactg gtgccgtgta tcttcgagta cgtgtacttt gcccgccccg attcgctgat    234120
     cgacggcgtc tcggtgtacg acgcgcgcct gcgcatgggc gaatacctgg ccgacaaggt    234180
     cgcgcgcagc atgcgcctgg gcgatatcga cgtggtgatg ccgattcccg actcgtcgcg    234240
     tccggccgcc atgcagctgg cgcaccggct ggggctggac tatcgcgaag gcctgatcaa    234300
     gaaccgctac gtgggccgta cgttcatcat gccgggccag gcggtgcgcc gcaaatcggt    234360
     gcgccagaaa ctgaacgcca tcggcatgga attcaagggc aagaacgtgc tgctggtcga    234420
     cgattccatc gtgcgcggca ccaccagccg cgagatcgtc gacatggcgc gcgcggccgg    234480
     cgccaacaag gtgtatttcg cctccgcggc gcctccggtg cgattcccca acgtgtacgg    234540
     catcgacatg ccgacccaga aggaactgat cgccaccggc cgcaccgatg acgaaatcgc    234600
     ccgcaccatc ggcgccgacg cgctgatcta ccaggacctg caggacatgc agcaggcggt    234660
     gcgtgacatc aatccgcgcc tgagccgctt cgaggcatcg tgtttcgacg gcgagtacgt    234720
     gaccggcgac atcaccgccg aatacctggc ccgcctgggc cagtcgcgcg acagcagcgc    234780
     cggcgacgaa gaggccggcg gcctgcagtt caacatgggc tacgcggcca acgacgcctg    234840
     accggcgcgg cgcggccggc ttgcgcaagc cggccgcgcg gccgtcaggc gttgcgccgc    234900
     aacgccgccg gcagggccag cgccagcacg attacgaaca gcgccaggct ccatatcgca    234960
     tactcgatgc ccagcaccgc caccgtggcg tccatgcagg tggcatagat gccgaacagc    235020
     cagggcaggg cgccgtccag tcccgtggcg ctcatgaaac gatcggcgaa ggtctggtcg    235080
     cacgacagca tcttggccgc cacgctgtac tggtaccagg cggcgacgat gccgcagatg    235140
     gccagcagcg ccgccagcat ggcggccagg cgcgccgcga tggcgccggc cagcgcgccg    235200
     gccagggcca ccacgccgat gcacaggtag atcagccgct gcagcacgca ccaggcgcac    235260
     ggcggcatat cgaagacatg ctgcgacagc agggccaggc ccacggcgcc aaagcacagg    235320
     atggcgatca ggaaaagcag gcgttcgcgg tatcgggtca tgggggcagg gacgggaaac    235380
     ggaaaggggc gggcggatgg ccgcgccagg gttaggccgg cggcgccgca ataggttgca    235440
     tgatctgccg catgacgtcc agcagcagtt cgctcgcgtc gctccagaag atctgcacgc    235500
     ccaggcacag catgatgaac gccgacagcc gcatgaacac ggcggtgccg ttgtcgccca    235560
     gccggtgcag catctgcgcg gcaaagcgca ggcagatgaa cagggtgaag gccaccagcg    235620
     ccacgccggg cagcgagccg gccaggcgcg ccaggctgag catgtggttt tcgtcgcgca    235680
     gcgacgcgcc taccgtgatg caggcggcga tggtgccggg gccgcagctg atcggaaagg    235740
     tgagcgggta gaaggcgcgc gcctgcgcca tctcgggcgt gaacgattcg gccatctggg    235800
     cgtgccgcga cgtatcggca tcgggcgagt tgaccagccg ccaggcgctg tagatgacca    235860
     gcatgccgcc gcccacgcgt acgatggcca gcgaaatccc gaagaaactg agcaccacgt    235920
     tgccggcgat catggcgccg atcatcatca acgccacgtt gatggccacg cgcttggaca    235980
     gctgggcgag ggtctgcttg gacgcgccct cggtcagcgt ccagaagatc ggcgtgatgg    236040
     ccggcgggtt gagaaacggc agcagcgtgg ccagggcaaa gaagaagctg cgtccgaaaa    236100
     ccagcaggta ctcgttgtat ggcatggcgg cgggggcggt ggcggggtga aggccgcggc    236160
     cgttcaggcg gcctgctggc gcggctcgtc gccggccagc gcgtccagga tggcgcgttc    236220
     gaactgcatc tggctgcgcg ggcgctccag cgccgagccc gacacgatga acacgtcctc    236280
     gacgcgttcg cccagcgtca tgatcttggc catgatcagg tccacgccgt gttcggcgaa    236340
     tacgcgcgcc agcgcgtaca gcaggccggg ccggtcggtc gcggtgaccg acaggcgcca    236400
     ggactggctg cgttcgtcgg gcgagagctc ggcctgcggc atgaccggaa acacccgcga    236460
     gcgccgggcg tggctgtgcg gcaggcgccg tggcgcatgt gcgtgccggg cggcgtgcgg    236520
     atcgcgcagg cgttcggcca gctcgtgctc caccagggtg gcctgggcgc gcaggtcggc    236580
     gaagccctcg ggcgccagca cgatgaagct gtccagcgcc cagccgtggc gggtggtgtg    236640
     cacgcgcgca tcctgcacgc tgagcgactt ggcgtcgaag tagccgcagg tcgtcacgaa    236700
     cagatccggc gcgtcgcgcg tgtagaccat gacctgcagc ccctcgccgt gctcggtggg    236760
     gcggacccgc accaccggct cgtcgggcgc cacctggtaa tacaggtggc gcgtgtgcca    236820
     ggcgatctcg gaggcgtcgt ggcgcaggaa gtaggcgatg tccagctggt tccagaaggc    236880
     ttcgcgggcg tcgtcgcgca ggcccgccag gcgggtcagg cgggccgcct cgtccttgcg    236940
     ctcggtcagc acggtgtgcg cgtcggcgtg cgcgccgccc agcgccgcca gggccaggcg    237000
     gaaaaggtct tccagcagtt tgcccttcca ggcgttccag acgcgcgggc tggtgccgcg    237060
     gatgtcggcc acggtcagca ggtagagggc ggccaggcgg cgttcgtcgc ccacctgggc    237120
     ggcgaagtcg cgcaccacct gcgggtcgga caggtcgcgc ttctgggcga ccgccgacat    237180
     cagcaggtga tggcgcacca ggaactcgac cagctcggca tcggccggat ccaggccgtg    237240
     gtcctgcgcg aagcggcgca cctcgcgcgc gcccagttcg gaatgatcgc cgccgcggcc    237300
     cttggcgata tcgtggaaca gcgccgcgac atacagcagc cagtggcggt ccaggccggc    237360
     gatcagctgg ctggccagcg ggtattcctg ggcgtgctcg ggcatggtga agcggcgcag    237420
     gttgcgcacg accgccaggg tgtgctggtc gaccgtatag acatggaaca ggtcgtgctg    237480
     catctggccg acgatgcgcc ggaacaccgg caggtagcgc ggcaggatgt tgagcatggt    237540
     catgcggcgc aactcgtgga cgatgccgcg cggctgctgc aggatctgca ggaacagctt    237600
     gcggttgacc ggattgcggc ggaactgcgc gtcgatgcgg tggcgcgaat gccagatggc    237660
     gcgcagcgtg cgggccgaca tgccgatcag ttccggatgc tgctgcatca ccaggaaggc    237720
     gcgcagcagc agcgtcggat tgcgctcgaa gccatcctcg cgcacgatgt ccagccgctc    237780
     gcgcaggttg cggaaatcgt cgtcgatcag gcgcgcgtcg ctgtccgggc gcgggaacag    237840
     ccgttcctcg atgttctgta ccaggatgac attgagctgg gtcaccaggc gcgcggccca    237900
     gtaataacgc tgcatcagca gttcgctggc gcgccgcgtc gccgtcgacg caatgccata    237960
     gaccgcggcc aggcccggtt gcaggtcgaa caggacgcgg tcttcgcgcc ggcccgtcag    238020
     caggtgcagc tcgatgcgca ggcgcttgaa ggcctgttcg gcgcgccgca gatcgcgcgc    238080
     ttcggacgag gtgagcaagc cggcctgggc cacctcgcgc cagctgtggc cgaagccggc    238140
     ggcgcgggcc atccacagga tgacctgcag gtcgcgcagg ccgccaggcg actccttgca    238200
     attgggttcc agcgcgtagg gcgtgtcctg gtagcgggcg tggcgctgct gcatctccac    238260
     ccgcttggcc tggaagaaca ccgccgcgtc cagccgtgcc tgcatggcgc tgtccaggcg    238320
     cttcatgagc gtgcggctgc cggccagcca gcgcgattcc agcagcgccg tctcgacggt    238380
     gatgtcgccg cgcgcctcgc gctcgcagtc ttccagcgtg cgcacgctat ggccgggttc    238440
     caggcccagg tcccacaggg cggccaccaa tgcctcgacc gcgcgcgcat cggccgccga    238500
     cgggggctgc ggcagcagga tcagcaggtc gacgtcggaa tgcggataca gttcgccgcg    238560
     gccatagccg ccgaccgccg ccagggtggc gccggccggc agcggacaca gcttgaccag    238620
     ctcgcgcagc gcctggtcga cgatgcgccg caattcggtc agcagcatgt ccggccgggg    238680
     atgctggcga aactgcgcga cggctgccgc ccgggcggcc tgcatgcgct gcttcagcgg    238740
     attcagatcg acgtggggca tggggcagcc ttgccgcgcg gcggcggggg tcagagagcc    238800
     gggatttcga ccggccgtgt cacgaaggcc ggcggggcgg gcatgccggg cgagaccgtc    238860
     agcacttcgt agccggtatc ggtgaccagc accgtgtgct cccactgggc cgacaggctg    238920
     tggtcgcgcg tcaccaccgt ccagccgtcg gccagctggc ggatttcgcg ccggccggcg    238980
     ttgatcatgg gctcgaccgt gaacagcatg ccggtcacca gcttgacgcc ggtgccgggc    239040
     ttgccgtagt gcagcacctg cgggtcttca tggaagcgct ggccgatgcc gtggccgcag    239100
     aattcgcgca ccaccgagaa accctgcgcc tcggcgtact tctggatggc atggccgata    239160
     tcgcccagcg tggcgccatt gcgcacctgt tcgatgcctt tccacatgca gtcgtaggtg    239220
     atgtcggtca ggcggcgcga caggatcgag ggctcgccca cgtgatacat gcggctggta    239280
     tcgccgaacc agccatcctt gatgatggtg acgtcgatgt tgagcgaatc gccgttcttg    239340
     agcaccttgt cgcccggtat gccatgacag acctggtggt tgaccgaggt gcagatggcg    239400
     ccggtgaagg gcgggtagcc gggtggggcg tagcctatgg tggccgactt gaccttcagt    239460
     tcgtcggtca ggtaggccag gcacagcttg tccagctcgc ccgtcgtgac gcctggtttg    239520
     acgtacggcg taatgaagtc gaggattttg gcggcgtctt ggcaggcggc gcgcattttg    239580
     gccagatcgg ccggatcggt aacgatgccc atgtatcagc ttgagtggcg cggtcgaaaa    239640
     atagtagaat tgtaggcttg cctggaaaag cacgccctgt cttggcccgg aatgtgatgt    239700
     cgaacgtgat ttgtcttgcg cgacgatagg cgcgaggaca ggccggttga aagggcaggc    239760
     aggcaagtag caaagcagta agtgtaaggc tatacggttt gtcttgcgtt cgcacggagt    239820
     cttgcccggt gttttgggcg aattgtgcgg ggcgaggcgg gccggatggg ccggatggct    239880
     gggaaagggt agactggctt tggcctgcgg ttggcgcgtt gcgcggtatc gcgggttgat    239940
     gtggcaccat tttctcgatc gacgctttag agcagcggtg caggcgcggt gtgggcgccc    240000
     ggcttaagtt cttggcggct cgcgctggcg ggctgcctga agaactgccc cgggatcctg    240060
     attccagcgg cccgattccg ctgccaacaa ggcagccagc tgggggcgac aatgtcggcc    240120
     gccagcgcgg atcgagacag gtggcgccgg ccgcgtgcgc ccgcgaccgt ctgggttcat    240180
     tgctgcgtcc ctggtttggg gcgcggcgat cggtcggctc ggtttgtttt ttttatttca    240240
     tcctgtttgt caggaaatcg cgcgttatgc cacccagggt gtcggtttta tccgatgcag    240300
     gtgtagcgca agacttaacc ctcggagata gttatgtccc tcatgcgtga aatgctggaa    240360
     gctggcgtcc acttcggcca ccagacccgt tactggaacc ccaagatggc cccgtacatc    240420
     ttcggtcacc gtaacaagat tcacatcatc aacctcgagc agacggtcgc caagtaccag    240480
     gaagcctcga agttcgtcaa gcaactggtc gcccgtggcg gcaacatcct gttcgtcggc    240540
     accaagcgcg ccgcgcgcga actggtggca accgaagccg cccgctgcgg catgccctac    240600
     gtcgacgccc gctggctcgg cggcatgctg accaacttca agacggtcaa gagctcgatc    240660
     aagcgcctga aggacatgga agccatggtc gccgacggcg gcttcgagcg catgaccaag    240720
     aaggaaggcc tgctgttcca gcgcgaactg gacaagctga acaagtcgat cggcggcatc    240780
     aaggacatga acggcctgcc cgacgcgctg ttcgtcatcg acgtcggcta ccacaagatc    240840
     gcggtcgccg aagccaaggt gctgggcatc ccggtcgtgg ccgtggttga taccaaccac    240900
     tcgcccgacg gcatcgacca tgtcattccc ggcaacgacg actcggcccg cgccatcgcg    240960
     ctgtacgcca agggcatggc cgacgccgtg ctggaaggcc gcgagcagaa catcaatggc    241020
     ctggtcgagg aaatcggcga aggccaggaa gagttcgtcg aagtgcagga caaccaggcc    241080
     tgatagccgg ttgccgcgcc ggccgggccg gcaagcctcg ggcgctgggc gcccgggctg    241140
     ccgcccggat gccggcgccg aggtgggctc ccgcctcacg acccgcccag gcgggtgcca    241200
     tatcgaatca accatatgtc ccggttcatg cttgccgggc catgtcttag cgaatttgga    241260
     gcaaacatgg ctgaaattac cgccgccctg gtcaaggaac tgcgcgaaaa gaccgatgcg    241320
     cccatgatgg agtgcaagaa ggctctgacc gaagccgaag gtgatctggc ccgcgccgag    241380
     gaaatcctgc gcgtcaagct gggcaacaag gccagcaagg ccgccgcccg cgtgaccgcc    241440
     gaaggcctga tcggcctgta catcgccgcc gacggtaagc agggcgccgt catcgaagtc    241500
     aactgcgaga ccgacttcgt cgccaagaac accgatttca tcgatttcat caacaagctg    241560
     gccgagctgg tcgccacgca gaatccgggc gacgtggccg cgctgtcggc gctgccgttc    241620
     ggcgaaggca cggtcgagac cacccgcacc gcgctggtgg gcaagatcgg cgaaaacatc    241680
     tcggtacgcc gcttcgagcg catccagacc ccgaactcgc tggccagcta cgtgcacggc    241740
     ggcaagatcg gcgtactggt cgagttctcg ggcgccgagg aagtgggcaa ggacctggcc    241800
     atgcacatcg ccgcgaccaa gcccaaggcc ctcaatgccg acggcgtcaa cgccgaagac    241860
     atcgccgccg agcgctcggt agccgaacag aaggccgccg aatcgggcaa gcccgccgaa    241920
     atcgtcgcca agatggtcga aggttccgtg cagaaattcc tgaaggaagt tactctgctg    241980
     tcgcaaccct tcgtcaagaa cgacaagcaa acgatcgaac agatgctcaa ggaaaagggc    242040
     gcttcgatca ccaagttcgt tctgttcgtc gttggtgaag ggatcgagaa gaagaccgcc    242100
     gatttcgctt ccgaggtcgc cgccgccgcc gctggccgcg cctgacgcgt catcgtaggg    242160
     gccggccagg gcggggcttc ccgaactgcc ggcctatttc ttgtcttaca ctttcgtcgg    242220
     atcgtttctc gggatatcac ctatgagcag cagatcatat aaacgggttc ttctcaaact    242280
     ttccggcgag gcgctgatgg gcgaagatgc ctttggcatc aatcgctcca ccatcgtccg    242340
     catgaccgat gagatcgccg aagtcgccgc actgggcgtc gaactggcca tcgtcatcgg    242400
     cggaggcaat attttccgtg gcgtcgcccc gggcgcgcag ggcatggacc gcgcgaccgc    242460
     cgactacatg ggcatgatgg caaccatcat gaacgcgctg gcgctgcagg acgcgctcaa    242520
     gcacaagggc gtcgacacgc gggtgcagtc ggcgctgaac atcgaccagg tggtcgagcc    242580
     ctacatccgg cccaaggccc tgcgctacct cgaagagggc aaggtcgtga tcttcgcggc    242640
     cggcaccggc aacccgttct tcaccaccga taccgcggcc gcgctgcgcg gtgcggagat    242700
     cggcgccgaa atcgtgctca aggcaaccaa ggtcgacggc atctacagcg ccgatcccaa    242760
     caaggatccg accgcgaccc gctacgcgcg catcagcttc gacgaagcca tcgtgcgccg    242820
     gctcgaggtc atggacgcca cggcgttcgc gttgtgccgt gaccaaaagc tgcccatcaa    242880
     agtgttttcg atcaacaagt tcggcgccct caagcgggcc gtcagcggcg aagacgaagg    242940
     cacgctggta cacgtttaag aaaaggaaat tccatgagcg tcgcagatat tcgtaagtcc    243000
     gctgaaacca ggatggccaa atcgcttgaa acgctcaagg cgagcctggc caagatccgc    243060
     acgggccgcg cccataccgg catcctggat cacgtgcagg tcgagtacta cggctcgccg    243120
     gtgccgatca gccaggtcgc caacgtgaat ctcgtcgatg cccgcaccat cagcgtgcag    243180
     ccgtacgaga agagcatggc gggcccgatc gaaaaggcga ttcgcgagtc ggacctggga    243240
     ctgaatccgg tctcgatggg cgaaaccatc cgcgtgccga tgccggccct gaccgaggag    243300
     cgccgccgcg acctgaccaa agtggtcaag agcgaaggcg aggacgccaa ggtggcggtg    243360
     cgcaacctgc gccgcgaagc caacgaggcg ctcaagaagc tggtcaagga caaggaaatc    243420
     tccgaggatg acgagcgtcg cgcccaggat gatgtccaga aactgactga ccgtgccgtc    243480
     ggcgacatcg acaagatgat cgtccagaaa gaagcggaaa tcatgaccgt ataattccgg    243540
     ttgaggtatc ggggccgtat cgacggctcc ggtgtcgata tcggaatctg ttccgtacgc    243600
     gccgtcccgg ccgcgctggt cctgtcggat ttggcgcagg cgcgacggcg caggcttttg    243660
     caataccttt ttgcttgccg ccttgcgcca agctccagcc atggcactca gttcgactca    243720
     ggcgattccg gaaacggggg acatccccag gcacgtagcc atcatcatgg atggcaacgg    243780
     ccgctgggcg acgcgccgcc acctgccgcg cacggcaggg cacgccaagg gcgtgcacgc    243840
     ggtgcgccgc gtggtcgagg cctgcggccg gcgcggcgtg cgctacctga ctctgttcgc    243900
     attcagttcc gagaactggc gccgtccggc cgacgaggtg tcgctgttga tgcggctgtt    243960
     cgtgcaggcg ctcgagcgcg aagtcgacaa attgcaggac cagggcgtgc gcctgcacgt    244020
     ggtgggagac ctgagcgcgt tcgagcccaa gctgcaggaa ctgatcgccc aggcgcagga    244080
     acgcaccgag cacaacgacc ggctgcacct gacggtggcg gccaattacg gcggccgctg    244140
     ggacatcctg caggccacgc gcgccatgct gcgcgccgat ccgggcctgg cccaggatcc    244200
     cgaccgcatc gacgaggcgc ggctggccga acatctttcg atggcctggg cgccggaacc    244260
     ggacctgttc atccgcaccg gcggcgaaca gcgcatttcg aacttcctgg tctggcaact    244320
     ggcctacgcc gaattctatt tcacagaaca attctggccc gatttcggcg ccgacgagct    244380
     cgatgccgcc ttcgagtggt atcgcacgcg cgagcggcgc ttcggccgca ccagcgcgca    244440
     attgcgcggc ggcgccaagc gctgaccccc aaggagacgt attcatgctg ggccagcgca    244500
     tcatcaccgc cgccgtattg cttgccgtcc tggccctgac gctggcgctg gccaacccgt    244560
     ggtggttcgt cgccttgctg gcgctgggcg cggcctgcgc cgcctgggag tggctgcgcc    244620
     tgacggtgcg ccagcccccc tcgggtgcgc tgtgcgtcgg cctggcggcg gcgctgctgg    244680
     cggcgatgct ggccatggcg caggcctgga tccagggagg cgtgtccggc ctgcggctcg    244740
     aggtctgggt cggctactgg ctcaccccgg cgatcgtggc cgtctggctg ctgggcgcgg    244800
     gcacggcggt cgcgcgcggc cgcgccgacg cgccggcggc cagcctgggc tggacgctgt    244860
     tcgccattcc cgccgtgctg gccgcctggt cggtgttggc gctgatgtat ctgtcgcgcg    244920
     gcggcgccta tgtggtgtcg ctgctggcgc tggtgtgggt ggccgatatc gccgcctatt    244980
     tcgccggccg cgccttcggc aagcgcaagc tggcgccgcg ggtcagcccg ggcaagacgg    245040
     tggccggcgc ggtggccggc gtgctgggcg cggtcgcgtg gatcgccctg agcagccaat    245100
     gggatggaac ttatggccag gcgctggtcg aacgctggtc ctggtggctg gcgttgccgg    245160
     cggccgcctt gctgggcgtc gtctccatcg tcggcgacct gttcgagtcc ttgctcaagc    245220
     gccgcgccgg ccgcaaggat tccagcgcgc tgctgcccgg ccacggaggc gtctatgacc    245280
     gcatcgacgc catcctgccg gtggcgccgc tggcgttgct catgtctgga gtgttgtttt    245340
     gacccgtttt caacgcgtcg ccgtcctggg atcgaccgga tcgatcggcg acagtacgct    245400
     cgacgttatc gcgcgccacc cggatcggct gggcgtgtat gccctgtcgg cctatagccg    245460
     catggacaag ctggccgccc aggcggccgc ctgcggcgcc gccgtggtgg tcgtgcccga    245520
     cgatgcggcg gctgcgcgct ttcgcgccgc ctggcgcggc aaggccgcca tgcccgaggt    245580
     gcgggtcggg ccgcgcacgc tggccgagac ggccgccgcg cccgagtgca ccacggtcat    245640
     ggccgccatc gtcggcgccg ccggcctgcc ggcggccctg gccgcggcgc aggccggcaa    245700
     gcgggtgctg ctggccaaca aggaagcgct ggtggcggcc ggatcgctgt tcatggcggc    245760
     cgtgcgcgag aacggcgccg aattgctgcc catcgacagc gaacacaacg ccatcttcca    245820
     gtgcatgccg cagggcgccc gggcggccgc gcccaccgcg cccgcgcccg gcgtgcggcg    245880
     cctgctgctg accgcctccg gcggcccgtt ccggcgccag gacccggccg acctgcacga    245940
     agtgacgccg gcccaggcct gcgcacatcc caactggagc atggggcgca agatttcggt    246000
     cgattcggcc accatgctga acaagggact ggaggtcatc gaggcccatt ggctgttcgc    246060
