(data stored in ACNUC7421 zone)

EMBL: BX640431

ID   BX640431; SV 1; linear; genomic DNA; STD; PRO; 347894 BP.
XX
AC   BX640431;
XX
DT   09-AUG-2003 (Rel. 76, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 8)
XX
DE   Bordetella parapertussis strain 12822, complete genome; segment 9/14
XX
KW   complete genome.
XX
OS   Bordetella parapertussis
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Alcaligenaceae; Bordetella.
XX
RN   [2]
RP   1-347894
RA   Sebaihia M.;
RT   ;
RL   Submitted (06-AUG-2003) to the INSDC.
RL   Submitted on behalf of the Pathogen Sequencing Unit, Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA, E-mail:
RL   ms5@sanger.ac.uk
XX
RN   [3]
RA   Parkhill J., Sebaihia M., Preston A., Murphy L.D., Thomson N., Harris D.E.,
RA   Holden M.T.G., Churcher C.M., Bentley S.D., Mungall K.L.,
RA   Cerdeno-Tarraga A.M., Temple L., James K., Harris B., Quail M.A.,
RA   Achtman M., Atkin R., Baker S., Basham D., Bason N., Cherevach I.,
RA   Chillingworth T., Collins M., Cronin A., Davis P., Doggett J., Feltwell T.,
RA   Goble A., Hamlin N., Hauser H., Holroyd S., Jagels K., Leather S.,
RA   Moule S., Norberczak H., O'Neil S., Ormond D., Price C., Rabbinowitsch E.,
RA   Rutter S., Sanders M., Saunders D., Seeger K., Sharp S., Simmonds M.,
RA   Skelton J., Squares R., Squares S., Stevens K., Unwin L., Whitehead S.,
RA   Barrell B.G., Maskell D.J.;
RT   "Comparative analysis of the genome sequences of Bordetella pertussis,
RT   Bordetella parapertussis and Bordetella bronchiseptica";
RL   Nat Genet 35(1):0(2003).
XX
DR   MD5; bc52d90961968c1a83b0e392f3d5e630.
DR   ENA-CON; BX470249.
DR   BioSample; SAMEA1705915.
DR   EuropePMC; PMC540052; 15608199.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00504; Glycine.
DR   StrainInfo; 494019; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..347894
FT                   /organism="Bordetella parapertussis"
FT                   /strain="12822"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:519"
FT   CDS_pept        149..1078
FT                   /transl_table=11
FT                   /locus_tag="BPP2581"
FT                   /product="putative ABC transport protein, inner membrane
FT                   component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2746"
FT                   /db_xref="GOA:Q7W7D9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7D9"
FT                   /protein_id="CAE37875.1"
FT                   /translation="MDIFTQQIINGLTLGSVYALVALGYTMVYGIIGLINFAHGDVVMI
FT                   GAMAATMVAAALVGGDPSTSAFAVLGAGLLVSVPLCMAVGWTAERVAYRPLRRAPRLAA
FT                   LITAIGVSIILQNVAMMVWGRNYLNFPQVLTPAVFEIGGARMSMLQIAIVVIAALIMGA
FT                   LLLVVHKTRLGTAMRATAQNREVAGLMGVNINTVISAAFLIGSALAAIAGMMVTTYYGV
FT                   SQYTMGFMLGLKAFTAAVLGGIGNLVGAMAGGLLLGIIESLGSGYIGDLTGGFLGSHYQ
FT                   DVFAFVVLVMVLIFRPSGLLGERVGDRA"
FT   misc_feature    158..1063
FT                   /note="HMMPfam hit to PF02653, Branched-chain amino acid
FT                   transport system / permease component, score 3.1e-52"
FT   misc_feature    join(191..259,272..325,338..406,452..520,584..652,713..781,
FT                   794..847,860..928,986..1054)
FT                   /note="9 probable transmembrane helices predicted for
FT                   BPP2581 by TMHMM2.0 at aa 15-37, 42-59, 64-86, 102-124,
FT                   146-168, 189-211, 216-233, 238-260 and 280-302"
FT   misc_feature    578..625
FT                   /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature."
FT   CDS_pept        1075..2163
FT                   /transl_table=11
FT                   /locus_tag="BPP2582"
FT                   /product="putative ABC transport protein, ATP-binding
FT                   component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2745"
FT                   /db_xref="GOA:Q7W7D8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7D8"
FT                   /protein_id="CAE37876.1"
FT                   /translation="MTRQPNTSGLSARNLVGIALIGIVLAVLPFVLGMAGQSWVRILNF
FT                   ALLYVMLALGLNIVVGFAGLLDLGYIAFYAVGAYTWALLASPHFGLHLPFWAILPMALG
FT                   VACVFGVLLGAPTLKLRGDYLAIVTLGFGEIIRIFLNNLNAPVNITNGPQGINRIDAFK
FT                   VGDFAFGRTETILGIRFTGPEKYYYLLVLLTLLIIVVCVRLQNSRIGRAWEAIREDEIA
FT                   AKAMGINSRNIKLLAFAMGASFGGVAGALFAAMQGFVSPESFSLTESISVLCMVVLGGM
FT                   GHIPGVILGAVILAVLPEFLRAVVEPAQHLLFGAVVLDPEGIRMLLFGLAMVCVMLFRP
FT                   AGLWPSAVRKRELSSTRQGGAA"
FT   misc_feature    1075..1179
FT                   /note="Signal peptide predicted for BPP2582 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.840) with cleavage site
FT                   probability 0.326 between residues 35 and 36"
FT   misc_feature    join(1111..1179,1189..1257,1276..1329,1357..1425,
FT                   1444..1497,1630..1686,1777..1845,1888..1956,2050..2118)
FT                   /note="9 probable transmembrane helices predicted for
FT                   BPP2582 by TMHMM2.0 at aa 13-35, 39-61, 68-85, 95-117,
FT                   124-141, 186-204, 235-257, 272-294 and 326-348"
FT   misc_feature    1177..2118
FT                   /note="HMMPfam hit to PF02653, Branched-chain amino acid
FT                   transport system / permease component, score 5.9e-41"
FT   CDS_pept        2160..2963
FT                   /transl_table=11
FT                   /locus_tag="BPP2583"
FT                   /product="putative ABC transport protein, ATP-binding
FT                   component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2744"
FT                   /db_xref="GOA:Q7W7D7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7D7"
FT                   /protein_id="CAE37877.1"
FT                   /translation="MSRILHAQGLGKRFGGLRALSEISFDIEAGEIYGLIGPNGAGKTT
FT                   LFNVLTGLYVPEEGQCEFNGMSLIGKKPHEVAAAGLARTFQNIRLFANLSAIENVMIGR
FT                   HVRTHAGVLGAVLRTRAERAEEAAIERRAQELLEYVGIGHRANDVARSLPYGDQRRLEI
FT                   ARALATDPRLLALDEPAAGMNASETVVLRQLIEKIRTDGVTVLLIEHDMKLVMGLCDRV
FT                   LVLEYGKVLSMGRPAEVQRDPKVIEAYLGAGAAHDPELHTTEQAP"
FT   misc_feature    2247..2843
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1e-55"
FT   misc_feature    2268..2291
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    2400..2447
FT                   /note="PS00063 Aldo/keto reductase family putative active
FT                   site signature."
FT   CDS_pept        2960..3691
FT                   /transl_table=11
FT                   /locus_tag="BPP2584"
FT                   /product="putative ABC transport protein, ATP-binding
FT                   component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2743"
FT                   /db_xref="GOA:Q7W7D6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7D6"
FT                   /protein_id="CAE37878.1"
FT                   /translation="MTASQALLELRGLQVAYGGIRAVRGIDLRVDPGELVCLIGANGAG
FT                   KSTTLRAICGLVPLAGGQVLYDGHSIGGQPSFALVRKGLVMVPEGRGIFGQLTIEENLA
FT                   MGAHVRRDAAQVRQDTQRVFTLFPRLAERRRQAAGTLSGGEQQMVAMGRAMIARPRLLL
FT                   LDEPSMGLAPLMVDKVFEVVRTIAAEGVTILLIEQNARLALEHADRGYVMESGEITLSG
FT                   PAREMLHDPKVRAAYLGEVEA"
FT   misc_feature    3056..3607
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   7.1e-48"
FT   misc_feature    3077..3100
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    3380..3424
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        complement(join(3749..4093,4457..5038))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2586"
FT                   /product="Putative membrane protein (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2742"
FT                   /note="Similar to Rhizobium loti transmembrane transport
FT                   protein MLL4118 SWALL:Q98ER5 (EMBL:AP003003) (446 aa) fasta
FT                   scores: E(): 6.1e-42, 46.62% id in 414 aa, and to Ralstonia
FT                   solanacearum putative transport transmembrane protein
FT                   RSP0107 or RS03015 SWALL:Q8XTK1 (EMBL:AL646076) (432 aa)
FT                   fasta scores: E(): 6.7e-34, 38.96% id in 426 aa. Note: The
FT                   central and missing part of this CDS reads on the opposite
FT                   direction, BPP2585"
FT                   /db_xref="PSEUDO:CAE37879.1"
FT   misc_feature    complement(join(3785..3850,3881..3946,3983..4048,
FT                   4460..4516,4529..4594,4634..4699,4712..4777,4805..4870,
FT                   4931..4987))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPP2587 by TMHMM2.0 at aa 28-47, 67-89, 98-120, 124-146,
FT                   159-181 and 185-204"
FT                   /note="3 probable transmembrane helices predicted for
FT                   BPP2585 by TMHMM2.0 at aa 10-32, 44-66 and 76-98"
FT   CDS_pept        4104..4460
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2585"
FT                   /product="Putative membrane protein (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2742"
FT                   /note="Similar to Rhizobium loti transmembrane transport
FT                   protein MLL4118 SWALL:Q98ER5 (EMBL:AP003003) (446 aa) fasta
FT                   scores: E(): 4.9e-31, 68.54% id in 124 aa, and to Ralstonia
FT                   solanacearum putative transport transmembrane protein
FT                   RSP0107 or RS03015 SWALL:Q8XTK1 (EMBL:AL646076) (432 aa)
FT                   fasta scores: E(): 6e-26, 56.91% id in 123 aa. Note: This
FT                   CDS is an internal region of the pseudogene reading in the
FT                   opposite orientation BPP2586"
FT   misc_feature    join(4248..4316,4344..4412)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP2586 by TMHMM2.0 at aa 49-71 and 81-103"
FT   CDS_pept        5135..5737
FT                   /transl_table=11
FT                   /locus_tag="BPP2588"
FT                   /product="putative TetR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2741"
FT                   /db_xref="GOA:Q7W7D5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7D5"
FT                   /protein_id="CAE37881.1"
FT                   /translation="MSRKSAPSSTAAPAPKLAADRIRATARELFYREGIRAVGVDAIVS
FT                   AAGVTKPSLYRSFSSKDELAASYLRDYEAEFWSRFDAGAQRYPDDPRAQLRLYLESLAR
FT                   RAVAAGPYRGCGLSNAAVEYPDPDHPARLVAETHKRELRKRLVEMARRMGAREPEILGD
FT                   GLMLLIEGAFISGQLFHGDGPARHVALLADRLIEASL"
FT   misc_feature    5135..5188
FT                   /note="Signal peptide predicted for BPP2588 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.877) with cleavage site
FT                   probability 0.766 between residues 18 and 19"
FT   misc_feature    5198..5338
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 7.4e-15"
FT   misc_feature    complement(5787..5794)
FT                   /note="Duplication due to IS1001 insertion"
FT   repeat_region   5795..5807
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS1001 element"
FT   repeat_region   complement(5795..7101)
FT   CDS_pept        complement(5798..7018)
FT                   /transl_table=11
FT                   /locus_tag="BPP2589"
FT                   /product="transposase"
FT                   /note="transposase for IS1001 element"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTN6"
FT                   /protein_id="CAE37882.1"
FT                   /translation="MLDRKLLESLGGWQGYGVERVEWPEDPGRTLSIYLKPTAKVMLCE
FT                   QCGARCRQVHETTVRRVRDLPLFEYRVVLHVPRRRLWCEQCGGPRLERLAWLGRYQRVT
FT                   DRLAQACSQLLQSSNVQAVARFFELGWHTVKTLDKARLRASVREPDWSKIEYLAMDEFA
FT                   LHKGHRYATVVVDPIGRQVLWIGPGRSRETARAFFEQLPPGAAQRIKAVAIDMTTAYEL
FT                   EIQAHSPQAEIVYDLFHVVAKYGREVIDRVRVDQANQLRQDRPARRIIKSSRWLLLRNR
FT                   DNLDRQQAVRLDELLQANQPLLTVYVLRDELKRLWFYQRPAWARQAWNHWYEQAEQSGI
FT                   AALNTFAQRLKGYLHGILARCRHPLNTSIVEGINNTIKVIKRRAYGYRDQEYFFLKIRA
FT                   AFPGNAR"
FT   misc_feature    complement(5939..6928)
FT                   /note="HMMPfam hit to PF01610, Transposase, score 7.9e-128"
FT   repeat_region   complement(7089..7101)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS1001 element"
FT   misc_feature    complement(7102..7109)
FT                   /note="Duplication due to IS1001 insertion"
FT   CDS_pept        join(7285..7548,7550..10246)
FT                   /transl_table=11
FT                   /gene="bapC"
FT                   /locus_tag="BPP2591"
FT                   /product="putative autotransporter"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2738"
FT                   /note="bapc seems to undergo phase variation at a poly C"
FT                   /db_xref="GOA:Q7W7D4"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR003992"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7D4"
FT                   /protein_id="CAE37883.1"
FT                   /translation="MNDRKSNSVSPVARYLRFGVAAVAGVAAGALPSSDVDAQAAPAAA
FT                   AAAKIEALSDTDIYSDYEHGIVMAPDNKDYISYKPAEGGPEAPSPFKPAPYVSLGNDVV
FT                   AERIRVDVRGNETLGVYVDSEHRSLTVRDSRIDAYGKPPSIESPNYYGAAAVYAGTLNI
FT                   ENSTVRHNYAAQPFEDAVGVGVTALGEKAILNVTDSEVSGTRGAVVGWGGEATFTNSIV
FT                   RGSTFGLYAEMCDTCRDDDGTSPSIRIKGGVVQGGVGANNVAVAVAGAGKVAIENAELL
FT                   GASGVYATFGVGVDMKGGRILAHNTNVVASQDYADGPYGGVVLTDGSQVNLEGVKVRAT
FT                   GQEAAGLWLLGGKDTSPRASLRNTDVHGEVAAIALGFNGEADISGGSLSAEEGGAVLTT
FT                   LAPDEVEYYYDYSLSMERPAADAPLTPVHVTLSDGARASGETLIAHGGLLPMTLRLSSG
FT                   ADARGDIVTLPPSAPPDFAEQPDAEPKPDAAAQSDAKAKARVMAQVDGGEPVAVPIPAS
FT                   SHPDAPIDVFIDSGAQWRGITKTVNALRIEDGTWTVTGSSAVNSLHLQAGKVAYATPAE
FT                   TNGKFKHLRVKTLSGSGLFEMNASADLSDGDLLVVSDEASGQHKVLVRGAGTEPTGVES
FT                   LTLVELPKGSQAGFTLANRGGVVDAGAFRYRLTPDNGVWGLERTSQLSAVANAALNTGG
FT                   VGAASSIWYAKGNALSKRLGELRLDPGAGGFWGRTFAQKQQLDNKAGRRFDQKVYGFEL
FT                   GADHAIAGQQGRWHVGGLLGYTRARRSFVDDGAGHTDSAHIGAYAAYVADNGFYFDSTL
FT                   RASRFENDFTVTATDAVSIRGKYRANGVGATLEAGKRFTLHDGWFVEPQSEVSLFHASG
FT                   GTYRAANNLSVKDEGGTSAVLRLGLATGRRIDLGKDRVIQPYATLSWLQEFKGVTTVRT
FT                   NGYGLRTDLGGGRAELALGLAAALGRGHSLYTSYEYAKGSKLTLPWTLHLGYRYTW"
FT   variation       7544..7555
FT                   /note="phase variable poly C"
FT   misc_feature    8180..8203
FT                   /note="PS00881 Protein splicing signature."
FT   misc_feature    9008..10240
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF03212, Pertactin, score 5.2e-248"
FT   CDS_pept        complement(10300..11538)
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="BPP2592"
FT                   /product="probable ammonium transporter"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2737"
FT                   /db_xref="GOA:Q7W7D3"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7D3"
FT                   /protein_id="CAE37884.1"
FT                   /translation="MDKADISWLLVSTLLVLMMAVPGLALFYGGLVRSKNVLSVLLQVL
FT                   CTFALGLLLWFAYGYSLAFTEGNAFFGGLSRTFFSGMFTPADGTYTLSGTLTELLFASF
FT                   QATFAGITCALIVGSFAERARFSAVLVFTAIWFTFAYIPIAHMVWFASETAPGLLNARG
FT                   ALDFAGGTVVHINAGVAGLVGAYVVGRRIGYGREAMQPHNLPMTFIGAALLWVGWFGFN
FT                   AGSSLAASDGATLAFFNTMTATAGAVLGWLFTEWAVKGKPSMLGAASGAVAGLVGITPA
FT                   AGLVGPVGALVIGVTAGVVCVWGVNGLKRLLRADDALDVFGVHGVGGIVGALLTGVFNA
FT                   KVLGGPGLDSASAIAGQVWVQFEGVLLTIVWSAVVAWIAYKIADKLCGLRVPEDQEREG
FT                   LDVTSHGESAYHS"
FT   misc_feature    complement(10309..11520)
FT                   /note="HMMPfam hit to PF00909, Ammonium Transporter Family,
FT                   score 3e-157"
FT   misc_feature    complement(join(10399..10464,10525..10578,10618..10674,
FT                   10687..10743,10765..10830,10876..10932,10972..11028,
FT                   11089..11154,11176..11241,11362..11427,11443..11508))
FT                   /note="11 probable transmembrane helices predicted for
FT                   BPP2592 by TMHMM2.0 at aa 10-32, 37-59, 99-121, 128-150,
FT                   170-189, 202-221, 236-258, 265-284, 288-307, 320-338 and
FT                   358-380"
FT   misc_feature    complement(10966..11043)
FT                   /note="PS01219 Ammonium transporters signature."
FT   misc_feature    complement(11464..11538)
FT                   /note="Signal peptide predicted for BPP2592 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.697) with cleavage site
FT                   probability 0.630 between residues 25 and 26"
FT   CDS_pept        complement(11564..11902)
FT                   /transl_table=11
FT                   /locus_tag="BPP2593"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2736"
FT                   /db_xref="GOA:Q7W7D2"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7D2"
FT                   /protein_id="CAE37885.1"
FT                   /translation="MKLVIAIIKPFKLDEVRMALSDIGVQGLTVTEVKGFGRQKGHTEL
FT                   YRGAEYAVDFLPKLRVEAAVPDHLVDQVIEAIEQSARTGKIGDGKIFTAPLEEVIRIRT
FT                   GESGEAAL"
FT   misc_feature    complement(11570..11902)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00543, Nitrogen regulatory protein
FT                   P-II, score 1.5e-58"
FT   misc_feature    complement(11750..11767)
FT                   /note="PS00496 P-II protein urydylation site."
FT   CDS_pept        12572..12877
FT                   /transl_table=11
FT                   /locus_tag="BPP2594"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2735"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7D1"
FT                   /protein_id="CAE37886.1"
FT                   /translation="MRSSNNRHEGEEAMNRTQQWMEDLQKNISDLIARSPAADVERNVR
FT                   AMMTQTFARLDLITREEFEVQVDLLARARTRVDQLSAQVQQLEARLATLEAGKPQA"
FT   CDS_pept        12984..14486
FT                   /transl_table=11
FT                   /locus_tag="BPP2595"
FT                   /product="putative chelatase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2734"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7D0"
FT                   /protein_id="CAE37887.1"
FT                   /translation="MTLAVLASRAIAGWQAPAVRVETHLGSGLPAFAIVGLPDVEVRES
FT                   RERVRAAIQNSGFDFPPGRITVNLSPADLPKASARFDLPIALGILLASGQVAASAAQTA
FT                   ALPDCVWAAELSLSGALVPLAAPLALALAVAREQPGATLVLPAGSAAVAAWVPGIRVLA
FT                   AHTLGEAAAYLAGHAELAPAERRSWPEVEPGPCLSDVRGQPAARRALEVAAAGGHSLLM
FT                   CGPPGAGKSMLAQRLPGLLPPLEQRQALEVAAIAGAGGAPEVLRGQPPFRAPHHSASAA
FT                   ALVGGGARPRPGEISLAHHGVLFLDELPEFERRALESLREPLETGKVVISQALHSVEYP
FT                   AVFQLVAAMNPCPCGWRGHASKACRCTPDQVRRYAARVSGPLVDRIDLWIELPATEPQW
FT                   LAEPPGEPSLPVRERVARCRQRQLARQGCLNAKLSGPALDAHCALGAAARTLLQQAMRR
FT                   LGGSARAAHRALRVARTLADLAHEPEIGAAHIAEAVQYRRPT"
FT   misc_feature    13038..14027
FT                   /note="HMMPfam hit to PF01078, Magnesium chelatase, subunit
FT                   ChlI, score 2.5e-48"
FT   misc_feature    13653..13676
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        14809..15006
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="BPP2596"
FT                   /product="50s ribosomal protein l35"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2576"
FT                   /db_xref="GOA:Q7W7C9"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W7C9"
FT                   /protein_id="CAE37888.1"
FT                   /translation="MPKMKTKKSAAKRFKVRGSGSIKRGQAFKRHILTKKTTKNKRQLR
FT                   GSAAVHETNVASVKAMMPFA"
FT   misc_feature    14818..14853
FT                   /note="PS00936 Ribosomal protein L35 signature."
FT   misc_feature    14818..14994
FT                   /note="HMMPfam hit to PF01632, Ribosomal protein L35, score
FT                   2e-27"
FT   CDS_pept        15022..15381
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="BPP2597"
FT                   /product="50s ribosomal protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2575"
FT                   /db_xref="GOA:Q7W7C8"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W7C8"
FT                   /protein_id="CAE37889.1"
FT                   /translation="MPRVKRGVTARARHKKVIAAAKGYRGRRGNVFRIAKQAVMRAGQY
FT                   AYRDRRNKKRTFRALWITRINAAVREQGMSYSVFIAGLKKAAIELDRKVLADLAVRDKA
FT                   GFAAIVQQAKAALAA"
FT   misc_feature    15025..15348
FT                   /note="HMMPfam hit to PF00453, Ribosomal protein L20, score
FT                   4.4e-56"
FT   misc_feature    15181..15231
FT                   /note="PS00937 Ribosomal protein L20 signature."