     catgccgtcc gaacgcatcg acgtgctgat ccatccgcaa agcgtcgtcc attccatggt    246120
     cgagtacgac gacggctcgg tgctggcgca actgggacag cccgacatgc gcacgcccat    246180
     cgcctacggg ctgggctttc cggagcgcct ggccagcggg gtggggctgc tggacctgac    246240
     gcgctggggg cggctggatt tcgagcagcc cgacctgcag cgcttcccgt gcctggcgct    246300
     gtcgttcgcc gcgctgcgcg ccggccagcc ggcctgcgtg gccctgaacg cggccaacga    246360
     agtcgcggtg gccgcgttcc tggaagggcg cctgcgctat acctgggtcg cccgggtcat    246420
     cgaggcggtg ctcgagtggc aggccaagca ggcatctgtt accctgacca gcctggatga    246480
     cgtgctcgac ctggatgcgc gcgcgcgctc attcgccggc aatctcggcc tggcgtgacg    246540
     cgccgggccg cctttcgcgt ccacccgagt ctgatccatg cttttcacgc tgctggcctt    246600
     tgtcgtcgcc ctgggcaccc taattacgtt ccatgaactg ggccactact ggatcgcccg    246660
     gctgtgcggc gtgcgcgtgc tgcgtttttc cgtcgggttc ggccgggtgc tggcgcgccg    246720
     caccgaccgc cacggcaccg agtgggccat ttccgcgatc cccctgggcg gctacgtcaa    246780
     gatgcaggac gatccgccgg caggcgccag cgcggccgag gcggcgcgct ccttcaatgc    246840
     ccagccggtc gggcgccgca tcgccatcgt ggccgctggg ccgctgttca atctttttct    246900
     cgccgtggtc ctgtatgccg gcctgaacct ggccggcacc gaagtgcccg cgccggtggt    246960
     gggccagccg gcggccggca cgccggccgc gcaggccggc ctgatggccg gcgaccgcat    247020
     cgaggcggtg caggggcgcg cggtcgattc ctggaatgac gcgcgctggc gcctgctgga    247080
     cgtgctttcc agccagggcg aggcgcagct ggaagtgcgc ggccccggcg gcgcggcgcg    247140
     cggtctcgtg ctgcaggtgc cgggcggcaa ccgcctggat ccggccgacg gcgacccgct    247200
     ggccgagacc ggcctgcgcc tggcccagcc caagccggtg gtgcgcgagg tcatcgccgg    247260
     cggcgccggc gagcaggccg gcctgcgtgg cggcgacctg atcgtggcgg ccggccaggc    247320
     cgccgacctg gacgcgggcg cgctggtggc cctgatccag cgccatgccg gccagcccct    247380
     ggccctgacg gtgcagcgcg gcgccgaccg cctgaccctg acggtggtgc cgcgggccga    247440
     atccgtgcag ggccaggagg tgggccgcat cggcgtgcag ctgggcgggg atatccccat    247500
     ggtcacggtg cgctacgggg tgatcgacag cgtctggcgc ggcgcccagc gcacctggga    247560
     cacggcctgg ctgtcgttgc gcatgatggg ccgcatggtg ctgggggagg tctcctggcg    247620
     caatatcagc ggcccggtca cgatcgccga ttatgccggc cagaccgccc ggatcggcct    247680
     ggaagcctat attgcctacc tggcgctgat cagtatcagc ctgggcgtat tgaacctgct    247740
     gccgataccc atgttggacg gagggcatct gctgtactat ctcgtcgaaa ttgtaaaagg    247800
     cagtcccgtt tccgatcgct ggatagacat cggccagcga gccggcatcg gcctgctcgc    247860
     aggattgatg ggcttggcac tgttcaatga ttttgcgcgc ctgttcactt aggcacgaat    247920
     agaataaaat cccccgccat ttgcacgacc aaggataccc aaggatgtct ctacgccgga    247980
     tgtttcatca caaaaagggc gttataccgg gtttgttagc cgccgcgctt cttgcgcccg    248040
     cgctggccca tgccttcgag ccctttgtcg tgcgggatat ccgcgtggag ggcattcagc    248100
     gtaccgacgc cggcacggtg ttcggctacc tgccggtcaa ggtcggcgag aagttcaccg    248160
     acgaggaggc caccgaggcg gtgcgccgcc tgtacggcac gggctttttc agcgacgtgc    248220
     agatccagac cgacaacaac gtcgtcgtgg tcgtggtgca ggagcgcccc acgatcgcct    248280
     cgatcagttt caatggcatg cgcgagttcg actccaaggc catcaccaag tcgctggctc    248340
     aggtgggttt cggcgaaggg cgcatcttcg accagtccat gctcgaacgc gccgagtacg    248400
     agctgaaaga acagtacctg gccaagggca agtacggcgt cgaagtcacc gcgacggtca    248460
     cgccgctgcc gcgcaaccgg gtgggcgtca gtttcgacgt gttcgaaggc gaagtggcca    248520
     agatccgcga aatccgcgtg gtcggcagca aggctttctc ggaaggcgag ctgctcgacc    248580
     agttcgacct gaccacgccg ggctggctga cctggtacac caacaccgac aagtactcgc    248640
     gcgagaagct ggaaggcgac atcgagcggc tgcgctcgtt ctacctggac cagggctacc    248700
     tggagttcac ggtcgagccg ccccaggtca ccatctcgcc cgaccgcaag gacatctaca    248760
     tcaccatcac cgtgcacgag ggcgagccct acaaggtgcg cgaagtgaag ctggccggca    248820
     acctgatggg gctggacagc gaaatcaaca acctggtcga gatcaagtcg ggcgaggtat    248880
     tctccgccgc caaggccaac aactcggcca aggccattac cgactacctg ggcgacctgg    248940
     gctacgcatt cgccaacgtc aaccccaacc cgcagctcga ccgcgccaag cacgaggccg    249000
     acgtcacgtt ctacgtcgac ccgagccgcc gcgtctacgt gcgccgcatc cagatcggcg    249060
     gcaacacgcg cacccgcgac gaagtggtgc ggcgcgaaat gcgccagcag gaagccgcct    249120
     ggtacgacgc gggcgacatc aaggtgtcgc gcgaccgcgt cgaccgcctg ggctatttca    249180
     acgaggtcaa cgtcaagacc gatccggtgc cgggctcgcc cgaccaggtc gacgtcaacg    249240
     tggacgtcaa ggaaaagccc accggcatca tcaacctggg cgtgggctac ggttcgtccg    249300
     aaaaggcgat tctgtcggcc ggtatcagcg aagacaacgt cttcggcagc ggcaccaacc    249360
     tgacgctgca gttgaatacc agcaagacca accgcgccgt ggtgctttcg cacaccgatc    249420
     cgtatttcac caaggacggc atcagccgca ccacctcggc gtactaccgc gtcaccgagc    249480
     cgtgggacaa caacgacggc gactaccgcg tgaaggccat gggcctgggc atgaacttcg    249540
     gcgtgcccat ctccgagtac gaccggatct tcctgggcgg cacgttcgag cgcaaccaga    249600
     tcgatctgta caacaactcg ccgcaggcct atcgcgactt cgtcgaccag tacggcgatt    249660
     cgaccaacgc gctgatcttc aacaccggct ggtccaagga cacgcgcgac agcgcgctgg    249720
     cgccgaccaa gggcgcgtac acgcgcctga agggcgactt ctccacgatg gatctgaagt    249780
     actacctgct gacggcgcag cagcagtact acctgccgct gggccgcagc tacacgctgg    249840
     ccctgaacgg catgatcgac tacggccgca gctacggcgg cctggactac ccggtgatca    249900
     agaacgtgta cgccggcggc atcggcacgg tgcgcggcta cgagggcgcc tcgctgggcc    249960
     cgcgcgaccg cctcacgggc gactacatcg gcggttcgcg ccgcatggtg gccaacgccc    250020
     agctgtacct gccgttcccg ggcgcctcga aggaccgcac gctgcgctgg ttcgtgttca    250080
     ccgatgcggg ccaggtcgcg gccggcagcg gcatgtcgtg cacggccggc aagccgggca    250140
     gcgaagtgga ggatccgtgc ggctggcgct tctcggccgg tatcggcctg tcgtggcagt    250200
     cgccgctggg tccgctgcag ttgtcgtacg ctcgcccgct gaattcgaag tccggcgacg    250260
     acacgcaggc gttccagttc cagatcggca cgggtttctg atcgctgcgg ggaagcctgc    250320
     gagccgttac gcatgaaaac atgggaaatg gccggttgcc cggccgtccc gcagtttagt    250380
     ggcacaatat cgtctttgct ttacctcatt ggaaggtgag attttcatga tgtctgattt    250440
     cgcacttaat acctcgggtt ccaagcgcgc caaacgaggg gccggcaagc tgggcgtatc    250500
     gctggcgctg gcgggtgctt tgctgttcgg gtcgtccgcg gcggtcaccg cgcaggcgca    250560
     aggcaccaag atcggcttcg tgaacacgga gcggatcctg cgcgaatcgg gtccggccaa    250620
     ggcggcgcaa agcaagatcg aatccgaatt caagcgccgc gacgacgaac tgcagcgcct    250680
     gagcagcagc ctgcgctcgc aggccgagaa gttcgacaag gatgccccgg tgctgtccga    250740
     atcggaccgt gtcaagcgcc agcgcgagct gagcaacctc gacatggacc tgcagcgcaa    250800
     gcgccgcgag ttccaggagg atttcaaccg ccgccgcaac gaagagttct cgagcatcgt    250860
     caccaaggcc aatgacgcca tcaagcgcat tgccgagcaa gagaactacg acctcatcat    250920
     ccaggacgcc gttacggtca acccccgtat cgatatcacc gacaaggtga tccagagcct    250980
     gggccgataa gcacgcccat gccggttctg ctggaccctg aaaacgcgct cgctctcgat    251040
     gtcctgctgg ccggcaccga tgcccagggg ctggactggc acctgagcgc ccccgatgcc    251100
     gccgatctgc ccaggatccg cggcatcggc acgctgtctt cggcgggaaa cgaggaaatc    251160
     agcttcctgt ccaatccccg ctaccagaat cagctggcca ccacgcgcgc cgccgcggtc    251220
     atcgtgacgc ccgacgtcgc gcaggcccgg caggagcagg gcgcgtcggg ccacgtgctg    251280
     gtggtgtgca agcatcccta tctgctgtat gcgcgcctgg cgcagtggtt cgagcgcgcc    251340
     agccggccgg ccgggcccgc cggcgtgcat ccgtccgcgg tggtcgaccc cagcgccgag    251400
     atcgacgccg atgcgcgggt cggcgcgcag tgcgtcatcg aggcgggcgc ccgcatcggg    251460
     cgcggcgcca ggctggggcc gggctgtgtg atcggcgccg gctccacggt aggggccgac    251520
     agcctgctgc atccgcgcgt caccctgtac gcgggcgtgc acgtgggcga gcgggccatc    251580
     atccacagcg gcgccgtgct gggcgccgac ggtttcggtt tcgcgcccga tcccacgctg    251640
     ggccgcggcg cctggggcaa gatcccgcag ttgggcgggg tgagggtggg caacgatgtc    251700
     gaaatcggcg ccaacaccac catcgaccgc ggcgcgctgg acgacacgat cgtgggcgac    251760
     ggcgtgaagc tggacaacca gatcatggtg gcgcacaacg tgcggatcgg cgcgcatacc    251820
     gccattgccg cctgtgtcgg catcgccggc tcgaccacca tcggcgagcg atgcaccatc    251880
     ggcggcgcat cgatgctgtc cgggcacctg gccatcgccg acgacgtcaa tatctcgggc    251940
     ggcaccgcgg tgacatcgaa cattgcgaag gccggccgct acaccggcgt gtatccttac    252000
     gccgaacaca gcgaatggca gcgcaatgcc gcggtcattc agcaattggc gctgctgcgc    252060
     cggcgcttgc gggccctcga gcgggaataa tcccgcacgg cccgtgtgcc cggttggcgg    252120
     cgcattgcaa cataatctat ttttgctttg caggaaaaca aatggaactc gacatcaagg    252180
     ggatcatgga ccggctgccg catcgctacc cgatgctgct gatcgaccgt gtgctggaga    252240
     tggtgcccgg caaatccatc gttgccatca agaacgtctc gatcaacgag ccgtttttca    252300
     cgggccattt tccgcatcat ccggtcatgc cgggcgtgct gatcgtcgag gccatggcgc    252360
     aggcttcggc cctgttctcg ttcaccgacg agaacggcgg gctgaagtgc gacggcgcca    252420
     agaccgccta ctacctggtg ggcatcgacg gcgcgcggtt ccgtaaaccc gtggtgccgg    252480
     gcgaccagtt gcggctggaa gtcgaggccg agcgcctgtc gtgtaccatc tgcaagtacc    252540
     agggccgggc cctggtcgac ggccaactgg tcgccgaagc caagctgatg tgcgcgatcc    252600
     gtagcctgga agagtaaatg tcaggaaaca tccatcccac cgccgtggtc gatccggcgg    252660
     cacagatcga cagttcggtc gtgatcggcc catacagcgt ggtggggccg ggagtcagca    252720
     ttgccgcggg caccgaggtc ggcgcgcact gcgtgctcga cggcgtgacc agcatcgggc    252780
     gcgacaaccg cttctaccgc ttttgctcca tcggcggcat gccgcaggac aagaagtaca    252840
     gcggcgaacc gacgcgactg gtcatcggcg accgcaacac ggtgcgcgag ttcaccacgt    252900
     tcaacaccgg cacggtgcag gacggcggcg tgaccagcat cggcgacgac aactggatca    252960
     tggcctacgt gcacatcgcg cacgactgcc atatcggcaa caacaccatc ctggccaact    253020
     cggtgcagct gggcggccac gtgcaggtgg gcgactgggc catcgtgggc ggcctgaccg    253080
     gcgtgcacca gttcgccaag atcggcgcgc acagcatgac cggcagcaac agctcgctga    253140
     tgcaggatgc gcccccgttc gtgctggcgg cgggcaatcc gtgccggccc gtgggcgtca    253200
     atgtcgaagg cttgaagcgg cgcggtttct cggcggcggc catctcggcg ctgcgcgatg    253260
     cgtacaagtc gatctaccgg cgcggactgt cgctggacga ggcgcgcgcc gagctgcgcg    253320
     cgcgccagca ggccgagccg gatgtcgccg agcatctgca gaccatgctg gacttcctgg    253380
     acgcttcgac gcgcggcatc atccggccat gagcctgcgc ataggcatgg tcgccggcga    253440
     gccttcgggc gacctgctgg ccgggcgcat catcgccggc ctgcaggccc gggcacccgg    253500
     cgtgcactgc gccggcatag gcgggcccca gatggcggcg cgcggcttcg aggcctggca    253560
     ccccatgcat gcgctcacgg tgttcggcta catcgatgcg ttcaagcgga ttcccagcct    253620
     gctgtcgacc tacggcgacg tcaagcggcg cctgctggcc gagccgccgt cggtgttcgt    253680
     gggcatcgac gcgccggatt tcaacctgcg cctggagcac cagttgcgcc aggccggtac    253740
     ccccaccgtg catttcgtcg gtccctcgat ctgggcctgg cgctacgaac gcatcaacaa    253800
     gatccgcgcg gccgtctccc acatgctggt gctgtttccg ttcgaggaag cgctctatcg    253860
     caaggaagga atcccggtca cctatgtcgg ccatccgctg gccggggtga ttcccatgca    253920
     gcccgatcgc gccgcggccc gcgcgcggct gggcatcgac gccgacgcgc gggtgctggc    253980
     catcctgccg ggcagccgct cgtccgagat ccgcctgctt gcgccgcgtt tcctgcaggc    254040
     cgcggccgag ctggtccggc gcgatccacg cctgcagtgc gtggtgccca tggtcaaccc    254100
     gcagcggcgc gccgagttcg aggctatcgc ggcccagcat ccggtgccgg gcctgcgttg    254160
     cgtgaccgcc gccgaggggc agggcgagac gccggtggcc tggtccgtca tggaggcgag    254220
     caacgccgtc ctggtggcca gcggcacggc cacgctggaa acggcgctgt acaagcggcc    254280
     catggtcatt tcgtacgtgc tgtcgccgtg gatgcggcgc atcatggcct ggaaatccgg    254340
     gcagcaacgt ccctacctgc cgtgggtggg gctgcccaat gtgctgctgc gcgatttcgc    254400
     cgtgccggag ctgctgcagg acgaggccac gccggccgcg ctggccgagg cgacctggca    254460
     ggcgctgacc gacgaggccg gcgcggcgcg catcgaggcg cgctttaccg ccttgcacca    254520
     ggacttgctg cgcgatacgc cggcgctggc cgcccaggcg attctggagg tggccgatgg    254580
     agcagcctga cctgttcggc acgctggcgc cgctgcccgc catcattgcc ggcgtcgacg    254640
     aagccggtcg cggaccgctg gccggcgcgg tctatgcggc cgccgtcatc ctggacccgg    254700
     accggccggt cgacggcctg gccgactcca aggtgctcaa ggccgagcag cgcgaagcgc    254760
     tggcggtgca gatccgcgcc caggcgctgg cctggttcgt ggccagcgcc agcgtgcagg    254820
     aaatcgacag cctgaacatc ctgcgcgcca ccatgctggc gatgcagcgc gccgtggccg    254880
     gcctggccat ggcgccggaa ctggccatgg tcgacggcaa ccaggcgccc aagctgcgct    254940
     gcgccgtgca gaccgtgatc aagggcgatg cgctggtgcc ggcgatctcc gccgcgtcca    255000
     tcctggccaa gacggcgcgc gacgccgacc tgctgcgcct gcatgccttg tatccccaat    255060
     acggcttcga ccagcacaag ggctacggca cgccgcagca cctgtccttg ctgcgcgagc    255120
     acggcccgtg ccccgaacac cggcgcagct tcgcgccgat caaggcgtac ggcgcgccat    255180
     gaagcacctg agttcgcgcg acaacccggc ggtcaaggcg ttgcacaagc tggccgccgg    255240
     cggcggccgc cgcgacggac ggatcctgct cgacggcgtg catctgtgcc aggcctggct    255300
     ggcgcaccaa ggcacgccgc tgcaggcgct gttcgatgtc gcgcggctgg accatcccga    255360
     gatccgcgcc ctggccggcc aggtgccgcc gcagcattgc ctggcgctgg attcgcgcct    255420
     gctgcagggg ctggccagcg tcgagagcgg ccagggcgtg gtgttcgtgg cgcgcgcgcc    255480
     cgaacccgcg ctgcctgaac gcatcgacga gaactgcgtg ctgttcgacc ggatccagga    255540
     cccgggcaat gtcggcacct tgctgcggac ctgcgcggcg gccggcgtgc gccgggtgct    255600
     gctggcggcc ggcacggccg cggcatggtc gcccaaggtg ttgcgcagcg gccagggcgc    255660
     gcatttcgcg ctgcatatcc acgaacacct ggacctggag gcggtgctgc cgcggctgga    255720
     cgtgccgctg gtggccacga ccctggcgcg gtccggctcg ctctacgaca cggacctgcc    255780
     ggcgcgctgc gcctgggtgt tcggccacga agggcagggc gtggccgagg cgctgctgcg    255840
     ggcggccgcg ctgcgcgtgc acattccgca cgagtcggcg gcggtcgagt cgctcaatgt    255900
     gggcgccgcc gccgccatct gcctgttcga gcagcgccgc cagcgccgct gacccgcccg    255960
     cgcctagacg cgctccagtc cgacctcctg cagcaccgtg gtggcgattt cctcgatcga    256020
     cttggtggtc gtcgacagcc acgaaatgcc ctcgcggcgc atcatgcgct cggcctcggc    256080
     cacttcgtag cggcattgct ccaggcgcgc gtaatggctg ttggggcggc gctcgttgcg    256140
     cacctcggcc agccgctcgg gctggatcga caggccgaac agcttgccgc ggtacggcgc    256200
     gatggtcttg ggcagcgcgc cgcgctcgaa atcgtccggg gtgagcggga aattggcggc    256260
     cttgacggcg tactgcatgg ccagatagag gctggtcggg gtcttgccgc agcgcgacac    256320
     gcccaccagg atcacgtcgg cctggtccag ctggttgacg aactggccgt cgtcgtgcgc    256380
     caggctgaag ttgatggcgt cgatccggtt gcggtatttc tcggagttgg ccgccatgtg    256440
     cgagcgtccg atggagtggc tggacttcaa gcccagggcc tgctcgatgt ggctgacgaa    256500
     tgttccaaaa agatcgagga aaacgccgtt cgactggcga accagcgcca ggatctcggg    256560
     gttgaccagg gtgctgaaga caatcggcgg cacgccggcc tcgagcgcgt tgcggttgat    256620
     gcgcgccacc acctcgcgcg ccttgtccag cgtatcgatg aagggcaggc gcacgggctt    256680
     gaaattgacc tcgtcgaact gcgatagcac ggagtggctg aaggtctcgg cggtgatgcc    256740
     ggtgctgtcc gaaacgatgt agaccgcacg ttcaataggg gtagaagtca tatgtaaaaa    256800
     aattccaacc aggtaccggg aggcttgtgc ccaagcgagt acaatcgccc cctaataagt    256860
     caccccaagg ggcggtccaa ggccagtttg gtcagcgcag ttgagctgca ttgaccaaac    256920
     tcgctttcat tccattgtaa aaggtgactt caatgtcgta tgtggtttcg ttcgagcagc    256980
     tccgcatgac ggacgtggac tcggtaggag gcaagaacgc atcattaggt gaaatgatca    257040
     gtcagctggc cggcgcgggg gtacgcgtgc ccggcggctt tgccacgacc gcccaggcct    257100
     tccgggactt cctgcaggct tccggtctgg acaagcgcat cgctgaccgt ctcgccaccc    257160
     tcaaccccga agacgtacgc gagctggcca gcgccggcgc gcagatccgt caatgggtga    257220
     tcgatgcgcc tttctcgcct gaattcgaac aggcgatccg caccgcattc gccgagctcg    257280
     acgccgacgg caagggctcg ttcgcggtgc gctcctcggc gaccgccgaa gacctgcccg    257340
     acgcttcgtt cgccggccag caggagacct tcctcaacgt ggtgggcgtc gacgacgtgc    257400
     tcgacaagat ccgccacgtt ttcgcctcgc tgtacaacga ccgcgccatt tcgtatcgcg    257460
     tgcacaaggg ctacgcccac gccgaggtcg cgctgtcggc cggcatccag cgcatggtcc    257520
     gttccgacaa gggcagcgcc ggcgtgatgt tcaccatcga caccgagtcg ggcttccagg    257580
     acgtggtgtt catcacctcg tcgtacggcc tgggcgagac ggtggtgcag ggcgccgtca    257640
     acccggacga gttctacgtc ttcaagccgt cgctcgaacg cggcaactat cccatcgtca    257700
     gccgccgcat cggctccaag ctgatcaaga tggaattcga ccccgagcgt cccgaaggcc    257760
     gcgccgtgcg caccgtcgat gtgccggtgt ccgaacgcaa ccgctattcg ctgaccgacg    257820
     acgaagtcat cgagctggcg cgctacgcgg tcatcatcga gaagcactac cagcgtccga    257880
     tggacatcga gtggggccgc gatggcgtgg atggcaagat ctacatcctg caggcgcgtc    257940
     cggaaacggt gaaatcgcag cagggcgtca atgacgtgca gcagcgctac cgcctcaagg    258000
     ccaccggcca ggtgctggtg accggccgcg ccatcggcca gaagatcggc gcaggcaagg    258060