FT   CDS_pept        15432..16478
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="BPP2598"
FT                   /product="phenylalanyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.20"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2574"
FT                   /db_xref="GOA:Q7W7C7"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W7C7"
FT                   /protein_id="CAE37890.1"
FT                   /translation="MRFEGSNSMTLLVDDLVSQAQERFAAASDAAALENAKARFLGKEG
FT                   ALTVLLKALGKLDPEQKREMGARINQAKQQIEALLNARRAALAQAELDARLASETIDVT
FT                   LPGRGKAAGGIHPVIRTWERVEEIFRSIGFDVADGPEVENDWTNFTALNNPLDHPARSM
FT                   QDTFYVDMHDADGLPLLLRTHTSPMQVRYARMHKPPIKVIAPGRTYRVDSGATHSPMFH
FT                   QVEGLWIAEDISFADLKGVYTDFLRCFFESDDLVVRFRPSFFPFTEPSAEIDMMFTSGP
FT                   NRGRWLEISGSGQVHPQVVRNFGLDPERYIGFAFGSGLERLTMLRYGVNDLRQFYEGDL
FT                   RFLRQFNE"
FT   misc_feature    15495..15722
FT                   /note="HMMPfam hit to PF02912, Aminoacyl tRNA synthetase
FT                   class II, N-terminal domain, score 1.4e-23"
FT   misc_feature    15780..16430
FT                   /note="HMMPfam hit to PF01409, tRNA synthetases class II
FT                   core domain (F), score 2.9e-104"
FT   misc_feature    16056..16106
FT                   /note="PS00179 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 1."
FT   misc_feature    16377..16406
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT   CDS_pept        16491..18908
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="BPP2599"
FT                   /product="phenylalanyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.20"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2573"
FT                   /db_xref="GOA:Q7W7C6"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W7C6"
FT                   /protein_id="CAE37891.1"
FT                   /translation="MQFPESWLRSLVNPSIGTDELAHRLTMAGLEVEETEPAAPPFTGV
FT                   VVARIVDIAPHPDADKLRVCQVDDGSGALLQIVCGAPNAAAGLTVPLARVGAELPGGMK
FT                   IGVAKMRGVQSSGMLCSARELGLSQDHAGLLELPAALRPGTDIRAALDLDDTLFTLKLT
FT                   PNRADCLSIFGVAREVAALTGTPLTAPAAEPVPVTIDHRLPVAIQAPDLCGRFAGRVIQ
FT                   GVNARAATPEWMKTRLERAGQRSVSALVDISNYVMLEVGRPSHVFDLDKIGGDLSVRWA
FT                   REGETLELLNGQAVALDPKVGVVVAGEQVESLAGIMGGEATSVTLDTRNIYLEAAFWWP
FT                   GAIAGRARRYKFSSEASHRFERGVDYASIPEHIELITRLILDICGGQAGPVDDQCVNLP
FT                   VREPVRMRLARCHRVLGVAVERAEVAQIFTRLGLPFQEQGDDFVVTPPSYRFDIEIEED
FT                   LIEEVARVYGFERIPDVPPVARAKMHAQPEARRGAHAVRRLVAARDYQEVVNYSFVEAA
FT                   WERDYAGNDNLVRLVNPIASHLSVMRSSLIAGLVAIVRHNANRKQSRVRLFELGRVFHR
FT                   DPQLADGPLEVAGVRQPLMLAGVAWGGAVEEQWGVPHRQVDFYDVKQDVEALFGARADA
FT                   LRFVADRYPALHPGRSARIELDGQPIGWLGELHPQWTQQADLHHAPVVFELDFEALAER
FT                   RLPAVRELSRQPAVVRDLALWVDAKLPAQAMLDTVAAAIARDPQLSVVQDAQVFDVWRE
FT                   KPVAGQTVTEKSLAFRFWLQDTEVTLDEARVADCIARIKDALVAAHNARQRA"
FT   misc_feature    16623..16928
FT                   /note="HMMPfam hit to PF01588, Putative tRNA binding
FT                   domain, score 1.3e-34"
FT   misc_feature    16935..17375
FT                   /note="HMMPfam hit to PF03483, B3/4 domain, score 5e-66"
FT   misc_feature    17691..17897
FT                   /note="HMMPfam hit to PF03484, tRNA synthetase B5 domain,
FT                   score 1.4e-23"
FT   misc_feature    18597..18902
FT                   /note="HMMPfam hit to PF03147, Ferredoxin-fold anticodon
FT                   binding domain, score 2.1e-05"
FT   CDS_pept        18914..19255
FT                   /transl_table=11
FT                   /gene="ihfA"
FT                   /locus_tag="BPP2600"
FT                   /product="integration host factor alpha-subunit"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2572"
FT                   /db_xref="GOA:Q7W7C5"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W7C5"
FT                   /protein_id="CAE37892.1"
FT                   /translation="MGTTMLAEPRTLTKAELAELLFERVGLNKREAKDIVDTFFEEIRD
FT                   ALARGDSVKLSGFGNFQVRDKPPRPGRNPKTGETIPIAARRVVTFHASQKLKSVVEQPS
FT                   SPPDPASAE"
FT   misc_feature    18947..19216
FT                   /note="HMMPfam hit to PF00216, Bacterial DNA-binding
FT                   protein, score 6.1e-48"
FT   misc_feature    19082..19141
FT                   /note="PS00045 Bacterial histone-like DNA-binding proteins
FT                   signature."
FT   CDS_pept        19314..19724
FT                   /transl_table=11
FT                   /locus_tag="BPP2601"
FT                   /product="putative MerR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2571"
FT                   /db_xref="GOA:Q7W7C4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7C4"
FT                   /protein_id="CAE37893.1"
FT                   /translation="MTRTEPTVTTLPPIPAKRYFTIGEVSDLCGVKPHVLRYWEQEFTQ
FT                   LKPVKRRGNRRYYQHHEVLLIRRIRSLLYEQGFTISGARNRLGDARDAAHDAEAAVRLS
FT                   AGELQALRNELGDISSMLGEALGGQSENAANA"
FT   misc_feature    19380..19487
FT                   /note="HMMPfam hit to PF00376, Bacterial regulatory
FT                   proteins, merR family, score 0.00044"
FT   tRNA            19897..19973
FT                   /note="tRNA Pro anticodon GGG, Cove score 77.19"
FT   CDS_pept        20188..20781
FT                   /transl_table=11
FT                   /locus_tag="BPP2602"
FT                   /product="putative lipoprotein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2569"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7C3"
FT                   /protein_id="CAE37894.1"
FT                   /translation="MMIENLPRMRRAGWAAAAIAVAGLAFTGCTTTTPNNQAAADQRNE
FT                   INAGADATLSKLYTASPQAKDLVQRARGVLVFPSVMGASFIVGGEHGKGVLRTGGKNAG
FT                   YYSTTSGSVGLQAGAQSRAYVLLFMTDEALAQFRQSSGWTAGADASVAVATIGANGRID
FT                   TNTAKQPIVGFVLNNAGLMAGVSIEGAKINKLDL"
FT   misc_feature    20188..20301
FT                   /note="Signal peptide predicted for BPP2602 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.425 between residues 38 and 39"
FT   misc_feature    20242..20274
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(21321..22034)
FT                   /transl_table=11
FT                   /locus_tag="BPP2603"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2583"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7C2"
FT                   /protein_id="CAE37895.1"
FT                   /translation="MAPSSHEWTDTLKDVYTARAANADLNARYIPLLPVNQRIQHERDR
FT                   ALAYMLRQHLSVPPAQARVLEVGCGSGSNLLDLIRLGFDPANLMGNDLMDSRVEQARHR
FT                   LPQAVPILAGNALDLDLEREGFDVLYQSTVFTSILDAQARRDLAQRMWHWTKPGGGVLW
FT                   YDFAYNNPRNPNVRGVPLREVRALFPHARIHTARITLAPPLARRLPATLYAPVNSLCPF
FT                   LRTHLLCWIGKPAAP"
FT   CDS_pept        complement(22157..22630)
FT                   /transl_table=11
FT                   /locus_tag="BPP2604"
FT                   /product="putative acetyltransferase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2584"
FT                   /db_xref="GOA:Q7W7C1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7C1"
FT                   /protein_id="CAE37896.1"
FT                   /translation="MAPRDLLIRPVRPGDEPRWRELWDGYTRFYEREPVEAVTRHTWRR
FT                   IMDPAQAVYAIVAESATHGVLGIANYLLHENTSTLAPVCYLQDLYVDPQARAQGAGRRM
FT                   LDWLVDEARTRGWSRLYWNTRENNYRARALYDQYTPHSGFVRYVVHTSPHKPA"
FT   misc_feature    complement(22208..22462)
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 2.3e-11"
FT   CDS_pept        complement(22633..23010)
FT                   /transl_table=11
FT                   /locus_tag="BPP2605"
FT                   /product="putative exported protein"
FT                   /note="Similar to Escherichia coli O157:H7 hypothetical
FT                   protein Yqjc or Z4451 or ECS3979 SWALL:Q8XAH3
FT                   (EMBL:AE005539) (127 aa) fasta scores: E(): 6.7e-10, 41.32%
FT                   id in 121 aa, and to Yersinia pestis putative exported
FT                   protein YPO0572 SWALL:Q8ZID3 (EMBL:AJ414143) (126 aa) fasta
FT                   scores: E(): 7.3e-09, 43.29% id in 97 aa"
FT                   /db_xref="InterPro:IPR009468"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7C0"
FT                   /protein_id="CAE37897.1"
FT                   /translation="MSRLVWAATILACDQALAQPPAPLTGCAAKQDRIETELAQARAHG
FT                   NTGRIKGLEEALAGARHCDDASLRADRERDVRDATDKVAERQRELDEERQEGDADDIAK
FT                   AERKLREAQQDLDNARAELTR"
FT   misc_feature    complement(22957..23010)
FT                   /note="Signal peptide predicted for BPP2605 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.954) with cleavage site
FT                   probability 0.903 between residues 18 and 19"
FT   CDS_pept        23135..24052
FT                   /transl_table=11
FT                   /locus_tag="BPP2606"
FT                   /product="Putative beta-lactamase"
FT                   /note="Similar to Xanthomonas maltophilia L2 beta-lactamase
FT                   BlaL2 SWALL:Q9F279 (EMBL:AF299368) (303 aa) fasta scores:
FT                   E(): 2.2e-47, 49.49% id in 297 aa, and to Xanthomonas
FT                   maltophilia beta-lactamase L2 precursor SWALL:BLA2_XANMA
FT                   (SWALL:P96465) (303 aa) fasta scores: E(): 4.5e-45, 48% id
FT                   in 300 aa"
FT                   /db_xref="GOA:Q7W7B9"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023650"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7B9"
FT                   /protein_id="CAE37898.1"
FT                   /translation="MNRRGFGAGMLAALGAACMPPWARAGMRRAARPADAAAQAQRQLA
FT                   LLEQRHGVRLGVQVHDRDSDRAFSHRADERFPMCSTFKLLAAGAVLARADRGDDSLRRL
FT                   IRYGAADIVAYSPVTGPRQAEGMTLEQLCEAAVTRSDNTAGNLLLSTLGGPPGLTAYAR
FT                   GLGDRMTRLDRIETALNEARPGDPRDTTTPAAMAGNLQRLLLGDALQSASRQRLADWLL
FT                   ASQTGDTRLRAGLPAGWRIGDKTGAGGHGTNNDIGVIWPRDGAPVLISAYLTQSSASRE
FT                   AQNAVLAEVGRIAAHAVAAWRLGS"
FT   misc_feature    23255..24031
FT                   /note="HMMPfam hit to PF00144, Beta-lactamase, score
FT                   3.4e-110"
FT   misc_feature    23360..23407
FT                   /note="PS00146 Beta-lactamase class-A active site."
FT   CDS_pept        complement(24067..24420)
FT                   /transl_table=11
FT                   /locus_tag="BPP2607"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7B8"
FT                   /protein_id="CAE37899.1"
FT                   /translation="MGTATNPQSPARPDAPMPLRLLAPMLVLFLAACSSMSEVTPVAKN
FT                   QYTVSYNAGMKAATWVEIKNQARERARQYCEAQGRKFARPEITSNHATGLMPKKAVVTF
FT                   YCDEKPQPPAEKN"
FT   CDS_pept        complement(24438..24797)
FT                   /transl_table=11
FT                   /locus_tag="BPP2608"
FT                   /product="Putative regulatory protein"
FT                   /note="Similar to the N-terminal region of Rhizobium
FT                   meliloti putative transcription regulator protein R03031 or
FT                   SMC02504 SWALL:Q92LL1 (EMBL:AL591792) (150 aa) fasta
FT                   scores: E(): 2.2e-07, 54.41% id in 68 aa, and to N- and
FT                   C-treminal regions (there is no similarity with the central
FT                   region) of Pseudomonas putida putative transcriptional
FT                   regulator SWALL:Q93FY6 (EMBL:AF302763) (153 aa) fasta
FT                   scores: E(): 3.5e-07, 39% id in 141 aa"
FT                   /db_xref="GOA:Q7W7B7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7B7"
FT                   /protein_id="CAE37900.1"
FT                   /translation="MTPPPAALYRAPDRNRPAPAMDPRLDAIDRQLLSLLQANAREPAA
FT                   ILARKLHLARSTVVARIARLERDGVIAGYGVRCETHEQLDDLLDHIGLIDGVKQTQTSI
FT                   VLSRRLDRRSAIAPG"
FT   CDS_pept        complement(24808..25410)
FT                   /transl_table=11
FT                   /locus_tag="BPP2609"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7B6"
FT                   /protein_id="CAE37901.1"
FT                   /translation="MKTIRNYAPPSPAALRRLQETLHYSTAQMNQLAGLDDQTPWPRYV
FT                   DGAEPHALGRQRLLYMAARLALPEAQWRLVLERMRNIGARFDYDDGEPLPAPGAVAPEP
FT                   VTEVKFGITLSSLSGAFHEMEQLREFAHFAHEAGVDTLVARAWFGRDDDICRFEPRHAT
FT                   PAVDGQQDRLFEAAARAIGHFEFGGRIYQGGLPTEPD"
FT   CDS_pept        25514..25795
FT                   /transl_table=11
FT                   /locus_tag="BPP2610"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2581"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7B5"
FT                   /protein_id="CAE37902.1"
FT                   /translation="MRPRKFCDIEGDMDIQEQIAVIVHTVSHQGGRIDALHSTLASVLH
FT                   LVKGSPGLREAIEAHLEQSYANLLARSENPQYVAGFESVRDTVVAALK"
FT   CDS_pept        complement(25910..27358)
FT                   /transl_table=11
FT                   /locus_tag="BPP2611"
FT                   /product="putative GntR-family regulatory protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2580"
FT                   /db_xref="GOA:Q7W7B4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7B4"
FT                   /protein_id="CAE37903.1"
FT                   /translation="MHHRAMNTQPLYLRLADHYRRAIQTGVLAPAQRMPSVRNLVRAHH
FT                   VSLSTALQACRQLEDDGLIEARPRSGYFVLRPRRPALAPVPEPDIKGALDPAQYVGIHD
FT                   RVSDFIASCQQHPLSADFALAAAPPQAYPMRALQLALTRAARHTPELLTAPVPPYGHPE
FT                   FRAVLARRAMECGISAAPDEVLVTHGCIEALNLALRAVARPGDTIAVESPTYFGLLQIL
FT                   ESLGLRALEIPTSPQRGISIEALELALQTHANVRAVVVVPNFQNPLSCVMDDSDKARLV
FT                   TLCERTGIALIEDDTYGALGDHGTPLALKSWDDSGNVIYCASLHKTLAPGMRLGWMLGG
FT                   RWSRRIGMLKFAQSRPNPPLPQAAAADYMGTKAYDRHLARLRQTLRVQREAMAAAVARH
FT                   FPDGTRLSVPTGGMLLWVELPACMPAMRVFEQALRAGIRITPGPMFSNSNRYDHFLRIS
FT                   CGVPYTADIAAAMKRLADIVAAGL"
FT   misc_feature    complement(25925..26836)
FT                   /note="HMMPfam hit to PF00155, Aminotransferase class I and
FT                   II, score 3.4e-07"
FT   misc_feature    complement(27137..27316)
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 1.4e-07"
FT   tRNA            27882..27958
FT                   /note="tRNA Met anticodon CAT, Cove score 85.01"
FT   CDS_pept        28048..28446
FT                   /transl_table=11
FT                   /locus_tag="BPP2612"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2567"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7B3"
FT                   /protein_id="CAE37904.1"
FT                   /translation="MPALLMRYHGPPERPCRIQGGDMGTAKYDHPGYLADAGAAGTYHV
FT                   GVWCPHGYPAHVHIGRAGSQDDARLRLRIPDGVFQSMPDDMETLCRRAFGQALAEGLLA
FT                   ASEGDFQEVRLRLDAQPWNGPLAAAQPA"
FT   CDS_pept        complement(28588..29328)
FT                   /transl_table=11
FT                   /locus_tag="BPP2613"
FT                   /product="putative exported endonulease"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2566"
FT                   /db_xref="GOA:Q7W7B2"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7B2"
FT                   /protein_id="CAE37905.1"
FT                   /translation="MKYAVVLAALLSLPLAAQAELVTRPNAVGHRDFRHAKKVLPRVYQ
FT                   SLERDFYCGCPYQGKRIDLQACGYAPRKQPRRAQQLEWEHVVPAWTLGHQRQCWQQRVN
FT                   GKPGGRKHCGRTDPVFARAEGDLVNLVPSVGEVNGDRQNFRYAVWADRPAPMYGQCETI
FT                   VDFKTRRIQPRKYVRGRIARIQFYMVERYRLKLSREDRRVLCVWAHAYPVDDWERARDQ
FT                   RIRTLQGNGNHYVTDPAAIQRQCG"
FT   misc_feature    complement(29272..29328)
FT                   /note="Signal peptide predicted for BPP2613 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.986 between residues 19 and 20"
FT   CDS_pept        29504..29635
FT                   /transl_table=11
FT                   /gene="ecnA2"
FT                   /locus_tag="BPP2614"
FT                   /product="entericidin A anti-toxin precursor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2565"
FT                   /db_xref="GOA:Q7W7B1"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7B1"
FT                   /protein_id="CAE37906.1"
FT                   /translation="MKNKALIVVLLAMAALSAGCNTVAGAGKDIERGGEKIQGAAQK"
FT   misc_feature    29516..29584
FT                   /note="1 probable transmembrane helix predicted for BPP2614
FT                   by TMHMM2.0 at aa 42-64"
FT   misc_feature    29531..29563
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        29707..30195
FT                   /transl_table=11
FT                   /locus_tag="BPP2615"
FT                   /product="putative lipoprotein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2564"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7B0"
FT                   /protein_id="CAE37907.1"
FT                   /translation="MGALMHNPSVALLGAGVDMRRVGLIGALLAAGVLSGCASQGLLSG
FT                   DTPGLSESFIVTADFQAAYRRAGEYVRVCHEQRPHPYGVVYQSSRRLGDRGAPNEVHVF
FT                   KREEPTKILEIIQSQTETPSTARVTVRVLGDGKWDAAEIAAAKASIQSATPVCRQDVG"
FT   misc_feature    29785..29817
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        30197..30607
FT                   /transl_table=11
FT                   /locus_tag="BPP2616"
FT                   /product="putative integral membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2563"
FT                   /db_xref="GOA:Q7W7A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7A9"
FT                   /protein_id="CAE37908.1"
FT                   /translation="MEHGADERTGDSGQGLLAGPLRLLAGLNGLAALMLVAFSLGIVGG
FT                   EVVPPALQAPLALFLAGLAAAMAAMLFGTAARYLRRRKAAGVRGRGHLPAVVLAIALYL
FT                   ASVAAFGAGCWLAVAPADTDYDQLPTVYATRV"
FT   misc_feature    join(30257..30325,30353..30421,30482..30550)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BPP2616 by TMHMM2.0 at aa 21-43, 53-75 and 96-118"
FT   CDS_pept        30689..32008
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="BPP2617"
FT                   /product="aspartate transcarbamoylase"
FT                   /EC_number="2.1.3.2"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2562"
FT                   /db_xref="GOA:Q7W7A8"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7A8"
FT                   /protein_id="CAE37909.1"
FT                   /translation="MHSFLGPPMSISQQAFLRDAMRRLNLTRDVFAGRIGVKRRALDTW
FT                   LLPEGSQEFRAMPEVVERFVSEIVQNRDLLEKYTQSGQVGPLRDRIAVEGRHQLLSVDQ
FT                   FTRESVEDLFRVADMMQPIARRQKVSRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGS
FT                   VCDTTGFTFSSMAKGESIYDTSRVMSGYVDAMVIRHPEQGSVAEFAQATNIPVVNGGDG
FT                   PGEHPSQALLDLYTILTEFSRLGKLLDGAHIAMVGDLKYGRTVHSLIKLLALYKGVKFT
FT                   LISPQGLEMPDYIVEQASRNGNVIEQKSTLAEGLAGADVIYATRVQKERFANEEAGEGY
FT                   TADFQVSRAIIDAYCGPDTIVMHPLPRDSRPGSNDLSTDLNHDPRLAIFRQTDNGIPIR
FT                   MAIFAVLLGVEGLVQHSMRDVTWQHPSHIGPDDSVFHGLD"
FT   misc_feature    30974..31411
FT                   /note="HMMPfam hit to PF02729, Aspartate/ornithine
FT                   carbamoyltransferase, carbamoyl-P binding domain, score
FT                   3.2e-48"
FT   misc_feature    31112..31135
FT                   /note="PS00097 Aspartate and ornithine
FT                   carbamoyltransferases signature."
FT   misc_feature    31430..31909
FT                   /note="HMMPfam hit to PF00185, Aspartate/ornithine
FT                   carbamoyltransferase, Asp/Orn binding domain, score
FT                   6.3e-42"
FT   CDS_pept        complement(32048..32947)
FT                   /transl_table=11
FT                   /locus_tag="BPP2618"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2561"
FT                   /db_xref="GOA:Q7W7A7"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W7A7"
FT                   /protein_id="CAE37910.1"
FT                   /translation="MWFKNLKIYRLSAPWALNGDQLEECLARFAYQGGNNLEMQSLGWI
FT                   SPRENGLLAHTLNGQILLTLRAEKKLLPTTVVNQVAKARAQEIEEQQGYKPGRKQMKEI
FT                   KERVTDELLPKAFSIYRDTRVWIDTVNHWLVIDAAASAKADEVIGLLAKTIDPLPLDNL
FT                   YVEQSPAAAMTGWLAADEAPANFSIDQDTELRASGESRAAIRYVKHSIDVDDVRRHIQS
FT                   GKQCTRLAMTWADRVSFVLTESLDVKRVAPLDVLKENPDAATQNDDEKFDSDMTLMTGE
FT                   VAKLLAELVDSLGGEKRV"
FT   CDS_pept        33101..33319
FT                   /transl_table=11
FT                   /locus_tag="BPP2619"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2560"
FT                   /db_xref="GOA:Q7W7A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7A6"
FT                   /protein_id="CAE37911.1"
FT                   /translation="MKPATIVGAVLIVLGAAALVYKGFSYTSEETVLQVGSVKATAQTE
FT                   KDVAIPSWAGIAAIVVGVLIIGVGMRR"
FT   misc_feature    join(33116..33184,33242..33310)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP2619 by TMHMM2.0 at aa 25-47 and 67-89"
FT   CDS_pept        complement(33582..34889)
FT                   /transl_table=11
FT                   /locus_tag="BPP2620"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2559"
FT                   /db_xref="GOA:Q7W7A5"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7A5"
FT                   /protein_id="CAE37912.1"
FT                   /translation="MHKQCIKCTDARQTKRLCWSEAGCNIVASQPSWRPVAHLSMLAQS
FT                   APAKPLAGLKVLDITHMLAGPYCTWLLWLLGAEVIKVERPGEGDFARAIAPFHGGESLY
FT                   FMSVNRNKRSIAVNLKTEEGKQILRDLIARSDILVENNRAGVMDRLGLGYDDAKALNPG
FT                   LVYASISGYGQTGPYRHKPAFDVIAQAISGMMSITGQEGGPPARVGVSIGDIASGLFAT
FT                   VAILAAIEGRHGSGEGAFIDVSMMDCQMALMENAISRYLNAGDVPERLGSRHPLIAPFQ
FT                   SFETKDFPIAVCVDTEPQWQRFCAALDLEPLLHDPRFQDGPMRALNHSQLEPLLNAVFA
FT                   SGRRDDFIARLEAADVPCSPINSIPEVARDPQVAHRRILVDNEGVKYVGAPFHYNRAPV
FT                   GGETSPPALGADSVSILRELGRSEAQIADLQRTGVL"
FT   misc_feature    complement(33978..34547)
FT                   /note="HMMPfam hit to PF02515, CAIB/BAIF family, score
FT                   8e-75"
FT   CDS_pept        complement(34907..35794)
FT                   /transl_table=11
FT                   /locus_tag="BPP2621"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2558"
FT                   /db_xref="GOA:Q7W7A4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7A4"
FT                   /protein_id="CAE37913.1"
FT                   /translation="MIYRRLPPLIAVRAFDAFSRSGSIRAAADLLAISHTVVSRHIQNL
FT                   EDAVGTRLVKKDGRGLALTREGQRFAAKTRRALDLIADACGELVHGRGDAIHVCCMAGL
FT                   ASRRLLMRLPELESRLDGKELILQPTTARPDFNKDEADAEIIYLTQPFIGDGLRAEMFS
FT                   RPRILAVCSPAFRERFPDIGEPEHLVHLPLLHEQSTDQWEQWLGSVGVAQLPILRGPRL
FT                   WHGHLTMEAAQLGQGIALVSELLANDRIARGDLVEVLPNVSVQMGGYYFVAPEHKWNDP
FT                   AIATVRQWLTEALS"
FT   misc_feature    complement(34913..35530)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 3.9e-15"
FT   misc_feature    complement(35591..35770)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 2.3e-16"
FT   misc_feature    complement(35636..35728)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   CDS_pept        36010..37173
FT                   /transl_table=11
FT                   /locus_tag="BPP2622"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2557"
FT                   /db_xref="GOA:Q7W7A3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7A3"
FT                   /protein_id="CAE37914.1"
FT                   /translation="MSISNRAAIVGLCESPRRHAPEVHPYQIQMECVQGALVDAGLSLA
FT                   DVDGLCVAAGDWAEGGGVNSVTEFAEYAGLRPTWFNSTDVGGCSYIVHAGHAAAAIAAG
FT                   LAEVVVISYAATPRWWPLSTPSFDPFVFPAGPGQYELPYGPTLISAYGLYAQRHMARYG
FT                   TTAEQLASVAVTFRTHAAANPHARLRTPITVDDVLASPMIASPLHKLDCCVVTDGGGAV
FT                   VMTSAERARDLRHKPVLLSGFGAATARTQLSQIAPDLSTLATLSGPRAFAMAGLSPADI
FT                   DVAQLYDAFTITPLLALEDLGFCKRGESGAFAADGQLTLGGALPCNTDGGGLSSNHPGK
FT                   RGIFALIEGARQLRGQGPGVQVPDAGRALVHGLGGTFCAAATAILTV"
FT   misc_feature    36700..37158
FT                   /note="HMMPfam hit to PF02803, Thiolase, C-terminal domain,
FT                   score 0.04"
FT   CDS_pept        37181..37573
FT                   /transl_table=11
FT                   /locus_tag="BPP2623"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2556"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7A2"
FT                   /protein_id="CAE37915.1"
FT                   /translation="MFDVTMPPVQDVCSQPFWEAACQQRLLVQQCPTTGRHQWYPRAHS
FT                   LADPGAAPRWVQASGRARLFSYTVIHKGGVQKAPYTCVLVELEEGPLMLTRCPSERPLQ
FT                   VDMPMRVAFEKIGDTLTLPVFVPMES"
FT   CDS_pept        37574..38017
FT                   /transl_table=11
FT                   /locus_tag="BPP2624"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2555"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7A1"
FT                   /protein_id="CAE37916.1"
FT                   /translation="MPVEFERIQLGERHVSSRIKITESHIVTFAGLTGDFNPLHMDEVA
FT                   ARENGYGQRIAHGMLGHAVSTGLRSGIDDWDIVAFLETRRRFVAPILAGDSVRYEAEVL
FT                   ELRPSRSKPFGVVKVSMQLRNQDGVTVQDGEDVFAVAMRGGVA"
FT   misc_feature    37592..37948
FT                   /note="HMMPfam hit to PF01575, MaoC like domain, score
FT                   3e-16"
FT   CDS_pept        38018..38764
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="BPP2625"
FT                   /product="probable 3-oxoacyl-[acyl-carrier protein]
FT                   reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2554"
FT                   /db_xref="GOA:Q7W7A0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W7A0"
FT                   /protein_id="CAE37917.1"
FT                   /translation="MKNERLQGRVALVTGGAGGIGLAVCRRLQAEGARIVVGDIGEERV
FT                   LAAAASLGEGALGVFLDVADRQSWAAAKRAVDAQGWQVDIVVNVAGIVRDRSLAKMSDA
FT                   EWSAVIDVNLRGTWLGCQSAFAWIGERGWGRIINVASTAIFGAYGQANYSAAKAGIVGL
FT                   TRTAALEGAKRGILVNAVAPGIVETAILADVPDQVREGWLARMPLKRTARPEEIAAVIA
FT                   FLASDDASYMTGQTLVVDGGATTGDY"
FT   misc_feature    38036..38746
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 6.2e-75"
FT   misc_feature    38435..38521
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   CDS_pept        join(38802..39263,39267..39839)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2626"
FT                   /product="putative exported protein (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2553"
FT                   /db_xref="PSEUDO:CAE37918.1"
FT   misc_feature    38802..38891
FT                   /note="Signal peptide predicted for BPP2626 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.997 between residues 30 and 31"
FT   misc_feature    join(38946..39263,39267..39836)
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding protein, score 0.017"
FT   CDS_pept        40051..41619
FT                   /transl_table=11
FT                   /locus_tag="BPP2627"
FT                   /product="ABC transport protein, solute-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2552"
FT                   /db_xref="GOA:Q7W799"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W799"
FT                   /protein_id="CAE37919.1"
FT                   /translation="MNYLRIFTTPNLIEPMLNSLVLAGSTAVIATALGVPMAWLVSRTD
FT                   MPGRGLVRVLVLAAFITPSFIGALGWILLAAPNSGWLNVWLRQWLGGDSPLNIYSMWGA
FT                   VFVCAVYTVPFTFTIVATALDEMAVELEDASAMLGGGILRTMRSVTLPLVMPAIVAGFI
FT                   LSFIQGMTLFGVPAFLLTPARVPVVTTKLAEFYQMFPPELNLAAAYCMPLLLMTGGLFF
FT                   LRRRILGRRQYVMIGGKARGSRLVGLGRWRWPALLGALLVPAVTVFLPYASLTLVSLSK
FT                   AWGQGPSWDNLTLHWYRWAVLDNPQTQSAIVNSLLYATMAATVCLLLGVVVAYMVERKL
FT                   FRGAWALGATASVPIIIPGIVLSVGFFSAFTQPFYGLYGTGALLVLAFVATFLPIAYSH
FT                   GGAIIKTISPDLERASRILGAGQVGTFGRITLPLMKPGLVSGWMLVFIPVMRELSVAVF
FT                   LITPQTNVMTTLIYNYKDGGNYEAVCATSNVLLLGTILIVMLGRLLTGLARRRGAAPVT
FT                   AGVTS"
FT   misc_feature    40051..40152
FT                   /note="Signal peptide predicted for BPP2627 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.885) with cleavage site
FT                   probability 0.323 between residues 34 and 35"
FT   misc_feature    join(40108..40176,40210..40278,40342..40410,40501..40569,
FT                   40663..40719,40807..40875,40990..41058,41077..41145,
FT                   41173..41241,41362..41430,41494..41562)
FT                   /note="11 probable transmembrane helices predicted for
FT                   BPP2627 by TMHMM2.0 at aa 20-42, 54-76, 98-120, 151-173,
FT                   205-223, 253-275, 314-336, 343-365, 375-397, 438-460 and
FT                   482-504"
FT   misc_feature    40417..40647
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 2.8e-07"
FT   misc_feature    41257..41478
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 6.1e-12"
FT   misc_feature    41260..41346
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        41616..42680
FT                   /transl_table=11
FT                   /locus_tag="BPP2628"
FT                   /product="ABC transport protein, ATP-binding component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2551"
FT                   /db_xref="GOA:Q7W798"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W798"
FT                   /protein_id="CAE37920.1"
FT                   /translation="MKAIRIQGLTKHYGAHQVLRGIDLELAQGELLALLGPSGCGKSTT
FT                   LQMLAGFDQPTDGQIWIGDRQVSGAGVMVPPERRNISLVFQNYAVWPHMTVFENVAYGL
FT                   QVRKVARTELAQRVKRALDTVRLTALAQRYPSELSGGQQQRVALARALVVEPDILLLDE
FT                   PLSNLDAHLREEMRYEIRQVHDLLGLTTVYVTHDQGEALVTADKIAVMQSGQVQQFDSP
FT                   VNVFSRPANTFVASFIGTNNELHGQLAEPGALRVGDRVLHGDDRRQAGAGGAACLCIRP
FT                   SAVKLGAAPGANTLSGTVTRVAYLGEYRDVQVELAAGQFVRAYVDPSSTLEPGQRVEVH
FT                   LPIEHCQILSVTTS"
FT   misc_feature    41700..42257
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   3.7e-60"
FT   misc_feature    41721..41744
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    42027..42071
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    42480..42659
FT                   /note="HMMPfam hit to PF03459, TOBE domain, score 1.3e-08"
FT   CDS_pept        42690..43484
FT                   /transl_table=11
FT                   /locus_tag="BPP2629"
FT                   /product="putative enoyl-CoA hydratase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2550"
FT                   /db_xref="GOA:Q7W797"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W797"
FT                   /protein_id="CAE37921.1"
FT                   /translation="MSSHTSMVHSEIREGALWILFDRPAARNAMTAEMEHAILALCESV
FT                   AHRPEIKAVVFSGAPASKPAFMAGADFGALETATTAEEFVALERSSEALLEAIEGMRVP
FT                   TIAAMAGACVGGGALLALCCDIRIATPSLKFGFPIARTVGNCLSVKNYARLAENLGAQR
FT                   VRDMVFSASLLSADALLHAGTIREIVPEDALHGRAQAIAAQVMALAPLTLWATRTSLLR
FT                   LRDKAVDGIADDDILSACYMSADFQEGVRAFMEKRAPAWIGA"
FT   misc_feature    42738..43259
FT                   /note="HMMPfam hit to PF00378, Enoyl-CoA
FT                   hydratase/isomerase family, score 2.9e-17"
FT   misc_feature    43005..43067
FT                   /note="PS00166 Enoyl-CoA hydratase/isomerase signature."
FT   CDS_pept        complement(43653..45329)
FT                   /transl_table=11
FT                   /locus_tag="BPP2630"
FT                   /product="putative sugar transport protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2549"
FT                   /db_xref="GOA:Q7W796"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W796"
FT                   /protein_id="CAE37922.1"
FT                   /translation="MSTATLSGQSPSAQRRPMTREERRVIFASSLGTVFEWYDFYLYGS
FT                   LAAIIAQHFFSGVNPTAAFIFALLAFAAGFAVRPFGALVFGRLGDLVGRKYTFLITIVI
FT                   MGLSTFLVGVLPSYASIGIAAPAILIILRLLQGLALGGEYGGAATYVAEHAPHGRRGFY
FT                   TSWIQTTATLGLFLSLLVILGVRTFMGEEAFKDWGWRIPFLISVVLLGISVWIRLQLNE
FT                   SPTFKRMKEEGKGSKAPIAESFGQWRNLKVVILALLGLTAGQAVVWYTGQFYALFFLTQ
FT                   SLKIDSNTANIMIAIALLVGTPFFVLFGALSDRIGRKPIIMAGCLIAALTYFPIFKGLT
FT                   HYANPALEKAQATAPVTVIADPATCSFQFNPVGTASFTSSCDVVKSFMARNSVNYENQS
FT                   AAAGSVAKVMIGNDEFASFDGKGLAPAEFKTKATELDKALTAAIRSHGYPAKADPAQTN
FT                   YFMVVVLLTLLVIYVTMVYGPIAAMLVEMFPTRIRYTSMSLPYHIGNGWFGGFLPPVAF
FT                   AVVAATGNIYDGLWYPIIIAVMTLVIGTLFVRETKDNDINA"
FT   misc_feature    complement(join(43686..43742,43758..43823,43887..43952,
FT                   44322..44372,44394..44459,44505..44570,44667..44732,
FT                   44778..44843,44907..44972,44985..45041,45078..45143,
FT                   45189..45254))
FT                   /note="12 probable transmembrane helices predicted for
FT                   BPP2630 by TMHMM2.0 at aa 25-47, 62-84, 96-115, 119-141,
FT                   162-184, 199-221, 253-275, 290-312, 319-336, 459-481,
FT                   502-524 and 529-548"
FT   misc_feature    complement(44004..45260)
FT                   /note="HMMPfam hit to PF00083, Sugar (and other)
FT                   transporter, score 3.8e-30"
FT   misc_feature    complement(44850..44927)
FT                   /note="PS00217 Sugar transport proteins signature 2."
FT   CDS_pept        complement(45524..46882)
FT                   /transl_table=11
FT                   /locus_tag="BPP2631"
FT                   /product="two-component system histidine kinase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2548"
FT                   /db_xref="GOA:Q7W795"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W795"
FT                   /protein_id="CAE37923.1"
FT                   /translation="MLAPLFLLWPMSVAITYVVAQNIANVPYDRALANNLNVLSHQVHA
FT                   VDGRAALRMTDAARDVLRVDETESVFWLALGSRGEYLGGDRALPLPPNVGQPRPGEILY
FT                   ADDTLRGFGVRLAYTWIDLGLPDTQPALVMVAETVEKRAQLANDIIKGVIIPQFVVLPI
FT                   AVLLVWFGLSRGVAPLNALQQRLRARRPDDLSPIDEQAAPSEIAPLVGAMNDLLDRLSA
FT                   NIETQRRFVADAAHQLKTPLAGLRTQAELALRDASPEEMQSSLRQLVTGSERATRLVNQ
FT                   LLLLARAENPDSPGQALTDLNAIAYEQTMQWVPQALALSTDLGFEGADRPVGISGNAIL
FT                   LAELLNNLIDNALRYTPRGGHITVRVSAQGDHAVLDVEDSGPGIAPEERERVFDRFYRV
FT                   LGTASDGSGLGLAIVREIAQKHQAEVVIDEHPTPYSDLPGTRIQVRFPLPGTL"
FT   misc_feature    complement(45536..45877)
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase, score 1.4e-37"
FT   misc_feature    complement(46010..46207)
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 2.6e-18"
FT   misc_feature    complement(46217..46423)
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 6.6e-09"
FT   misc_feature    complement(join(46370..46435,46826..46882))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP2631 by TMHMM2.0 at aa 43-65 and 195-217"
FT   CDS_pept        complement(46998..47687)
FT                   /transl_table=11
FT                   /locus_tag="BPP2632"
FT                   /product="two-component response regulatory protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2547"
FT                   /db_xref="GOA:Q7W794"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W794"
FT                   /protein_id="CAE37924.1"
FT                   /translation="MRILIAEDDSILTDGLSRSLRHNGYAVDAVRDGLAADSALAVQPF
FT                   DLLILDLGLPHLPGLEVLRRLRARNSVLPVLILTAADSIEQRVKGLDLGADDYMAKPFA
FT                   LSELEARVRALTRRGAGGGATIVRHGRLVFDQTGRIATVDDQTLDLSAREVSLLEILLA
FT                   RSGRMVSKTQLVDHLCEWGEAVSTNAIEVYVHRLRKKLEPSGVKIITVRGLGYCLERDQ
FT                   GASYLAS"
FT   misc_feature    complement(47043..47252)
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C terminal, score 4.9e-20"
FT   misc_feature    complement(47328..47687)
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 6.8e-36"
FT   CDS_pept        47927..48988
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="BPP2633"
FT                   /product="RecA protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2546"
FT                   /db_xref="GOA:P0A450"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A450"
FT                   /protein_id="CAE37925.1"
FT                   /translation="MDDKTSKAAAAEKAKALAAALSQIEKQFGKGSIMRYGDNEVEHDI
FT                   QVVSTGSLGLDIALGVGGLPRGRVIEVYGPESSGKTTLTLQVIAEMQKLGGTCAFVDAE
FT                   HALDVQYASKLGVNLTDLLISQPDTGEQALEITDALVRSGSVDLIVIDSVAALVPKAEI
FT                   EGEMGDSLPGLQARLMSQALRKLTATIKRTNCMVIFINQIRMKIGVMFGNPETTTGGNA
FT                   LKFYSSVRLDIRRIGAIKKGDEVVGNETRVKVVKNKVAPPFKQAEFDIMYGSGISREGE
FT                   IIDLGVQANVVDKSGAWYSYSGNRIGQGKDNVREYLKEHKEMAIEIENKVRENQGIVSR
FT                   AATFPASEAEDGE"
FT   misc_feature    47969..48937
FT                   /note="HMMPfam hit to PF00154, recA bacterial DNA
FT                   recombination protein, score 3.3e-245"
FT   misc_feature    48146..48169
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    48590..48616
FT                   /note="PS00321 recA signature."
FT   CDS_pept        49021..49587
FT                   /transl_table=11
FT                   /locus_tag="BPP2634"
FT                   /product="RecX-family regulatory protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2545"
FT                   /db_xref="GOA:Q7W793"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W793"
FT                   /protein_id="CAE37926.1"
FT                   /translation="MATFNRRPPSAARAGRRTANPDDEFETLAQSRDDAAAPSRPGRTL
FT                   KARAVGYLSRREYSRLELARKLQPYAEEGDDIEAVLDDLQREGWLSNARFAQSLAHRRA
FT                   PRQGASRIVQELKQQGVADDQVAELREQLRVTEYARALAVWQKRFGEKPADRAAYARQA
FT                   RFLAGRGFAHDVIRRILGGGDDELD"
FT   misc_feature    49219..49578
FT                   /note="HMMPfam hit to PF02631, RecX family, score 0.00028"
FT   CDS_pept        complement(49662..50591)
FT                   /transl_table=11
FT                   /gene="metR"
FT                   /locus_tag="BPP2635"
FT                   /product="transcriptional regulatory protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2544"
FT                   /db_xref="GOA:Q7W792"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037406"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W792"
FT                   /protein_id="CAE37927.1"
FT                   /translation="MLEIRHLETLAAIRDGGSLQEAAERLHLTQSALSHQLRDLETRLG
FT                   TPLLNRRTRPARLTTAGLRVLALADDVLPRLRATERELQRLAAGRTGRLHLAIECHSCF
FT                   QWLMPALDAFRGQWPDVALDLSAAFSFAPLPALVRGDLDLVITSDPQALEAVTYLPLFK
FT                   YELVLAVAESNPLAANRHVMPEQLADQTLITYPVDRQRLDIFTGFLDPADIEPAAIRRA
FT                   ELTPIIAQLVASNRGVAALPNWALTEYLGQGWLRVCHLGPQGVWPTLYAAVRTEDSDSS
FT                   YIDEFLTIARDVCFKTLSGIKAAKGLPA"
FT   misc_feature    complement(49707..50333)
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 2.4e-37"
FT   misc_feature    complement(50403..50582)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 1.4e-20"
FT   misc_feature    complement(50448..50540)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   CDS_pept        50732..53047
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="BPP2636"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocyst
FT                   eine methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2543"
FT                   /db_xref="GOA:Q7W791"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W791"
FT                   /protein_id="CAE37928.1"
FT                   /translation="MRKAGIVMTIIHNLGFPRIGAQRELKRAVEAYWAGRQTAEALHET
FT                   GRALRAAHWQRQADAGVAFVPVGDFAWYDHILEWTTLLGAVPARFGHPEGKPVDLDTLF
FT                   RMGRGRAPSGKPAAACEMTKWFDTNYHYIVPELTPGQTFRVAREDLFEQVKEAQALGHR
FT                   VKPVIPGPLTWLWLGKGDAFAQGAGDIGKLQLLDALLPVYGEVLERLAGLGVEWVQIDE
FT                   PALVLDLPQAWRDAYQAVYAKLAASPVKLLLATYFDGLKDNLATALALPVAGLHVDLVR
FT                   APDQLSDVASGLRPGQVLSAGVINGRNIWRTDLDAALAMLAPVREQLQERLWLAPSCSL
FT                   LHVPVDLAGETELDAELLGWLSFAVQKLDELCLLGKALGGDADPAVQQGLAAQRAALQA
FT                   RRQSPRIHNPAVAQRMAGQAGVSRERAPFGQRIARQQSELRLPAFPTTTIGSFPQTAEI
FT                   RALRRDWKSGALTDSAYENAIRKEIEEVIRFQEKVGLDVLVHGEPERNDMVEYFGELLA
FT                   GFAFTKNGWVQSYGSRCVKPPIIFGDVARPAPMTVGWSAYAQSLTDKPVKGMLTGPVTI
FT                   LQWSFVRDDQPREATCRQLALALRDEVVDLEAAGIRVIQIDEPAIREGLPLRRADWRAY
FT                   LDWAVDCFRLSTAGVGEATQIHTHMCYSEFNDIIESIAAMDADVITIETSRSNMELLKA
FT                   FEDFHYPNDIGPGVYDIHSPNVPEVDWMVELMRKAAARLPKERLWVNPDCGLKTRAWPE
FT                   TEAALIGMVQAARTLRAA"
FT   misc_feature    52061..53032
FT                   /note="HMMPfam hit to PF01717, Methionine synthase,
FT                   vitamin-B12 independent, score 9.4e-218"
FT   CDS_pept        53252..53866
FT                   /transl_table=11
FT                   /locus_tag="BPP2637"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2542"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W790"
FT                   /protein_id="CAE37929.1"
FT                   /translation="MPLPPPDTPRQPLHTRSIRVQSYGREDGLWDLEAELIDYKGYDFP
FT                   KRDGQLFKVGEFIHHMHLRITIDEAYTIIAAQAVYDAAPYDGVCTNIEQAYRDLVGMNL
FT                   LKGFRRQVKERFGHVAGCTHMTELSQVLPTAAVQSMAGRRRQNSNPDKRPFQLGGCHAL
FT                   RTDGPVVQEHYPKWYTGANAGSSADTSSDSPSLSYVLTGIT"
FT   CDS_pept        53863..55023
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="BPP2638"
FT                   /product="Succinyl-CoA synthetase, beta chain"
FT                   /EC_number="6.2.1.5"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2541"
FT                   /db_xref="GOA:Q7W789"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W789"
FT                   /protein_id="CAE37930.1"
FT                   /translation="MKIHEYQGKELLKQFGVTVPRGIPAFSVDEAVAAAEKLGGPVWVV
FT                   KAQIHAGGRGKGGGVKLGRSIDEVRQLSSEILGMQLVTHQTGPQGQKVRRLLIEEGADI
FT                   KKEYYVGIVTDRGTQRVCVMASSEGGMDIEEVAAHSPEKILKVFVDPAAGLTDAEAAEL
FT                   ARGIGVPEASVGKAAAEFQKLYKAYWDTDASLAEINPLILTGSGDIIALDAKFNFDSNA
FT                   LFRHPEIVAYRDLDEEDPAEIEASKFDLAYIQLDGNIGCLVNGAGLAMATMDTIKLFGG
FT                   EPANFLDVGGGATAEKVTEAFKIMLKNKSVKAILVNIFGGIMRCDVIAEGVITACKAVN
FT                   LNVPLVVRMKGTNEELGKKMLAESGLPIISADTMAEAATKVVAAVK"
FT   misc_feature    53947..54456
FT                   /note="HMMPfam hit to PF02222, ATP-grasp domain, score
FT                   2.7e-42"
FT   misc_feature    54598..55017
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00549, CoA-ligase, score 5.2e-71"
FT   misc_feature    54631..54705
FT                   /note="PS01217 ATP-citrate lyase / succinyl-CoA ligases
FT                   family signature 3."