     tgcgcgtggt ggccgatatc tccgaaatgg acaaggtcca ggccggcgac gtgctggtca    258120
     ccgacatgac cgatcccaac tgggagccgg tcatgaagcg tgcctcggcg atcatcacca    258180
     accgcggcgg acgcacctgc cacgcggcca tcatcgcgcg cgaactgggc attccggccg    258240
     tggtcggctg cggcgacgcg accgacctgc tcaaggacgg ccaggccgtg acggcctcgt    258300
     gcgccgaggg cgacgaaggc cgtatctacg acggcctgat cgagaccgag gtcgaggaag    258360
     tgcgccgcgg cgagatgcct ccgatcgacg tcaagatcat gatgaacgtg ggcaatccgc    258420
     agctggcgtt cgacttcgcg cagatcccca acgccggcgt gggcctggcc cgcctggaat    258480
     tcatcatcaa caacaacatc ggcatccacc ccaaggcggt gctggattat ccgaacgtcg    258540
     acggcgagct gaagaaggcg gtcgagtcgg ccgcccgcgg ccacgccagc ccgcgcgcct    258600
     tcttcgtcga gaagctggcc gaaggcgtgg cgaccatcgg cgcggcgttc tggcccaagc    258660
     cggtgatcgt gcgcatgtcg gacttcaagt ccaacgagta ccgcaagctg gtgggcggtt    258720
     cgcgctacga gcccgaggaa gagaacccca tgctgggctt tcgcggggcg tcgcgctata    258780
     tcgccgccga tttcgaggag tgcttccgca tggaatgcga ggcgctcaag aaagtgcgcg    258840
     acgaaatggg cctgaccaac gtcgagatca tggtgccgtt cgtgcgcacc ctgggccagg    258900
     ccaggaaggt cgtcgagctg ctggccgccc acggcctggc gcgcggcgag aacggcctga    258960
     agctgatcat gatgtgcgag gtgccgtcca acgccatcct ggccgaacag ttcctcgagt    259020
     acttcgacgg cttctccatc ggttcgaacg acatgaccca gctgacgctg ggactggacc    259080
     gcgactccgg catggagctg ctggcggccg acttcgacga acgcgacgat gcggtgaagt    259140
     tcatgctgcg ccgcgcgatc aaggcgtgcc tggcggccaa caagtacgtc ggcatctgcg    259200
     gacaggggcc cagcgaccac cccgatttcg cgcagtggct caaggacgag ggcatcctgt    259260
     ccatgtccct gaacccggat acggtggtgg agacctggca gcaactggcc aagtaagcgc    259320
     ccggcagcag gaaaaagcct cgcccttgcg gcgaggcttt ttttcgccgg gcggcgcggg    259380
     cggctaggcg cagcaggcca ggaagcggcg caccagcgag gcggcaagcg gcgtggggcc    259440
     ggccgcgcgc gccaggcctt cgacgtccag cccgtgggcg gcgtagagcg ccgcgtggtg    259500
     gcgcagatgg gcggcgacga acccgggcgt gaactcgggg tggaactggg ctgtatagat    259560
     gcgcggggcc aggcgcagca tctggtgcgc gtcctgggcc gagcgcgcca gcacggcggc    259620
     gcggcgagca cggcctgctc gtgcatcatc tgggcgtcga aggcggccgg caggccggcc    259680
     agcaaggggt ccgtggcggc cgcgggcagc aattcgaccg gcagggtgcc cagttcgcgg    259740
     ccggccgggt tgtcgcccac cacgccgccc agcgcgtggg ccagcaactg gtgcccgtag    259800
     cagatgccga acatgggcag gccggcgccg gcggcctggc gcagccagtc ggcggccgcc    259860
     tcgctccagg gcgcgcggtc ggtcaccatg gccggcgagc cggtgatcag cgcggcccgg    259920
     tacgcgccgg gcgcgcgcgg cgcctcgtcc ttgtaggagg ccaccacgtg cgtgccggcg    259980
     gcatccagcc cggcggcctg gcgcagcatc tcggcgtagc tgccgtgcgc ggcgcgcagg    260040
     gcggtggcgg gattgccggt atgcaggatc agaacgggca gggcggcggt catggcgggg    260100
     gatcgggccg gtggcgggag agggggaacg ccatgataaa ggcacggcgt gacaggcgcg    260160
     agtggcggga aatacgtaca atcgttgcca tatattgaaa ctcgggacgg aacgctatgt    260220
     ggatttggtt cggtttggcc gccgttgccc tgatcggcga ggtgggctcc ggtacgtttt    260280
     acctgctgct ggtggcgctg ggcctggccg ccggcggtat cgcggcctgg ctgggggcgg    260340
     acacctggca tggcaactgg tggcgtgcgg cctggtggcg ctgctggggc tgctggcgct    260400
     gcgccgcacc ggcgtgctga aaaagcgcga ggtcaacgcc gcgcgcaacg ccgacgtcaa    260460
     cctggatatc ggccagtccg tcatggtgga tgcgtggtcc gacgcgggca cgacccaggt    260520
     gtattaccgg ggcgcgcaat ggcaggccga gctcgcccac ggccagccgc gccaggccgg    260580
     ccgccacatc atcgccgaaa tacgcggcac gcgcctggtg ctggcgcccg cgccggccgc    260640
     gtaaccatga ccttgcccgc cggcgacggc aggcttcact agcagagggt atttatcatg    260700
     atcgacgttt ccactgtggt cctgattgtc atcgtcatcc tggcgctgat gatcgtggtc    260760
     aaggccatcg ccatcgtgcc gcagcagcat gcctgggtgg tggagcggct gggcaagttc    260820
     gaccgcgtgc tgtcgccggg cgccggcttc gtgattccct tcatcgaacg ggtgtcgtac    260880
     aagcattcgc tcaaggaaat cccgctcgac gtgccgagcc aggtctgcat cacgcgcgac    260940
     aacacgcagt tgcaggtcga cggcgtgctg tacttccagg tcaccgatcc gatgcgcgct    261000
     tcgtacggct cgtcgaacta catttccgcc atcacccagc tggcgcagac gacgctgcgc    261060
     tcggtgatcg gcaagctgga gctggaccgc acgttcgagg agcgcgagtt catcaacagc    261120
     accatcgtcg cgtcgctgga cgaggccgcg ctgaactggg gcgtgaaggt gctgcgctac    261180
     gagatcaagg atttgacgcc gcccaacgag atcctgcgcg cgatgcaggc gcagattacc    261240
     gccgagcgcg agaagcgcgc cctgatcgcg gcttccgagg ggcgccgcca ggagcagatc    261300
     aacatcgcca ccggcgagcg cgaggccgcc atcgcgcgct ccgaaggcga gaagcaggcg    261360
     cagatcaacc aggcccaggg cgaggccgcg gccgtgctgg ccatcgccga ggcgaccgcc    261420
     aaggcgatcg agcaggtggg cgaggccgtg cgccagcccg gcggcatgga agccgtcaac    261480
     ctcaaggtcg ccgaacgcta cgtggatgcc ttcagcaatg tggccaagga gggcaatacg    261540
     ctcatcctgc cgtccaacct gtccgatgtg ggcgggctca tcgcctcggc catgacgatc    261600
     gtcaagtcga ccaagagcgc gtgaggttcg acccgggcgc gccggccgcg gcgcgtcctt    261660
     tcgcgtccgc gccatagcgt tccgccctca tgctggctcc ggtcaccctg ctggtgattt    261720
     ccaccctgtc gagcctggtg acgctgggag tcctgggttc gctgctgcgc agcgccatcg    261780
     cgggcatccg cgagctgatg tgggccaacg tgctggtgct gtgctcgctg ctgctgttca    261840
     cgctgcaggc caaccccgcc atgccgccgt ggctggcgat ccaggcgccc aacgtgctga    261900
     tctcgtccgg cgtcgtgctg ttttgcgccg gcgtcttccg cttcatgcaa cagcgcccgc    261960
     cgtggcgcct gctgctggga ctggcgctgt cgatcggcgc caacatctgg ttccactatg    262020
     tcgacccctc ggtcaacgcc cgggtggtcg cggcctcggg cctgcatgcg ctgctgtggg    262080
     gcggcagcgc atggaccatc tatcgcaaca tgccgctgcg gcggtcgcgc tacagctact    262140
     ggttcgccgg ggtgaccgcc accgtggccg ccctgggcca tgccttgcgc acggccgtct    262200
     acggcctgca gatcgagcag acccaggggc tgttgcagtc atcggtatga aacgtggcct    262260
     ttctggcgat cggcgtgctg gtcatgccca gcatgatgct gggcatgatc atgatgatcc    262320
     acgaccgcat gctggccgag cgcgagcgcg aggccaacca ggacttcctg accggcctgc    262380
     tgtcgcgcaa ggcatggtgg cgcgagggcg agcgcctgtg cgcgcgcgtt gcgcacgggc    262440
     cggccgctga ccctgctggc gctggacatc gaccgcttca agcaggtcaa tgaccagcac    262500
     ggccacgccg ccggcgatgt ggtgctgcgg catttcggtt cgctggccac cgcgctgctg    262560
     cgcagcggcg atgtcatcgg ccggctgggc ggcgaggaat tcgtggcctt gttgcccgat    262620
     accgacggcg acacgggcgt gagcgtggcc gagcgcttgc tggccagtgt gcgcgccacg    262680
     ccgtgctcgc acggcggcaa ggcgctgacc tacacgttca gcggcggggt ggcgcaatac    262740
     cgcgcgggcg atacgctgcc ggtgctggtg gagcgggcgg acgcggcgtt gtacgcggcc    262800
     aagcgggccg gccgcgaccg catcaggaat cgcgttggtt gacgcgcgtg tcgtgcttca    262860
     ggacacgttc cttttcgcgc tgccagtcct tttcgcgggc ggtgtcgcgc ttgtcgtaca    262920
     gcttcttgcc ccggcccagc gcgaagtcca gcttgatgcg gccgttcttg tagtgcaggt    262980
     tgagcggaac cagcgtgtag ccgcgctgtt cgaccttgcc gatcagcttg cggatttcct    263040
     cggccttgag cagcagcttg cgggtgcgcg tggcgtcggg gcggatgtgg gtggacgcgg    263100
     taggcagcgg gctgacgtgc atgcccagca ggtagatttc gccatcgcgc acgatgacgt    263160
     agctttcctt caagtgcacg cggccgtcgc ggatagcctt cacttcccat ccttccagga    263220
     ccatgccagc ttcgtagcgg tcctcgatga aatagtcgtg cgtggccttg cggttatcga    263280
     taatactcat ggaggcaatg gtaagggcgc gcggtgccgg taaaatccta gcattctagc    263340
     catttgcgat agctgatgca caaagtccaa cgatccgtcc tggttccgta ttcggccgcc    263400
     cagatgttcg acctggtggc cgatgtcgag aaataccccg aattcatgcc gtggtgcggc    263460
     ggcgccgagg tgcactcgcg ctccgagcac ggcatgcagg cctcgatcct gatcagcttc    263520
     gcgggcctga aacagcgctt cagcacgcgc aacacgcacg attatccgca gcgcatcgat    263580
     ctcgagctgg tcgacgggcc tttctcgatg ctggtgggcc attgggtatt ccagccgctg    263640
     gccgaggatg cctgcaaggt gctgttcacg ctggagtacg cgttctccaa ccgcgccctc    263700
     gaaatggtgg tgggcccggt gttcaaccgt atcgcggcca gcttcatcga ttcgttcacc    263760
     aagcgcgcgc aggccaagta tggcgaatga cacgccggcg cccgccggtt cgctgcgcgt    263820
     gacggtctgc catgcatgcc cggacggggc atggcagcgc gccgtcacgc tgccggccgg    263880
     cgccacggtg gccgacgcgg tggccgccag cggctttgcc gcggcgcacc gcggccagga    263940
     tccctgggcg catggcgtgg gggtgttcgg caaggcgcag gcggctgacg cgccgctggc    264000
     cgatggcgac cgggtggaaa tctaccgggg cctcagcttc gatcccaagg agtcgcgccg    264060
     gcggcgggcc gagcaccggc gtgcgctggc cgcgcgcggc ggcaaggcgc gtccggccgg    264120
     cctgctgtaa ggccgcgggc ttcccggggc gattgcggcg tccaggcgcc cacattgtcg    264180
     ccggcaagac agtgcgcggc cgtttcgggc gtaacatact cgccaacgac ttacgtttac    264240
     gttaacgtca tgtcgagcgg ccgccggcga ttcacaagat cgccacgcag ccgcatgacc    264300
     ataccgagaa catctggaga ctggccgtgg atttcgaact caccgacgag cagcgcgcgt    264360
     tcgcgcaggc cgcgcgcgac tatgcacagg gcgaactggc cccgcacgcg gcgcgctggg    264420
     acgccgaggg cattttcccg cgcgaggcct tcgcccgcgc cggcgaactg ggcttttgcg    264480
     ccatctatgc cagcgaggag atcggcggac tggggctgcc ccggctcgac gccacgctgg    264540
     tcttcgagga gatggcggcc gtggacccct cgaccacggc gttcctgacg atccacaaca    264600
     tggccacctg gatggtgggg caatgggccc ggccggcggt gcgcgagcag tgggggccgc    264660
     tgctggccag cggcgagaag ctggcgtcgt actgcctgac cgaacctaat gcgggctcgg    264720
     atgccggctc gctggccacg cgggccgagc gccagggcga tgattacgtg ctcaacggcg    264780
     ccaaggcctt catttcgggc ggcggcgata ccgacctgct ggtggtgatg gcgcgcaccg    264840
     gcggcgacgg gcccggcggg gtcagcgcct ttgccgtgcc cgccgacgcc gcgggcatcg    264900
     cctatggccg caaggaagag aagatgggct ggaacagcca gtccacgcgg cccatcacgt    264960
     tcgagcaggt gcgcgtgccc gcctcgcaca tgctgggcga gcccggcgag ggcttcaaga    265020
     tcgccatgaa gggcctggac ggcgggcgca tcaacatcgg cacctgctcg gtcggcgcgg    265080
     cccagggcgc catggacgcg gcgcgccgct acatggacga gcggcgccag ttcaaccgca    265140
     agctggcgca gttccaggcg ctgcagttca agctggccga catggccacg cacctggtgg    265200
     cggcgcgcca gatggtgcgg ctggccgcct gcaagctgga cgccggctcg gccgacgcca    265260
     gcacctattg cgccatggcc aagcgcttcg ccaccgacat gggtttccag atctgcctgg    265320
     acgcgcagca gatccatggc ggatatgggt atttgcgcga ctatccgctc gagcgcctgg    265380
     tgcgcgatac tcgcgtgcac cagatcctgg agggcacgaa cgagatcatg cgggtcatcg    265440
     tcgcccgaca attgcttgaa aaaggagccg atatccgatg aatgcgcccg tgctgtttga    265500
     agaacgaatt gccgacaatg gcgtgcgcct gggcgtggcc acgctcaatg cgccgcagac    265560
     cctcaatggc ctgtcgctcg agatggtcga gctgctcgac gcgcgcctgc tcgcctgggc    265620
     cgccgacgcg gccgtggcga tggtcatcct gcagggggcg ggcgagaagg cgttctgcgc    265680
     cggcggcgac ctgcacgggc tgtaccgcag catgcgcgag aacaccggcg gcgatccctg    265740
     ggccaatacc catgcgcgcc gcttcttcga gcacgagtac cggctggact acctgatcca    265800
     cacctacccc aagccggtgc tgtgctgggg ccatggcatc gtcatgggcg gcggcgtggg    265860
     cctgatgatg ggcgccagcc accgcgtggt cagcgagacc acgcgcatgg ccatgcccga    265920
     gatcaccatc gggctgtttc ccgacgtggg cggcagctgg ctgctcaacc gcatgccggg    265980
     gcgcaccggg ctgttcctgg cgctgaccgg cgcgcacgtg aacgcctccg acgccttctt    266040
     cgccgggctg gccgatttcc ggctcgattc ggcgcagtgg ccggatttct gcgcctccct    266100
     gctgagcctg ccgtgggccg gccagccggg cgggcccggc accggcaacg cggcgccgcg    266160
     ctcgatcaac gacggcctgc tgcgccaggc gctgctggcg cacgaaccgg ccacgcagct    266220
     ggagcccggc cccctgcgcc agcattcgtt cctggtgaac agcctgtgca gcggcaagcg    266280
     gctggacgac atctacgccg agatcgccga gctcaaggat cacgccgatc cctggctggc    266340
     cagggccgcg gccaccatgc tggccggttc gcccggttcg gcgcggctgg cgtatgccct    266400
     gcagcagcat acgcggctgc gttcgctggc cgatgtgttc cgcatcgagt acgtggccgc    266460
     gctggcctgc gcggcgcacg gcgatttcgc cgaaggcatc cgtgcgctgc tggtcgacaa    266520
     ggacaggcag ccgcgctgga atcccgccac cctgtccgag gccagcgacg actgggtgcg    266580
     caagttcttt gacgagccct ggccggccgg ccagccccac ccgctggcgg acctgggcca    266640
     cggcgcctag gcgcgccggt tcgctcgttc ccctatgacg cacaggagac aaccatcatg    266700
     agcagcattg cattcatcgg tctgggcaac atgggcgcgc ccatggcgct gaacctggtc    266760
     aaggcgggcc acgacctgac ggtattcgac ctggtgccgg cggcggtcaa gacgctgacc    266820
     gacgccggcg cgcgcgcggc cggttcggcc gccgaggcgg tgcagggcgc cgaactcgtc    266880
     atttccatgc tgccggccag caagcatgtc gaaggcctgt acctgggcca ggacctgctg    266940
     gccagcatcg gcgccagcgc gctggtcatc gagtgcagca ccatcgcgcc cgattcggcg    267000
     cgcaaggtgg ccgccgccgc gcaggcgcgc ggcatcgcca tgatcgatgc gccggtatcc    267060
     ggcggcacgg gcggcgccgc ggccggcacg ctgacgttca tcgtcggggg cgaggcgccg    267120
     gcgctggagc gcgcgcggcc ggtactggcc agcatgggca agaacatctt ccatgccggc    267180
     ggcgccggcg ccgggcaggt ggccaagatc tgcaacaaca tgctgctggg catcctcatg    267240
     gccggtacgt ccgaggcgct ggcgctgggc gtggccaacg gcctggaccc caaggtgctg    267300
     tcggacatca tcagcaagag ctcgggccgc aactgggcca ccgagctcta caacccctgg    267360
     ccgggcgtca tggagcatgc gccggcgtcc aagggctatg ccgggggctt cggcgtggac    267420
     ctgatgctca aggacctggg gctggcggcc gaggcggcgc tgggcacgcg ctcgtccatc    267480
     ctgctgggag agctggcgcg caacctgtat tcgctgcaca gccagggcgg cagcggcggg    267540
     ctggacttct ccagcatcgt caatctgtat tcgccgggcg agcgcaactg atcccgccct    267600
     ggccgggcgg ccagggccat tccgcgagag gcttgcatgc ctgataccga ggctttcgag    267660
     gccgcgcgcc agcgcgtgca cgacaacttt gcccgccaga gcgtcatggc gctgatcggc    267720
     gcgcgcctgg gcgccgtcga acctggcgag gtcgagatcg cgttgccgta tcgcgccgac    267780
     ctgtgccagc agaacggttt cctgcatgcc ggcatttcca ccaccattgc cgacagcgcg    267840
     gggggctatg ccgcctatac gctgttcgga cccggcgaag acgtgctgac atcggagttc    267900
     aagatgaact tcctggcgcc ggccgatggc gagcactttg tcgccagcgg caaggtgcta    267960
     aagcccggca ggcggctgag catctgccag gtggagctgc gcgcctgccg cggcgagcgc    268020
     agcacgctgt gcctggtggg gctgatgacc gcggtgcggg tgacgccgcg ttgaacggcg    268080
     cggcggccta tacttggcgc gccaatcccg gccgccacga gtgacgcctg cccatgcccg    268140
     cccgatccca ccatcgcatc ttccgttccg gctggctgcg cgccgcggtg ctgggcgcca    268200
     atgacggcat cgtctccacc gccagcctga tcgccggggt ggcggccgcg caagccagcc    268260
     atgccgccat cctgacttcg ggcctggccg gcctggtggc cggagcgctg tccatggccg    268320
     ccggcgagta cgtatcggtg aagtcccagg ccgatatcga ggcggccgat ctgcggctgg    268380
     aacagagttc gctcaagcgc aattcgcgcg aagagctgga agaactgacc ggcatctatg    268440
     tcgagcgcgg cctgtcgccc gacctggcgg ggcaggtggc ccggcagctg acgcgccaca    268500
     acgccctgga cgcgcatgcg cgcgacgagc tgggcatctc ggtgcacaac cgcgcccagc    268560
     cggtgcaggc ggcgctggcc tcggccgcgt cgttcgccgt cggggcggcg ctgccgctgg    268620
     ccatcgccat ggcggcgccg ctggcgcaac tgatgccggt ggtgatcgcc gggtcggtgg    268680
     ccgggctggg catactgggc gcggtggccg cgcgcgccgg cggcgcgccg gtggggccgg    268740
     ccgccgtgcg ggtggtgttg ctgggggcgg ccgccatggc cctgaccgcg ggcgtggggg    268800
     ccttgttcgg cgtggcggta tagccggaca gcctagccgg cggcgttgcc ggccagttcg    268860
     tagggcaggg gcgccagggc gatgcgcggg ccctgcgcgc tgagcagccg caggtcgccg    268920
     tcgggcaggc tggccagggt ggtttcgaac agcagcgcga gctgcccgtc gctgcgcgcg    268980
     gcgtcgacca cgcgtccgca gggttcgtcc ggccgcgcgc tgtcgtagat gtcctggccg    269040
     gccaaggggt cgggcaggtc ggccggggcc tcggcgatca cgccatgggc catgcggcgc    269100
     ttgaccgtgc cgcggtaatg gctgcgcgcc accacctcct ggcccggata gcagcccttg    269160
     gtgaagctga cgccgccgat gaggtcgaga ttgacggtct gcggaatgaa gacgtcctgc    269220
     gtggccgcgc cgatccaggg caggccggcg gccaggtcgg cggcctgcca ggcggactcg    269280
     gacgcgcggc ccaggtgcgc ggccagcgcg ccggcccgct ccagctgcgc ttcggtggcg    269340
     atccaccacc agcgcggctg cgcatcggcc gagggcgcgc cgatccaggt gccggtgggc    269400
     aattcggcgc gctgccaggg cgcggcgggc agggcgccgc cggcggcgtc ctgcagcgcg    269460
     gccagcgcgg cgggggcgca ttgcacgccc gccgcccacg ccggcaccgg agccagccgc    269520
     gccttggcgc gcaatacgaa catggacagg cgcttgagca ccgcctcggc gacgtcggcg    269580
     cgcaccagcg cctgccatac cggggcgctt tcgtcggccg cggcggcccg ccacatgacc    269640
     agcgtggcca gcaggcggcc cttggcggtg cagtagccgg ccaggcgggc gtggtcggcg    269700
     ggctggccgg tgacgtcctg ggtcagttgc ccatgcagga aagccagcgc gtcggcgccg    269760
     gccgcgccga tgacgcgcag gctggccagc ggcgcgcatt gcgccgaacc atcggcgcgc    269820
     gcgggaatcg aatcgtagaa agcgtgcatg gcggaattct aaaaggggcg gatgacgcgc    269880
     acgcgcgaac cggcgtgggc cgcgcggcgt cgaacaaacc ccgatgatac ccggggcggc    269940
     ccgcgccggc ccctatgacc cggctgaccg cgggggcgtg ggcgggccag ccgccgcgcc    270000
     cgcgatccat taaacttgcg cacacttatg agaaaacgca ttcgtttcta ttttctgctg    270060