FT   CDS_pept        55043..55924
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="BPP2639"
FT                   /product="succinyl-CoA synthetase, alpha chain"
FT                   /EC_number="6.2.1.5"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2540"
FT                   /db_xref="GOA:Q7W788"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W788"
FT                   /protein_id="CAE37931.1"
FT                   /translation="MSILINKDTKVITQGITGKTGQFHTRMCREYANGKAAFVAGVNPK
FT                   KAGEDFEGVPIYANVKDAKADTGATVSVIYVPPAGAAAAIWEAVEAELDLVICITEGIP
FT                   VRDMLEVKNRMQAMNSKTLLLGPNCPGLITPDEIKIGIMPGHIHRKGRIGIVSRSGTLT
FT                   YEAVAQVTELGLGQSSAVGIGGDPINGLKHVDVLKLFNDDPDTDAVIMIGEIGGPDEVN
FT                   AAQWAKDNMKKPVVGFIAGVTAPAGKRMGHAGALISGGADTADAKLEVMEACGIRTTRN
FT                   PSEMGKLLKSVL"
FT   misc_feature    55052..55396
FT                   /note="HMMPfam hit to PF02629, CoA binding domain, score
FT                   2e-52"
FT   misc_feature    55454..55897
FT                   /note="HMMPfam hit to PF00549, CoA-ligase, score 1.8e-40"
FT   misc_feature    55511..55600
FT                   /note="PS01216 ATP-citrate lyase / succinyl-CoA ligases
FT                   family signature 1."
FT   misc_feature    55763..55804
FT                   /note="PS00399 ATP-citrate lyase / succinyl-CoA ligases
FT                   family active site."
FT   CDS_pept        56200..56895
FT                   /transl_table=11
FT                   /locus_tag="BPP2640"
FT                   /product="integral membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2539"
FT                   /db_xref="GOA:Q7W787"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W787"
FT                   /protein_id="CAE37932.1"
FT                   /translation="MELSSAAFWIALLQIIWVNILLSGDNAVVIALAARSLPPDQQKKA
FT                   IVVGSAAAIVMRIVLTLVAAKLLLLPWLKLIGAALLVYIGVSLLLPEGEDDGAEKGHGS
FT                   LLVAIRTIMIADLVMSLDNVVAVAAAAMGDTTLLVLGLAISIPLVIFGSALLLKVIERF
FT                   PIIVWVGAALLGFIAGELLVGDPALEESVARIDTMLGVTQHDFALMVGAIGAILVLALG
FT                   KIFQARQRA"
FT   misc_feature    join(56227..56295,56332..56391,56401..56469,56506..56574,
FT                   56602..56670,56689..56748,56815..56874)
FT                   /note="7 probable transmembrane helices predicted for
FT                   BPP2640 by TMHMM2.0 at aa 10-32, 45-64, 68-90, 103-125,
FT                   135-157, 164-183 and 206-225"
FT   CDS_pept        56967..57773
FT                   /transl_table=11
FT                   /locus_tag="BPP2641"
FT                   /product="integral membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2538"
FT                   /db_xref="GOA:Q7W786"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W786"
FT                   /protein_id="CAE37933.1"
FT                   /translation="MAAFCHGEADGGLPGISPVFTNNACWGFQVLEFFQTLSWAAVFQI
FT                   ILIDILLGGDNAVVIALACRNLAPKQRMQGILWGTAGAIILRVVLIAFALTLLNIPFLK
FT                   VVGGLLLVWIGVKLLVPEDEGHDSIKGGTSIVAAVKTIIIADFVMSLDNVIAIAGAAQN
FT                   AHADHQIGLVVFGLVVSVPIIIWGSTLVLKLIDRFPMVVTFGAALLGWIAGGMLITDVF
FT                   VVRQFGEQPSAVKIGVEIAGALLVVLLGRWLASRKTASKESVNESA"
FT   misc_feature    join(57084..57152,57189..57257,57369..57437,57474..57542,
FT                   57570..57638,57672..57731)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPP2641 by TMHMM2.0 at aa 40-62, 75-97, 135-157, 170-192,
FT                   202-224 and 236-255"
FT   CDS_pept        57892..58836
FT                   /transl_table=11
FT                   /gene="HemC"
FT                   /locus_tag="BPP2642"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="4.3.1.8"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2537"
FT                   /db_xref="GOA:Q7W785"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W785"
FT                   /protein_id="CAE37934.1"
FT                   /translation="MAAVERLTIATRASRLALWQAEHVRDLLRARYPACSVELLTLTTR
FT                   GDQILDRTLSKVGGKGLFVKELETALLDGRADLAVHSLKDVPVDLHAPFELSCVLERAD
FT                   PRDAFVSNDYGSLADLPPGAAVGTSSLRRESQIRARYPHLVVKPLRGNLDTRLGKLDNG
FT                   DYAAIVLAAAGLERLGLAARIRALLEPADSLPAAGQGALGIEILQGRADVRAMLAPLGD
FT                   AATLACVTAERAVSRMLGGSCQVPLAAYARIDGDELALRALVAAPDGRRIVRAERRGPR
FT                   DQAQAIGESAARDLLADGADAILAELLPTSPAP"
FT   misc_feature    57910..58782
FT                   /note="HMMPfam hit to PF01379, Porphobilinogen deaminase,
FT                   score 1.4e-143"
FT   misc_feature    58585..58635
FT                   /note="PS00533 Porphobilinogen deaminase cofactor-binding
FT                   site."
FT   CDS_pept        58833..59657
FT                   /transl_table=11
FT                   /locus_tag="BPP2643"
FT                   /product="putative uroporphyrinogen-III synthase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2536"
FT                   /db_xref="GOA:Q7W784"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W784"
FT                   /protein_id="CAE37935.1"
FT                   /translation="MTGRSGPRGGLPMSQIAILTRPQGRNGALAQRLHEAGWQTLCLPA
FT                   LRIEPLPPENGAVPLPRDYDLVVFVSGNAARLYLEQLGERGQLPWPAGAVAATVGPASA
FT                   RALLDSGQFGADTTVLHPAETALTHDSEALWALLRARPALPRRALLVRGTQGRDWLADR
FT                   LAAAGVEVSRHAVYRRRPAPWAQEGRQRLRDWARAGERPTWLLTSGEGIDALVQGLREE
FT                   QLLDWWLQGRFVVTHPVLAERLRALAGGGADAPMVKNCMPADEAIFATFVAA"
FT   misc_feature    58902..59594
FT                   /note="HMMPfam hit to PF02602, Uroporphyrinogen-III
FT                   synthase HemD, score 1.1e-05"
FT   CDS_pept        59644..60879
FT                   /transl_table=11
FT                   /locus_tag="BPP2644"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2535"
FT                   /db_xref="GOA:Q7W783"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W783"
FT                   /protein_id="CAE37936.1"
FT                   /translation="MLRLESSLHAITEYNRVMTDNTSATSPGTVPGTPGTAAADEAVAS
FT                   QSRKGKGVNSTLVTALIIVILLAVGLGWAAWLQRKQFVSAGQEVAARLNTLGAELTQSR
FT                   NDMREALALAQAQSGKVAELEGKVREAQSQYSALQQALQNLNDGASDEMLANDIERLIT
FT                   IASQQLRLAGNVSNAIVALETAQARLARADRPRFASLQQSINGDLDRLRAVGVVDIAAQ
FT                   SARIDRLVALVGRAPLLVPDAAAPGVTAVPQANEAVPASVDPGADLPADAAWWQRWQAE
FT                   IASWPGRAGSALAHELGDLIRVQRVDQPTALLLSPEQAGQLRSTLRQRLLTAQLSMLMR
FT                   QPAVWKSELDAVAATLAQYFDGKAPDTVAALALARELGQVEIAVRVPDVADSLNGIAAL
FT                   RAAGFNADGQQD"
FT   misc_feature    59806..59874
FT                   /note="1 probable transmembrane helix predicted for BPP2644
FT                   by TMHMM2.0 at aa 55-77"
FT   CDS_pept        60883..62478
FT                   /transl_table=11
FT                   /locus_tag="BPP2645"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2534"
FT                   /db_xref="GOA:Q7W782"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W782"
FT                   /protein_id="CAE37937.1"
FT                   /translation="MRTWFWTLLLAVVAVALAVVLRAHAGNVLLLVWPWRIELSLTLTV
FT                   LLLVAAFVTLYIGLRLLAWLVAIPDRLRAWRGRRAQERDHELLERGWIGLLEGRFAQAE
FT                   KDLSKLFDQTKVRSRRVLAALSGARAAHNLGEYERRDRMLESAREQAGEDAGLQEATAT
FT                   VSADMLLDQGRAQQALDLLEPLQDGGARHLHTMRLLLRAETALQHHERVFMLARGLLRR
FT                   NAIGKAEAEQLIDSAGAARLRAGMAVDQWRPIWKDLKSDERLLPNIALAGAAAFEDAGE
FT                   ASEAARILEAAVAVKFNPALVAAYARCDAAQVPHRLAKAETWLQQRPADTDLLTALGLL
FT                   CLNGQLWGQAERYLQRSVSRRNDPQAHALLGSLYDRLDRPADAARHWRQATAARVALPV
FT                   LAADIALPAADTKADPAWLDAEREYVPNMSEYTAPVIADAPPEVEPGAVDYVLDPDARA
FT                   AGEHEPASAVAPEPVSVPPRTAIDIEDYFDSAPIPAAAIEAPVSSYRAGGDDEQPAKPG
FT                   GAVSSAGPASGDKA"
FT   misc_feature    60883..60957
FT                   /note="Signal peptide predicted for BPP2645 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.991 between residues 25 and 26"
FT   misc_feature    join(60892..60960,61018..61086)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP2645 by TMHMM2.0 at aa 4-26 and 46-68"
FT   CDS_pept        62507..63043
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="BPP2646"
FT                   /product="inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2533"
FT                   /db_xref="GOA:Q7W781"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W781"
FT                   /protein_id="CAE37938.1"
FT                   /translation="MSLDRVAPGKKLPDDFNVIIEIPMNADPVKYEVDKESGAIFVDRF
FT                   MLTAMHYPCNYGYIPQTLSEDGDPADVLVLTPFPIQIGAVVRCRAIGVLEMDDESGGDA
FT                   KLLAVPIEKLYPPYRNIKSYEDLPAEDVSRIQHFFEHYKDLEKGKWVKVKGWKGVDAAH
FT                   EEIVRSAERYAKGQA"
FT   misc_feature    62555..63031
FT                   /note="HMMPfam hit to PF00719, Inorganic pyrophosphatase,
FT                   score 4.2e-60"
FT   CDS_pept        63227..63922
FT                   /transl_table=11
FT                   /locus_tag="BPP2647"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2532"
FT                   /db_xref="GOA:Q7W780"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W780"
FT                   /protein_id="CAE37939.1"
FT                   /translation="MDYVFPPSPPAAVPVAGGNARFPVRRVYCVGRNYAEHAKEMGFTG
FT                   REDPFFFCKPVDAILSVADGATGEMPYPPKTANLHYEMELVVVLGKGGRDLTVEQADEC
FT                   VWGYALGLDMTRRDLQGEAKKQGRPWEVGKAFDLSAPLGPIHPRSAVGTLDKGAIWLDV
FT                   NGERKQSSDISQMIWNIPESIAYLSGLFELQPGDIIFTGTPEGVGAVVKGDVIVGGVEG
FT                   LGELRVRIA"
FT   misc_feature    63347..63862
FT                   /note="HMMPfam hit to PF01557, Fumarylacetoacetate (FAA)
FT                   hydrolase family, score 1.1e-55"
FT   CDS_pept        63949..64080
FT                   /transl_table=11
FT                   /gene="ecnB"
FT                   /locus_tag="BPP2648"
FT                   /product="entericidin B-like bacteriolytic toxin"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2531"
FT                   /db_xref="GOA:Q7W779"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W779"
FT                   /protein_id="CAE37940.1"
FT                   /translation="MRSKIVLTAFVVFGFVLQGCNTVAGMGKDMSDAGSAITHAAEK"
FT   misc_feature    63949..64005
FT                   /note="Signal peptide predicted for BPP2648 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.973) with cleavage site
FT                   probability 0.523 between residues 19 and 20"
FT   misc_feature    63961..64029
FT                   /note="1 probable transmembrane helix predicted for BPP2648
FT                   by TMHMM2.0 at aa 5-27"
FT   misc_feature    63976..64008
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   repeat_region   64133..64145
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS1001 element"
FT   repeat_region   64133..65439
FT   CDS_pept        64216..65436
FT                   /transl_table=11
FT                   /locus_tag="BPP2649"
FT                   /product="transposase"
FT                   /note="transposase for IS1001 element"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TTN6"
FT                   /protein_id="CAE37941.1"
FT                   /translation="MLDRKLLESLGGWQGYGVERVEWPEDPGRTLSIYLKPTAKVMLCE
FT                   QCGARCRQVHETTVRRVRDLPLFEYRVVLHVPRRRLWCEQCGGPRLERLAWLGRYQRVT
FT                   DRLAQACSQLLQSSNVQAVARFFELGWHTVKTLDKARLRASVREPDWSKIEYLAMDEFA
FT                   LHKGHRYATVVVDPIGRQVLWIGPGRSRETARAFFEQLPPGAAQRIKAVAIDMTTAYEL
FT                   EIQAHSPQAEIVYDLFHVVAKYGREVIDRVRVDQANQLRQDRPARRIIKSSRWLLLRNR
FT                   DNLDRQQAVRLDELLQANQPLLTVYVLRDELKRLWFYQRPAWARQAWNHWYEQAEQSGI
FT                   AALNTFAQRLKGYLHGILARCRHPLNTSIVEGINNTIKVIKRRAYGYRDQEYFFLKIRA
FT                   AFPGNAR"
FT   misc_feature    64306..65295
FT                   /note="HMMPfam hit to PF01610, Transposase, score 7.9e-128"
FT   CDS_pept        complement(65399..66364)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2650"
FT                   /product="Putative transcriptional regulatory protein
FT                   (pseudogene)"
FT                   /note="Similar to the C-terminal region of Ralstonia
FT                   solanacearum probable sigma-54 interacting response
FT                   regulator transcription regulator protein RSP1667 or
FT                   RS02226 SWALL:Q8XPH3 (EMBL:AL646086) (491 aa) fasta scores:
FT                   E(): 8.4e-57, 55.85% id in 299 aa, and of Escherichia coli
FT                   transcriptional regulatory protein ZraR or HydG or B4004
FT                   SWALL:ZRAR_ECOLI (SWALL:P14375) (441 aa) fasta scores: E():
FT                   1.9e-38, 44.51% id in 301 aa. Also similar to the
FT                   C-terminal region of downstream CDS BPP2651 (469 aa) fasta
FT                   scores: E(): 3.1e-49, 51.803% identity in 305 aa overlap"
FT                   /db_xref="PSEUDO:CAE37942.1"
FT   repeat_region   complement(65427..65439)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS1001 element"
FT   misc_feature    complement(65474..65596)
FT                   /note="HMMPfam hit to PF02954, Bacterial regulatory
FT                   protein, Fis family, score 2.5e-08"
FT   misc_feature    complement(65723..66364)
FT                   /note="HMMPfam hit to PF00158, Sigma-54 interaction domain,
FT                   score 3.5e-101"
FT   misc_feature    complement(66080..66127)
FT                   /note="PS00676 Sigma-54 interaction domain ATP-binding
FT                   region B signature."
FT   misc_feature    complement(66272..66313)
FT                   /note="PS00675 Sigma-54 interaction domain ATP-binding
FT                   region A signature."
FT   CDS_pept        66666..68072
FT                   /transl_table=11
FT                   /gene="zraR"
FT                   /gene_synonym="hydG"
FT                   /locus_tag="BPP2651"
FT                   /product="Putative transcriptional regulatory protein"
FT                   /note="Similar to Ralstonia solanacearum probable sigma-54
FT                   interacting response regulator transcription regulator
FT                   protein RSP1667 or RSrs02226 SWALL:Q8XPH3 (EMBL:AL646086)
FT                   (491 aa) fasta scores: E(): 2.7e-100, 58.83% id in 464 aa,
FT                   and to Escherichia coli transcriptional regulatory protein
FT                   ZraR or HydG or B4004 SWALL:ZRAR_ECOLI (SWALL:P14375) (441
FT                   aa) fasta scores: E(): 2.7e-58, 42.82% id in 439 aa. Also
FT                   similar in its C-terminal region to upstream CDS BPP2650
FT                   (322 aa) fasta scores: E(): 5.1e-49, 51.803% identity in
FT                   305 aa overlap"
FT                   /db_xref="GOA:Q7W778"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W778"
FT                   /protein_id="CAE37943.1"
FT                   /translation="MHCGGTMPHLLIVDDDDAVRDNLVEIGREHGYTVAQAGTVRDALI
FT                   QVERQLPDLVLTDVRLPGATGMDLFSRISHAGVEVVVITGYGSMENAIEALRAGATDYL
FT                   VKPICMERLEQILARVASAGQDGDWDPSQPFQQEDRFGRLVGASAPMQALYRQISRVAP
FT                   TEVTTLLIGESGTGKELAAHAVHELSARRAGPFVAVNCGAISPNLIESELFGHERGSFT
FT                   GAERQHKGYFERADNGTLFLDEVTEMPLDLQVKLLRVLETGAFMRVGTNREISCSVRVV
FT                   AATNRSPEQAVRDGRLREDLYYRLSVFPIELPPLRERGDDLAMLAGRFLDGLNREYGKD
FT                   KRFAPQALQTMAEYAWPGNVRELKNFVRRAFILAESDTLDASALTPQISPSDAAGGGQV
FT                   IVPVGSTLAEADRRLILATLQRCGGVKKQTAAMLGISAKTLYNRLEEYGEAGPPDAAPG
FT                   AEGAASRAQH"
FT   misc_feature    66687..67040
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 2.3e-28"
FT   misc_feature    67095..67757
FT                   /note="HMMPfam hit to PF00158, Sigma-54 interaction domain,
FT                   score 3.7e-126"
FT   misc_feature    67353..67400
FT                   /note="PS00676 Sigma-54 interaction domain ATP-binding
FT                   region B signature."
FT   misc_feature    67731..67760
FT                   /note="PS00688 Sigma-54 interaction domain C-terminal part
FT                   signature."
FT   misc_feature    67884..68006
FT                   /note="HMMPfam hit to PF02954, Bacterial regulatory
FT                   protein, Fis family, score 2e-13"
FT   CDS_pept        68148..69914
FT                   /transl_table=11
FT                   /locus_tag="BPP2652"
FT                   /product="Putative pyruvate dehyrdogenase"
FT                   /note="Similar to Streptomyces coelicolor putative pyruvate
FT                   dehydrogenase SCO7412 or SC6D11.08 SWALL:Q9L147
FT                   (EMBL:AL158061) (600 aa) fasta scores: E(): 2.9e-123,
FT                   55.51% id in 589 aa, and to Lactobacillus plantarum
FT                   pyruvate oxidase SWALL:POXB_LACPL (SWALL:P37063) (603 aa)
FT                   fasta scores: E(): 5.4e-39, 29.52% id in 552 aa"
FT                   /db_xref="GOA:Q7W777"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W777"
FT                   /protein_id="CAE37944.1"
FT                   /translation="METVSDFVLERLAQWGIRRIFGYPGDGINGLMGAFGRTRQPLEFV
FT                   QARHEEMAAFMACAHAKFTGQVGVCMATSGPGAIHLLNGLYDAKLDHQPVLALVGQQAR
FT                   RALGGDFQQEVDLVSLFKDVAHDFVQQAASAEQARHLIDRALRIALERRCVTCVILPND
FT                   VQDLPAVRELPREHGSVPTGIGVTSHAAVPPDTALRNAADILNRGERIAILAGAGALEA
FT                   AEPLQAVAERLGAGVAKALLGKAALPDALPYVTGAIGLLGTQPSWEMMNECDTLLMVGT
FT                   AFPYSEFLPSEGQARAVQIDRDGRNLNLRYPVEVGLAGDSRQTLQALLPLLEPKPQVRW
FT                   RERIEASVARWWRTVEARAMVDASPVNPQRVFWELSQRLPDRSIVTADSGSAANWYARD
FT                   VKLREGMMASLSGGLATMGCAVPYALAAKLAYPERPVVALAGDGAMQMNGINELITIAD
FT                   RWRAWADPTLVVLVLNNGDLNLVTWEQRVMGGDPRFEDSQRLPPFAYADYTRMLGLHGL
FT                   RVERAQDLGAAWGEALTAGRPAVLEVLTDPEMPPLPPHIRARQVRAYVQALRADPAGGA
FT                   ALRATLKQWWAG"
FT   misc_feature    68148..68666
FT                   /note="HMMPfam hit to PF02776, Thiamine pyrophosphate
FT                   enzyme, N-terminal TPP binding domain, score 3.4e-45"
FT   misc_feature    68727..69179
FT                   /note="HMMPfam hit to PF00205, Thiamine pyrophosphate
FT                   enzyme, central domain, score 3.8e-16"
FT   misc_feature    69231..69776
FT                   /note="HMMPfam hit to PF02775, Thiamine pyrophosphate
FT                   enzyme, C-terminal TPP binding domain, score 5.1e-28"
FT   misc_feature    69420..69479
FT                   /note="PS00187 Thiamine pyrophosphate enzymes signature."