     ctcgtgctgg tggcgctgct cggcgccgcg ctggcggccg gcggcgcctg gacctggatg    270120
     cacaggccgg tggcgctcaa gtccgaccgc atcgatttcg tggtggatcc gggcagcacg    270180
     ccgcgcgcca tcgcgcgcac cctcaaccag gccggcgtgg cggtctggga gccgggcttc    270240
     gtctggatgg cgcgcctgtc cgagctggac aagcagatca aggccggcgg ctaccaggcc    270300
     atcgacggcg actcgccctg gcagttgctg caacggctgg cgcgcggcga catgagccag    270360
     cgccagatca ctttcctgga gggctggatg ttccggcaga tgcgccaggc gctgcgcgaa    270420
     catcccgacg tcaagcagac cctgggcgag accagcgacg aggccctgat ggaaaggctg    270480
     ggctcgacgg tgacccatcc cgagggcatg ttctttcccg acacctatgt gttcactccg    270540
     ggcagcacgg atttcgacat cctgcggcgc gcctaccagg aagggcagcg tatcctggag    270600
     tcgacctggg ccaagcgcca ggatgggctg ccggtgggca cgccctacga agcgctgatc    270660
     ctggcctcca tcgtcgagaa ggagaccggc cacgggccgg agcgcgcgcg cgtggccggg    270720
     gtgttcgcca accggctgcg catcggcatg ctgctgcaga ccgatccgac cgtgatctac    270780
     ggcatgggcg aggcctacca gggccgtatc cgcaagcgcg acctgcagac cgacacgcca    270840
     tggaacacct acacccgtcc gggcctgccg cccacgccca tcgccgcgcc cgggcgcgcc    270900
     gcgctgctgg cggcggtgca gcccgaacgc cacaaatacc tgttcttcgt gtcgcgcggc    270960
     aacggcacca gcgagttctc ggtcaacctg aacgaccaca accgcaatgt gtcgcgctac    271020
     atattgggac aagggcaacc gcaacaagga tcgcagcaat gaccccgcgt ggacgtttca    271080
     ttacgctgga gggcgtcgat ggcgccggca agagcaccca taccgcatgg atggtgcagg    271140
     cgctgcgcga cctgggcctg acggtgctgg ccacccggga gcccggcggg acgccggtgg    271200
     gcgagaagct gcgcgagctg ctgctgtccg aacccatggc cctggaaacc gagaccttgc    271260
     tcatgttcgc ggcgcgctgc gagcacgtgc gcgaagtgat cgcgccggcg ctggcgcgcg    271320
     gcgagtgggt ggtgtgcgac cgcttcaccg atgcgtccta tgcctatcag ggcggcggac    271380
     gccaattggg cgcggcgcgc gtggcggcgc tggagcagtg ggtgcatccc gatctgcagc    271440
     ccgaccgcac ctggctgttc gacgtgccgc tggacgtggc gcgcgcccgg ctggcgcgct    271500
     cgcgccagct cgaccgcttc gagcgcgagg aggatgcctt cttcgaacgc acccgcgccg    271560
     cctaccacga gcgggcgcgc agctcggatg gacgtatccg catcatcgat tcgagccggc    271620
     cgctcgaggt cgtgcgcgcg cagctcgaca gcgaggtgcg cgagctggtg gcgcaagcgg    271680
     catgagcctc ggtcgcttcc tgccctggca gacggagatc gcccgctcct ggctgagcgg    271740
     gcgcgaccgc ttcgcgcatg cctggctgat ccatggcaat ggcggcatcg gcaagctgga    271800
     ctttgcggcg gccgcggcgg ccagcctgct gtgcgagtcg ccgcgccagg gcctggcgtg    271860
     cggcgagtgc gcggcctgcg cctgggtggc cagcggcaac catccggatc tgcggcgcat    271920
     ccgtccggag gcggtcgcgc tggaagaggg cgccgaccag gccgaaggcg ccgaggaggc    271980
     cgaggccggt tccggcggcg cggcggccaa gcgcgcgccg tccaaggaca tccgcatcga    272040
     ccagatccgc gcgctcgaac cgtggttcaa caccgccacg caccggggcg gctggcgcgt    272100
     ggcgctgctg tatccggcgc atgcgctgaa cgtgatatcg gccaacgcct tgctgaaggt    272160
     gctggaggag ccgcccgcgc atacggtgtt cctgctggtg gccgatgcgc ccgaccgcct    272220
     gctgcccacg ctggtgtcgc gctgccggcg cctgccgctg cccacgccgt cggccgggca    272280
     ggcgctgcaa tggctgggcg agcagggcgt ggagccggcg gccgactggc tggctgccgc    272340
     cggcggcgcg ccgctggcgg cgcagcgcct ggcggcccgg ggcgatgcgc cgtgcccggc    272400
     ctggctggcg caactggtgc agcccttggc cgcgggcaag gcgcccgatg tgggcacgct    272460
     gaccgaaaac ctggaaaagg tggcggcggc cgagtggatc gacgccctgc agcgcctgtt    272520
     caccgacctg acgctggccg cccatggcgc ggccagccgc tactatccct cgctggccga    272580
     gccggtgcgg caagccgccg cgcgcgcgca gcccgcgcaa ctggccgaga ccgcgcgctg    272640
     gctgagccgc cagcgcgggc tggccacgca tccgctcaac gccaagctgt tcgtgcacgc    272700
     ggccctgcag cgcgtggtgc tatcctgcca gtgacgatcg ggccacggcc cgtttctcct    272760
     gtgatccgta ttctgtggtc cgtatgtacg tagactccca ttgtcatctg aattttcccg    272820
     aattggcgca agacctgccg gccgtgctgg atcgcatggc cgccaaccag gtcacccatg    272880
     cgctggtcgt cagcgtcaac atgcccgact ggccgggcct gatgcaattg gtcgagccgc    272940
     acggcaatct ctgggcgtcg gtgggggtgc accccgacta tgaagacacg cccgatcccg    273000
     agcccgccga gctcgagcgc ctggccgcgc accccaaggt ggtggccatc ggcgagaccg    273060
     ggctggacta ctaccgcctg agcgagccgc tggactggca gcgcgagcgc tttcgccgcc    273120
     atatccgcgc ggcgcgctcg accggcctgc cgctgatcgt gcatacgcgc gcctcggcgc    273180
     aggacacggt gcgcctgctg cgcgaagagg gcgccgacga ggtcggcggc gtgatgcact    273240
     gttttaccga gtcctgggag atcgcccagc aggccatggc gctgaatttc catatctcgc    273300
     tttcgggcat cgtgacgttc aagaacgcgc agctcgtgca cgaggtggcc gccaatatgc    273360
     cgctggaccg gctgctgatc gagaccgact cgccctacct ggcgccggtg ccatatcgcg    273420
     gcaagctgaa cgatccgtcc aaggtgatcc acgtggccga gaagatcgcc gagctcaagg    273480
     gtattccggt ggccgaggtg gcgcatgcct ctaccgagaa tttcttcaaa cttttcaata    273540
     agataaaacg ataatctaat ttgaattatt taaagtgaat tctagatttt ggcggtattc    273600
     caccatgaaa cccttgcgta cccgttttct gcgctggcgc ggcgccgcgg ccggcggcct    273660
     gctcgccggc gccttgctgg ccagccccgc ctgggcggcc aagcaggccg actggtgggt    273720
     gtatgtccat aacgacaagg cccgcgacat cggcgccttg ctggcggcgg gcgccgatcc    273780
     caatgtgcgc tacgacaatg gccagccggc catcatgcgg gcggtggtcg acaacgcctg    273840
     ggaggtgttc gatgtgctgg ccgccaaccg ccgcaccgat ctcaacgccg agaatcccgc    273900
     gggcgagacg cccttgatgt acctggcggt ggcggggcag accgaacgcg cgcaggcgct    273960
     gatcgcgcgc ggcgcgcagg tcaaccggct gggctggacg ccgctgcact atgcggcctc    274020
     gaagggccgg ctggagaccg cgcgcatgct gctgggcaag caggcgctgg tcaatgcgcc    274080
     gtcacccgac ggcaccacgc cgctgatgat ggccgcgtat tcgggcgatc gccgcatggt    274140
     gcagttgttg ctggatgccg gcgccgatat caccacgcgc aacctcaagg gcatgagcgc    274200
     ggccgactgg gccgccttcg gcaagtccga ggcgctggcg cgcgagctca agcccatgat    274260
     cgcccgcgcc gaggccgaac ggcaggcccg ccatggcgca gtggccacgc ccaagctggc    274320
     gccggccgcc gaaacgccgc ccacggcaca gcccgcggca gcccctgccg cggcgtcgca    274380
     acccggcgaa ggccgctccc tgtccggcgt ctcgggcgtg cggctgaatt cctacgatta    274440
     acccgggtgc ctgtccccgc ggggacaggc accctggcct ccctgttcct gctcctccac    274500
     ctgatcacgt gccgcccacc ggggcggcat ttttttgctc ggggttttcc ctgaaattct    274560
     cataaattga gaatgaattc tgaaaaaatg ggaaaaactg aataatctgc gcacgcaata    274620
     tcaaggaacg atcgacatgc aagaacaagc catcgcgggt ggcgccgagc gcgtgctgta    274680
     tgtgctggcc accctggcgc gcgaggaagc cccgctgacc gtggcggcgc tggccgagcg    274740
     caccggcctg gcccagagca cgctgtaccg gcaggtggcc ctgctcaagc gctgggggtt    274800
     cgtgctggag caggctggcg cctatacgcc gggcccgctg tgcgtgcagc tggcgcgcgg    274860
     cttcgaccaa tcgtcctatc tgatccagga agccttgccc gatatgaccc gcctggccgc    274920
     cgattcgggc gagacggtgg gcttgctggt ggccatgtcc gaccaggcgg tctgcctgga    274980
     gatggtcgaa agccggcatc cgctgcgctg ttcgttcgtc aagggccgcg gcctgccgtt    275040
     ggcgcgcggg gcctcggcca agtcgctgat ggcgttcatg gcgccggcgc gcctgcaggg    275100
     ccggctgcac gagctggccg ggcagggcgt cgacgccgcc gcgctggcgc gcgacctgga    275160
     ggcgatccgc gccgccggct acgcggtcag cgacagcgag gtcgacgccg gcgtgtgggg    275220
     ctgcagcgcg ccggtgttcg agcggccgca ccaggccgcc ggctcggtca ccctgatggc    275280
     gccttccacg cgcgtggccg aacgcaccgc gaacctgatc aacctgacgc tggcggccgc    275340
     caaacgcatt tccagccgcc tgcagcattc ctgatgtatc cctgtggccg tatccatcca    275400
     tacggttttc ttcactccaa tgccgcaccc atcaccaaag gaagcatcat gacgactcgc    275460
     cgccaactgc tgaccgccgc cctgaccctg aacctggcct ggggcgccgg cgccgcgcat    275520
     gcccaggaga ccattcgcgc cgtgaccgac gcgacgttcc cgcccatgga attcgtcaag    275580
     gacggcaagc gcaccggttt cgatatcgaa ctggtcgagg cgctggccca ggccatgggc    275640
     aagaaaatcg aatggatcga catcgacttc aagggcctga tcccggcgct gcaggccggc    275700
     cccgcgccga catcgccgtg tcggccatct acatcaccgc cgagcgccag aaagtggtgg    275760
     atttcaccga cccgtactat gcgggcggcc tggtggtgct gaccaagaag gatggtccgg    275820
     tgaagtcgct caaggacctg gagggccgca aggtgtcggt gcaggtgggc accaagtcgg    275880
     tcaactatct gaaggagcac ttccccaagg tgcagcgcgt cgaggtggag aagaaccagg    275940
     agatgttcaa cctggtgcag atcggccgcg ccgacgcggc ggtgaccggc aagccggcgg    276000
     ccaagctgtt cgcgcaaagc acgcaggacc tggctgtgct gagcgagcag atcaccaccg    276060
     aggaatacgg catcgccgtg ccgaagtcca agtccggact gacccgcgag ctcaacgagg    276120
     cgctcaagaa gctgaaggct gacggtacct acgagcgcat cgtcaacaag tggttcgagg    276180
     cgcaggccaa atgatgctgg atttcgcgcc tgtctttgcc gacttcgacg cattgctgcg    276240
     cggcgcggtc gtcaccgtgg aggtgacggc ctgcgcgctg ctgctgggct gcgtcatcga    276300
     cctgctggtc ggggtcggcc gcctcaacac ccgcaacgcc gcttcatcta caacctgtgc    276360
     agcgtatacc tgctgttctt tcgcggcacg ccgctgctgg tgcagctgtt catctggttc    276420
     ttcgggctgc cgcagttcgg catcacgcta ccggcgttcg cctgcggcgt gctcggcctg    276480
     ggcatctatt ccggcgccta cgtctcggag atcgtgcgcg gcgccatcca gtcggtcgac    276540
     cgcggccaga tggaagcggc ccgctcgctg ggcatgtcct cggcgcaggc gatgcgcatc    276600
     atcatcctgc cgcaggccgt ggtgcgcatg attccgccgc tgggcaacga gttcatcgcc    276660
     ctgatcaaga attccgcgct ggtttcgctg ctgacgatcc acgatctgat gcacgaaggc    276720
     cagaagatca tcagcgtgtc gtatcgctcg ctggagacct atctggtggt ggccctgatt    276780
     tacctggtgt tgacgaccgc gacgacgacg atcctgcgcc ggatcgagca tcgcctgcgc    276840
     gcgggaggga tggtgcaatg agtacgcaag agatgatccg catccgcgga ctgcgcaagg    276900
     cctatggcga gcacgaagtg ctgcgcggca tcgatttcaa tgtcgaggcc tcgcaggtgg    276960
     tggtggtgat cgggcccagc ggctcgggca agagcacgct tttgcgctgc tgcaacggcc    277020
     tggaggtggc gcagggcggc accatcgata tctgcggcca caacctgctc aaggatggcc    277080
     ggctgctgcc cgaggcggag ctcaatcgcc tgcgcatgca ggtcggcatg gtgttccagg    277140
     gtttcaacct gttcccgcac ctttcggtgc tggacaacgt gaccgtcggg ccgcgcacgc    277200
     tgcgcggcat gagccgggcg caggccgagg agctgggcgg cgacctgctg gccaaggtgg    277260
     ggctgcgcga aaagatggcg gccatgcccg gctcgctgtc gggcggccag aagcagcgcg    277320
     tggcgatcgc ccgcgcgctg gcgatgcagc cgcgcgtgat gctgttcgac gagcccacgt    277380
     cggcgctcga cccggaactg gtgggcgagg tgctgcaggt catgaagctg ctggcccgcg    277440
     aaggcatgac catgatggtg gtcacgcacg aaatgggttt cgcgcgcgaa gtggccgatg    277500
     tggtggcggt gatggacggc ggcagcattg tcgagtccgg tccgcccgag ctgattttca    277560
     gccagccgcg cgaggcgcgt acccgcgcct tcctgcaggc cgtcctcagc gcatcgcagg    277620
     gggcggcatg agcgtggcca acgattccgc gtccatctgg accgcgcgcg acgacagcgg    277680
     cgagcgcggc gatacgcgcc ccgcctggcc cacatcgtcg cgctggggca ggacgccggc    277740
     gccggcgacg ccgcggtgct gggctttgcc tgcgatgccg gcgtggcgcg caaccagggg    277800
     cggcgcggcg cgccatccgg cgcatgatgg ccggcctgcc ggcgcacaat ctgcgtcgcc    277860
     tggtcgacgc cggcgacgtg gtgtgcgagg acgaccagct cgaggcggcg caggatgcgc    277920
     tggccggccg cgtggccgcg ctgctgcagg ccgacgcgca tccggtggtg ctgggcggcg    277980
     ggcacgagat cgcctggggc agtttccagg gcttgcggcg ctggctggac gcgcgcggcg    278040
     accgcgaacc ggtgctggtg ctcaacctcg acgcgcattt cgacctgcgc accggccggc    278100
     cgggcagttc gggcacgccg ttcgaccaga tcgccgagta ttgcgcggcg cgcggccacg    278160
     cgctgcagta cgcctgcctg ggcgtctcgc cgctgggcaa cacgcccgcg ctctacgcgc    278220
     gggcggccga ggtcggcgcc gtctgggtgg aagaccgcca catgcaggag gcccatctgg    278280
     gcgagcgcct ggcccagctc gatgccttgc tggcggcggc cggccacgtc tatctcacga    278340
     tcgacctgga cgtgctgccg gcggcgaccg cgccgggggt ctcggccccc gcgccctatg    278400
     gcgtgccgct ggcggtggtc gaggaggtgg cgatgcatgt gcgcgccagc ggcaagctgc    278460
     gcctggccga cctggccgag tgcaacccgg cctacgacat cgaccaccgc accgcgcgcg    278520
     tggcggcgcg cctggcgtgg cgcttgctgg gcggcgcggc gcggtagacg gcgggcccgc    278580
     cacgggctta ggatgtaggc gttggccgcc cggatcggcc cgatccgggc ggcctgcccg    278640
     aaggttgttg caaggcgcgc ttttttgatg cggccctaat aaatatttat ctctttttat    278700
     tggggccgca gctggtttcg tggaaaaata agcgcaacct cagcccggag atcctcccta    278760
     tgtctcaagc tcccgcccat tccttgccct catacctgga tgccgagcat ctgggcccct    278820
     gggggatcta cctgcagcaa gtcgaccgcg tcacgccgta cctgggtccg ctggcccgct    278880
     gggtcgagac gctcaagcgt cccaagcgcg cgctgatcgt ggacgtgccg atcgagatgg    278940
     acaacggcag catcgcccac ttcgagggct accgcgtcca gcacaatacg tcgcgcggcc    279000
     cgggcaaggg cggcgtgcgt ttccaccagg acgtgacctt gtcggaagtg atggcgctgg    279060
     cggcctggat gtcgatcaag aatgccgccg tcaacctgcc gtacggcggc gccaagggcg    279120
     gcgtgcgggt cgacccgcgc acgctgtcgc actccgagct cgagcgcatg acgcgccgct    279180
     acacctcgga gatcggcgtc atcatcgggc cgtccaagga catcccggcc ccggacgtga    279240
     acaccaacgc ccagaccatg gcctggatga tggacacgta ctccatgaac gaaggcgcca    279300
     ccgccaccgg cgtggtgacc ggcaagccga tcgcgctggg cggcagcctg ggccgggtcg    279360
     aggccaccgg ccgcggcgtc ttcgtggtcg gctgcgaggc ggcgcgcgac ctgaacctcg    279420
     acgtatccaa ggcccgcatc gtggtgcagg gtttcggcaa cgtcggcggc accgcggcgc    279480
     gcctgttcca tgaggccggc gccaaggtga tcgcggtgca ggaccacacc ggcaccatcc    279540
     acaacgacgg cgggctggac gtgcacaagc tgctggcgca cgtcggcaac cagggcggcg    279600
     tggccggctt caccggcgcg cagcaactgg ccgacgacga tttctgggga ttggagaccg    279660
     atttcctgat ccccgccgct cttgagggac agatcaacga aaacaacgcc gccagggtgc    279720
     gcgccaaggt cgtggtcgag ggcgccaacg gcccgaccac cccggaagcc gacgatatcc    279780
     tgcgcgagaa cggcgtctac gtggtgcccg acgtgctggc caacgccggc ggcgtgacgg    279840
     tcagctactt cgagtgggtg caggacttct ccagcttctt ctggagcgag gaggagatca    279900
     accagcggct cgagcgcctg atgcgcgagg cctacagcgc cgtgtcgcaa gtggccaagg    279960
     agcacaaggt caccctgcgt accgcggcct tcatcgtggc gtgcacccgc atcctgcagg    280020
     cgcgccaggt gcgcggcctg tatccctgac cgctgcgcgg cgggccccgc agggcccgca    280080
     tcggcgtacc aggcagccgg cctcgcaagg ggccggcgcc gttttcagcg caggctgatc    280140
     caggtggtct tgaggtcgct gtacttgtcc atcgcgtgca gcgacttgtc gcgcccgaag    280200
     ccggattgct tgacgccgcc gaagggcacc gtgatgtcgc cgtcggcata gcagttgacc    280260
     cataccagcc cggcgcgcag gcggcgcgac aggcggtgcg cgcggccgag gtcggcggtc    280320
     cacagcccgg cccccagccc atagatggaa tcattggcca gcgcgacggc ctcgtcctcg    280380
     tcggcgaagc cttgcgcggc cagcaccggc ccgaagattt cctcgcgcac cagcgagttg    280440
     tcctggccgg gacaatcgaa gatggtcggt tcgatgtagt agccgccgct gtcggtcagc    280500
     acttgccggc cgcccaggcg cagccgcgcg ccttcctggg cgccggcggc gatgcgggcc    280560
     atgaccgcct gcgtctgccg ttcgtcgacc atggcgccca gcgcgctgtc cgggtccagc    280620
     ggattgccgg ggcgcagggt ggcggcgaag gcggccactt tttccatgaa ggcgtcgtag    280680
     atgccgtgct gcacgtacag gcgcgaaccg gcgatgcaga cctcgccctg gttggagaag    280740
     atcgccagcg cggcgacctg ggccgcgcgg tccaggtcgg ggcagtcggc gaacacgata    280800
     tggggcgact tgccgccgca ctccagccag acgcgcttga gattggattg gcccgagtag    280860
     gtcatgaagc gcttgccggt cgccgtcgag ccggtgaagg cgatgcagtc gacgtccggg    280920
     tgcaggccga gcgcctggcc ggcctgcgcg cccaggccgg gcaccacgct gaacacgccg    280980
     ggcgggatgc cggcctgttc ggccagggcc gccagccgca gcgccgacag cgaggcctgc    281040
     tcggcaggct tgaggatgac gctgttgccc acggccagcg ccggggccac tttccaggcc    281100
     gccatcatca aggggtaatt ccacggcacc acggcggcca ccacgcccag cggctcgcgc    281160
     gtgatggtgg ccagcgcgtc ggcgccggta ggcgcgatct cgtcgtagcg cttgtcgatg    281220
     gcttcgccgt accacgcata gcagcgggcg gtctcgggca ggtcgaaggc cagggcgtcg    281280
     cggatcggct tgcccatgtc cagcgtttcg agcagcgcca gctcttcctg gtgttcggtg    281340
     atcagcgcgg ccaggcgcag caggcggtgc ttgcgctcgc gcggggccag gccgctccag    281400
     acgccggcct cgaaggcgcg gcgcgcggcg gccaccgcgc ggtccacgtc ggccgcgccg    281460
     caggcggcga tatcggccag cttgcggccg tcgatcgggc tgtgcgcggc gaaggtggcg    281520
     ccatcggcgg cgtcgcaata ggcgccgtcg atataggcgc ggccttcggg ggcgagggcg    281580
     gcggcttgcg cgcgccagta ggcggaatcg tgcagggtca tgggagtcgg atgcgggcag    281640
     gcccggcggc gcgccgccgg gcggggtgaa tcagcgcggc gcgttggcgc gcgccaccat    281700
     ggcgtcgagc agcacgttgc agccggcctc caggtgggcg ggctgggcgt cctcgatctc    281760
     gttgtggctg atgccgtcct tgcagggcac gaagatcatc gccgtgggcg cgaccgcggc    281820
     catgtacacc gcgtcgtggc cggcgccggt cacgatgtcc atggccggca ggccgcggcg    281880
     ctgcgcgccg tcgcgcacct tgccgaccag gtcgggatgg aagggcgtcg gcgcgaagta    281940
     ctgcacctgc tcgcactgca ccgatacggc atgccgcgcg gcggtgtcgg cgcacgcctg    282000
     gcgccacagc gcgtccatcg tggcgagcgt ggcttcgtcc tcgtggcgca ggtccaccgt    282060
     gaagcgcacc tggccgggga tcacgttgcg cgaaccgggg taggcgtgga tctcgcccac    282120
     cgtgccgcgg ccgtgcggct ggtgcgcgtt ggcgatctcg accaccgcct gcagcagatg    282180
     gctggccgcg tacagcgcgt ccttgcggat cggcatcggg gtggggccgg catgcatctc    282240
     catgccttgc accaccacgt cgtaccagcg cacgcccagc gagccggtca ccacgccgac    282300
     gatcctgtct tcgtgttcca ggatggggcc ttgctcgatg tgcgcctcga agtaggcgtc    282360
     gaccgcgcgt ccgcccaccg ggtcggcgcc ggcatagccg atggcgcgca gctcgtcggc    282420
     caccgacttg ccctcggcgt cgcgcgcggt cagcgcggtc tcgagcggga atttcccggc    282480
     gaacacgccc gagcccatca tcacgggcag aaagcgcgag ccttcctcgt ttgtccagat    282540
     tgccacttcc agcggcgcgt cggtctgcac gccgtggtca tcgagggtgc gcatgacttc    282600
     cagtccggcc agcacgccgt agcagccgtc gaacttgccg ccggtgggct gggtgtcgat    282660
     gtggctgccg gtcatgaccg gcgcgcgcga cggatcgcgt ccggcgcggc gcgcgaagat    282720
     attgccgacc tggtccacgc gcacggtcag gcccgcgtcg cgcatccagc cggtgaccag    282780
     gtcgcggccc tggccgtcga gcgcggtcag cgccaggcgg caattgccgc ccttgggcgt    282840
     ggcgccgatg cgcgccaggt ccatcagcga ctgccacagc cgctgtccgt cgatggagat    282900
     cggggagttg ttgctcatgt ctttacctca ttgcacgccg gcggcctggg cctgggccgc    282960
     ctggtggatt tccgtcaggg tctggcccgg cgcgatgccg tcggcttcgt agcggatttc    283020
     caatagcgcc ggcaattgct cgcgttcggc gaaggcgcgc gcgcgctcga aggccgggcc    283080
     gaagtcctcg gtgcgctcga ccgcttcgcc gtagccgccg taggcgcgca cgaattgggt    283140
     gaaatcggga ttctggaagt ccagggcaat ggcgcggccc gggaattcgc gttcctggtg    283200
     ggcgcggatg gtaccccaga tgccattgtt gaacaccagc acgaccacgc cgacgcggta    283260
     ttgcagcgcc acgccgagtt cctgcagcag cgccacgccg agttcctgca tgttcatctg    283320
     gaagcagccg tcgccggcgt agcagaccac ggtgcgggcg gggttttcca gcttggccga    283380
     aatggccgcc ggcaggccgt agcccatcga gccgaccgtg ggcgccaggc tggtgcccgg    283440
     gccgctgaac tggcggtagc ggtgcgggta cagggcgtaa ttgcccgcgc ccaccgtgat    283500
     gcaggcgtcg gccgggatgt gctggttgac gtaggcggcg gcgctgtcga ggttgagcgg    283560
     gccgggcgag ggcagcgggg ccagcgtggc caggtattcg tcgtgcgcgg cgcgcacggc    283620
     ctgcgcgcgg ctggcgcggt gtcccggccg cagcgcgtcg agcgcggccg cgaacccggc    283680
     cgggtcggcc acgatgccca gggtcggcgc gaacacccgg cccagttcgt tggggtcggg    283740
     gtaggcgtgc accagccgct ggcgcggcag cgggctctcg atcacggtgt agccttcggt    283800
     ggtggcctcg cccatgcgcg tgcccaccgc caggaccagg tccgcgccgg cgatgcgctg    283860
     gcgcagttcc ggcgccatgg cccagccgac gtggccggcg gcattgggat ggcgctggtc    283920
     gaagcattcc aggcggcgcc aggccgtgcc taccggcagc tcgaagcgtt cggcgaacgc    283980
     ggcggcctgt ccgatggcct cggcgctcca gcctgtgccg cccagcagca tgaagggccg    284040
     ctcggcctgg tccagcaatt cgaccatgcg cgccaggtcg gccgcgccgg gcaggcagcg    284100
     cgcgcgccgg tagcgcggca tgtcggccac gcgggcgcgg ccccacagcg tgtcctcggg    284160
     cagcgccagc accaccggcc cgggccggcc gctggtggcc accgcgaagg cgcgcgcgat    284220
     gaattcggga atccgctcgg tgcggtcgat ctgcgcgacc cacttggcca tctggccgaa    284280
     catgcggcgg tagtcgattt cctggaacgc ctcgcgctcc atgaagtcgt tgccgacctg    284340
     gccgatgaac agaatcatcg gggtcgagtc ctggtaggcc gtatgcacgc cgatgctggc    284400
     gttggtggcg ccggggccgc gggtgacgaa gcagatcccc ggctcgccgg tcagcttgcc    284460
     ataggcctcg gccatgtagg ccgcgccgct ttcctggcgg cagacaatgg cgtcgatggc    284520
     gccgcgatgc tcgttcaggg cgtcgatgca gggcaggtag ctctcgccgg gaatcatgaa    284580
     cacgcgccgc gcgccgtgca cgcgcagctg ctgcatcagg atctggccgc cgttgcgctc    284640
     gggcagggct ggcgtggtca tgactgctct ccttgggact cgcgggggcg cgccgcgcgg    284700
     gcggcccatt gttcgaattc ggcgtggcgc gccagcaggc ggcgcgcggt gttgtagtcg    284760
     ggcgggtcga cgcgcgcgcc gccggcgtcg cggccgtcgc gttgcgcctc gaagcgggcc    284820
     gccaggtcgc gcgcggccgc cacgcggtcc gcgtccggcg tgaaggcggc gtgaatggcg    284880
     ggcacctgtt cggcgaacac ggcgcacttg gatttcaggc cgatgcggcg cgcccacagc    284940
     aggtcggcct gctgggcggc ggggtcgcgg tagttgaacg ggcagtcgat cggcaggcag    285000
     ccggccgcga cgcaatcgac caggaagcgc gcgcgcaggg cgtgcagttc gatgccgtcg    285060
     gggccgcgct cggcgccgcc caggctggct gtcaggtcct cggcggccag caggcaggcc    285120
     gatacgcgcg ggctggccgt caggatttcg caggcgcgcg tcacgcccag cgccgactcc    285180
     agcgtgggca cgatctcggt gctgcccggc gccaggccgg cctcggcctc gcaggccgag    285240
     atggcgcggt cgagcgcggc gatctgcgcc gcgctttcgg catgcggcag gaaaatcgcg    285300
     tccggcgcgc cggccatgat gccgcgcagg tcgtccaggc cgtcttcttc cagcttgttg    285360
     atgcgcaccg cgccgatcac gccggcggcg cggcattgcg ccagcagcgc gacgatgcgg    285420
     cggcgcgcgg ccggacggtc ggccggcgcg gtgaactctt ccaggtcggc caccagcgcg    285480
     tcggcgccgc tggccaggcc ggccgcctgg gcctgctcca gcagcccggg aacgaacatc    285540
     cagctgcggc gcaggctggc ggggcggcgt tggccgcccg ggttggagat gggggtcatt    285600
     gcacgtgcct cggcaggaac agcaccagtt cggggacgaa ggtcagcagc agcatgacgg    285660
     cggtcatggc cagcatcatc cagctcagcg ggcgcagggt ctgcatcatg ttgatgccgc    285720
     cgatcttgca ggcggccatc aggtccacgc ccaccggcgg ggtgttcgcg ccgatcgcca    285780
     tgttgatcga cagcaggatg ccgaaatgca ccgggtcgat gttgtagtgg gccagcaccg    285840
     gcatgaccac cggcgccacg atgatgatga ccgggatggc ttccatgaag gtgcccagca    285900
     gcagcaccac cgtcagcacc agcagtacgg cgatcttgct gtcggtccag tccaccagca    285960
     ggccggacag ggcctgcggc acctgctcgg ccaccagcac ccaggcgaac aggcccgagg    286020
     cgccgatcag cagcaggatg gacgcgctgc cttcgccggt cgacttcagg ctctcccaca    286080
     gggacttcag gctgagcgtg cggtaccaga aaaagcccac cagcagcgca tagacgatgg    286140
     cgctggaggc ggcctccgtg gcggtgaaga tgccgaagcg gatgccgccg atgatcagca    286200
     cgggcaccat cagcgcgggc agggcgtcga tggcggcggc gcgcagctcg ccccacgaga    286260
     acggctggcc gccggcccag ttgtgcttgc gggcctgcca gatcgccacg acgatcagcg    286320
     aagcgcccag caggatgccg gggatgatgc cggccaggaa cagcttgccc accgaagtgt    286380
     cggtgatagt gccgtagaca atcagcacga tgctgggcgg gatgatggtc gaggtggcgc    286440
     cggcgctgcc gatcagcgcg cagctgaacc ccttgtcgta gccgctgcgt gccatggcgg    286500
     gcagcagcag gctgccgatg gcgatcacgt cggccacgcc cgaacccgac agccgccgaa    286560
     catcaggcag gccagcacgg ccaccacggc caggccgccc ttgatatcgc cgacgatggc    286620
     cgcgcacagc cgcacgatgc gctgcgtcag gcccgcgccg ttcatcagct gggcggccag    286680
     gatgaacagg ggaatggcca gcagcgtgaa gctgtccagg ccgaccacgt attgctgggc    286740
     cgccaccatc atcggggcgg cgtcgtagac ggccaggtac gccaggcacg ccagcaccag    286800
     cccgaaggcg atcggcatgt cgatcagcac cgtgaccgtg aatacgccca tcaggaaaag    286860
     ggcaccggta gacatctttt aatcctttgc cgcgacgggg tcggccggtt ggaacaattg    286920
     cgccaggtgc accacgatgg tgatggcgca cgccaccggc agggcgaggt agaccgtgcc    286980
     ggccgatacg tcgagcgcgg gcagggtctg gtccatggtc agttcggcca gctgccagcc    287040
     ggcataaccc agcgcggcca ggccgacgat gatcaatgcc tggttgacgc ggtcgcagat    287100
     ggccagcgcg cgcgggttgc gcacgacgaa gggcagcagc ccggccatca ggtgggtgcg    287160
     ttcatggctg caggtgacgc cgccgatgaa ggccgcccac accagcacca ggcgcggcaa    287220
     ttcctcggcc cagtgcggcg tggtgtgcat cacgaagcgt tcgaacacaa cgtaggtgat    287280
     cagtgcggcc agcaaggcca ccgccagggc ggcgatggcc ttgctcaggc cggacagcgc    287340
     gtgcgagatc cggcccagca tttacttggc ctcgcggtac ttctgcaaca ggcccatcag    287400
     ctcggggcca taggcggttt cgtaggtctt ccagatcggc gcgacggccg cggcgaaggg    287460
     ggccttgtcg acttcgttga cctgcatgcc cttttccttg agctgcgcga cgaactgcag    287520
     gtcgccttcg gtgatcatct ggcgttgcgc gtcgcgccac ttgtcggcgg cggcctggac    287580
     gatcttgcgg tcgtcggcag agatgcggtt ccagatcggc ttggagacga tcaggcttgc    287640
     cggaccccac acgtgaccgg tcagcgacag atacttctgg acctcgaaga acgacgaggt    287700
     gtagatgatc gacagcgggt tttcctgcgc gtcgaacacc ttctgctgca gggccgagta    287760
     gagctcgccg aaggccagcg gcgcggggtt ggcgcccagg gcgaggtgtc caggcgcatc    287820
     ttgtcgggcg tgacgcgcgt cttcaggccg ttcaggtcgg ccggcgtgtt gaccgggccg    287880
     cgattgttgg tcaggtggcg aaagccgttt tcccaccacg acacgatcac caggttcttc    287940
     ttctcggcca gcttggccag cgccgcgccc agttcgccgt cgtaggcctt gtaggcctgc    288000
     tgcgaggtgg tccaggtgta gggcagctcg acgatgccga acttcggttc gatcggctgc    288060
     agcgagcccg agccgatgat ggccgcgccc tggctgccga tctgcaggcc ctcgagcatg    288120
     gtcttctcat tgcccagctg gccgctgggg aacaggatga agttgacgcg gccggcggtc    288180
     ttttccttga cttcggcggc gaaaccttcg gcggccttgt tccagctgtg gctgggggcc    288240
     agcacgtggc ccagcttgat gtccagggcg tgggcggccg gggcgactgc cagcgccagg    288300
     ccggcggcgg cgaacaggga ggtcagggta cgggtcagct gcatggtttt caccttgaaa    288360
     tgttctggct tgtgaaacgt cgggaggaac gaagccggaa accgccggcg caagcggggg    288420
     cccaggccga cgcgcgagcg tgtcggcggc aaggcgggaa atcggcaagc agggcgccag    288480
     cgtcgggcgc gggaggcgga cgggccgccg gaatcaattc atcggatggc tccgctgcca    288540
     aagtcttcgc gcaggcgcgc caggatgccg accagatggt cgtgcatggc atggcgggcc    288600
     cggataggat cgcggtcgac gatggccgcg aggatgcgtt cgtgttcgcg ctcggcggct    288660
     tcccagacct tggtcgtgac gaaatgctgt tcgagccggc tgaacaccgg gctggtggcg    288720
     ctgaggtgcc agatatgcga gatggcggcg gccagcgcgg cgttgccgca ggctgccgcg    288780
     atggcgccgt ggaaggcctg gtcgtgggcg ccgggcgagt cgctcagcga catcgccgcg    288840
     tgcgccgacg agatcgcggc gatctgcgcg ggcgaggctt tctgggccgc cagcgacgcg    288900
     cactcgggct ccagcagcag gcgcgtgtcg agcaggtcga acggaccgat gtcggtgtgg    288960
     ccgggctggg gcgccggcgc gacgccatag tcgccatcgg cgcgcggcgc cgccacgaac    289020
     acgcccgtgc ccacgcggac ttcgacatag ccttcgattt cgagggcgat cagggcctcg    289080
     cgcaccgagg cgcggctgac ctgcagttgc tcggccagtt cgcgctcggc gggcaggcgg    289140
     ccgccggcgg gaaaatcgcc ggcgcggatg cggccggcga tctggtcggc aatcatgcgg    289200
     tacaggcgcg tgggggcgac ggcttggaag gatcccatgg ttggtggcgt gtccggttat    289260
     ctggtggccc agtggtcagg ccactaatat accgaagcgc ccggcgaata aaaatagcgg    289320
     gcgatggcga atccgggctt tctagggaaa accactaggc cgcgccgcgt ccgcccgccg    289380
     ccagcgccag cagcgcctcg cgcaacacca ccgcgttgtt gtgctcggtg tcgcgcgcgc    289440
     cgtagaccag cgtaagcggg ccggccccgg cctgcgccag cagggcgcgc agctgcgcct    289500
     gatgcgacgg gccgcgcagc tcggccagat agcgttcgcg aaacgccggc cagcggggcg    289560
     tctggtggcc gaaccactgg cgcagcgccg cgctgggcgc caggtccttg atccagtcgt    289620
     ccagcggcag ggcgtccttg cgcaggccgc gcggccacag cccgtcgatc agcacccggc    289680
     gcccgtcggc gggcgcggcg gcctcatagg cgcgcttgag atggatggcg ggcttcatgg    289740
     gcgcgggcgc gtttgcgcat acactgggcg gcctgatcga aagcgagttt tcatgaggcg    289800
     gtttcctggg cggatgctga agtggctggt cctggcctgc ggcctggcga cggcggccgg    289860
     gctgctcgcc tggcggctgg cgccgtcttc cgactatatc gcgcctgcgg ccgggcagga    289920
     ccgcctgcgc ggccaggcca tctaccaggc gaactgcgcc gcctgccatg gcgcgcggct    289980
     cgagggccag cccgactggc gccagcggct ggccagcggg cggctgccgg cgccgccgca    290040
     cgatgccagc ggccacacct ggcaccaccc cgacgcggtg ctgctggaca tcatccgcca    290100
     cggcatggtg ccgggccgcc acgcgccgga cggctaccag agcgacatgc cggcctacgc    290160
     gggcgtgctg tcggacgcgg agatcgcact ggtgctcgcc tatataaaaa gcacctggcc    290220
     gagccaggtg cagcaggacc agcgggccgc cacgcagcag atgacgccgc gctagcgtgg    290280
     cggcgcctca gtgcgccagg accatggcga agtagccgaa cacggtcagc agcacgccgg    290340
     agacggcgta gccgaccggg aatcccagcc agggcacgct ggagccgact tccttggcgg    290400
     cttcgcgcgc cggccccgag tggctgcgcg cgccggcggt ggcgcccatc agcagcgcgg    290460
     ggttgatctt catgatgtga aagccgatgg cccacacgat gatgggcggg atggtcgagg    290520
     cgagaaagcc cacgatgaag atcttcagcg cgatcgcgcc ggttagctgg gtgagcaggt    290580
     cggcgccggc gttgatgccg acgatggcca cgaagccgat caggcccagg tcctcgagga    290640
     tgttgcgcgc ggcgttgggg gtgttgccga aaaagcgcag ccgcgaggaa atcgacgaca    290700
     cgatgatgcc cgacagcagc aggccgcccg cgttgcccag ccccaccttg gcgccgaacg    290760
     ccggcacttc gatcagcccg atcagaaagc ccaggatcat gccgaacgac agggtcagca    290820
     ggtcggtggc cgagctatgg cgcgcaatca cgccgaagat ctcgccggcc ttgctgacgg    290880
     ccggctgcag gccggtcacg aacagtacgt cgcgcttttg cagcgtggtt tccaggccga    290940
     tgggcagcgg cacgccgctg cgctcgacgc gctgcagctg gatctgcccg gccagctccg    291000
     aaccgcggaa ggtcttcagc ggccggccgg tcacctcctt gttggtcacc aggatctcgg    291060
     cctggtccag cggtatgttc agcgcgcggg cgtcgggcac ctcggggccg agcatcccca    291120
     tgttggcggt catttcctcc aggcggccgc ccagcgccac cacgtcgccc tgctgcagca    291180
     cggtctcggc cgaggggccg agcagctggt cgccgcgctc gacattgacc acctggtact    291240
     ggggaaagcg cgtgcggaac tgctggaccg tcttgccgat cgattccggg ttctcgaccc    291300
     ggtaggcgcg caggtcgaac ggatgaaagg ccgtcagccc ggcgtcgtcc acgttgggca    291360
     cgccatgcgc cttctcgaac tcgagcgcgg cggccttggc gtccacgccc cagatgcgcg    291420
     gcaggtactt gcacagcagg atgatgccga ccgtgcccca gatgtaggtg atgccgtagg    291480
     acagcgcgat catggcgctg atctgctcgg gactctccga acccagcgac agcacgccgg    291540
     cgctgaccgc ctgttcggcc gagccgatgg ccgccgacat ggtctgcgag ccggccagca    291600
     tgccgccggc cgcgcccagc ggcaggccga agaactgcgt gcccagcacc acgatggcca    291660
     ggcccaggat cggcgcgatg atggccagga tggcgtagtt gatggactcc ttgttcagcg    291720
     cgttgacgaa ggacggaccc acgcgcagcc ccacgccgta catgaacagg taatagagca    291780
     gcgacttggc gaactcgtcc aggtggaact tgacgccgta ggccgcgccc acggtggcga    291840
     ccaggcagcc gaccacgatg gcggcggcga ccgcgcccag cccgtagccc ttgatggaaa    291900
     acttgccgac ccagaccgcc aggccgatgg tgagaaacag cagtatgtag gggttgctgc    291960
     ccaggaattg cacgaaagcc tgcatggtct atgctccgcg attcgtccag tcaaccgtgc    292020
     gatgcccggc cggcgcatcg cacgccttgc gcgcatggcg gcggacccgg ccgggcccgc    292080
     cgcgcggccc tagcacttgg ccggcgagga cttgtgcgtg tcgtgcagcg ccggcggcgt    292140
     ggccgtcccg ccgtgctgct ccaggtactt gcacgccttg acgatgtctt cggccagcaa    292200
     cagcgcgacg ttgcggttga tgtgcgggcg caccaccacg cgcaggctgc gcaccgactc    292260
     cgcgtcgggc ggcatggtat aggcggaaat cacccagccg cgttcgcgca ccttgttgga    292320
     cacgtcgaac tcgttgaact tcttgacctt ggggtccagc gtgacggcca ccacgggaat    292380
     gcgctgcgta tcgttcatga tggtgaagta gccgctgtcg accaggtgct ggcgcagcgc    292440
     gatggcgttg tccagcgtgc gtgcatgacg cgcttgaagc cgtcgaagcc caggcgcagg    292500
     aactggtagt actgcaccgc cacctggaac gagttgcggc tgaaattgag cgtggccgtg    292560
     ggcatctcgc cgcccagata gttgacgtag aagaccaggt cttcgttgaa caccttgcgt    292620
     tcgcggaaga tcacccagcc caggccgggc ggcgtcaggc cgtacttgtg gccggaggcg    292680
     ttgatcgact gcacgcgcgg caggcggaag tcccatttgt agtcggggta caggaacgga    292740
     ttgacgaagc cgccggaggc cccgtcgatg tgcatgggca ccgaaacgcc ggtcttcttc    292800
     tcgtaggcgt cgagccagtc gtggatgccc tggatgtcgt cgtcctcgcc ggtgaaggtc    292860
     tggccggcga tggcgaccac cgcgatggtg ttctcgtcga cgtacttgtc caggtcttcg    292920
     gcggtcaggc agtactggcc gggcttgagc ggcacgatgc gcggctcgac gtcgaaatag    292980
     cgcaggaatt tcttccacac gatctgcacg ttgccgccgg tgaccatgtt gggccgggtg    293040
     gcgtccttgc cttcgcgttc gcggcgctgg cgccagttcc atttgtgcgc caggccggcc    293100
     agcatgcacg cctcggacga gccgacggtg gccgtgccgt agggttcggc gtccttgggg    293160
     ccgttccaca gctggtgcag ccacctgacc atgcgctgtt ccatggcgaa cagctgcggg    293220
     tagatgtcat ggtcgatgta gttcttgtac atgttctttt cggcgatccg gacggcttcc    293280
     ggctcggcga acgtcgtcac gaacgacgac atgttcggca tcgggttggt atcggtccat    293340
     tcgtcgctga gcaccagcgc ctgggtggcg cgcgccgaca tgccctcgac cgggaagtgg    293400
     tcttccggga cttcgatgtt gaactggtcg taaggcgtca tctgttctgg cgatttgctc    293460
     atgctggatc tccgaagtga actggcgggg aacaaggaca gagccggcgg gaacgcggcc    293520
     ggcgtacgct aagactggaa tggctggggc gcggcgttgc gcgtcgcgct agcgcggacg    293580
     gcgcggcggg acgggcagga agcgggagcg ggagcggggc gcgggacgcg ccggcggggc    293640
     ggtggcggcg gcggcggcgg cggcaggggg gcggaaggtg ttgcaggaca tggacgagct    293700
     cacataaatg atgatttatg caaaccgttg cctacttgcg gcagcgggcc gactttcgac    293760
     gcggcggtga ctcagtatgg agaatgcccc tgggccgcct gcgtaggatg atgcctgatg    293820
     tcgatacgga gcacaatgaa atttgcaacg taacgtaaca aatgttcggc gatccggggg    293880
     ctttcctaat ccgcggttac gggccccatg gcggcctgcg cggggccggc cggagccggt    293940
     ggcgcggcat ggccgcgccc gcccgcggcg ctgacggaga tgtagctgac ggcgtgcgtg    294000
     acctgcggcg ggttgggccc gctgtgaaag gcctgggccg cgtcgatggc catcttgtcg    294060