FT   CDS_pept        69963..70196
FT                   /transl_table=11
FT                   /locus_tag="BPP2653"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W776"
FT                   /protein_id="CAE37945.1"
FT                   /translation="MKASNDTPSSKPSAPRRDEAPAARKPRPGEEQADGSPGEAGAISN
FT                   PMPGLSPQRTPGIDRWSENDFEAVWRRATREL"
FT   CDS_pept        70302..70646
FT                   /transl_table=11
FT                   /locus_tag="BPP2654"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   transmembrane protein RSC0753 or RS05100 SWALL:Q8Y1D7
FT                   (EMBL:AL646060) (108 aa) fasta scores: E(): 2.5e-05, 31.11%
FT                   id in 90 aa"
FT                   /db_xref="GOA:Q7W775"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W775"
FT                   /protein_id="CAE37946.1"
FT                   /translation="MHAHTEDRARMRESKQQVKSGLHELIAGAEALLRSTASYGGSELE
FT                   SVRDRLKHQLEAARDQAGGWERSAVERYQRASRVADGYVHENSWKLIGVAIVLGALLGA
FT                   CAMSDRGRRR"
FT   CDS_pept        complement(70666..70965)
FT                   /transl_table=11
FT                   /locus_tag="BPP2655"
FT                   /product="Putative exported protein"
FT                   /note="Low similarity to Yersinia pestis putative
FT                   lipoprotein YPO2202 SWALL:Q8ZEH1 (EMBL:AJ414151) (104 aa)
FT                   fasta scores: E(): 0.0014, 27.77% id in 90 aa, and to
FT                   Escherichia coli osmotically inducible protein Y precursor
FT                   OsmY or B4376 SWALL:OSMY_ECOLI (SWALL:P27291) (201 aa)
FT                   fasta scores: E(): 0.014, 31.88% id in 69 aa"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W774"
FT                   /protein_id="CAE37947.1"
FT                   /translation="MTTASLPCALRSALLALLLAACSGPASGNDMALAAQIRQALVETP
FT                   GLRSETVQVQSRNGAVRLSGTADTDEAAAQALSAARSVPGVREVRNEIRVRDPL"
FT   misc_feature    complement(70882..70965)
FT                   /note="Signal peptide predicted for BPP2655 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.959 between residues 28 and 29"
FT   misc_feature    complement(70900..70932)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        71153..71896
FT                   /transl_table=11
FT                   /locus_tag="BPP2656"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar in its C-terminal region to Rhizobium
FT                   meliloti SMC22-1 RB0216 or SMB20225 SWALL:Q9R9P4
FT                   (EMBL:AF178441) (228 aa) fasta scores: E(): 3.4e-09, 35.02%
FT                   id in 197 aa"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W773"
FT                   /protein_id="CAE37948.1"
FT                   /translation="MRNDNRRQPPYGDDDFGPHDEFERDFRLGGRDVRQGRPSWHGNDR
FT                   PEAQEYSRGSGRWGAEEPDYGRPYGERPNRATGGQPNRRGPQYEQGGPYPGTRRAQWNE
FT                   PITSRSADPGQSSYGGFRDEDPRWQRQQFHDGPLAGDYGGYHGDGGEWAGLAGAGHRAG
FT                   SRRILPKGYTRSDERLREDVCERLAHSGLDVSDVSVSVTDGQVELSGTVARRRDKYAIE
FT                   NCADDCLGVADIDNRIRVVAPTAAP"
FT   CDS_pept        join(71911..72339,72341..72355)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2657"
FT                   /product="conserved hypothetical protein (pseudogene)"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Rb0503 or Smb20522 SWALL:Q92W42 (EMBL:AL603643) (122 aa)
FT                   fasta scores: E(): 2.1e-11, 40% id in 115 aa, and to
FT                   Agrobacterium tumefaciens Agr_c_723p SWALL:Q8U5M3
FT                   (EMBL:AE007978) (142 aa) fasta scores: E(): 6.3e-14, 42.24%
FT                   id in 116 aa"
FT                   /db_xref="PSEUDO:CAE37949.1"
FT   variation       72336..72343
FT                   /note="(CCAG)2 in parapertussis; (CCAG)1 in bronchiseptica"
FT   CDS_pept        complement(72406..72894)
FT                   /transl_table=11
FT                   /locus_tag="BPP2658"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Anabaena sp. hypothetical protein ALR3394
FT                   SWALL:Q8YRQ0 (EMBL:AP003592) (171 aa) fasta scores: E():
FT                   7.7e-25, 46.15% id in 156 aa, and to Rhizobium meliloti
FT                   hypothetical membrane-anchored protein SMB21362 or RB0938
FT                   SWALL:Q92UZ6 (EMBL:AL603645) (146 aa) fasta scores: E():
FT                   7.4e-12, 30.13% id in 146 aa"
FT                   /db_xref="GOA:Q7W772"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W772"
FT                   /protein_id="CAE37950.1"
FT                   /translation="MDVDWNGMFALTVPPLELFLRGTLIYWFLLALLRLAGRRDIGSLG
FT                   VADMLVLVLIADAAQNAMAGEYKSVTDGAILLLTIVGWTVAIDRASYFLPAVGRVLAPS
FT                   TVCLVRDGELQRRNMRREYITEAELMSELRLKGYDSLDDVHRAYMEPDGNISALRRHG"
FT   misc_feature    complement(72799..72864)
FT                   /note="1 probable transmembrane helix predicted for BPP2658
FT                   by TMHMM2.0 at aa 10-32"
FT   CDS_pept        complement(72946..73365)
FT                   /transl_table=11
FT                   /locus_tag="BPP2659"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W771"
FT                   /protein_id="CAE37951.1"
FT                   /translation="MSAAPERVRRPQTPCPWRPREPAGAAAPQARRLQGMRHPPLRRAI
FT                   VPKRSLWPVSPPDAEPRPGLGPSDSSDSASDLPDAAAETDSDTGGTGERPDVEYDRQPP
FT                   DGADIAPDTQTDAGHAGVSRHRPDPVRNGGPPDQS"
FT   CDS_pept        73449..74189
FT                   /transl_table=11
FT                   /locus_tag="BPP2660"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W770"
FT                   /protein_id="CAE37952.1"
FT                   /translation="MDHGAGWRRLVGPDPGTAMAQRLLVVSPHFDDAVFSCGGLLAATP
FT                   GATVLTVFSGVPSVAAALPDWDRRCGFERADQAMQARQAEDRNALAELGASGLGLDLLD
FT                   SQYPGSEAMLARLPTVLAAAVQSIRPGALLIPLGLFDEDHVRVADAALAVRGLFDGCDW
FT                   LAYEEVLYRRRRGAVQARLTQLHGRKVYATPVALPGDARGASKTRAVAAYHSQLEPLGL
FT                   VPGHGDDAAPERYWRLTWPRPDAG"
FT   CDS_pept        74246..74845
FT                   /transl_table=11
FT                   /locus_tag="BPP2661"
FT                   /product="Putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="GOA:Q7W769"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W769"
FT                   /protein_id="CAE37953.1"
FT                   /translation="MSMIVAARFMTFDAAAAAAGRLQAAGVSQEDIHTFYVNSAGAHDR
FT                   YPLGGDRRADPDAGPAQYGAITGAAVGGLALGAIAGVVASALAATALALVAAVGVGAYV
FT                   GALFGALWVAGRGRRPLRPATASPTASPPGADEHAPVRHAGVMLALHVDGVQAERTLAL
FT                   LRDAGGQDLERAQGRWVDGKWEDFDPLQPPQLAAGG"
FT   misc_feature    74246..74317
FT                   /note="Signal peptide predicted for BPP2661 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.929) with cleavage site
FT                   probability 0.703 between residues 24 and 25"
FT   misc_feature    join(74432..74500,74519..74587)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP2661 by TMHMM2.0 at aa 83-105 and 112-134"
FT   CDS_pept        74977..75450
FT                   /transl_table=11
FT                   /locus_tag="BPP2662"
FT                   /product="Hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W768"
FT                   /protein_id="CAE37954.1"
FT                   /translation="MARQHGASGDVQAYARQAAARLQDLGRGLADVAHAQAVTLPAGPD
FT                   VTQRTHLQELAQQREAAFDRMYLHWAGVALGEETLRHYQQAAEEAQAAPVREFAVHTLP
FT                   MLQNLLQDARRLARPPPQAEPRKLPPGGPGEPAPPSPASPSAPPSIDATRPGR"
FT   CDS_pept        complement(75455..76462)
FT                   /transl_table=11
FT                   /locus_tag="BPP2663"
FT                   /product="Putative short-chain dehydrogenase"
FT                   /note="Similar to Bacillus subtilis general stress protein
FT                   39 YdaD SWALL:GS39_BACSU (SWALL:P80873) (285 aa) fasta
FT                   scores: E(): 3.5e-43, 51.07% id in 280 aa, and to Rhizobium
FT                   loti oxidoreductase, short-chain dehydrogenase/reductase
FT                   family Mll6858 SWALL:Q987Y1 (EMBL:AP003010) (287 aa) fasta
FT                   scores: E(): 5.3e-58, 60.21% id in 284 aa"
FT                   /db_xref="GOA:Q7W767"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W767"
FT                   /protein_id="CAE37955.1"
FT                   /translation="MPKTPSDASPKTRQAADRTAERQREIQREQDQRDQRKPAAGRPGE
FT                   APRTGARDHPEPPMPRQHLAKPGNEADMALQPQFLAPAYRGSGKLEGLAALVTGGDSGI
FT                   GRAVAVLYAREGADVAIVYLQEHEDARETARHVEAEGRRSLLIAGDVRDPVFCEEAVAR
FT                   TLREFGKLDILVNNAAYQEHASSLQDITDERLDETFRTNIYGYFHMARAALPHLKEGAS
FT                   IVNTGSVTGLRGHPKLLDYSSTKGAIHAFTWSLAANVAERGIRVNAVAPGPVWTPLNPA
FT                   DQAPEQIKDFGAKTALKRAAQPEELSPAYVFLASPACASYITGIVLPVTGTPGE"
FT   misc_feature    complement(75464..76192)
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 1.5e-65"
FT   misc_feature    complement(75695..75781)
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   CDS_pept        complement(join(76533..77414,77416..77517,77519..78973))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2664"
FT                   /product="Putative ATP-dependent DNA-ligase (pseudogene)"
FT                   /note="Similar to Rhizobium loti ATP-dependent DNA ligase
FT                   MLL4606 SWALL:Q98DP8 (EMBL:AP003004) (829 aa) fasta scores:
FT                   E(): 1.1e-79, 42.85% id in 840 aa, and to Agrobacterium
FT                   tumefaciens ATP-dependent DNA ligase ATU4632 or AGR_L_502
FT                   SWALL:AAL45426 (EMBL:AE009391) (771 aa) fasta scores: E():
FT                   4.6e-72, 42.96% id in 789 aa"
FT                   /db_xref="PSEUDO:CAE37956.1"
FT   misc_feature    complement(77822..78388)
FT                   /note="HMMPfam hit to PF01068, ATP dependent DNA ligase
FT                   domain, score 6.8e-23"
FT   misc_feature    complement(78299..78325)
FT                   /note="PS00697 ATP-dependent DNA ligase AMP-binding site."
FT   CDS_pept        complement(78992..79948)
FT                   /transl_table=11
FT                   /locus_tag="BPP2665"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein PA2150 SWALL:Q9I1W5 (EMBL:AE004642) (293 aa) fasta
FT                   scores: E(): 1.4e-45, 44.06% id in 295 aa, and to
FT                   Streptomyces coelicolor hypothetical protein SCO0601 or
FT                   SCF55.25c SWALL:Q9RJP3 (EMBL:AL132991) (347 aa) fasta
FT                   scores: E(): 1.8e-28, 38.71% id in 310 aa"
FT                   /db_xref="GOA:Q7W766"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W766"
FT                   /protein_id="CAE37957.1"
FT                   /translation="MLSLPSRQGGMMARIVWKGAIAFGLVHVPIVVHAASRPSRLDFDW
FT                   IDRRDNAPVGYQRINKRTGRAIDSEHIVKGYEYEKGEYVYMNDEDFARANVAATQTVEI
FT                   LDFVKAEEVPLYYFDTPYYLAPDRRGGPGYALLHRALRDSGRIGIAQVVLHTRQHLAAV
FT                   MPVGEVLMLVTMRYADEIVPAEEFGLDDAATHDRPGARELRMAMRLLDDMTRKWDPAQY
FT                   RDAYRDDLLAAIDRKVRAGKTHELAEPGEAAPRASAKVIDLAAMLQQSLERGKRRAGAP
FT                   AAPAKRAASARKATAKGAAAKRARKTPARRAPARKAA"
FT   misc_feature    complement(79313..79888)
FT                   /note="HMMPfam hit to PF02735, Ku70/Ku80 beta-barrel
FT                   domain, score 2.5e-46"
FT   misc_feature    complement(79844..79909)
FT                   /note="1 probable transmembrane helix predicted for BPP2665
FT                   by TMHMM2.0 at aa 13-35"
FT   CDS_pept        complement(79968..80291)
FT                   /transl_table=11
FT                   /locus_tag="BPP2666"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 ElaB protein or B2266 or Z3526 or ECS3154
FT                   SWALL:ELAB_ECOLI (SWALL:P52084) (101 aa) fasta scores: E():
FT                   1.6e-06, 40.74% id in 81 aa, and to Yersinia pestis
FT                   putative membrane protein YPOo0570 SWALL:Q8ZID5
FT                   (EMBL:AJ414143) (101 aa) fasta scores: E(): 2.1e-05, 36.58%
FT                   id in 82 aa"
FT                   /db_xref="GOA:Q7W765"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W765"
FT                   /protein_id="CAE37958.1"
FT                   /translation="MPTSKRPANFPADPTAPMSAGARQRWLDEIHATLDDPQYADIEEL
FT                   KARLRQQLDAAREAWSQLADTTSSLASEAADCADEFVHARPWQAVGVAAGVGMLVGALL
FT                   CRR"
FT   CDS_pept        complement(80352..80690)
FT                   /transl_table=11
FT                   /locus_tag="BPP2667"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas putida hypothetical 12.0 kDa
FT                   protein SWALL:O68643 (EMBL:AF052749) (109 aa) fasta scores:
FT                   E(): 3.5e-22, 54.63% id in 108 aa, and to Salmonella
FT                   typhimurium putative cytoplasmic protein STM1261
FT                   SWALL:Q8ZPY1 (EMBL:AE008755) (108 aa) fasta scores: E():
FT                   1.2e-21, 59.4% id in 101 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W764"
FT                   /protein_id="CAE37959.1"
FT                   /translation="MVMLNTHVVECLQACGRCAAACDYCASSCLREGHGADMARCIALD
FT                   LDCAAACRLCAAMMARESEFSTHMCTLCARICEVCGDECARHEPRHCQECATACHACAS
FT                   ACRAMARP"
FT   CDS_pept        80775..81074
FT                   /transl_table=11
FT                   /locus_tag="BPP2667A"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Homo sapiens P8 protein p8 SWALL:Q9NRK3
FT                   (EMBL:AF216972) (77 aa) fasta scores: E(): 3.2, 35.52% id
FT                   in 76 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W763"
FT                   /protein_id="CAE37960.1"
FT                   /translation="MTARRAVHYHALYAISCARCKMSKPEPARGADAHDDPSLDQAKVL
FT                   PPRSPVLVPNLPPKPPARAQADKHGPAVDNQTESNWADGAAPQPRARNARSSIF"
FT   CDS_pept        complement(81060..82085)
FT                   /transl_table=11
FT                   /locus_tag="BPP2668"
FT                   /product="Conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1332A"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein PA2244 SWALL:Q9I1M5 (EMBL:AE004650) (333 aa) fasta
FT                   scores: E(): 2.7e-66, 56.36% id in 330 aa, and to Rhizobium
FT                   meliloti putative DNA topoisomerase I protein RB1274 or
FT                   SMB21445 SWALL:Q92U65 (EMBL:AL603646) (351 aa) fasta
FT                   scores: E(): 8.8e-42, 40.82% id in 338 aa"
FT                   /db_xref="GOA:Q7W762"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013500"
FT                   /db_xref="InterPro:IPR014711"
FT                   /db_xref="InterPro:IPR035447"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W762"
FT                   /protein_id="CAE37961.1"
FT                   /translation="MSPAAPAALRYVDDSRPGLARRRLPGGKFAYYDADGRRVRDPATL
FT                   ARIAALAIPPAYREVWICARADGHLQATGRDARGRKQYRYHPDWRAWRDAAKYGQLREF
FT                   GRALPRIRRRVARDLSSRGLAPDKVAATVVRLLETTLARVGSRAYARENGSFGLTTVTR
FT                   RHAWLQGSRLRLRFTGKSGVAHDVTVRDRRIARVVKRCLDLPGQQLFHYLDEDGEPRPV
FT                   DSELINAYLREAGGGDFTAKHYRTWAASALALSLLLRCPAEGAAARRAAVVEVVKLVAA
FT                   RLANTPAVCRACYIHPGIVQAYLDGALPAGGAAPAGPRGLAADERRLLAFVAAWPHSEN
FT                   R"
FT   CDS_pept        complement(82082..82804)
FT                   /transl_table=11
FT                   /locus_tag="BPP2669"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1333"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein PA2141 SWALL:Q9I1X4 (EMBL:AE004641) (182 aa) fasta
FT                   scores: E(): 3e-18, 40.64% id in 187 aa, and to
FT                   Mycobacterium leprae cina-like protein CinA or ML2015 or
FT                   MLCB561.17 SWALL:CINA_MYCLE (SWALL:Q9X7D6) (428 aa) fasta
FT                   scores: E(): 8.7e-12, 41.95% id in 143 aa"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W761"
FT                   /protein_id="CAE37962.1"
FT                   /translation="MPPTVQGDAMNALQRTALYMQEQRLTLVTAESCTAGLIASLLAEE
FT                   PGAGALLDCAYVVYSPRAKTRCLGVAPDILRRHNLTSEAVARAMALGAARHSDANVAIA
FT                   NTGVADEPADGTPAGTQCYAWLFKAGPADAQPTIYTETARFDGARNTIRRDSARYALQR
FT                   LPHYHALWRVAGNPEPSTMKPTPTSHDRKQDDDTEREAQRSHGSQQSRTKKDGHVSQIG
FT                   SNQDQSSQRNRGQGARRS"
FT   misc_feature    complement(82301..82780)
FT                   /note="HMMPfam hit to PF02464, Competence-damaged protein,
FT                   score 8.2e-25"
FT   CDS_pept        complement(82822..83577)
FT                   /transl_table=11
FT                   /locus_tag="BPP2670"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1334"
FT                   /db_xref="GOA:Q7W760"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W760"
FT                   /protein_id="CAE37963.1"
FT                   /translation="MTTHSETITIPVFDTQVAGTLLTPRAKLPGVLFVHGWGGSQRFDL
FT                   SRARDIAGLGCICLTFDLRGHAATEAQRRQVTREDSLRDIMAAYDALIAHPAVDTSAIA
FT                   VVGSSYGGYLAAILTTLRAVRWLALHVPALYRDDEWAQPKLQLDRAAISAYRHATVAPE
FT                   GNRALSACSSFRGDVLIVEAEHDDYIPHSTIMSYRGAFLHSHSLTHRIVDGADHALSDK
FT                   RCQQAYSSILLNWATEMVVGARVGAGRPA"
FT   misc_feature    complement(83236..83328)
FT                   /note="PS00708 Prolyl endopeptidase family serine active
FT                   site."