     gccagcgtca tgcggtcgtt catgcgcagg tactgcagcc aggagtcgac cacgaacatc    294120
     tccgaccagc gttcggcgtc ctcgaggtcg cggaacaatt gccattggtc ggcgccgttg    294180
     cgcatgcgca tcagccgcag cgggccggcc gcgtcgatga aggcgcgcgc gcgttcggcg    294240
     gcgatgcggt actcgatcga gaccagcacc acgccatggc gcgcgtcgaa gtccgactgt    294300
     ccggcgggca gggccgcccg cggcagcacc gagaggcact tgtcgtcgac gtggtcgggc    294360
     agccgcgagc ggtacagcag cgccacggtg aacagcagcg ccacgccggc cgccgccatc    294420
     gccccgcggg tgcccatgct gccggcgaag tggccccaga tgaacgagcc cagcgccagc    294480
     ccgccgaaaa tggcggtctg gtagagcgtc agcgcgcgcg ccttgaccca gtccggcacc    294540
     agcagctgca cggtggcgtt gtaggtggcc agcacggcga tccagcacga gccggacagc    294600
     agcagcgccg ggaacaccac ccacaggttt tcggtcacgc ccagggcgat caggcccagc    294660
     gccagcaagg cggcggccac gctgatcagg cggctgacgc cgagccgccg ctgcaccgtg    294720
     cggatgccga ggctgccggc gatggcgccc aggccgaggg cgcccagcat gtagccgtac    294780
     agcgaggcgc tgccgttgtc gtgttcgtgc gccagcaccg gcagcagcgc ccacagggcg    294840
     ctggccgaca ggccgaacga gaaggcgcgc atcatgacca ggcgggtcac gttcgagtac    294900
     tcggtaaagc gcagcgccgc caccacgcct tcgtagatgc gctcgggcgg cagggtgcgc    294960
     ggcggcgttt cgcggcgcca gcgccagatc gcccagatca gcgcgccata gcagaagcag    295020
     ttcagcagga agacccaggg ggcgcccagg gcgcccagca gcacgccgcc gatggccggc    295080
     ccgatggcgc gcgcgacgtt gtagttcacg ctgttgagca ggacggcgtt gcctacgtac    295140
     tggcgcggca cctgctcgct gacggcggcc tgccaggccg gggtgacgat ggcgctgccg    295200
     atggagacca cgaacaccgc cacgatcagg gtgaccgggt gcagcagccc gaggaaggcc    295260
     agcgccgtga tgagggtgcc gacgaccagc tccaggccca tgcccaccag catcaccttg    295320
     cgccggtcgt ggttgtcggc gaccacgccg gtcacgatgg acagggccac caagggcagg    295380
     gcggcggcca cctggatcat ggcgacgatg agcgggccgc tctgggcttc ggtcacgatc    295440
     caggccgcgg cgaccgactg ggcccagatc cccagattgg cgaacaggtt ggcgatccag    295500
     atcatgcgga acgccggata gccgaacggc gccagcaccc cggggcggga cggcggcggg    295560
     gcggcttcgg cgctggcgcg cggcaggtct tcgggggcgg aggcgggggc ttgcagcatg    295620
     ggagcaagga aggcgcggcg cgacgccgtc gggtgcctgg taccttctcg cgccgcgccg    295680
     accctgtcaa gcgcgcgcgg gtagaaacgg atgcggcggc gttcctcctg gtgtagcatc    295740
     cgtatgcccg ccccacgcgg caaggaaatg gccggcggcg tatgacgcct ctgtctggag    295800
     ctgactatct tggcgctttc ccggcctgca cgcttactga gccgtatcgg catggtgacc    295860
     gcactgggca tcgtggcggc gctcggcatc gtgatcgcag tggcatccat cctggcccag    295920
     gaccggcaac aggtctggga gcgcgaagcc cgttcggccc gcaatgtgct gcaggcgctg    295980
     gccggcgaat tcgagcgcac ggtgacggcc tacgacctgg tcatccgcgg cgtcatcggc    296040
     gacctggccc agccggcggt ggcggcgatg gggcccgagg cgctgcatcg cctgctgttc    296100
     cagcagggcg cgcggcccga caacctggcg gtcctgctgg tgctcgacga gcgcggcgag    296160
     gtgatcctgg attcgcgcac ggccgtcgtt gcaccccgca accgctccag gcgcgattac    296220
     ttccaggcgc atgtcgacaa cccgcaggcc ggcctgttca tcagcaagcc ctatcgcagc    296280
     cgcaaccgca acggcgagct gagcatcgcg ctgagccgcc gcctcgcgca tccggacggc    296340
     agcttcgccg gcgtggtggt ggccgcggtc agcctgtcgt atttccgcga ccgcgtggtc    296400
     cagctgaacg tgggaccgcg cggctcgatg accctgttcc gcgacgacgg catcgtcatc    296460
     agccgcaagc cgtacgtgga ggcgcagatc ggcgtggacc tgagcgagtc cgccaacgtg    296520
     agccggttcc cgcgcgaggg caggggcgcc ttcgtcggca ccgccatcct ggacggggtg    296580
     gaacggctct accagttcga gcgggtgggc aagctgccgc tgatcatggt ggtggcgctg    296640
     tccaccgacg acatgatgac gccatggcgc cgccacgcct gggtgctggc cggcgccgtg    296700
     ctgctgctgt gcgcgttgct ggtggcgctg ctggcggcgc tcgagcgcga gttgcgcagg    296760
     cgccgcaacg ccgaggccga gctggcgcaa ctggcgcgca tcgacaccct cagcggactg    296820
     ctcaaccggc gcgccttcgc gcaggtgctg gcgctggagt gggaggccgc gctgcgcggc    296880
     cgcacgccgc tggcgctgct gctggtcgat gtggaccact tcaaggccta ctacgactgt    296940
     tatggccgtt cggccagcga tgtgctgttg cggcgcgtcg ccgatgcggt gcgcgattgc    297000
     gtgccctatg ccgccaatgt ggtggcgcgc cacggcgccg acgaattcgt ggtgctgctg    297060
     cccggcatgg ggttgcgcag cgccgcgtgg ctggccgagc gggtgcgcgc ccgcgtgctg    297120
     gggctggccg tgccgcaccg cggcaaccgg ggcggcgtgg tctcggtcag catcggctgc    297180
     acggccatga cgccgctggc cggcagcgag gccgcggtgc tggtcgaacg cgccgatgcg    297240
     gcgctgtacc tggccaagtc gcgcggccgc aaccgggtcg agcgcatcgg cgacccgagc    297300
     accgcggggc agggggcgga gcgcgaaatg gcgcaggagc cgggcggctc ctagcgcggc    297360
     gcgagccgcg ggcaggccgg ggccgaccgg atgttcagga atatgtaaga aatggtaagg    297420
     ttggggatta tgcgcgccgc tggcgcgtct agccctccat gacctccgat tcgccaacct    297480
     ttcccgtcgc cgcccagttg cccgccctgc gcgcctacgc gcgcaccctg acgcgcaacc    297540
     cgcacgacgc cgaggacctg ctccaggagg cgctcacgcg cgcctacgag cgccgccata    297600
     ccctgcgcgc cgacggcaac ctgcgggcgt ggctgatggc gatcgtgcac aacgtgttcg    297660
     ccagcgaatg gcgccgccgc caggccgcgc cggcgcaggc cgcgccgctg cacgacatgg    297720
     aggacgccgc cgcggtggcg ccgccccagg agcacagcgt gcggctggcg cagatcgagc    297780
     gcgccttcat gcagctgccc gacgaccagc gcgccgcgct gcacctggtg acgatagaag    297840
     gcatggccta ccaggaagcc gccgacgcgc tgcagatccc gatcggcacg ctgatgtcgc    297900
     ggctgggccg cgcccgcgcg gcgctgcgcc gcttcgagga cggcatgggc gaggcggcgg    297960
     ctgaccggcg cgcccgcttc aggatcgtgg gaggccggga tgccgcatga acctgtgacc    298020
     gagatcgatc tcaacgccta tgtggacggg cagctcgacc cggcccgccg catcgaggta    298080
     gaggacttcc tgtcgcgcca ccccgaggag gccatgcggg tcatggcgga cctgcgccag    298140
     cgcgacgcgc tgcggtgggc cctgggcgcg tcgcagcagg cgccggccga cggcgcggac    298200
     acccccacgg ccgtgcacac ccggcgcctg gcgcgccggc tcgaacgcgg gctggtccgc    298260
     cgcgggctgg acgaccggtt gcgccaggcc gccgcggcgg tgctgctggt ggccgtcggc    298320
     tgggccgggc atgtcgggta cgcggcgcgc tacccggaca tgcggcacgt ggtggccgcg    298380
     accgcgccgt ccttcgtcga ggacgccgtg caggcgcacc gcaccgccaa ggtgcgcgcg    298440
     gccatggcat cgcagccgcg cgtgccgcat ctggatgccg acgaattgct gcgcgccacc    298500
     ggcgtgcgcg tgccggccct gccggcttcc tgggccgtgc gcgacgtgca ggtcttcccc    298560
     ggccgcaccg ggcccagcgt ggagatggaa gtcgaggccg ccggcctggg ccggctgtgg    298620
     gtgttcgccg cgcgcgagcc cgcccatgcc gccgaggccg cgccggtcgt ctcgcgcttc    298680
     caggacgccc cgatcgccta ttggcagcag gggcagtggg cttacgcgat caccggcgac    298740
     ttgcccgatg ccgaactggg ccgcgccgcg ggccagatga ccgtcgcgat gctggccacg    298800
     ccctgacggg cgcccagtgt ttctgttttc accaccgagg agtatccccg catgacacaa    298860
     catgttatgg cgcgcggcgc cgaaggaggc gcccgtgctt gagtttttcc agaccctgag    298920
     ctgggccgcc gtattccaga tcatcctgat cgacatcctg ctgggcggcg acaacgcggt    298980
     cgtgatcgcg ctggcgtgcc gcaacctgga gcccaagcag cgcatgcagg gcattctgtg    299040
     gggcacggcc ggcgccatcg gcttgcgggt cgtgctgatc gccttcgcgc tgacgctgct    299100
     gacggtgcct tacctgaaga tcgtgggcgc gctgctgctg tgggtgggcg tgaagctgct    299160
     gatccccgag gatgacgcgc atggcaacat caagggcggc acgtccatcg ccgccgcggt    299220
     caagaccatc atcatcgccg acttcgtgat gagcctggac aacgtcattg cgatcgccgg    299280
     cgcggcgcag ggcgcggcgc aggagcatca gctgggcctg gtgatcttcg gcctggtggt    299340
     cagcgtgccc atcatcatct ggggcagcac gctggtgctc aagctgatcg accgcttccc    299400
     gatggtcgtc accttcggcg cggcgctgct gggctggatc gccggcggca tgctggtcac    299460
     cgacgtggtg gtggtcgagc gcttcggcga agtctcgggc gtcgcgaaga tcgccgccga    299520
     ggtggcgggc gcgctgctga tcgtgggcct gggccgctgg ttcgcccgtc gcaaggccgc    299580
     ggccgcgccg cagaccgcgc gcgaaagcgc ctgacggcat ggcagcgggc gggcgcgcgc    299640
     ccgcccggcg aacgaaccgg cgccctggtg gcgccggttt ctttattgcg caagaaatgc    299700
     ccatgccgat gcgcgggcag gcgtggcgcg gcggcggggt gggttatcca cagcttttcc    299760
     accgcgcttg tggatgaatg cgccgccgcg tgtcacccgg ccgcggcgga tgccgcgccg    299820
     tccagccagc gcgcgtagtc cggtccgctc atggggcggg cgaacaggta gccttgtccc    299880
     tggcggcagt gcagctgcag cagcgcctgg tgctgcggcg ggttctcgat atcctcggcc    299940
     accaccgtga tgcccaggcg ctcggccatg gccagggtgg cggcgaccac gctttcgctg    300000
     cgtgcgtcgc cgggcaggcg gcgcacgaac gaggcgtcga tcttgagttg gttgaagggc    300060
     aggtggcaca gccgctgcat cgacgaaaag ccggtgccga aatcgtcgat cgacaccgtg    300120
     cagcccatca gccgcaggcg caccaggttt tcgagcgtgg ccgcgggcgc gtcgagtagc    300180
     ccgttttcgg tgacttcgat ggtcacgatc gaggcgggca gggcgtgctt gcgcagcgcc    300240
     tgcgccaggg tcggcaacag ctcggccgaa ccgagctgcg aggtttcgaa gttgagcgcc    300300
     aggtcctgcg tggcgccggc cgtggctagc aggcgggcct gtcccagcgc ggcgtcggtc    300360
     aggtgccaga tcaggcggtc gagcaggtcc tgctccttga gcgcctccag gaacgaggcg    300420
     ggaccgagca cgccgaggtc gggatggcgc cagcgcgcca ggacttcggc gccgcagggg    300480
     cgcagggtca gcaggtcgac cttgggctgg aagtagggca cgatctggcc ggcggccagc    300540
     gcgcgggcga cctcgcgcgc gggcggcgcc ggcggctggc ggctggccgt gggggcggcg    300600
     ttggcccggg cgcgctggcg ctcggcctcg tggcggtcca gcagggcctt caggcgttgg    300660
     gcgtccagcg gcttggccag gtcgcccagc acccgcagcc cgatcagcgc cgccatgtcc    300720
     agcaccgccg cgatcaggtc gctgctgaca tcgctgctga tgatgaccgc gccgagcaac    300780
     tgccgtcggg cggccacgcg caggaactgc gcgccatcca tgccggacat cttgatgtcg    300840
     cagatggcga tgccgacctg gccgtgctcg ttcaggcggc gcaaggcttc gttgccgtcg    300900
     gccgcctcga ggatgcgggt gtagccgagc gcgcgcagcg catggaccac gaccaggcgg    300960
     tgggcgggat ggtcttcgac gacgagaatg tcgggcagat tcatgcgtat ccctgggccg    301020
     ccggatcggc gtgagcaacc ctgatgctta tatcgctttg cctgcgtttt tccaagcctg    301080
     ggcggctcag tccttcattg caaatgagaa tcgatattat ctataatcga tgcatcgtgg    301140
     ccttgccgcc tcgctacgcc tgagccattt cgcgccatgc cccacatccc gctccagtac    301200
     gacttgctgc aacaggaata cgccgccttg ctgtcgcagt acggacgcgc gcagacgcgc    301260
     tgcagccgcc tgctgtcgcg gcacgccgag cagatcgcgc aattgcgcca ggaggtcatg    301320
     gtgctgcgcg gcgcgctggt ggcgcagacc agcgccctgg cctgggcccg cgaggaccgc    301380
     gctgccctgg aggcgtccct gccgggcctg ccgcgtcgcc gcgttctggc gcgccgcctc    301440
     gacttcctga tggaacgggt gcaaagcctg ctgcgcgcgc gttccggtgg cacgcccggg    301500
     cccgcgctga tggtcgatgc cagcgcgaag tcggtgctgt gcgtcggcgc gggcggggcc    301560
     gccgcgcggg ccgcgcgcgc agccatcgag cgcgccggcg gccgctttct gcatcacgac    301620
     ggcgaagtcg gcgatgccgc cgggctggaa gccagcctgg tatcggccga cctggtcatc    301680
     tgccagaccg gctgcgtcag ccacggcgcg tactggcgcg tgcaggacca ctgcaagcgc    301740
     acgggcaagc aatgcgtgct ggtcgagcag ccggccgccc tgaacatcgt gcgggtgcgc    301800
     aggcccgccg acgcgccgca ggactgagcg cggcgccggt agtcttgcct tcccggccgg    301860
     ccgcagggat taagcgcgcc gctggcgcgt ctattgcggt atgcattcgt acatcttgcc    301920
     cagtccgtgc cgccaggcgg ccgggctccg atcgtgaagg gcggacccgc ggaccccatc    301980
     gcggatgtcg agctggacgc ctacatcgac ggccagctcg atagcgcgcg gcgcgccgac    302040
     gtcgaggcct tcctggcgcg cgacgcgcgc gcggcggcgc gcgtaagcgc cgacctgcgc    302100
     ctgcgcgatg ccctgcggca aggcgccacg cgccatggcg ccggcgcgcg cgacgcgcat    302160
     acgcgggccc tggccgaccg cctgcaggcg gcccacgccc ggcggcgggt cgcgcgccgc    302220
     gcccggcgcc tgctggcggt ggcgatcctg gtggccgcgg gttgggcggg acatgcggcc    302280
     ctgacggcct ggacgccggc cgagccggcc ggcgacgccg gcgtgcaggt gttcctggac    302340
     gaggcgatgc gcgcgcatcg tacggcgcag ttgcgcgccg gcatgcgctc gcagcccgcc    302400
     gcgccgcgcc tggaccgcgc cgaactggcg cgccaggccg gcgtgccgct gccggcctgg    302460
     ccgtgggatt ggctgccgcg cgatgtgcag gtctttccgt cgcgcggcgg gccagccgtg    302520
     gaggtggcgc tgctggccgg gcgcgcgggc ccgatctcgc tgtatggcgc gccaggcggg    302580
     gcaggccccg acagcgcgcc gcggatggcg cgcggcgcgg gcgccgaggc cttgttctgg    302640
     tggcggcgcg gcgcttgggt ctatgcggtg atcggcgcgt tgccggaggc ggcgctgcgg    302700
     ccgctggcgc agcggctggc cgacgcccct ctggtgcacg agtaggcgag caagcgcgat    302760
     tcggcgcaca atgggatggt ccggccggcg tgcaggcggc gggccggaca cgcagcccca    302820
     tgccggccgt ccggcttgac gcgggtcaag ccggtggatc cggcagggcg ttatggttgt    302880
     gcatccgggc ctggcggcgc cgtgccgcga catgcccggc catactttgg agctcgccat    302940
     gtatcaacac atcctcattc ccatcgatgg ctctgacctg gccaatacgg cgatcgacaa    303000
     gggcctggcg ctcgcgaaag cgctgggcgc ccgcgtcacg gtgctgacgg tggtcgagcc    303060
     ctatccgcac atggccgccg aggccgtgca gctgggcggc ctgcgcaagg aatacgaaaa    303120
     gcaggtccat gcgcgcgcca gcgaatggct ggagcccgcg ggggccaagg ccgcggccgc    303180
     gggagtgccg tgcgagctgc tcaagcgcga cgccgacatg gcgtttcgcg ccatcgtgga    303240
     gacggcggcc gaacggggct gtgacctgat cgccatggcc tcgcacgggc gcggcggcgt    303300
     ggccgcggtg ctgctgggca gccagacgca gaaggtgctg gcgcattcgc aggtgccggt    303360
     gctggtgtac cgctagcgcg gcgccggcca ggcggaccgc gacattgcta tgatggccgg    303420
     cttggcccgc gtccggcggg acgggccgcc cattcgtcgt ttccagaggc cgcatcttga    303480
     atacccccac gcccgtttcc accgattacc tgcgcgcgca ccagttcctg ggtttgcagc    303540
     cggggcccag gttgctggtg ctgggcgcgg tgcacggcaa tgaagtctgt ggcacgcgcg    303600
     ccatcgaacg catcctggcc gagctcgaaa gcggcgcgct ggcgatcacg cgcggccagc    303660
     tgacgctgct gccggtgacc aatcccctgg cctaccgcaa aggcgagcgc cagggcgacc    303720
     gcaatctcaa tcgcaacctg cgcgtatgcg cgacgccgac cgattacgag gaccgtatcg    303780
     gcaatgccct gtgcccgctg ctgcaggcgc acgacgtgct gctggacctg cattccttcc    303840
     acaccggcgg ccagcccttc gcgatgctgg gcccgcgcga caaccaggag gcgctcgagc    303900
     ctttcgcgca tgcccgggag gaggcgcggc tggtggcgca cctggggccg cgccgcgtgg    303960
     tcgagggctg gatgcaggcc tacgagcgcg gcgtgcggcg ccggcgcgag cagaaccccg    304020
     gcgcgcccgc ggccttgctg gacgcggcct atggcgtggg ctccacggag tatttccgcg    304080
     cgcatggcgg ctatggcgtg acgctggaat gcggccagca cgacgacccg gccgcgcccg    304140
     aggtggccta ccgcgccatc cgccagacgc tggcgctgct gggcctggcc gatatcgcgc    304200
     tggagccgcc gcggcgcgac ttcgagacct tgtgcctggt cgacgtggtg gaccgcgagg    304260
     ccgacggcga cgccttcgcg cggccctggg ccagtttcga cccggtgcgg cagggcgagc    304320
     tggtgggcac gcgcgccgat ggccggcagg tgctggcgcc gcgcgacggc tatgtggtgt    304380
     tccccaaccc gcgcgcgctg gcgggcaacg agtggttcta tttcgccgtg gccagcgacc    304440
     gcctgggcga ggatgcagga aattgaaacg gcgcggcgaa cgccttggca tgcgttgcta    304500
     gacttttccg tgggcggcga tccgccgccg gttttcctag gaggtgttca tgtccaagtc    304560
     catagtcctg accctggccg ccgtggccct ggccacgcag gccgggttgg cgcaggccca    304620
     gtatgtcggc ccgtccagca accagcagat gagcgtgaag gaattgctgg acacggcgcg    304680
     cgacgacgcg gtggtgaccc tgcgcggcaa gctggtcaag cagctcagcg acgacaccta    304740
     tctgctggat gacggtacgg ggcgcgttca ggtcgagatc gaccggcacc tgttcccgcc    304800
     caaccagccg gtcgacgcca atacgctggt ggaggtgtcg ggcgagttcg acaaggaagt    304860
     catcggcact tccgaggtcg aggtcaaggc gctgcgcatc ctcggcgcgg ccaaatagcc    304920
     gcaacggtcg gctgcttaca ggcagcgtct cgcttcttaa gattattcct taatttttgc    304980
     ctgtagctgc ctgatttatc tacgtatttg ctgatcggca gggccggtcc gcgcgatcgg    305040
     gcccacggcc gggctgccgc gttgcgccgc gggcggcatt ccctgcaggt cctgcaccgg    305100
     cgcatgggca tggccacccg gtaggcctgc agcaccatca ggcaatcgat gtcgccgagg    305160
     ccctgggcgg cgcacggcga gcgcgccgcc gtctgcctgg cggcctgttc cgcctggtaa    305220
     gcggccacgg cgcgcgccat gcgcgcctgg gcgtgcaggt cgcgcagcag gtccgccggc    305280
     gccgccgcgg ggccggcggc gccgtgcggc cggacggacg gcgccgcgtg gggccagtcg    305340
     tgcgacggcg gcgcggccga ggtgcgcggc ggcaccggcg cgaggcgcgc caggggcgta    305400
     gaccaggtga gggcggcgat ttccatggcg tgctccgagg ccaggcggta cagggttggt    305460
     ccgggccggg cgcccggaag ttccgcggcg ggaaatttgt aaaagtgcag aggcaggcgg    305520
     attaaatcgc catgccgggg gtcatatccc ccatgaccga agaacctccg tccagacccg    305580
     ggccggcgcg cgcgccggcc catccgcttg tctctccgtt ttcgatgacg cgccgcggca    305640
     tgccgcggcg cgcgccgttt gcccgcaagg aatgccgatg ccgttcgaat ggatgaccga    305700
     ccccactgcc tggctggggc tggcgaccct gatcgtgctg gagatcgtgc tgggcatcga    305760
     caacctggtg ttcatcgcca tcctggccga caagctgccc gcgcaccagc gcaaccgcgc    305820
     gcgcatgata ggcctgacgc tggccttgct gatgcggctg ggcctgctgg ccagcatcgc    305880
     ctgggtggtg acgctgaccg cgccgctgtt cacggtgtgg ggcgcgcaga tatccggccg    305940
     cgacctgatc ctcatcctgg gcgggctgtt cctgctgttc aagggcacca tggagctgca    306000
     cgaacgcgtc gagggcaacg cgcacgcggg cggcggcggg cgtacgcagt acgccgcgtt    306060
     ctggcaggtg atcgtgcaga tcgtggcgct ggacgcagtg ttctcgctcg attcggtgat    306120
     taccgccgtg ggcatggtgc aggacctgag catcatgatg accgccgtgg tggtggcgat    306180
     gatcgtgatg atggtggcca gccggccgct gatggccttc gtggctcgcc atccgaccgt    306240
     ggtgatcctg tgcctgggcc tgctgctgat gatcgggttc agcctggtcg cagaaggcct    306300
     gggtttcgac gtgcccaagg gctatctgta cgcggcgatc ggcttttcca tcctggtcga    306360
     ggcctgcaat cagctggcgc ggcgcaacct ggcgcgcggc gcccatgcgc tgggccggcg    306420
     ccagcgcgcc gcgcacgcgg tgctgcgcct gctgcaggcc ggccgcgagg gacgggccca    306480
     tcccgaggaa gtcgccgcgc tggtggccga tacgggcgag gggccgctgt tcgcgccgga    306540
     ggaaagcacc atgatcgagc gggtgctggc gatgggcgag cgcgatgtgc gctcgatcat    306600
     ggtgccgcgc gccgacatgg tgtggctgga cgtgcgcgat ccgcgccacg tggtgctgga    306660
     gaaattcgcc ctgggccatg cgcgcctgcc cttgtgcgcc ggcgacccgg gcaatgtgct    306720
     gggcgtggtg catctgcgcg acctgctgcc gcggctgtcc gcgccggggc cggtcgacct    306780
     ggtcgacgcg gcgcgtccgg ccgcctacgt gagcgagacc acgccgatcc cgcaattgct    306840
     gcagcagatg cgcgacctgc gccagcatct gctgctggtg gtcgatgagc acggggtgtg    306900
     cgtgggcctg gccacgccgc tggacgtcct gacggcggtg gccggcgaac tgcccgatgc    306960
     cggcgacgcc gacccgccga gcgccagccg cttgcccgac ggcggctggt cgctggatgg    307020
     gcggctggcg gtcgaggaag tggcgcgcct gctgcaggcg ccggacctgc ggcgcgacta    307080
     tccggacgcg acgctggccg ggtgcctgct gcgcgccagc ggcgccatcc ccgaggaagg    307140
     ccagggcatg gattggcggc agtggcgctt cgaggtcgag cgccgcgtcg ggccgcgcat    307200
     cgagcgggtg cgcgccacgc gccgcgtcga agcgctggcc gacgaactgg ccggcccggc    307260
     gtaggcgcgc cggccggctc agcgctggcc gtcgtgcacc gagacggctt ccttggtcag    307320
     gccgcccagg cgcgcgtgca cgcgtgcccc ggtgcccatg accagcgcga acaggatttc    307380
     gcgcggacgc ggggcgtcct ggatgccgat ctcgatgctg ttgaaatggc tgcgcacgta    307440
     cgaggcatgg atgtagtgca ccggcaccat catgcgatag ccggccgtgg ccacggcctt    307500
     gaccgccggg accatggcct tgggttcgcc cagcacgctg cgcatcgccc agccgccggc    307560
     ttcgtgccag accgcgccgt gctccatttc gccgtccacg cccacgatgg cggctttgct    307620
     gtagacctcg atgttgtcct tgcccagcgt gtcgaccagc tcggtggcga gcagggtgcc    307680
     cagtgagcgc agctcggcca tgaacggcat caggtcgggc tcgtagcggc ccgcgtaggg    307740
     attgcggatc acggcgcagg aggccgccag cttgagcggc tgcgccggcg ccgggccgtt    307800
     ctcgtgatag gtggtttcga cgatgagcgt gcgcttgcgg atttcgatca aagacatggt    307860
     gtgatcctgt gagcggaggg gttactgggg cgcaatgccg gtttccttga cgatgccggc    307920
     ccatttttcg atttcgctgc gcacgaaggc gccgaaggcg gcggggcctt gcgttttcac    307980
     gctcaggccc tggcgcgcgt aggtctgcgt caactcgggc gcggccagcg ccttgtccag    308040
     cgcgccggcc aggcgctcgg tgaccgcggg cggcaggccg gcgggtccca tcaggccgaa    308100
     ccagacggtc aggtcgaagc ctggcgcgcc gctttcgttg agcgtgggaa tgtcgggcgt    308160
     cagcgcgaag cgcccgggcg tgctgacgcc gtacaccttg accttgccgg cgcgcgcctg    308220
     ctgcaggccg ttggccaggt cggtgaaggt caggtccacc gtgccgccga tcacatcggt    308280
     gagcgcctgc gggccgccgc gatagggcac gggcgtgaca gtgatgtcgc ccatggcggc    308340
     cagcttggcg ccgaacacct gggcgctgcc cgagccgtag gcgtaggtca gcttgtccgg    308400
     gtgctggcgg ccgtagtcat acaggtcggc caccgtcttg cccgcgacat cctgcccgcc    308460
     caccagcagg tacggcgttt cggccaccgc gccgatgggc gtgaggtcgc gcgccgggtc    308520
     gtagggcagg ttcttgaaca ggctgacgcc gctggccgcg gtcgatacgc cgaccaccac    308580
     cagcgtgtag ccgtcgggtt gcgccttgac cacgtcctgg gtgccgatga tgccgttggc    308640
     gccgggcttg ttctcgacca cgacgggctg gccgagttcg gcggccatgc cctggccgag    308700
     gctgcgcgcc acgacgtcgg taatgctgcc ggggggaaac ggcaccacca tgcggatcgg    308760
     gcgttcggga taggcggccg tggcctggcc gatggccagc gccagcgccg ccgtggcgaa    308820
     caggggcttg aacatgtcgg gttgtctcct tggattcgtt ggacggccgc gccttcaggc    308880
     gggctcggtg gctggcgtgc gctgcgccag gaagcggtgg atctcggtgt tgtccgcgcc    308940
     gccgggcagt tgcgccagcg cctgccgcca cagctcggcg cacagcgcca gctggtccgc    309000
     ctgcacgccg gtcagcgcct gcaggctttg cgccgtgccg aggtccttgg ccatcagcgc    309060
     cagcgcgaag ccgccgttgt aggtgccggg gatgatgaac tgcctgagct tggtttcgct    309120
     ggcgacgttg cggccgctgg aggcgttgag cacgtcggtg aagacctcca ggtccagctc    309180
     catgcggcgc gcgatcacca tggcttcgga gacggccagc aggccggccg cgtagacata    309240
     gttgttcagg gccttcatgg cgtgcgccga gccgaccgcg ccggtgtgga tgatggccgc    309300
     gcccatgcgt tccaggatgg ggcgcacccg ccgcaggtcg gcctcggcgg cgccggccat    309360
     gatggccagc gtgccggtgg aggccttggc cacggctccg gagacgggcg cgtcgatcag    309420
     cgtcaggccg cgcgcggcca gctgttcgga caggagccgc gtatcggccg ggttggacga    309480
     gcccatgtcg acgatggcgg cgccggactc gagcaggtcg atcagcccgg gctggccgtc    309540
     gccgcccagc accaccgcgt tggtgatggc gctgttgggc aacatggtga tcaccgcgtc    309600
     gcaggcggcc agttcctgca ggccggcggc cgcgcgcagg cgtttgcccc aggccgggtg    309660
     gccggccagc cgctcgaacg gggcgggcga gcggtcgtag gccaggatct gccagcgctc    309720
     gtcgccggcc aggttttcga gcatcggcaa gcccatcatg cccaagccga cgaaccccag    309780
     tgtctgcatc atgcatattc cttatcgaat gcgccgtatc gatcgccggc acaacccggc    309840
     aatgctaccg atgacggggt ttttgcactt atgcttagtt ggccctgggg tataacattc    309900
     cattatcgat tcaatggaaa ttcggagggc aagggtgcgt ttcaagctca ggcagatgga    309960
     ggcgttccgg gcggtgatgc tgaccggctc gatgaacggc gcggcccgcc tgctgttcgt    310020
     ctcgcagccg gcggtcagcc gcctgatcgc gcatgccgag caaagcctgg ggctgcgcct    310080
     gttcgagcgc gacaagggca agctgacgcc caccgcggag gcgcagcggc tgttcgagga    310140
     agtgggccag ctgttcgacg aggcattgcg catcgacgaa ctggcgcgcg acctggccga    310200
     acgtcccgag ggcgaactga agctgtgttc cagtcccagc ctggcgctga atttcctgcc    310260
     gccggtgaac gcccgctatg tgaacgagca cccccgggtg cgcctgaaat accacaccac    310320
     gctgctttcg gacatggcgc acgagttgct ggggcgcaag gtcgagctgg ccgtctcggt    310380
     gctgcccatc gacaacccca atctggtggt cgagccgttc gccaccggcc atatggtctg    310440
     catcctgccg caaggccatg cgctggcgcg ccaggacagc gtggggctgg ccgagctggc    310500
     ccgcaaccgg ctggtgctgt acagccgcaa tattccgttc ggccagctgg tggcggcggc    310560
     gttccagcgc gccaatgtgc catggcgcgc cacggtcgat atcgtgcgcg cgcggaactg    310620
     gcctgcgcgc tggtgcgcag cggcgtggga gtggccatcg tcgacgagtt ctcggtggcc    310680
     ggcggcggct ggccgggcat cgaggtgcgg ccgctgcgcg aacccattcc gctggccctg    310740
     agcctggtgc gctcgcgctt cgagcggccc ggccgccagg cgcagcgctt cgtcaagctg    310800
     ctgaaggagc acgcccagcg gcgcgccgcc gccgtgcagt gaggcggctt cagcccaggg    310860
     cgcggcgcag cgcctcgaag aacagcgtcg attgcaggcg ttcggaccgg gcctggccgg    310920
     ccacgctggc ggccagcgcg gcgtccaccg gcacgagcgg ccggccggtc gattcggcca    310980
     gcacctgcgc gcaacaggcg cgctcgaggt agtagaggtc atcgaacgcg tagtcgatgc    311040
     gttcgccgca caccaccacg ccgtggttgc ccaggaaggc gatatccgcg ccgtccatgg    311100
     cgcgcgcgat gcgttcgcct tcggccgcgt cgagggccag gccgttgtag cggcggtcgg    311160
     cggccacgcg gccatggaag cgcatggcgt tctgcgacag cgtggtgtcg agcatgcgcg    311220
     cctcggtcag ggtcagcgcg gtggcataag gcatgtgggt atgcagcacg caggccttgc    311280
     cggcgacctg gtggatggcg gcatggatga acatggccgt gggttcgact tcatggcggc    311340
     cggccagctt gttgccggcg gcgtcgacca gcacgatgtc ctcggcgcgc acctccgacc    311400
     acatcagccc gcgcgggttg agcaggaagg cgcccgcctg gcccggcagc gcgacgctga    311460
     agtgattgca tacgccttcg cccaggccat ggtgcgccgc cgcgcgcagc gccagggcca    311520
     ggtcgtcgcg cagcgcggcc acggctgtgt cctggtacag cgatcgggcg gaatcggtcg    311580
     gggcggaggg gggcatggcg gtctcggcga aagcgggtgg ggacgaggga ttgcgcagag    311640
     tctagcagtt gcgtggggcg gtgcgcgttg cgtcaaggga aagcgctggc taccatgcag    311700
     ccacgccacc gcgtccggca cgtcgccggc ccgcgcatcg gatgaggcgc catggaaccc    311760
     atacatcgtc gcagggattt tttgcagcgc gccggcgcct tgctgctgtc gggcacgctg    311820
     ctgggcggtt gcgccgcgcg ccggcccgcg gcgccgggcc cggccgcgcc tgcggccggc    311880
     ggcacgcctg cggcgccggc cgcgccgccg gctggccagc cggtgccggc gctgcgggcc    311940
     ggcgcgcatc gccatcgtgg cgccggcctc ggccatcgcc ggggcggccg acgaggcggc    312000
     cgaatggctg ctggagcgcg gctacgagcc gcaggtcatg ccggcggcgc gggcgcggct    312060
     ggcgccgccg ttcgactacc tggccggcga cgacgcggcg cgcctggccg acctgcatgc    312120
     ggccttcgcc gatccggcgg tgggcgcggt atggtgcctg caaggcggct tcggttcgtg    312180
     gcgggtgctc gaccagatcg actacggcct gctgcgccgg cacgccaagc ctttcatcgg    312240
     ctacagcgac gtcaccgcgc tgcacctggc gatccagcgc tacgccggct tcgtgacctt    312300
     ccacgggccc atgctggcgc aggacctgct ggccgggcgc caggcgccca ccgagcaggc    312360
     cttgctggac atggtgagcg gccggctggg cgccggctca tggatcgcgg cgccgccgca    312420
     ggcgcggctg gccaccctgg ccagcggcgt ggccacggga cgcctgatcg gcggcaacct    312480
     ggccttgctg gccgccttga ccggcacgcg ctacgccatc gatgcgcgcg acggcatcct    312540
     gttcttcgag gacgtcaacg aagccttgcc gcgcgtggac cgcatgctgg cgcaactgcg    312600
     gcgggccggc gcgttcgacg gggtgcgcgg cgtgctggtg ggcagcttca cccggctgct    312660
     gggcgtgccg ggcgacggcg aagcggcgca ggcggcgctg tacccgctgg tgcgcgagca    312720
     tttccaggcg cgcggcattc cggtgctggc cggctggccc agcggccacg gcgaccccaa    312780
     tctcaccttg cccctgggcg cgcgcgtcac gctcgatgcc gggcgcggcg cgctgcggct    312840
     ggagcagcca gtcgccgtct gagccgcgcg gcccgaacgc gcgaacgccg cggcgggcgc    312900
     ggcgttcgca gtacgggcat gagccgtgat cgcggtccta gatcatggac ttgccggtgg    312960
     cgcgcgcgtc gcggatgtca cgccacaggg tgacgatcag caccagcagg acggcagccg    313020
     aaacgacggg ccaggccagg aagtaaagcg tcaatagcat gatggaatct cctgattgga    313080
     acggcggctc agccgcgggc aggctggggt tgggcggcgg gggccgcagg cttggcgccc    313140
     atcatgcgcg ccttctcgta gtggaacgag gtgacgcgct cggccagcag gctgaaatcg    313200
     aagcgctcct ggttgcgcag gctcagggcc acgcagacca cggtgctgac gccgtaggcc    313260
     gtcagcgaac ccagcagcac gatgtattcg cgcagcgtgc cgacgaagca gggcagcagg    313320
     aagagggtcg ccagcgtgcc cagcgtcagg gcggtgacac ggccgaagaa ggcgaagctc    313380
     atcaggccga tcaccacgcc gccgccgatg gccgcgcaga tttcatagaa caccgccacg    313440
     gcgccttcga tcggcaccag ttcgaagcgc acgatggtaa acagcaccac cgccgagatc    313500
     accgaccaga agaaggcgct gttgctgacg cggtcccagt agaagctggc gatgacggga    313560
     aacacgatgg ctccccacag cgcgccgacg aacaccagca tgaccaggat gtccagccgc    313620
     aggctggcga agatcacgcc gaccatggtg gccacgatca tggtcgcgcg gccccaccac    313680
     agcatgcggc gcggatcggg gcggccgccg gccaggttct tggcgtagat gtccgtcatc    313740
     acgatggccg acagcgcggc caggtcggag tcggcggtgg aggacagcga gcccaccacc    313800
     aggatgaaga acagcgcgat cccgacgggc ggcaggtagg tcgaggccat ctgcgggatg    313860
     atgttgttca tgttgccgtt gaccggctcc aggccgacga acaaggccag caggcccagc    313920
     atgcccagtc cgatcaccac cgcgccgtag ccgatggtgg cggtcaggaa ggtcggcttg    313980
     atcaggtcct cgcgcaccgc gaacaggcgc tgggcgatgg tctggttgcc gatggcatag    314040
     gccagtaccg ccacgaagta gggcgcgccc tgttccagga tggccgtggt cgagaagaag    314100
     tcggcctgct cgctgctcag ccgccacatg ttggcctgca gcatgtcggg gccgccggcg    314160
     ttgaagaaaa tgagcgggat gatgatgacc gcggccagga tcatggccac cagttgcgcg    314220
     aagtcggtca tcaccgaggc gcggaacccc gaccacagcg tatacgacag cacgcccagg    314280
     ccggcgatca gcacgccctg gatgaacgac agcgggctca gcaccgagac cagcgcgccg    314340
     gcggcggtga agttgaccat caggctgatg cagctgccga cgatgttgga gacggccatg    314400
     atcatctggc tggacgcgcc gtggcgggcg tggatgacct cggccagggt gtgggccttg    314460
     ggcgccagct ggcggaagcg cttgccgaac gggtagatga acagaatcat cagcgcgccc    314520
     cagaaaccgt agtggatggg gccggacagg ccgtacttga agccggaggt ggcgctggcg    314580
     tagaacgacg cggcccagat ccaggtggcg atcatgctgg ccgccgacag cccgaaaccg    314640
     accgagctgt tggagaccat gtagccatcg acgttctcct tcttctgccc gatcatcaac    314700
     gacatcagga aagtggcgcc gtagaaggcc accaggagca ggacggctgt ggtccctgag    314760
     agttggaaaa attcagactc ttgcatctta tgggtccttt tcccccgctg ggcgcatgat    314820
     tcaccgttca tggccgcatg agtgccgttt ccgcggaagt gcgatgggcg gcaattaccc    314880
     atggcagacc gaaacaccgg acgatcgatg acgtacgcgc gatcgcatgc acgcccgaca    314940
     gggtcgcgat cggcgaggtc cggcgtcagg caagcatcaa gacacaccgc aatggtgtct    315000
     tgctaccgga tcgggttgga tttgtgggcg tctggcgctg cccgatacgg tgtagcaatg    315060
     aaccggcttt gtgggccggc atgttggttc cgcggccgtg gggccgggag gggtgtttcg    315120
     gcacgaatgc cgggccgctg tgcgcagcct ggtgctggac atcaaggccg gtgaacgtct    315180
     tgatgcctgg tgacagtaag aatagaccgc aagtataggg tcaaacgcgc gtcaggtcca    315240
     gccgcgcgcc ggcgccggcg gctgcggcat ggcgcaaacg cagcaggctg gcgatgcccg    315300
     cgatgacggc gaaggccacg cccagccata gcgcggcggg cgctgcggcc gcgccgcgca    315360
     gggtgaacag gccggccacc agcgccgcgc ccagcgactg gcccagcatg atgctggagc    315420
     tggtcatgcc gctggcgccg ccgctgcgtt cgggcggcgc atcggccagc atggcgcgca    315480
     tgttgggcgc ctggaagaag ccgaagccgg ccccgcacag cgccatgcgc cagcccaggt    315540
     cgaaggcgtc cggcgcggcc ggcaacgcca ccagcgacag caggcccgcg gccagcacgg    315600
     ccatgccgat gccgccgagc aggccgggcg gatggcggtc cgacagcgcg cctgcgctgg    315660
     ccgcgctcag cgcggccagc gcaggccagg gcgtgatcag gaagccggtc tgcacctggg    315720
     tgtagcccag caggctttgc agcatgaagg gcagggcgac gaaggccagc gtctgggccg    315780
     cgaaagcgcc cagcgtggcg gcggccgaca gcgcgaagat ggggcggcgc agcaggtcgg    315840
     tggccagcat gggcgcgccg cggcccgatt ggcgcctgag cagcagcgcc agcattgcca    315900
     gcgtggcaag cgcgtaggcg gtgttgccgc cggcgccgac atcgtgcgcg taggcattga    315960
     gcgtatagac cagcaaggcc aggaacagcg cgcacagcag gcccgcgacg gcatcgtagc    316020
     ggcgtgcgct gcgcggggtg ggcggcagcg cgcatacgcc cagcgccagg cccagcggca    316080
     cgttgatcag gaacagccag tgccagctgc ccaggctgag gatcagcgag gccgcagtgg    316140
     ggccggccgc cagcgacagg ctgacgacca gcgcgttcag gcccaggccg cacccgagct    316200
     gttcgcgcgg atagacaaag cgcgtcatgg ccagcgccac gcccaggatg ccggccgcgc    316260
     ccacgccctg cgccagccgt ccggcgatca gccacggcag cgaaggcgcc aggccgcacg    316320
     ccagggaggc cagggtgaac agcaccaggc cggccatgga aatgcggcga tggccgatga    316380
     tctcgcccag cgacgcgatg ggcagcagcg ccgccaccat ggccaggtgg taggcgctga    316440
     tgacccagat cgaactggct tcgcttacgc ccaggtcggc ggcgatggcc ggcagcgccg    316500
     tgttggcgat ggccgattcg agcgtcgcca tgaagacgtt gatcaggatg gccgcgacgg    316560
     cgatggcgcg ggtcgggtgc ggcaggccgg caccggcctg cgcaagctgg ttgagtctga    316620
     aactgagcaa agcggttatc ggagggaggt ggcgggacgg cggcatcggg ccgcggcgcc    316680
     gccgcggggc tggcgaggct gcgcgggcag cggcaaggcc gggggatggc acatggtagc    316740
     ggccgccgct gcccgcgtga aattaaaaat cccactcgtg cccagtgcgt atggcaatgc    316800
     ctacggggat cgacggcggc tacaggcgct ggccgcccgt ggcgtcgatg cgctgcccgg    316860
     tgatccagcg cgcctggtcc gaggccagga aggccacgat gtcggcgatg tcctcgggct    316920
     ggcccacgcg gccgagcgcg atgtcgcgcg ccagcgcgtc ggccatggcg ggatcgcggg    316980
     cgcgcgtgtt catgtcggtg gcggtggcgc cgggcagcac ggcattgacg gtgatgccgc    317040
     gcgcgcccag gtcgctggcc agcaacaggg tcagcgcctc caggccggcc ttggccggcg    317100
     cgtagacgct catttcgggg taggcggcgc gcgtgcccat cgacgagacg ttgacgatgc    317160
     gcccgccgtc gcgcagcagc ggcagcaggt gctggatcag gaagaacggc gttttcaggt    317220
     tgacctggat gatccggtcg aagtcctgcg gggagacctc gggcaggcgc gcgcgcaggc    317280
     ttacgccggc gttgttgacc aggatgtcga ggccttcgtc gccggtctgt tcgcgcaggc    317340
     tggcgcgcag gtcgcgggcc agcgcgccgg cgccgtcggg gtgcgccagg tcggcgcgca    317400
     gcgcccaggc cctgccgccg gccgcgccga tggcctggac gacctcgtcg gcctgttccc    317460
     gcgccgcgtt gtaatgcacc gcgaccgtcg cgccgcaccg gcccagcgcc agggcgatcg    317520
     cgcggccgat gccgcggctg gcgccggtga ccagggcggt cctgccggcc agggacgatt    317580
     gagtggcgac ttgattcatg ctgcgagctc cggttgcgag gttggcgggt gtcggttcga    317640
     tgcgggggac attctcgccc gccagcgcgg gcctgtcatc gccgcgggca ggaacagcag    317700
     gcaaaatcgt cggggcagcg cccgtcaagg cgcgccggcc gcggcgccga ggtaggcgtg    317760
     gaaggcctga gcgagcgggg agcgcacgga cgagcgcagc cagaccatgc cgacctgccg    317820
     cgatgggcag ggatcgggca gcggccagcg cctgacccgc gcatccgcgg ggcccagggt    317880
     tggccagtcg ggcagcacgg agacgccgaa gccttcggcg accagcgccg aaatgtgttc    317940
     gatgccgtcc agctcgaatt gcaccttcgg gcgcacccca tgggcgcgca ggtattcgtc    318000
     ggccatcttg ccggcgacca ccttgcggtc gtactggatg aaaggttcgc gcgccgcgac    318060
     gcgcagggcg ttcccgacgc gcagggcgct gggagccagg aggaccaggc gttcttcccg    318120