FT   CDS_pept        complement(83564..84709)
FT                   /transl_table=11
FT                   /locus_tag="BPP2671"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1335"
FT                   /db_xref="InterPro:IPR021519"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W759"
FT                   /protein_id="CAE37964.1"
FT                   /translation="MNPAAAVPRRPVDLVVAHPGRRDAPRHERASLRALGRDIAELLGC
FT                   EYADALPAAARDPRLRVYYVPARTLLDGRALALGIQGPDDLFGGVAPHGFVATKAITHA
FT                   LPHDGCAAPAAWSRELGARLSDCVLPGCTVFALDEARQAGARMLRTGALRVKPVRATAG
FT                   RGQRKVADAAALDQALAEQDAGEVRRYGLVLEEHLEDISTYSVGVAQVGVHLASYIGTQ
FT                   SLTLDHAGLEVYGGSDLWFVPGPLPALLQLELDAPRRAALEHAMRYDEQAFACYPRLYA
FT                   SRRNYDVARGRDAQGRWRTGVLEQSWRAGGASLTEIAALRAFAQDGGLRRAHAATSEHY
FT                   GPDPAHPPGTRIVFHAHDAEVGFISKAGGMTQDNGTDDDDT"
FT   CDS_pept        complement(84763..85710)
FT                   /transl_table=11
FT                   /locus_tag="BPP2672"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1338"
FT                   /db_xref="GOA:Q7W758"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W758"
FT                   /protein_id="CAE37965.1"
FT                   /translation="MRHAHHHGHRRRRLGAWLAGIVGLAVVGVLLYQARRIDWHAVARA
FT                   AHDIPGPAVALAAALALAGYLAYAGFDILARRYAGHRLPAWQVAAIAMTSYALNLNLGV
FT                   LLGGVAVRLRLYGRHGLRTACGLRVVAFATATNWVGYAWLAGALLLAGQMPTPAGWHLG
FT                   AGLLRTVGAALLAGALAYLYLCRYARRRAYTLRGHRWVLPDLPTALRQMGLAGVSWAIM
FT                   GGIIYVLLQGRAPYPEVLAILLFSSIAALLAHIPGGLGVIEALLAAALATRMPASESLG
FT                   AVLMYRLLYAWIPLCVALPAYLGAEWRHRRAAAG"
FT   misc_feature    complement(join(84796..84861,84925..84990,85021..85086,
FT                   85150..85215,85261..85326,85390..85455,85486..85551,
FT                   85615..85665))
FT                   /note="8 probable transmembrane helices predicted for
FT                   BPP2672 by TMHMM2.0 at aa 15-32, 53-75, 85-107, 128-150,
FT                   165-187, 208-230, 240-262 and 283-305"
FT   CDS_pept        complement(join(85707..86684,86683..86862))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2673"
FT                   /product="probable phospholipase (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1339"
FT                   /db_xref="PSEUDO:CAE37966.1"
FT   misc_feature    complement(85980..86063)
FT                   /note="HMMPfam hit to PF00614, Phospholipase D. Active site
FT                   motif, score 2.4"
FT   misc_feature    complement(86463..86546)
FT                   /note="HMMPfam hit to PF00614, Phospholipase D. Active site
FT                   motif, score 3.9e-05"
FT   variation       complement(86682..86691)
FT                   /note="(CGGCG)2 in parapertussis; (CGGCG)3 in pertussis and
FT                   bronchiseptica"
FT   CDS_pept        complement(86859..87617)
FT                   /transl_table=11
FT                   /locus_tag="BPP2674"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1340"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W757"
FT                   /protein_id="CAE37967.1"
FT                   /translation="MPPEPIRLRILTVNAHKGFTSFNRRFILHELREALREARPDLVLL
FT                   QEVLGEHQRHAARHARWPAVSQYEFLADTLWSAYAYGRNAVYPDGHHGNAVLSKYPIVS
FT                   HRNEDLSVGAAHEPRGMLHCVLDVRDAPAPLHALCVHLGLREAHRQEQLRRLCQYLRQH
FT                   VPAQAAALLAGDFNDWRQRADATLARCGLADVHRLALGHAARTFPAACPLLRLDRIYVR
FT                   NVAGSEPRRLSRRPWSRLSDHVPLAAEVTL"
FT   misc_feature    complement(86868..87596)
FT                   /note="HMMPfam hit to PF03372,
FT                   Endonuclease/Exonuclease/phosphatase family, score 1.6e-19"
FT   CDS_pept        87711..87923
FT                   /transl_table=11
FT                   /locus_tag="BPP2675"
FT                   /product="Hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1341"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W756"
FT                   /protein_id="CAE37968.1"
FT                   /translation="MVRARPKETTMSATLCCHVPPKPDPIPPDSPPGDLPVDPDTDDPD
FT                   IDLPPPDAPGDPARRLAASVRFLLS"
FT   CDS_pept        87996..88628
FT                   /transl_table=11
FT                   /locus_tag="BPP2676"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1342"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W755"
FT                   /protein_id="CAE37969.1"
FT                   /translation="MHPFHVFAMSAHGGRGGGHAGGRHGGGHGAGGDGPDWRRGRKFSA
FT                   DDLQLMILALLEEGPSHGYELIKALGARSRGFYTPSPGMVYPTLTWLEEAGHATVSQDG
FT                   ARKHYHLAEPGRAHLQANRERVTLLMAQLAHVGRKMEWMRRAWAGQPIETGSEGEDLAT
FT                   GWLPEYVQARMALKQALARHADATPARQRQLAAILARAAAELDDLSS"
FT   misc_feature    88149..88379
FT                   /note="HMMPfam hit to PF03551, Transcriptional regulator
FT                   PadR-like family, score 3.6e-15"
FT   CDS_pept        88654..89454
FT                   /transl_table=11
FT                   /gene="mxcB"
FT                   /locus_tag="BPP2677"
FT                   /product="iron utilization protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1343"
FT                   /db_xref="GOA:Q7W754"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W754"
FT                   /protein_id="CAE37970.1"
FT                   /translation="MLPTELNVQRVRHPLKMRLLEVKRVTRPTPHLARITLAGDALRDF
FT                   VSASFDDHVKVFFPPPGAARPVLPELGPDGLVFAEGEPRPPMRDYTPRRHDARAGELDL
FT                   EFVLHGEGPAASWAARAQPGQQLGVAGPRGSFVVPLEYDWHLLVGDESALPAIARRLEE
FT                   LPPGKPVIALIEVADPAARLALSTRAQASVQWLLREPAGSRLPEAVRALRLPPGEGYAW
FT                   AAAESAVARAVRQALVDTHGLDKSRIRAASYWKRGEAAVHETHD"
FT   CDS_pept        join(89616..91766,91770..92216)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2678"
FT                   /product="autotransporter (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1344"
FT                   /db_xref="PSEUDO:CAE37971.1"
FT   misc_feature    89694..89726
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    join(90813..91766,91770..92213)
FT                   /note="HMMPfam hit to PF03212, Pertactin, score 4.6e-07"
FT   variation       91767..91769
FT                   /note="In-frame TAG stop codon in parapertussis; CAG in
FT                   pertussis and bronchiseptica"
FT   CDS_pept        complement(92204..95623)
FT                   /transl_table=11
FT                   /locus_tag="BPP2679"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1345"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W753"
FT                   /protein_id="CAE37972.1"
FT                   /translation="MQQLGATRRYAASDLVGFLACEHLTQLDLRALNAGQAPAAAADEQ
FT                   MALVQAKGQAHEQAWLERLRARHPDLADVTRAGPDLAARLAATRAAMAAGAPVIYQAAL
FT                   CHGPYVGHADFLLRTECPSALGDYGYEALDTKLARSPRASFVLQLSFYAWLLEHAQGVA
FT                   PRSMHVVLGSGRELALRVADYAHYLRQVLRRFEAAIAAEPAPPTYPEPCEHCPQCRWRV
FT                   GCEARRVADDHLSLVAGMSRQQARRLNAQGVATLAQLGALPEHAQVAGIEAGTLQRLRA
FT                   QAALQWRARVDGARHYELLAAQDEGPRGLARLPRPDPGDMFFDMEGDPLEDGGLEYLFG
FT                   LYVVDDGAERFVPFWAHDRRQERQAFEAFMDFVAERLRRHPDAHIYHYAPYEATALKKL
FT                   MSLHGTREAEVDHLLRAGKLVDLYRVVREGLRISEPSYSIKYVERFYLPRRAGEVTNAG
FT                   ASIVYYERWKAAGEPRLLQDIADYNRDDVVSTWRLRDWLCGIRPAGLPWHNEADQQDLD
FT                   AARAVIGEMTEAERRLLPYRAALADDLPADEAAWSPRDAFRALAWHLLDFHRREQKPAW
FT                   WAWFARGEATDGELIEDAECLGGLVRDDAAPPVRQAQSLRYTYRYPAQETKLRTGARCT
FT                   DVRTGASLANLVVDPHARLASFTCSARKPAPPPRMALGPAAPVNSKELVNAVFRYGDAV
FT                   CRAPDGMSTPMRAVDALLRREPPRIRGLARGAPLVAPHAELLPQVLDVVARMDETTLFL
FT                   QGPPGAGKTYTGSRVLLQLLRAGRRVAVSSNSHHAINNLLRGLERLAEREGFALRGAKK
FT                   SASAGDDSCLGGRQIEDVFDNKDVDPARHQLVAGTAWLFARPEFEQAFDYLFVDEAGQV
FT                   SLANLVAMGQCARNIVLLGDQMQLGQPSQGTHPGRSGESALEYLLDGQATIAASQGVFL
FT                   DTSYRMHPEICGFISEAIYDGRLRAAPATAAHRLLLDEAAGRELPAHGIRYVPVPHDGN
FT                   TQSSREEAARVAELCALLLRQRYVGEAGAPAPLRLDDILFVAPYNVQVNTLRAALPDGA
FT                   RVGTVDKFQGQEAQVVIVSMATSSGDYLPRDLEFLFSRNRLNVAISRARTLAILVASPA
FT                   LTAVRCRSAEQMALVNTLCWVAETGSASPYQV"
FT   misc_feature    complement(93338..93361)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(95631..96536)
FT                   /transl_table=11
FT                   /locus_tag="BPP2680"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1346"
FT                   /db_xref="GOA:Q7W752"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W752"
FT                   /protein_id="CAE37973.1"
FT                   /translation="MQDLNDLYYFVQTVDHRGFAPAGRALGMPKSKLSRRIAVLEERLG
FT                   VRLIQRSTRHFSVTDIGQTYYEHCKAMLVEAEAAQEAIDAAQVEPRGVVRLSCPVALLH
FT                   THVGAMLGEFMLRYPRVTLHLDASNRRVDVLGEGVDVAIRVRPPPLENSDLVMRPFADR
FT                   GQCLVASPALLARHGAPALPADLAAWPSLALGQPNQPHSWLLTGPQDAQATVPLAPRMV
FT                   TTDMLALRSAAVAGVGVVQLPSMMVRGQLADGTLVRLLPEWAPCRELIHAVFPSRRGLL
FT                   SSVRTLVDFLAERFAALQED"
FT   misc_feature    complement(95649..96278)
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 4.5e-43"
FT   misc_feature    complement(96348..96527)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 3.7e-13"
FT   CDS_pept        96675..97253
FT                   /transl_table=11
FT                   /locus_tag="BPP2681"
FT                   /product="putative reductase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1347"
FT                   /db_xref="GOA:Q7W751"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W751"
FT                   /protein_id="CAE37974.1"
FT                   /translation="MARLHIIICSTRPGRVGPAVADWFHAQALAHGGFEVALVDLAQVG
FT                   LPLYDEPRHPMLQQYEHAHTRAWSRSVASADAFVFVTPEYNYGPPPALVNALNYVYKEW
FT                   NYKPAAFVSYGGVSGGMRAVQAEKQTLTTLRMVPIFEYVAIPMVAERLDAAGRFQPQPI
FT                   HDSMAQGLLTELRRFSDALQVLREPASTP"
FT   misc_feature    96678..97205
FT                   /note="HMMPfam hit to PF03358, NADPH-dependent FMN
FT                   reductase, score 3e-35"
FT   CDS_pept        join(97250..97723,97725..98147)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="BPP2682"
FT                   /product="putative citrate lyase beta chain (pseudogene)"
FT                   /EC_number="4.1.3.6"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1348"
FT                   /db_xref="PSEUDO:CAE37975.1"
FT   misc_feature    join(97352..97723,97725..97967)
FT                   /note="HMMPfam hit to PF02896, PEP-utilizing enzyme, TIM
FT                   barrel domain, score 0.03"
FT   CDS_pept        complement(98247..99287)
FT                   /transl_table=11
FT                   /locus_tag="BPP2683"
FT                   /product="probable LacI-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1355"
FT                   /db_xref="GOA:Q7W750"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W750"
FT                   /protein_id="CAE37976.1"
FT                   /translation="MAGIAARTNVTIKDIATRLKLSHATVSRALADHPKISAATKASVR
FT                   EAAQAMGYVPNGTAQNMRTAHSPVIGLIVPDIQNDFYAAVAKIVADAAVARGFQLALSI
FT                   TEDNPEREFNDLRAFVVSRAAGVIITPTIKPKPETIALLKGVRAIQLIRQHAAVAAEAV
FT                   VIDERAATRAAAEHLIHYGHRRIAYVGTTTDLSLGEDRLSGFSSAMSKAGLDASLTAVG
FT                   PPRVEFAHRAVHGLMSGPKPPTALIIGSSRLTVGALKALRGLGLSCPADVSVVGYGDPD
FT                   WFELVGDGLTTVSPPVYPLGAYAINLLLARIQGEAVPAAADPAHATASRFPATLAIRGS
FT                   TRPLAR"
FT   misc_feature    complement(98271..99089)
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar binding domain of the LacI family, score 4.6e-08"
FT   misc_feature    complement(99183..99266)
FT                   /note="HMMPfam hit to PF00356, Bacterial regulatory
FT                   proteins, lacI family, score 6.5e-06"
FT   CDS_pept        complement(99275..99883)
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="BPP2684"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1356"
FT                   /db_xref="GOA:Q7W749"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W749"
FT                   /protein_id="CAE37977.1"
FT                   /translation="MQAFIRAHGIILPMNQDHVDTDAIIPQRWLVTVERDGLADGFMGA
FT                   WRYDEHGQPRPECVLNQPAYQGAAIVLARENYGCGSSREHAVWAHQGYGIRAIVAASYG
FT                   PIFHENCLKNGLLPITLPAADVATLMAQALADPGCACEVDLVSQRVIGPDGRAYPFEID
FT                   AGRRQLLLEGVDDIDLALARAADIAAFQRRQQQDQPWLA"
FT   misc_feature    complement(99377..99757)
FT                   /note="HMMPfam hit to PF00694, Aconitase C-terminal domain,
FT                   score 4.8e-17"
FT   CDS_pept        complement(join(99885..100463,100467..101312))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="BPP2685"
FT                   /product="3-isopropylmalate dehydratase large subunit
FT                   (Pseudogene)"
FT                   /EC_number="4.2.1.33"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1357"
FT                   /db_xref="PSEUDO:CAE37978.1"
FT   misc_feature    complement(join(99915..100463,100467..101267))
FT                   /note="HMMPfam hit to PF00330, Aconitase family (aconitate
FT                   hydratase), score 6.7e-160"
FT   misc_feature    complement(100050..100091)
FT                   /note="PS01244 Aconitase family signature 2."
FT   misc_feature    complement(100221..100271)
FT                   /note="PS00450 Aconitase family signature 1."
FT   variation       complement(100464..100466)
FT                   /note="In-frame TAA stop codon in parapertussis; TAC in
FT                   pertussis and bronchiseptica"
FT   CDS_pept        101482..102477
FT                   /transl_table=11
FT                   /locus_tag="BPP2686"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1358"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W748"
FT                   /protein_id="CAE37979.1"
FT                   /translation="MNSIKRVRGKTAALFAALGLWAAAVPAAGAATPYPERPIRLIVPF
FT                   GAGGTTDILGRVLGQQLGEALKQTVIVENRPGANGNIGSDAVAKAAPDGYTLLFAADAT
FT                   LVINPTLYSQLPFKPESDFAPISRIAVVPLVLVANPAVKADTLPELVKLGGKPDARLDF
FT                   GSAGAGSMGHLVGERLNRATGMSMTHIPYKSGAQAISDVVSGQIPLLITGLAVAEPFLR
FT                   DGKLKAIAVTSGQRFPGAPKVPTIAEGGVKDFDSPSWYGLLAPAGTPAPVLEKIHAALA
FT                   SALQTEDMKKRMVELGAWPVVDTQAAFAELIKADTQRWSQIIQAAGITVQ"
FT   misc_feature    101482..101571
FT                   /note="Signal peptide predicted for BPP2686 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.593 between residues 30 and 31"
FT   misc_feature    101641..102465
FT                   /note="HMMPfam hit to PF03401, Uncharacterized protein
FT                   family, UPF0065, score 3.7e-96"
FT   CDS_pept        102497..103675
FT                   /transl_table=11
FT                   /locus_tag="BPP2687"
FT                   /product="putative mandelate racemase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1359"
FT                   /db_xref="GOA:Q7W747"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034611"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W747"
FT                   /protein_id="CAE37980.1"
FT                   /translation="MRITAIREIAVPLQGNISNSLVSFAEHTVSLVALVSDVVRDGRPL
FT                   IGYAFDSIGRYAQPGLMRERFIPRLLQAAPHELLDDGGQAFDPARASAIMLRNEKPGGH
FT                   GDRAAAVGALELAFWDLNAKLRDEPAYCTIARHVGRPAQAGATQVYAAGGYYYDSGDPL
FT                   QRLRDEFRGYLDQGFVKFKMKIGGASLADDLARIEAALGVAGEGANLAVDANGRFDLDT
FT                   ALAYARALEPYGLRWYEEIGDPLDYHLNSLVAQAYAGTIATGENLFSLPDVRNLLHFAG
FT                   VRPGRDILQMDPGLSYGLTEYLRMMAAVEAAGFGRSCLHPHGGHLINLHIAAGLGLGGC
FT                   EAYPGVFQPFGGYPAACALGAGQVRPTDAPGFGLEQKQELAPYISVLAHGKA"
FT   misc_feature    102923..103648
FT                   /note="HMMPfam hit to PF01188, Mandelate racemase /
FT                   muconate lactonizing enzyme, C-terminal domain, score
FT                   0.00014"
FT   misc_feature    103686..103733
FT                   /note="Signal peptide predicted for BPP2688 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.961) with cleavage site
FT                   probability 0.399 between residues 16 and 17"
FT   misc_feature    103689..104051
FT                   /note="HMMPfam hit to PF02254, TrkA-N domain, score
FT                   0.00052"
FT   CDS_pept        join(103701..104195,104198..104605)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2688"
FT                   /product="putative ketopantoate reductase (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1360"
FT                   /db_xref="PSEUDO:CAE37981.1"
FT   CDS_pept        complement(104762..105184)
FT                   /transl_table=11
FT                   /locus_tag="BPP2690"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein PA3123 SWALL:Q9HZA1 (EMBL:AE004736) (125 aa) fasta
FT                   scores: E(): 2.9e-26, 62.5% id in 120 aa, and to Rhizobium
FT                   loti translation initiation inhibitor MLL4450 SWALL:Q98E15
FT                   (EMBL:AP003004) (132 aa) fasta scores: E(): 1.1e-15, 42.4%
FT                   id in 125 aa"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W746"
FT                   /protein_id="CAE37982.1"
FT                   /translation="MSAITRIASPLPLPFSRATIAGGFLFLSGQIPMDANGQVVRGDIR
FT                   AQTDAAIARIRETLALAGAGLQDVVKVTVWLSDLALFADFNDAYKQHFQDGFPCRSTVE
FT                   AKLAMEVDVEIEVQAWIGDKTPRGGASYTPGPVSEA"
FT   misc_feature    complement(104822..105163)
FT                   /note="HMMPfam hit to PF01042, YjgF family, score 3.3e-30"
FT   CDS_pept        complement(105298..105711)
FT                   /transl_table=11
FT                   /locus_tag="BPP2691"
FT                   /product="putative exported protein"
FT                   /note="No significant database matches"
FT                   /db_xref="InterPro:IPR031948"
FT                   /db_xref="InterPro:IPR038643"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W745"
FT                   /protein_id="CAE37983.1"
FT                   /translation="MPSCRPRLALACLAVLLAVPAAPVLAAPSGAAPCPPAAQAVSAPL
FT                   SSGGAVVVSNGACEPASIGSYVVNRYDDLDAGAFRAGLAIARDGVLVEWALDERQGKRV
FT                   LRLVSETAGSGAYRNTQYIELTGDGGLRLLDRP"
FT   misc_feature    complement(105634..105711)
FT                   /note="Signal peptide predicted for BPP2691 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.971 between residues 26 and 27"
FT   CDS_pept        complement(105790..107019)
FT                   /transl_table=11
FT                   /gene="cycH"
FT                   /locus_tag="BPP2692"
FT                   /product="cytochrome C-type biogenesis protein"
FT                   /note="Similar to Rhizobium meliloti cytochrome C-type
FT                   biogenesis protein CycH or R01017 or SMC02361
FT                   SWALL:CYCH_RHIME (SWALL:P45400) (381 aa) fasta scores: E():
FT                   1.7e-16, 30.64% id in 310 aa, and to Bradyrhizobium
FT                   japonicum cytochrome C-type biogenesis protein CycH
FT                   SWALL:CYCH_BRAJA (SWALL:P45399) (369 aa) fasta scores: E():
FT                   6.7e-15, 26.43% id in 367 aa"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR017560"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W744"
FT                   /protein_id="CAE37984.1"
FT                   /translation="MTALWLIVLLLLLATLAALILPMLRRERAAGPADAAATVRAFYQA
FT                   QRAQLQRELREGALTAQAHARAEEELQRELLQALDARRDTAPAPARRASLAAACALSVA
FT                   VPVAAMLLYQHLGDPRAAASMMLAAPQDAHAEDAAQDMTQAIGALAERLRRQPDDAEGW
FT                   YMLARSYETLGRYDDAVAAYMETVRLVPDQPALLADLADALLSANGGAPDAKSERVIAQ
FT                   ALALQPDQPKALALAGMAALRRGDAAQALAHWQRLKTLLPPDSPAAAQIDNNIAQARAM
FT                   ATGAPPAPAPQAAAPDSLAGHASIAAALRAQVADTDTVFILARPADGGRMPLAILRKQV
FT                   RELPLDFTLDRAQAMSPAATLAQASTVDVEIRVSRAGAAEARPGDLVGVLRGVAVGSRG
FT                   LRLVADTVVR"
FT   misc_feature    complement(106228..106329)
FT                   /note="HMMPfam hit to PF00515, TPR Domain, score 8.5"
FT   misc_feature    complement(106441..106542)
FT                   /note="HMMPfam hit to PF00515, TPR Domain, score 5e-05"
FT   misc_feature    complement(join(106669..106734,106957..107007))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP2692 by TMHMM2.0 at aa 4-21 and 95-117"
FT   misc_feature    complement(106915..107019)
FT                   /note="Signal peptide predicted for BPP2692 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.602 between residues 35 and 36"
FT   CDS_pept        complement(107016..107438)
FT                   /transl_table=11
FT                   /gene="ccmH"
FT                   /gene_synonym="nrfF"
FT                   /gene_synonym="cycL"
FT                   /locus_tag="BPP2693"
FT                   /product="cytochrome C-type biogenesis protein"
FT                   /note="Similar to Pseudomonas aeruginosa cytochrome C-type
FT                   biogenesis protein CcmH or PA1482 SWALL:Q9I3N0
FT                   (EMBL:AE004577) (155 aa) fasta scores: E(): 3.9e-16, 46.1%
FT                   id in 154 aa, and to Escherichia coli cytochrome C-type
FT                   biogenesis protein NrfF precursor or B4075 SWALL:NRFF_ECOLI
FT                   (SWALL:P32711) (127 aa) fasta scores: E(): 2.6e-13, 46.31%
FT                   id in 95 aa"
FT                   /db_xref="GOA:Q7W743"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W743"
FT                   /protein_id="CAE37985.1"
FT                   /translation="MRRAALLLGLWLLLGAPAAADIAQRELRLAHSLRCLVCQNQTLAE
FT                   SNAPLAHDMRALIRQQLADGRSDEEVMQFFEDRYGDFVRYEPPFKPATWLLWLGPFALL
FT                   LAGFVVLWRALARRPGAAPLTDAQRARAERFLDEES"
FT   misc_feature    complement(join(107094..107159,107367..107417))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP2693 by TMHMM2.0 at aa 7-24 and 93-115"
FT   misc_feature    complement(107379..107438)
FT                   /note="Signal peptide predicted for BPP2693 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.977 between residues 20 and 21"
FT   CDS_pept        complement(107435..107956)
FT                   /transl_table=11
FT                   /gene="ccmG"
FT                   /gene_synonym="dsbE"
FT                   /gene_synonym="cycY"
FT                   /locus_tag="BPP2694"
FT                   /product="cytochrome C-type biogenesis protein"
FT                   /note="Similar to Pseudomonas aeruginosa thiol:disulfide
FT                   interchange protein DsbE or CcmG or PA1481 SWALL:DSBE_PSEAE
FT                   (SWALL:Q9I3N1) (180 aa) fasta scores: E(): 2.6e-27, 47.02%
FT                   id in 168 aa, and to Escherichia coli, and Escherichia coli
FT                   O157:H7 thiol:disulfide interchange protein DsbE or CcmG or
FT                   B2195 or Z3452 or ECS3084 SWALL:DSBE_ECOLI (SWALL:P33926)
FT                   (185 aa) fasta scores: E(): 2.7e-23, 43.6% id in 172 aa"
FT                   /db_xref="GOA:Q7W742"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W742"
FT                   /protein_id="CAE37986.1"
FT                   /translation="MLRYLLPLAAFLAMAAFLALGLGRDPRALPSAMLDKPAPPIGLPL
FT                   LQGDGRRLEVAQLRGRVWVLNVWASWCAPCREELPLLQEVGPRDAVPIYGLNYKDKPED
FT                   ARAWLARHGNPYVASASDVDGRVGIEYGVYGVPETFVIDGAGRIRYRQLGVLTPQIWRE
FT                   RLLPVIEGLR"
FT   misc_feature    complement(107711..107767)
FT                   /note="PS00194 Thioredoxin family active site."