     gatgaggctc caggcgcagg tcttgtgcag ctcgaaattc gggtgcacca ggatcgcggc    318180
     gtcgagctgg cccgccatga cgcgctccag caggacggac gaggtgccgg gctcgatgta    318240
     gatctggatg tccggatgcg cccgcatcca gcggcgcagc aggggcggaa ccagccccat    318300
     cagcgccgtg ggcgttgcgc ccagccgcat ggggccggcc ggcaggccgg tgtccgaggc    318360
     ggccgagcgc aggtcgcgct cgccgcgcag caattcgcgg gcgcggtcca cgatgcgcgc    318420
     gccggccacg gtcggccgga ccgtccgtcc cgcgcgcgtg agcagccgcg agcccaggtc    318480
     ggcctcgagg gcgcgtatct gctgcgcgag cgtcgtgggc gccaggccga gccggcgcgc    318540
     ggcgtcggcg atcgagccgg actcggccac cgtgacgaag ctgtggagga atcgcatgtc    318600
     cataaacacg tattttacgt tttatgaaac ttgggagtgc gccttttttt atttattgaa    318660
     gacgcgcgac atcgcgtttt cccattcaac aggcatcagg agacgatcat ggccatcatc    318720
     aagtccatcg aagtctgcgt ggcgcgcgtc ccgatggaca aggtcaccta tctgtccaac    318780
     cgcaccgtcg tggaccgcca ctacgggctg gtgaaagtgc gcagcgccga cggcgtcgaa    318840
     ggcatcggtt tctgctacgt cggcaaccag gccggggaga tcttccgggt cgccgtcgag    318900
     caattgctcg ggccggtgct gatcgggcgc gattcgctgg ccgtggaagg gctgtggcgc    318960
     gagatgtacc aggaagcgct gctgcagggc cgcatgggca cggtcatgcg cgcgctcagc    319020
     gcgctggata tcgccctgtg ggacctgaac gcgcgcgccg cgaacctgcc cctgcacaag    319080
     tacctgggcg ccgtcgagct cgacagcgtg gcggcctacg ccagcggcgg ctattacgtg    319140
     gagggcaaga ccgccgggca gctgggcgaa gagatggcca gctacgtcga gctggggttc    319200
     aaggcggtca agatgaagac cggccgctgg tcgccgcagg gcgagcagtc gcgcgtgcgg    319260
     gccgcgcgcg aggccatcgg cgaggacgtc gagctgatgc tggactgcaa caacggctgg    319320
     gtggataccg tgcaggcgat ggaatacctg cggcgcatgg agccgtacaa cccgtacttc    319380
     atcgaggagc cgttcagccc cgatgacgtg gaaagccacg cgcgcctggc ccggctgacc    319440
     cgcattcccg tggccaccgc cgagatcggc tacggccgct ggtaccacaa gcagctgctg    319500
     gacatgggcg cggccgccat cctgcagacg gacgcggcgg tctgcggggg catcaccgag    319560
     tggaagcgca tcgcggcgat ggcggccggc tacggcatcc agatgtgccc gcactggttc    319620
     cacgatgtgc atgcgccgct ggccgcggcc acgcccaacg cgcggtacgt ggagttcttc    319680
     tgggacgacc aggtgctgaa cttccgccgg ctggtggacc gccagctcga gcacaaggac    319740
     ggacgcgtca tcctgcatca aacccccggc ctgggcttcg gattcgacga gaatgcggtc    319800
     gccaggtacg ggcgctggac gacggagtcc tgaaccggcc gccgcaccct gtacccaacc    319860
     ctcatcggag acaagaaaat gatgaaactt cgcgcggcct gcgcgctggc cgccgccctg    319920
     gcctgcggcg cggtcctggc ccaggacctg ggcggcaagc ccctgaccct ggtggtgccg    319980
     ttcgccccgg gcggcaacgc cgatatcgtg gcgcgctcat acgccgttcc catggcccgg    320040
     ctgatcggcg cgaccgtcgt ggtcgacaac cgcggcgggg gggggggcgg cgcgatcggc    320100
     acggccatcg tggccaaggc gcccgcggat ggcagcacgc tgctttcggc gacgccgggc    320160
     caattgggga ccttgccgca catgttcaag accggctaca agtcggcgga cttcgtgccg    320220
     gtgggcgtgg tgagcaagac ctcgatcgcc ctggtcgtca agcacgacga cgcgcgcttc    320280
     aagaccacgg aggagttcat cgcgtacgcc aggcgcaacc cgggcaggct caacgtgggc    320340
     catgccggac caggctcgcc caatcacctg gccatgctcc agttcgagaa cgcgacgggc    320400
     acgcgcttca cgcccatcgc gtacaagggt tccggaccgg cattgatcga cctgttgtcg    320460
     ggccagatcg acgtcatatt cgaccaggtg agcagctccc tgccgcatct gaaggcaggc    320520
     aagctgtcgg ccctgctgat actgggcccg acgcgcgacc cgagcatcgg gcaggtgcgc    320580
     acgctcaagg aagcggggct gcccgagttc gacgccagca cctatatcgg cgtgctggcc    320640
     cccaagggcg tgccggccga gaccgtggca aagctgacgt cggtcatccg gcaggtggcc    320700
     gacgacccgg ccttcgacag caagctgcgg gaaatcggca gcggggcgtt ctacgccgat    320760
     ccggccgatt tcgcccggat cctgcaggcc gacgaggacc tggccaaggc gatgatccag    320820
     cagggcaggc tgatcgatgg ttgagcgcgc gcgcctggcc gagggcggcg gttgggactg    320880
     ccatttccat gtattcgacg ccagccgcta cacgctggcg gccggcagcg cgtaccagcc    320940
     cgaggacgcc agcctggccg cctttcgcgg cgtgtgccgc gcccgcggga tcggccgggc    321000
     ggtgctggtc catccgagtg tgtacggcgc cgaccacagc agttatgaag acgcgctggc    321060
     agccaacggc gactggctgc gcggcgtggc ggtggtctat cccgacgagg cgaccacgcc    321120
     cgacgcccgg atcgagcact gggatctgct gggcaccgcc ggcacgcgga tcaaccgcct    321180
     gtttcccggc gcgccgcaac atcccgaacg catcgtcgag cgcgtcaagc ccttcggctg    321240
     gcatgtccag gtgctgaccg acatcgtcga ggacatcggc ctggtcaggc gcatcgccgc    321300
     acgcgatgtg cccgtggtgg tcgaccattt cgggcaccac ccgcatgcgc agctgctgcg    321360
     cagcgcgggc tggcaggacc tgcttgcctt ggtgcgggag ggggcggcct gggtcaagct    321420
     gtcggcgccg taccgggtgg gcgcgcaagg cccggcctgg ccgggcgcgc aggcgctggt    321480
     ggaccagctt gtacaggcca atccgcgcca gctcgtgtgg ggcagcgact ggccgcaccc    321540
     gcccgatcac cggcatccgt tcccggcgcc ggaccaggcg gcgatcggcg cgacgatcgc    321600
     gcaatggctg ccggacgcgc aactgcgccg ccaggtcatg gaactgaatc cgctgcgcct    321660
     gtacggcggg acgcgcgccg ccgggcgctg agcgccagcg cggcgcggca ggcgggttgt    321720
     ttacactgga gcggcacata cacccgcccg gccgcggccc tgcgccgcgg acgcggactt    321780
     cgatggagcg agtgccatgt tcagtcatgt gaccgtgggc gtcagcgatc tggcgcgcgc    321840
     cggacgtttc tacgatgcgc tgctgcagcc gctggggctg cgccagcggc agacgcagcc    321900
     cgatggcggg ccgccttcgt tgtgctgggt gcgggccggc acgagcctgc cgcgcttttt    321960
     cgcctatatg ccgttcaacg gccggccgcc cagcccgggc aacggcgcca tggtggcttt    322020
     cctggcgcag acgccggagc aggtcgaccg ggcccacgcg gccggcctgg ccgccggcgg    322080
     cagcgacgaa ggcgcgccgg gaccgcgggc gcgctatggg ccgggctact acggcgccta    322140
     tctgcgcgat cccgacggca acaagctgca cgtcgtgcat cgcagcggcc cggccgccgc    322200
     gggctaggtg tcgattctca ataggttatt cacatctggg atacgcgtga tgggtggctg    322260
     atgtccgaga gcggagtgtg gccgacacca gttgtagcgg tcaatgaagg gctgcaaggc    322320
     agcctgtcgt tcggctgagc tcgtgtaggg cctggcgtat gcccactccc gtaagcaggt    322380
     ctgcacgagg cgctcggcct tgccgttggt cttgggggtg taggggcggg tgcggatgtg    322440
     acggattccc agctccacgc acaccgcccg aaaggtcctg gagacgtagc cgctgccgtt    322500
     gtcggtcatc acgcggtcga tgcgcacgcc cagactggcg tagtaggcgg tggcttggcg    322560
     caggaactca gcgcactgat cgccgccctc atcgtcgagg atgcgagcaa aggacacgcg    322620
     cgagaagtca tcgatggcca ggtgcacagc gtcccagcca atgccgcggt tgcggttctg    322680
     ggcccgatcg ccggtgatgc gatggcccac gccccggatg cggcccagcc gcttggtgtc    322740
     gatgtgcagc agctcgcctg ggctggcgcg ttcatagcgg cgcaccggcg ccggcggctc    322800
     cagcgaggcg agtcgactca ggccgatgcg ttccatatac cgcgccacgg tggccaggct    322860
     gcggccggct tcacgcgcga tgcgccacag cggcagacgc tggcggcgct gctgggcgaa    322920
     gtgctcaacc tgctcgggcg cacaggcctt cgggctgcgg tgcgggcgag aactgcggtc    322980
     aagcaggccg tccagacctt cgcttcggaa gcgggcaagc cacttgtaac cggtgcgcag    323040
     gctcacccct gccgcctggc tggcctgcct catcgtccag ttctgttgca tcaccctgtt    323100
     aacaagaagg gctcgaccta ggcgggtcaa tcgcgcatgc ttatggttgt tcatccagtg    323160
     tcctgccctg agttgcgatg gcgtggtaac cacagcatcc caggtccggc ctggatgaac    323220
     aacctattga gacatcacac ctagagcagc ttggtgccca gcgggacgtc gcggtcgggc    323280
     acgcacagcg cgacttcgcc ctgcgcgtta tggaagccgg tgaccaggca ttccgactgc    323340
     agcgggccga tctgcttctt cggaaaattg accacggcga ccaccagtct gcccagcagc    323400
     gtctcgggct gatagaggtg cgtgacctgc gcgctggact tcttcacgcc gatctcggcg    323460
     ccgaagtcca cgtgcaggat ataggccggc ttgcgggcct cgggaaacgg caaggcctgc    323520
     acgatgcggc cgacccgcag ttcgaccttg gcgaaatccg tccagtctat gagttgcatt    323580
     gttggttcga tccgttgcta gtaggcgggc gctgatctta acgcgcgctg ccgcgccggc    323640
     gcgcgctata ttgcttcacc atccttgaca tggcccgggc aggacgcgag gccccgtagc    323700
     cacgggatcg cgcgcaccga tggccgggcc acggccgccg ccgcggcggc aggccggata    323760
     tccgatcgat cttgactatt cttggcaaat caacgacggt tatgggcgct tgaaacgaag    323820
     cgcatcttca ccagtgccgc aacgcgtgcg aggaacggcg ataccctcgg tgcgcagtcg    323880
     cgttcgcggg cgggaagatc agcataatac gaaccggcgc cgtcagcgat gccaggcgca    323940
     gcagtgcgac tcagctttgg gacaaacgat gtactttccc ttgcgcaagg ccttgttaac    324000
     cgggttatgg actgctgccg cgttgggcgc ggtgatcgga ccaagtctgc tcgccgtgga    324060
     catggtgcgc gagtacgggc tgcggcaaca gcgcgagcag gcccaggtcc tggcgcaacg    324120
     gttgctgggc cgcatcggcc tgaccgccga ccgcctgctg cgcatccatc gcgagctggt    324180
     gcacaccggt ggctccagcc cttgcgcgcc ttactccacc tacctgatgc agcagcaggt    324240
     gctgcgtttt ccggatgtgc gcgccgtcgc ctacgtggaa gagggccgcg tgctctgttc    324300
     ctcgctgggc gacacggtga ccggcgtcga tctggggccg agcgatttca ccaccggcaa    324360
     ccgtatctcg gtgtggaact cggccgtgtt gccggccgcg cccgagacgc cgttcagggt    324420
     gttcgccaag gaaggctacg ccatcatcat ggagcgcgaa agcaccaacc agctcggtgg    324480
     cgcggtgccg caagcgatgg ccgcggtctc gttctcgggg acgcccgacg atgccatcgt    324540
     atggggcgaa ctgccgcgcg catggttcaa gcgggcgcgc gagagcaacg cgttcgtcga    324600
     cgacaaatac gttgttgcgg tgcagcgttc caccgcccaa gggctggtgg cgctgggcgc    324660
     ggtggcctcc tcgcagggcg cagaggcctt gcagcggctg gccatcctgc tggtgccgct    324720
     gagcgcggcg gccgggctgg gcctgctggt cggggccgtg atcctggcgc gcaggcagtt    324780
     cagcctgcct cagctgatcc gctccgggct gcggcgcaac gagttctaca tggtctacca    324840
     gcccatggtc gaagtgggca ccggccgctg cgtgggggcg gaagccttga tccgctggag    324900
     gcgccgcaac ggcgacctga tcgcgcccga cgtgttcatc gacgaggccg agcgcgtggg    324960
     gctgatcggc aagatcaccg agcgagtatt cgaattggtg tcgagcgatg tgcagcgctg    325020
     gcgcggccgc ctgggcgatc tctacatcag catcaatgta tcggcggccg acatggcctc    325080
     gggcgcggcc gagcgcctgc tgagcgaaat gttcgcgcgc acggggctga cgccgtcgca    325140
     ggtggtggtc gagctgaccg aacgggcgct gctgcactcc gacgaggcgg tggcggcgat    325200
     caagatcata cgcaagatgg ggggacgggt cgccatcgac gacttcggca ccggctattc    325260
     cagcctggcg tatctcacct cgttcgaggt cgatggcctg aagatagaca agcgcttcgt    325320
     cgacgccatc gggcgcgatg cgcccagcag cagcgtgtcg gtgcacatca tcgaaatggc    325380
     gaagtcgctg ggcctgcgcg tggtcgccga gggcgtcgag accgccgggc agcagcgctt    325440
     cctgagcgag catggggtcg actatgcgca gggctggctg ttcgggcgtc ccatgccgct    325500
     caacgagctg ctggcgatgg cgcgccggcc gccgcccggc taggcaaaac gaagcatcat    325560
     cctcccgcgc gcgggcggca gatagcggga taagtggcca tgcgtggcat ctgatcctcg    325620
     aattggcccc aggcggcgcc gatacactgg gcccagacaa agagcagccg ggtgccggac    325680
     cacccgccac gagggggatg ccatgcgcag gaatttgccc gtcaccgggc acgagttcgt    325740
     attgcaggat gaccagtatc tcatttccaa gacggacttg aaggggcgca tcacctactg    325800
     caacccggcc tttatcgcca tcagcggatt ctcgcgcgaa gagctgctgg gccagccgca    325860
     taacatcgtt cgccacccgg acatgcccga agacgtgttc gcggacatgt gggccacgct    325920
     gcaggcgcgc aagccctggc tggcggtggt gaagaaccgg cacaagtccg gcggcttcta    325980
     ctgggtgctc gccaacgcga tgcccgtgat cgaggcgggc aacgtgacgg gctatgcctc    326040
     ggtgcgggtc aaggccacgc aggcgcagat cgaggccgcc gagcacttct atgcccaggt    326100
     ggaaagcggc cggatgggcg gccatggatt gcgccacggt caacgcgtgc cgcgcggctg    326160
     gcggcgcgcc gcccgcgcgc tggcgtttcc gttgcgcaag ggcgtgcggc ctgccttgct    326220
     gcggctggcg gccgccatgt gcggcctggc ggccattccc acctacttcg ccatcggcgc    326280
     catgccgccg gaggccgcgc cgtatggctg gggcgcctat gcgctgggtg cgctgggcgc    326340
     ggtgctggcc gcgatggcgc tgggcggccg gttcggcagg caactgcgca atgccgagga    326400
     ggtggcgcgc cagatcgcgg ccggcaacct ggtcaacgag gtggactcgg gcgtcggcgg    326460
     cgagatgcgc aatctctatt tctacctgga catcatgcgc aagagcctga tcggcatctc    326520
     caccgaggtc atcggcaaga cgtccgagca tgtgcatacc atctcgcgcc tgcgcgagga    326580
     cagccagggc ctggccgcgc gcaccgaggc gcagtcggcg gcgctgcagg acaccgccag    326640
     cagcgtggag caactggccg agacagtcac ccgcaacgcc gaaagcgccg gggtggcggc    326700
     ccggctgacc caggaaagca gcgaggtggc cgcgcaaggc ggcgccgtgg tcggcgaact    326760
     ggtggcgacc atgcaggggc tggacgcgag ttcgcgcaag atggccgaga tcgtatccgt    326820
     gatcgaaggg attgccttcc agaccaatat cctggcgctg aacgccgccg tcgaggcggc    326880
     gcgggccggc gagcagggca agggcttcgc ggtcgtcgcg gccgaggtcc gcagcctggc    326940
     gcagcgcacc gctcaggccg ccaaggaagt caaagtgctg atcgacgatt cggtggggcg    327000
     catgtccacc ggctcggccc aggcgggccg ggcgggcgag acgatgcgcg agctggtgca    327060
     gtcggtcgag cgcgtgaccg ccttgatggc cgagatttcc accgcctcgg gcgagcaatc    327120
     gaccggcgtg gcgcagatca gttccgccgt gcaccgcatg gaggaggtgg tgcagcagaa    327180
     cgtctccatg gtgggcgaac tgacccacgt cgccgagcac ctgggccagg agtcggggtc    327240
     gctggtcgag gccatcggcg tattccgcac ccccggcgcg ggcgcgcgcg cgatcggcat    327300
     gccggagcag gcgccacggc gcgcgcctgc gcgcaccctg ttgctggccg agcacccctg    327360
     agcctgccgg cgcctcgcgc gccggatctc cgcttgcctc cacacgcggg cagggcagtc    327420
     atgcccgccc gcgttttgcc gtgcccgccg gggaataaat cgccctgaat gtaacaattt    327480
     gcgtaatata tcgcggcaat tgctggcaat ttccgcctcc gagggcgtct ggtcggggct    327540
     ctctggcatg gctttgccaa aattgacaat accaaattgt tcatactcgt atactttagt    327600
     tactgcagct tcgggtcggc catcaacccc gccgtccgga gccgcggcaa tgaccggggg    327660
     acattgcgtc accaggaacg tcaggccttc tttccgagca ccttgcaata tggccatatc    327720
     cgatgcgaat cgcggcggcg cgccaggcgc tgcgccgggt cccgacccgg ctcatatcct    327780
     gcatgaactc gccggattga tggccatttc tccggggcgg gacttcctgg acgagctggt    327840
     caaccgcgcc gtccagcgcc tgggcgtgga ctatgcgtgg gtggtgttgc atggcgccaa    327900
     gggcgagcat gccaggaccg tgctcagcgc caactgccgc atgcgctgga acggggcgga    327960
     gagctacctt gccacgggcc agagcgcgct ggccggcgtg ctgtcgcacg ccacgcaata    328020
     tgtgtgcgcg cgggacctgg agcggcacgt gccgggcgac ctggcgctgc ggcgcctggg    328080
     cgcgcaggcc tgcgtggcgc atgccttgcg cgacgagtcg ggattgcagc gtgggcatgt    328140
     cgcgttcgtg ttcagcgagc cgcttgccga cccggccatc tatgtgagcg cgctgagcgc    328200
     ctgcgcggcg ttcaccgagc gggccgtgct cgcgctggac gccgagcgca aggcgcgcca    328260
     ggaagcgctg cagcttgcca gccgctacca ggccttgttc gagaaggcgc cggtgctgat    328320
     caatgccttc gacgcgcgcg gcaagtgcat cctgtggaac ctcgagtgcg agcgcaagtt    328380
     cggctggtcg atggaggaag tcaacaacca tcccgagccg ctggcgctgt tctaccctga    328440
     tccgcagacg cgcgcgcgcg tggtggcctc ggtcagccag gcgccgggcc gagccttcga    328500
     ggaatggcat ccggtcaccc gcgccggcaa ggtgctgtcc acgctgtggt ccaacatcgt    328560
     gctggagtcc ggcacgatcg tgaacatcgg gttggacatt accgaacgca agcgcgccga    328620
     actggcgctg acccggctgg ccacgataga cagcctcacc gattgctgga accgcgccga    328680
     gatattgaag atcctgcgcc aggaaatcac gcggctgcgc cagcatcccg accagccgct    328740
     ggccgtggtg atgctcgacc tggatcactt caagcagctc aacgatctcc acggccatct    328800
     ggtcggcgac gcggcgttgc gctatttcag cgaccagttg cgctcgaacc tgcgcggcac    328860
     ggatttcgtc ggccgcatcg gcggggaaga gttcctggcg ctgttgccgg gctgcgacgg    328920
     cgacgccgcg ctggccatgg ccgaccggct gcgggcggcg ctgcgcaacg acccgttcac    328980
     caccgaaggc caggccgcgc ccttgtcggt cagcgtgggc attgcgttcg cgacgccgga    329040
     agacaccgcg gtgtccgacg tcatgcggcg cgccgacacc gcgctgtacg aggccaagcg    329100
     gcgcggccgc gaccgcgccg tcgtctactt cggctgaccg gcccgccgcg tgcgccggcg    329160
     ccgtctgcta taaggcagga cggcacatat cggtggaagg catcatgcag cgcttgcagg    329220
     cgtcgctcga acgacggcag gtcggtatct atttcgcggc gatggcgctg ggcgccgtgc    329280
     tggcctggca ccggcccggc ctgcaggtgg gcgaggccac gctcaatctc atgctggccg    329340
     gcatgctgtt ggcgaccttc atgcaggtgc cgctggccgg ctggcgcgcc acgctgcccg    329400
     gcatgcggtt cctgggggtg ctgctgagcg tgaacttcgt gctcgtgccg gccctggtct    329460
     ggggcctggc cgcgctgttg ccggccgacc ccatgatccg cctggcggtc ctgctggtgc    329520
     tgctcgcgcc ctgcatcgat tatgtcgtga cgttcgcgca attgggccgt gccgacgccc    329580
     gggccctgct ggcggccact ccggtgctgc tgtgcgggca gatgctgctg ctgccgctct    329640
     acttgaacgt catgctgggc agcgatgccg ccgcgctgat tcgtcccggt ccgttcgtgc    329700
     aggcctttgt ctggctgatt gccttgccat tggcggctgc aacgggcgtg cagtgggcgg    329760
     ccgcgcggtc ggcagcctgg cgcggcgcgg ccagcgtggt cggcctgttg ccggtgccag    329820
     cgaccgcgct ggtgctggcg accatcgtgg ccgctgtcgc accgcgcatg gcgctggccg    329880
     gcgaggccgt atcgcgggtc gtcccggtgt atctgctgtt cgccgtcatt gcgccggccg    329940
     cgggctggct ggccgcgcgc cgcgcccgtc tggcggcgcc acaggcgcgc gcggtcgcgt    330000
     tcagcgccgg tacgcgcaat tcgctggtgg tgctgccgct ggccctggcg gtgcccggcg    330060
     gtgtgccgct gttgcccgcg ctgatcgtgg cgcagacgc