FT   misc_feature    complement(107888..107944)
FT                   /note="1 probable transmembrane helix predicted for BPP2694
FT                   by TMHMM2.0 at aa 4-23"
FT   misc_feature    complement(107894..107956)
FT                   /note="Signal peptide predicted for BPP2694 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.464 between residues 21 and 22"
FT   CDS_pept        complement(107956..109950)
FT                   /transl_table=11
FT                   /gene="ccmF"
FT                   /gene_synonym="cycK"
FT                   /locus_tag="BPP2695"
FT                   /product="cytochrome C-type biogenesis protein"
FT                   /note="Similar to Pseudomonas fluorescens cytochrome C-type
FT                   biogenesis protein CycK SWALL:CCMF_PSEFL (SWALL:P52225)
FT                   (660 aa) fasta scores: E(): 4.8e-131, 54.42% id in 656 aa,
FT                   and to Escherichia coli cytochrome C-type biogenesis
FT                   protein CcmF or B2196 SWALL:CCMF_ECOLI (SWALL:P33927) (647
FT                   aa) fasta scores: E(): 2.2e-95, 51.89% id in 661 aa"
FT                   /db_xref="GOA:Q7W741"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W741"
FT                   /protein_id="CAE37987.1"
FT                   /translation="MIPEIGLFSLILALLVAIVQGVLPLVGASTGWQAGLRVARPAAVT
FT                   QFCLVTVAMGCLAWSFLDNDFSVLYVAGNSHADLPAAYRFAALWGGHEGSLLLWLYLLT
FT                   AWTLAVALHSRALPPAFAARVLAVMAWISIGFLLFLLFLSNPFERLMPPAQAGRDLNPL
FT                   LQDPGMIVHPPMLYMGYVGFSVAFAFAIAALLSGELDAIWARWVRPWTLLAWMFLTIGI
FT                   LLGSAWAYYVLGWGGWWFWDPVENASFMPWLAGTALIHSLIVTERRGAFRSWTVLLAIA
FT                   AFSLSILGTFLVRSGVLTSVHAFAVDPGRGLYILGFMTLIVGGSLALYAWRAPTVGLGG
FT                   GFALLSRESLLLSNNVVLAAATGAVLLGTLYPVALDVLDWGKISIGPPYFEAVFVPLMT
FT                   PAIFLMGVGPMARWKHSAVPDLAQRLRIAFGVSLATALTVPLAWPGARAWPGSPLIVLG
FT                   LWLAAWSVASAAAHAWQRLADGEGSWARRLRRQPRAWYGMLLAHAGVGVFIAGVTLANG
FT                   YEDKQELRMDIGATQAAGGYQFTFAGIAPAAGPNYQAERARFVVTRDGRPVVTLHPEKR
FT                   HYTVQGMPLSHAAIDTRFTRDLFVALGEPVGQRAWTVRLQVKPFMAWIWSGCVLMALGG
FT                   LMAATDRRYRQWRAAEARQAVTAVAREAG"
FT   misc_feature    complement(join(108034..108090,108403..108468,
FT                   108532..108597,108613..108678,108718..108783,
FT                   108829..108894,108958..109011,109057..109122,
FT                   109159..109209,109255..109320,109360..109425,
FT                   109522..109587,109609..109665,109765..109830,
FT                   109870..109935))
FT                   /note="15 probable transmembrane helices predicted for
FT                   BPP2695 by TMHMM2.0 at aa 5-27, 40-62, 95-114, 121-143,
FT                   175-197, 210-232, 247-264, 276-298, 313-331, 352-374,
FT                   389-411, 424-446, 451-473, 494-516 and 620-639"
FT   misc_feature    complement(108592..109248)
FT                   /note="HMMPfam hit to PF01578, Cytochrome C assembly
FT                   protein, score 9.5e-38"
FT   misc_feature    complement(109870..109950)
FT                   /note="Signal peptide predicted for BPP2695 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.895) with cleavage site
FT                   probability 0.357 between residues 27 and 28"
FT   CDS_pept        complement(109947..110408)
FT                   /transl_table=11
FT                   /gene="ccmE"
FT                   /gene_synonym="cycJ"
FT                   /locus_tag="BPP2696"
FT                   /product="cytochrome C-type biogenesis protein"
FT                   /note="Similar to Bradyrhizobium japonicum cytochrome
FT                   C-type biogenesis protein CycJ SWALL:CCME_BRAJA
FT                   (SWALL:P45401) (169 aa) fasta scores: E(): 1.3e-23, 53.23%
FT                   id in 139 aa, and to Escherichia coli, and Escherichia coli
FT                   O157:H7 cytochrome C-type biogenesis protein Ccme or B2197
FT                   or Z3454 or ECS3086 SWALL:CCME_ECOLI (SWALL:P33928) (159
FT                   aa) fasta scores: E(): 9.6e-16, 39.24% id in 158 aa"
FT                   /db_xref="GOA:Q7W740"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W740"
FT                   /protein_id="CAE37988.1"
FT                   /translation="MTTRRGRRALLIAGGVGLLALAAALVLNALRSNLVFFFSPTQVHA
FT                   HEAPSSGSFRVGGLVRAGSVERAADGLTLRFVVTDTVREVPVAYTGLLPALFREGKGVV
FT                   VAGTMGADGVFRATEVLAKHNENYMPPQAADALRQAGALPSATLQTEAR"
FT   misc_feature    complement(110013..110408)
FT                   /note="HMMPfam hit to PF03100, CcmE, score 3.4e-56"
FT   misc_feature    complement(110274..110408)
FT                   /note="Signal peptide predicted for BPP2696 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.957 between residues 45 and 46"
FT   misc_feature    complement(110316..110381)
FT                   /note="1 probable transmembrane helix predicted for BPP2696
FT                   by TMHMM2.0 at aa 9-31"
FT   CDS_pept        complement(110395..110547)
FT                   /transl_table=11
FT                   /locus_tag="BPP2696A"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa1478 SWALL:Q9I3N4 (EMBL:AE004577) (58 aa) fasta
FT                   scores: E(): 6.5, 33.33% id in 39 aa"
FT                   /db_xref="GOA:Q7W739"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W739"
FT                   /protein_id="CAE37989.1"
FT                   /translation="MSWDALFSLQGHSPYILAAYGGAALLIAVELAVLWRAARRPPTGG
FT                   DDDDA"
FT   CDS_pept        complement(110544..111302)
FT                   /transl_table=11
FT                   /gene="ccmC"
FT                   /locus_tag="BPP2697"
FT                   /product="Putative heme export protein"
FT                   /note="Similar to Pseudomonas aeruginosa heme exporter
FT                   protein Ccmc or PA1477 SWALL:Q9I3N5 (EMBL:AE004577) (252
FT                   aa) fasta scores: E(): 2.6e-39, 46.35% id in 233 aa, and to
FT                   Escherichia coli, and Escherichia coli O157:H7 heme
FT                   exporter protein C CcmC or B2199 or Z3456 or ECS3088
FT                   SWALL:CCMC_ECOLI (SWALL:P33929) (245 aa) fasta scores: E():
FT                   1.2e-33, 44.79% id in 221 aa"
FT                   /db_xref="GOA:Q7W738"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W738"
FT                   /protein_id="CAE37990.1"
FT                   /translation="MRDRPAGGRGWLRYASPAVFYPMAGRWAPRLGALAALLAAAGLYL
FT                   GLAVAPVDSQQGEVYRILFVHVAAAWMSMFLYLVMAGYAALGLVYNTRLSFMMMRALAP
FT                   TGALFTAATLWTGALWGKPTWGAWWVWDARLTSELILLFLYLGFMALQAAAGDTRRADR
FT                   GGAILLLVGVINIPIIYFSVTWWNTLHQGASISLTAAPSMARIMVAATLLMVAAFWAYS
FT                   AAVALARVRVVIAGREPAAAAGGPLSREGS"
FT   misc_feature    complement(110592..111215)
FT                   /note="HMMPfam hit to PF01578, Cytochrome C assembly
FT                   protein, score 2.1e-32"
FT   misc_feature    complement(join(110619..110684,110745..110810,
FT                   110850..110915,110946..110996,111036..111101,
FT                   111147..111212))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPP2697 by TMHMM2.0 at aa 39-61, 76-98, 111-128, 138-160,
FT                   173-195 and 215-237"
FT   CDS_pept        complement(111337..112002)
FT                   /transl_table=11
FT                   /gene="ccmB"
FT                   /locus_tag="BPP2698"
FT                   /product="Heme exporter protein B"
FT                   /note="Similar to Vibrio cholerae heme exporter protein B
FT                   VC2056 SWALL:Q9KQE4 (EMBL:AE004279) (222 aa) fasta scores:
FT                   E(): 1.8e-34, 50.22% id in 221 aa, and to Escherichia coli,
FT                   and Escherichia coli O157:H7 heme exporter protein B CcmB
FT                   or B2200 or Z3457 or ECS3089 SWALL:CCMB_ECOLI
FT                   (SWALL:P33930) (220 aa) fasta scores: E(): 3.6e-31, 46.54%
FT                   id in 217 aa"
FT                   /db_xref="GOA:Q7W737"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W737"
FT                   /protein_id="CAE37991.1"
FT                   /translation="MLKSLAQIAWRELRLAWRRPADTLGATLFFVVAGTLFPLALGPDP
FT                   QLLAAIGPGVLWVSALLAILLSLQQPFVHDHGSGALEQLLVSPHPLPVLVGLKLAAHWL
FT                   ATCAPLILASPFLALQFGLSAQAVGVLALSLLLGTPTLALIGGLGAALTLGLRGGALLP
FT                   LVVLPLYVPVLIFGSGAVAATASGLGAWPQLSLLGACLCLAILLCPWSASAALRVALE"
FT   misc_feature    complement(111349..111900)
FT                   /note="HMMPfam hit to PF03379, CcmB protein, score 6.7e-48"
FT   misc_feature    complement(join(111355..111420,111457..111522,
FT                   111553..111618,111640..111705,111796..111861))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BPP2698 by TMHMM2.0 at aa 17-39, 69-91, 98-120, 130-152 and
FT                   164-186"
FT   CDS_pept        complement(111968..112642)
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /locus_tag="BPP2699"
FT                   /product="Putative heme export protein"
FT                   /note="Similar to Haemophilus influenzae heme exporter
FT                   protein A CcmA or HI1089 SWALL:CCMA_HAEIN (SWALL:P45032)
FT                   (212 aa) fasta scores: E(): 1.5e-17, 40.42% id in 188 aa,
FT                   and to Escherichia coli heme exporter protein A CcmA or
FT                   B2201 SWALL:CCMA_ECOLI (SWALL:P33931) (207 aa) fasta
FT                   scores: E(): 6.7e-16, 40.21% id in 189 aa"
FT                   /db_xref="GOA:Q7W736"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W736"
FT                   /protein_id="CAE37992.1"
FT                   /translation="MQNAEAAPALLAAHGLVGRRGGRRPLDLNLRPGQLVHVRGANGSG
FT                   KTSLLRTLAGLLRPRRGEVRWNGADIHADLPGYYLHMAHLGHDNGCSDALTARENLRYA
FT                   LHVAGAPRAEPELERALRDWGLAAGADAPAARLSQGQGRRLALARVMLSRKRLWLLDEP
FT                   DAGLDAASLQRLHGMLDAHLAGGGAAVLASHRGGGAWAGCTQTLELDEYAHAEVVGADC
FT                   LA"
FT   misc_feature    complement(112007..112546)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   5.5e-33"
FT   misc_feature    complement(112502..112525)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(112629..113279)
FT                   /transl_table=11
FT                   /gene="napC"
FT                   /locus_tag="BPP2700"
FT                   /product="cytochrome C-type protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 cytochrome C-type protein NapC or B2202 or Z3459 or
FT                   ECS3091 SWALL:NAPC_ECOLI (SWALL:P33932) (200 aa) fasta
FT                   scores: E(): 1e-42, 59.14% id in 186 aa, and to Pseudomonas
FT                   aeruginosa cytochrome C-type protein NapC or PA1172
FT                   SWALL:Q9I4G5 (EMBL:AE004547) (198 aa) fasta scores: E():
FT                   1e-60, 76.04% id in 192 aa"
FT                   /db_xref="GOA:Q7W735"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR011885"
FT                   /db_xref="InterPro:IPR024717"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W735"
FT                   /protein_id="CAE37993.1"
FT                   /translation="MPAMRELIKRYWDIIRRPSVHFSLGFLTVGGFVGGILFWGAFNTA
FT                   MELTNTEQFCTGCHEMRDNVYAELKGTIHYTNRSGVRAICSDCHVPHNWTDKIARKTQA
FT                   SKEVWGKIFGTINTREKFVEKRLELAQHEWARLKANDSLECRNCHNYESMDFTRQSMRA
FT                   QNMHSTYLADKSKTCIDCHKGIAHTLPRMPPDQTSLAPPAAGPARADTGHAER"
FT   misc_feature    complement(112704..113231)
FT                   /note="HMMPfam hit to PF03264, NapC/NirT cytochrome c
FT                   family, N-terminal region, score 1.7e-110"
FT   misc_feature    complement(112731..112748)
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    complement(112830..112847)
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    complement(113010..113027)
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    complement(113100..113117)
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    complement(113154..113219)
FT                   /note="1 probable transmembrane helix predicted for BPP2700
FT                   by TMHMM2.0 at aa 20-42"
FT   CDS_pept        complement(113287..113763)
FT                   /transl_table=11
FT                   /gene="napB"
FT                   /locus_tag="BPP2701"
FT                   /product="diheme cytochrome C precursor"
FT                   /note="Similar to Alcaligenes eutrophus diheme cytochrome C
FT                   precursor NapB SWALL:NAPB_ALCEU (SWALL:P39186) (169 aa)
FT                   fasta scores: E(): 1.5e-34, 61.93% id in 155 aa, and to
FT                   Escherichia coli diheme cytochrome C precursor NapB or
FT                   B2203 SWALL:NAPB_ECOLI (SWALL:P33933) (149 aa) fasta
FT                   scores: E(): 3.1e-16, 45.45% id in 132 aa"
FT                   /db_xref="GOA:Q7W734"
FT                   /db_xref="InterPro:IPR005591"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W734"
FT                   /protein_id="CAE37994.1"
FT                   /translation="MSLRTAAIVLSVALGAAAWAAPPLPLQDPMRGPTPVADETNPPLM
FT                   SPVENKDIRRVRTYSMQPPTIPHKIDGYQIDKNFNRCLACHARVNTEETQAPPLSVTHY
FT                   MDRDSNVLAEVSPRRYFCVQCHVPQAEARPLVSNTFQDIDVILKRLTAPKPDQK"
FT   misc_feature    complement(113383..113400)
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    complement(113503..113520)
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    complement(113704..113763)
FT                   /note="Signal peptide predicted for BPP2701 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 20 and 21"
FT   CDS_pept        complement(113783..116278)
FT                   /transl_table=11
FT                   /gene="napA"
FT                   /locus_tag="BPP2702"
FT                   /product="periplasmic nitrate reductase precursor"
FT                   /EC_number="1.7.99.4"
FT                   /note="Similar to Alcaligenes eutrophus periplasmic nitrate
FT                   reductase precursor NapA SWALL:NAPA_ALCEU (SWALL:P39185)
FT                   (831 aa) fasta scores: E(): 0, 80.26% id in 831 aa, and to
FT                   Escherichia coli periplasmic nitrate reductase precursor
FT                   NapA or B2206 SWALL:NAPA_ECOLI (SWALL:P33937) (828 aa)
FT                   fasta scores: E(): 0, 69.67% id in 831 aa"
FT                   /db_xref="GOA:Q7W733"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010051"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W733"
FT                   /protein_id="CAE37995.1"
FT                   /translation="MSMARRDFIKQTAAAAAATVAGVPLTGYTQNIVTESEAAKLKWSK
FT                   APCRFCGTGCGVNVAVKDNQVVATHGDFNAEVNKGLNCVKGYFLSKIMYGSDRLTQPLL
FT                   RIKDGKYAKDGEFAPVSWDQAFDVMAEQFKRVLKDKGPEAVGMFGSGQWTVWEGYAALK
FT                   LMKAGFRTNNLDPNARHCMASAAVGFMRTFGADEPMGCYDDIENADAFVLWGSNMAEMH
FT                   PILWTRVTDRRLSAPATKVAVLSTFEHRSYELADLTLTFEPQSDLAILNYIANHIIRTK
FT                   RVNRDFVDKHTVFREGNADIGYGLRPEHPLQQAARNAGDAGGSKPITFDDFARFVSKYD
FT                   LEYTAKLSGVPKNRLEELAELYADPKVRVTSFWTMGFNQHTRGVWCNNMVYNIHLLTGK
FT                   ISTPGNSPFSLTGQPSACGTAREVGTFSHRLPADLVVTNPEHRRHAEEIWKLPDGTIPS
FT                   KVGAHAVLQNRMLKDGKINAYWVMVNNNMQAAANLMNEGLPGYRNPENFIVVSDAYPTV
FT                   TTLSADLILPAAMWVEKEGAYGNAERRTQFWHQLVDAPGQARSDLWQLVEFSKRFKVEE
FT                   VWPADLLAKKPEYRGKTLYDVLFANGKVNQFPNTELDPEYANQEAQAFGFYLQKGLFEE
FT                   YAEFGRGHGHDLAPFDVYHKARGLRWPVVDGKETLWRYREGSDPYVKPGTGFQFYGNPD
FT                   GKAVIFALPYEPPPEAPDKEYPFWLSTGRVLEHWHSGSMTRRVPELYKAFPEAVCFMHP
FT                   DDAQALGVRRGVEVEVVSRRGKMRTRVETRGRDKPPRGLVFVPWFDAGQLINKVTLDAT
FT                   DPISFQTDFKKCAVKIVKV"
FT   misc_feature    complement(113804..114130)
FT                   /note="HMMPfam hit to PF01568, Molydopterin dinucleotide
FT                   binding domain, score 8.1e-41"
FT   misc_feature    complement(114302..116158)
FT                   /note="HMMPfam hit to PF00384, Molybdopterin
FT                   oxidoreductase, score 5e-212"
FT   misc_feature    complement(115352..115387)
FT                   /note="PS00192 Cytochrome b/b6 heme-ligand signature."
FT   CDS_pept        complement(116262..>116474)
FT                   /transl_table=11
FT                   /gene="napD"
FT                   /locus_tag="BPP2702A"
FT                   /product="component of nitrate reductase system (partial)"
FT                   /note="Similar to Pseudomonas sp. G-179 NapD napD
FT                   SWALL:Q9Z3W5 (EMBL:AF083948) (93 aa) fasta scores: E():
FT                   0.12, 30.15% id in 63 aa, and to Pseudomonas aeruginosa
FT                   napd protein of periplasmic nitrate reductase napd or
FT                   pa1175 SWALL:Q9I4G2 (EMBL:AE004547) (109 aa) fasta scores:
FT                   E(): 0.087, 36.06% id in 61 aa"
FT                   /db_xref="InterPro:IPR005623"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W732"
FT                   /protein_id="CAE37996.1"
FT                   /translation="ALAAGHGAEIHAVSDTGKLVVTLEAHSTGEMLERIAAVQGQDGVL
FT                   ASAMVYQHIDTLDSMNEEIDDVNGS"
FT   misc_feature    116415..116918
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   6.4e-37"
FT   CDS_pept        116442..117005
FT                   /transl_table=11
FT                   /locus_tag="BPP2703"
FT                   /product="Putative ABC-transporter ATP-binding protein
FT                   (partial)"
FT                   /note="Similar to Clostridium acetobutylicum glutamine ABC
FT                   transporter, ATP-binding protein CAC0378 SWALL:Q97M22
FT                   (EMBL:AE007552) (243 aa) fasta scores: E(): 2.2e-34, 51.93%
FT                   id in 233 aa, and to Escherichia coli hypothetical
FT                   amino-acid ABC transporter ATP-binding protein YecC or
FT                   B1917 SWALL:YECC_ECOLI (SWALL:P37774) (250 aa) fasta
FT                   scores: E(): 8.6e-34, 47.6% id in 250 aa"
FT                   /db_xref="GOA:Q7W731"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W731"
FT                   /protein_id="CAE37997.1"
FT                   /translation="MDFRAVPGGKSQYAADADVRRLCRKMGMVFQSFNLFPHMTVLQNV
FT                   IEAPVTVKGLRRDAVIPKAEELLRKVGLLAKRDNYPGRLSGGQKQRVAIARALAMEPDI
FT                   MLFDEPTSALDPELTGEVLRTMRQLADEHMTMLVVTHEMGFARKAAHRVVFMDEGRILE
FT                   EAASDRFFDAPQHPRTREFLAHML"
FT   misc_feature    116691..116735
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        complement(117035..117796)
FT                   /transl_table=11
FT                   /locus_tag="BPP2704"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Rhizobium meliloti putative stomatin-like
FT                   protein RB1114 or SMB20989 SWALL:Q92UL3 (EMBL:AL603646)
FT                   (256 aa) fasta scores: E(): 1.1e-64, 76.54% id in 243 aa,
FT                   and to Archaeoglobus fulgidus hypothetical protein AF1420
FT                   SWALL:YE20_ARCFU (SWALL:O28852) (249 aa) fasta scores: E():
FT                   5.5e-47, 55.93% id in 236 aa, and to Homo sapiens
FT                   erythrocyte band 7 integral membrane protein Epb72 or Bnd7
FT                   SWALL:BAN7_HUMAN (SWALL:P27105) (287 aa) fasta scores: E():
FT                   7.2e-36, 44% id in 250 aa"
FT                   /db_xref="GOA:Q7W730"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W730"
FT                   /protein_id="CAE37998.1"
FT                   /translation="MFMNLAFYLPILVLLLALIALAVRILREYERGVIFTLGRFTGVKG
FT                   PGLILIIPVVQQMVRVDQRTSVFDVPSQDVISRDNVSVKVNAVIYFRVIDPERSVIQVE
FT                   NFRQATSELAQTTLRSVLGKHDLDEMLSERDKLNIDIQEILDAQTDAWGIKVANVEIKH
FT                   IDLNESMVRVIARQAEAERERRAKVINAEGEEQAAQKLLDAARTLAQQPEAMQLRYLST
FT                   LAVIGAQNNSTVVFPFPTDLAGALGRWAQKQ"
FT   misc_feature    complement(117212..117733)
FT                   /note="HMMPfam hit to PF01145, SPFH domain / Band 7 family,
FT                   score 7.4e-74"
FT   misc_feature    complement(join(117632..117697,117719..117784))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP2704 by TMHMM2.0 at aa 4-26 and 33-55"
FT   misc_feature    complement(117731..117796)
FT                   /note="Signal peptide predicted for BPP2704 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.995) with cleavage site
FT                   probability 0.989 between residues 22 and 23"
FT   CDS_pept        complement(join(117840..118664,118668..119018,
FT                   119021..119284))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2705"
FT                   /product="Putative membrane protein (pseudogene)"
FT                   /note="Similar to Rhizobium etli NfeD SWALL:Q52729
FT                   (EMBL:U41754) (467 aa) fasta scores: E(): 5.1e-76, 55.9% id
FT                   in 449 aa, and to Pseudomonas aeruginosa hypothetical
FT                   protein PA0451 SWALL:Q9I667 (EMBL:AE004482) (443 aa) fasta
FT                   scores: E(): 5.3e-44, 53.4% id in 455 aa"
FT                   /db_xref="PSEUDO:CAE37999.1"
FT   misc_feature    complement(join(117876..118664,118668..119018,
FT                   119021..119242))
FT                   /note="HMMPfam hit to PF01957, Protein of unknown function
FT                   DUF107, score 5.1e-145"
FT   misc_feature    complement(join(118094..118159,118220..118285,
FT                   118301..118366,118397..118462))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BPP2705 by TMHMM2.0 at aa 274-296, 306-328, 333-355 and
FT                   375-397"
FT   misc_feature    complement(119174..119284)
FT                   /note="Signal peptide predicted for BPP2705 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.678) with cleavage site
FT                   probability 0.223 between residues 37 and 38"
FT   CDS_pept        complement(119443..>119928)
FT                   /transl_table=11
FT                   /locus_tag="BPP2707"
FT                   /product="Putative iron-containing alcohol dehydrogenase
FT                   (partial)"
FT                   /note="Similar to the C-terminal region of Alcaligenes
FT                   eutrophus maleylacetate reductase I TfdFI or TfdF
FT                   SWALL:TFF1_ALCEU (SWALL:P27137) (354 aa) fasta scores: E():
FT                   1.9e-09, 29.6% id in 152 aa, and of Pseudomonas sp.
FT                   maleylacetate reductase TcbF SWALL:TCBF_PSESQ
FT                   (SWALL:P27101) (352 aa) fasta scores: E(): 9.4e-08, 30.38%
FT                   id in 158 aa"
FT                   /db_xref="GOA:Q7W729"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W729"
FT                   /protein_id="CAE38000.1"
FT                   /translation="TCLHGLKMLFDGLRQTRRAPDDLDARLQSQLGVWLASTGLGRIEW
FT                   GASHGIGHQLGAVAAVPHGHTSCVMLHNVMRHNLSHTAERQALISATLGQPGVPAADLI
FT                   EALARELGMPTRLREVGVERAHFEAIAAGGMQNMMVRSNPRPIASPADIVAILEQAY"
FT   misc_feature    complement(119731..119793)
FT                   /note="PS00060 Iron-containing alcohol dehydrogenases
FT                   signature 2."
FT   CDS_pept        join(120089..120682,120684..121055)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2708"
FT                   /product="Conserved hypothetical protein (pseudogene)"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein PA0290 SWALL:Q9I6K0 (EMBL:AE004467) (323 aa) fasta
FT                   scores: E(): 1.2e-25, 33.33% id in 294 aa, and to
FT                   Synechocystis sp. PleD or SLR1657 SWALL:P74658
FT                   (EMBL:D90917) (275 aa) fasta scores: E(): 4.6e-24, 36.11%
FT                   id in 216 aa"
FT                   /db_xref="PSEUDO:CAE38001.1"
FT   misc_feature    120365..120493
FT                   /note="HMMPfam hit to PF00785, PAC motif, score 1.4e-09"
FT   misc_feature    join(120530..120682,120684..121028)
FT                   /note="HMMPfam hit to PF00990, GGDEF domain, score 2.1e-65"
FT   CDS_pept        complement(121217..121513)
FT                   /transl_table=11
FT                   /locus_tag="BPP2709"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1688"
FT                   /db_xref="GOA:Q7W728"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W728"
FT                   /protein_id="CAE38002.1"
FT                   /translation="MSLYYRISFVLSVLALAAWAIAVTLYKAPRHGDGYGPDPLGVLLF
FT                   LALWPVGLLLAHSGLLACLVRGQRPASILQGRHGVAIHLALGAGFLAYALYRV"
FT   misc_feature    complement(join(121226..121291,121328..121393,
FT                   121439..121504))
FT                   /note="3 probable transmembrane helices predicted for
FT                   BPP2709 by TMHMM2.0 at aa 48-70, 85-107 and 119-141"
FT   CDS_pept        121620..122537
FT                   /transl_table=11
FT                   /locus_tag="BPP2710"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1687"
FT                   /db_xref="GOA:Q7W727"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W727"
FT                   /protein_id="CAE38003.1"
FT                   /translation="MGPTDMRVSTRQLQAFLLVAEVRSFTRAAETLHVTQAGLSSMINE
FT                   LETQVGIRLFERSNRATALTQAGTQFLPYARQAVESLNKGMLELSALNRRQQGGIRVGV
FT                   SPLIASTVLPAVMREFQQCTGRSCEVVDAELEVLHDMVETGRLDATYGTYMRRASRLKS
FT                   EYIFGMALRLAGPGRLIPPGLEIAGVEDWARQHDIVLWALPDSNAVQQVVDRYLLEVGA
FT                   HALRRQEVCHVATVASLISAGMGMGFVPTFLADFYDRDTIGQIALPQGAPAVDFYCTSD
FT                   ASNPASSSIHVFSRLLAAHCSAAA"
FT   misc_feature    121647..121826
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 2.2e-20"
FT   misc_feature    121689..121781
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    121896..122525
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 8.4e-11"
FT   CDS_pept        complement(122542..123255)
FT                   /transl_table=11
FT                   /locus_tag="BPP2711"
FT                   /product="probable short-chain dehydrogenase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1686"
FT                   /db_xref="GOA:Q7W726"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W726"
FT                   /protein_id="CAE38004.1"
FT                   /translation="MKTQATAGDGAAVVAIAGGMGALGRALAQRFKQRGDQVVVLDQAT
FT                   GAAGLPQAGADLALLDVDLNDVASTRHAFDTIARRFGRLDALVSVAGGFHHETLAEGKV
FT                   EAWDRMYALNLRTAVVACQAALPLMLARGAGHVVCIGSDAIGRAHAGLGAYAASKAGVA
FT                   ELVRTLAAETRDQGIAANAVLPGTLDTPGNRRAMPDADFSRWVSLDAAAALILFLASPL
FT                   AAQINGACIPIVNRC"
FT   misc_feature    complement(122548..123228)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 7.8e-31"
FT   misc_feature    complement(122746..122832)
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   misc_feature    complement(123172..123255)
FT                   /note="Signal peptide predicted for BPP2711 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.625) with cleavage site
FT                   probability 0.538 between residues 28 and 29"
FT   CDS_pept        complement(123269..124240)
FT                   /transl_table=11
FT                   /locus_tag="BPP2712"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1685"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W725"
FT                   /protein_id="CAE38005.1"
FT                   /translation="MMKGICAAFAFAALAASWQGPAQAAFPDQPIKLVVPFAPGATIGP
FT                   LAQLVSEQLSSDLGTPVYTEFKTGAGGNIGADIVAKSPGDGYTLLLGTISILTINPSLY
FT                   PDLPFDPVKDFKPVSMLVTTQNILVVNPESKIQSVADLADYARQHPGQATFGSSGTGST
FT                   MHLAGELFSTTAQVKMTHVPYRGGGPARSDLLGGRLTLMFSDLSAVPMVQAGKLRALAV
FT                   TGSQRDGRIPDIPTMQESGMKGFDVEPWYGLVAPAGTPDAVIARLNASVRKVFDKQQVR
FT                   DALQNIGLRPASDLSVAYMAGKIDSDLGKWAPIVKSVDMKTN"
FT   misc_feature    complement(123281..124105)
FT                   /note="HMMPfam hit to PF03401, Uncharacterized protein
FT                   family, UPF0065, score 2.4e-95"
FT   misc_feature    complement(124169..124240)
FT                   /note="Signal peptide predicted for BPP2712 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.975 between residues 24 and 25"
FT   CDS_pept        complement(124301..126031)
FT                   /transl_table=11
FT                   /locus_tag="BPP2713"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1684"
FT                   /db_xref="GOA:Q7W724"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W724"
FT                   /protein_id="CAE38006.1"
FT                   /translation="MHDEQALDLVIRGGLLMDGHGGAPRVADIGVRGALIAEIGDIAPG
FT                   AAAEIDARGKIVTPGFVDIHTHYDGQIIWNSRLAPSSWHGVTTVVMGNCGVGFAPVRAA
FT                   DRGNLIELMEGVEDIPGIALHEGLDWAWETFPDFLRATERIEHDIDFCAQLPHAALRVY
FT                   VMGERALRLEMATPEDIARMRSLAAEAMRHGAIGFSTSRSINHRSVTGDPMPLLRAAEE
FT                   ELTGIAMGLADAGGGVLEIIIDFDDPDMLEAEFGMMRRLVEKSGRPLSFSLMQKHGNKD
FT                   GWRRLLALTAQAAADGLPIRAQVAPRGVGVLLGLQGSRNVFSDCASYKAIAQLALDERV
FT                   RRMRDPALRAQLLRESQDTPLGKRLNEFDNIFPLGNPPCYDPGPERSIAALARRADADP
FT                   AELAYDCLLEEDGKALLFSPFANYADQNLDACAQMLADPNTVIGLGDGGAHVALISDAS
FT                   FPTFLLKHWGGGAGRPAFDLPWLVKRQTADTARAVGLHDRGVLEVGKKADINVIDPATI
FT                   DPGVPVMNMDLPAGKGRYLQKPSGYVATIVSGVVVYRDAAATGALPGRLVRMAAESAAA
FT                   "
FT   CDS_pept        126250..126630
FT                   /transl_table=11
FT                   /locus_tag="BPP2714"
FT                   /product="putative transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1683"
FT                   /db_xref="GOA:Q7W723"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W723"
FT                   /protein_id="CAE38007.1"
FT                   /translation="MIQESLYYFGMNAEQAVSSLGALAHAQRLSVFRALVVAGPAGLTP
FT                   SVMADGLGIARNALSFHLKELAHAGLVSVEQHGRNLIYRADFFRMNALLGYLTEHCCQG
FT                   ATCEVSDSRKNTAGCDAGARRA"
FT   CDS_pept        126634..127821
FT                   /transl_table=11
FT                   /locus_tag="BPP2715"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1682"
FT                   /db_xref="GOA:Q7W722"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W722"
FT                   /protein_id="CAE38008.1"
FT                   /translation="MPGAPVRVVGILGTAQTLAWASSYYLPAMLADPMARDVGVSTPTV
FT                   YAAFSAALVASALIGPWTGLAIDRHGGRMVLAGTSLLFALGLGMLDAAQGLWTMVAASL
FT                   VMGVAMGAGLYEAAFSSLVRLYGHHARGAITGITLIAGFASTVGWPLSAWMETLFGWRG
FT                   ACLGWAALHLMIGLPLNAWLPKAVAAETPSPDAPAAQEGTLPAARPGPQGLATALLAFV
FT                   FAATWFISTAMATHLPRMLQATGATLAAAVAVGALIGPAQVAGRLLEFGLLRHVHPLLS
FT                   ARLAALAHPAGVAVLLAAGPALAPLLAILHGAGNGILTIAKGTLPLALFGPQGYGACQG
FT                   WLMMPARVAQALAPFLFGLALDAWRANALWLSGGIGLAACAALLVLRARPDPIKP"
FT   misc_feature    join(126652..126720,126763..126831,126844..126912,
FT                   126922..126990,127027..127095,127270..127323,
FT                   127360..127428,127486..127554,127573..127641,
FT                   127723..127791)
FT                   /note="10 probable transmembrane helices predicted for
FT                   BPP2715 by TMHMM2.0 at aa 7-29, 44-66, 71-93, 97-119,
FT                   132-154, 213-230, 243-265, 285-307, 314-336 and 364-386"
FT   CDS_pept        127824..128267
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="BPP2716"
FT                   /product="arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1681"
FT                   /db_xref="GOA:Q7W721"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W721"
FT                   /protein_id="CAE38009.1"
FT                   /translation="MHQQRCVMTSITIYHNPACATSRNVLGLIRNSGEEPAIIEYLKTP
FT                   PDAATLRSLIVAMGMPVRDLLRQKGTPYDELGLSDPKWTDEQLIDLMLQYPILINRPIV
FT                   TTPLGTRLCRPSETVLDLLSRPQRGAFDKEDGQPVIDADGNRV"
FT   CDS_pept        128260..128982
FT                   /transl_table=11
FT                   /gene="arsH"
FT                   /locus_tag="BPP2717"
FT                   /product="putative NADPH-dependent FMN reductase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1680"
FT                   /db_xref="GOA:Q7W720"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W720"
FT                   /protein_id="CAE38010.1"
FT                   /translation="MSEVLADLPNIDPSRFKQPNAAELFPPGRATHAPRFLLLYGSLRE
FT                   RSYSRLVAEEAARLLRALGGETRLFNPSGLPLVDDASEDHPKVRELHELVRWAEGMIWS
FT                   SPERHGAMSGLMKTQIDWIPLSMGAVRPTQGKTLAVMQVSGGSQSFNAVNQMRVLGRWM
FT                   RMLTIPNQSSVAKAYQEFDEAGRMQPSPYYDRVVDVAEELMKFTLLTRDASPYLVDRYS
FT                   ERKEAAEALSRRTAQARI"
FT   misc_feature    128359..128886
FT                   /note="HMMPfam hit to PF03358, NADPH-dependent FMN
FT                   reductase, score 7.9e-57"
FT   CDS_pept        complement(128979..129587)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2718"
FT                   /product="Putative LysR-family transcriptional regulator
FT                   (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1679"
FT                   /note="There is an internal deletion relative to B.
FT                   bronchiseptica orthologue. Similar in its N-terminal region
FT                   to Rhodobacter capsulatus CbbrI SWALL:O34014 (EMBL:U87283)
FT                   (298 aa) fasta scores: E(): 2.3e-05, 32.57% id in 175 aa,
FT                   and to Chromatium vinosum rubisco operon transcriptional
FT                   regulator RbcR SWALL:RBCR_CHRVI (SWALL:P25544) (302 aa)
FT                   fasta scores: E(): 2.3e-05, 57.69% id in 52 aa, and to
FT                   Escherichia coli hca operon transcriptional activator HcaR
FT                   or PhdR or B2537 SWALL:HCAR_ECOLI (SWALL:Q47141) (296 aa)
FT                   fasta scores: E(): 0.00088, 30.7% id in 127 aa"
FT                   /db_xref="PSEUDO:CAE38011.1"
FT   misc_feature    complement(129411..129575)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 5.9e-17"
FT   misc_feature    complement(129441..129533)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   CDS_pept        129745..130740
FT                   /transl_table=11
FT                   /locus_tag="BPP2719"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   RA1058 or SMA1927 SWALL:Q92Y30 (EMBL:AE007292) (330 aa)
FT                   fasta scores: E(): 2.6e-42, 43.42% id in 327 aa, and to
FT                   Agrobacterium tumefaciens hypothetical protein ATU4727 or
FT                   AGR_L_312 SWALL:AAL45521 (EMBL:AE009401) (329 aa) fasta
FT                   scores: E(): 7.8e-39, 40.81% id in 321 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W719"
FT                   /protein_id="CAE38012.1"
FT                   /translation="MTSSPALTMTLRAVLALAATASLALGPAAPAAAETFPAKPVTLVV
FT                   PFPPGGPTDTSARLFGAVMADKLGQPVIVENRAGAGGSVGTTVVTRSKPDGYTLLWGGT
FT                   SSIVVAPALYTNLQYDPIKSFTPIGMAVRGPLILVSRPDLGPKDIGQLRDYAKNHDLSV
FT                   ASAGTGSIGHLTAEMFKSEAGARMLHVPYRGGAPALTDVMGGQVDLFFDTVTLLTPQIR
FT                   AGKLRAYAVTGSQRYSGLPEVPTVAETIGKPFEAYSWFGLLAPAGTPAPAVQALTDALA
FT                   AAAKDPEVIKQLSALGLEPVGDTPQEFAQAIRADLDKWTGVVRSAGVKPQ"
FT   misc_feature    129745..129843
FT                   /note="Signal peptide predicted for BPP2719 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.866 between residues 33 and 34"
FT   misc_feature    129910..130728
FT                   /note="HMMPfam hit to PF03401, Uncharacterized protein
FT                   family, UPF0065, score 3e-111"
FT   CDS_pept        130780..131985
FT                   /transl_table=11
FT                   /locus_tag="BPP2720"
FT                   /product="putative monooxygenase"
FT                   /note="Similar to Bordetella pertussis hypothetical 45.1
FT                   kDa protein SWALL:O30447 (EMBL:AF006000) (406 aa) fasta
FT                   scores: E(): 1.3e-46, 41.37% id in 394 aa, and to
FT                   Salmonella typhimurium putative monooxygenase STM2175
FT                   SWALL:Q8ZNM3 (EMBL:AE008797) (397 aa) fasta scores: E():
FT                   8.1e-37, 34.42% id in 398 aa"
FT                   /db_xref="GOA:Q7W718"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W718"
FT                   /protein_id="CAE38013.1"
FT                   /translation="MPDTSSPRILIAGAGLGGLTAALALQARGFQVRVLEQAAQLRELG
FT                   AGIQLSANANRVLYQLGLGAALEQVASPAPGKRIRLWNTGQTWPLFDLGAQSVERYGYP
FT                   YLTIYRADLHRVLAEAVLARDPQAIELGARVESVAQDDAAASVTLADGSTRQADILVGA
FT                   DGVHSRVRAALHGQDQARFSGALAWRGVIPAHKLPPHLREPYAVNWVGPGAHVIHYPLR
FT                   RGELVNFVGILERDDWQVESWTQQGTIAECARDFAGWHEDVQTLIHALDTPFKWAMMLR
FT                   EPLARWTSGRITLLGDACHPTLPMLASGAAMAIEDGYVLAHCLDGMRADARQALVRYQD
FT                   LRVERTARVVRGSAENAKRFHNPELAHAAGAAAYVEQQWSEARVRERYEWLFTYDVDAE
FT                   PV"
FT   misc_feature    130780..130860
FT                   /note="Signal peptide predicted for BPP2720 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.975) with cleavage site
FT                   probability 0.617 between residues 27 and 28"
FT   misc_feature    131245..131841
FT                   /note="HMMPfam hit to PF01360, Monooxygenase, score
FT                   5.8e-38"
FT   CDS_pept        132329..133540
FT                   /transl_table=11
FT                   /gene="dadA3"
FT                   /locus_tag="BPP2721"
FT                   /product="D-amino acid dehydrogenase small subunit"
FT                   /EC_number="1.4.99.1"
FT                   /note="Similar to Rhizobium loti D-amino acid dehydrogenase
FT                   3 small subunit DadA3 or MLR9201 SWALL:DAD3_RHILO
FT                   (SWALL:Q981X2) (412 aa) fasta scores: E(): 1.7e-101, 64.25%
FT                   id in 400 aa, and to Escherichia coli D-amino acid
FT                   dehydrogenase small subunit DadA or DadR or B1189 or Z1952
FT                   or ECS1684 SWALL:DADA_ECOLI (SWALL:P29011) (432 aa) fasta
FT                   scores: E(): 4e-39, 33.25% id in 403 aa"
FT                   /db_xref="GOA:Q7W717"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W717"
FT                   /protein_id="CAE38014.1"
FT                   /translation="MSRIAVIGAGITGVTTAYALALRDHQVTVFDRHRYSAMETSFANG
FT                   GQLSASNAEVWNSRSTLFKGLRWMLRRDAPLLLNPRPSWHKYSWLGEFLRQIPRYEANT
FT                   IETVRLAIAARQHLFDIAARERIDFDHERRGILHFYASRREYDSALRVNALLRAGGLER
FT                   RPVSPEEMRAIEPALQGDFYGGFFTESDSTGDIHKFTTGLARAAARHGALFRYETPVSG
FT                   IDHRGGAIAITTAEAVERYDKVVICAGVGSRRFASMVGDRVNIYPVKGYSITVSLDDEA
FT                   SQAGAPWTSLLDDRAKIVTSRLGAGRFRVAGTAEFNGFNRDIRADRVEPLVAWVRRYFP
FT                   QVSTSRVVPWAGLRPMLPSMLPRVGPGKRPGVFYNTGHGHLGWTLSAATAQLVAEAVTA
FT                   GAGT"
FT   misc_feature    132329..132385
FT                   /note="Signal peptide predicted for BPP2721 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.969) with cleavage site
FT                   probability 0.771 between residues 19 and 20"
FT   misc_feature    132332..133522
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 1.5e-05"
FT   CDS_pept        complement(133571..134038)
FT                   /transl_table=11
FT                   /locus_tag="BPP2722"
FT                   /product="putative 4-hydroxybenzoyl-CoA thioesterase"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein PA5185 SWALL:Q9HU04 (EMBL:AE004931) (147 aa) fasta
FT                   scores: E(): 2.6e-29, 55.4% id in 148 aa, and to
FT                   Mycobacterium tuberculosis hypothetical protein Rv0163 or
FT                   MT0172 or MTCI28.03 SWALL:O07408 (EMBL:Z97050) (151 aa)
FT                   fasta scores: E(): 2.4e-24, 44.21% id in 147 aa"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W716"
FT                   /protein_id="CAE38015.1"
FT                   /translation="MNDSAGQAPRPQRWQRAGFSHFEAMPVRWMDCDMYGHVNNVVYYA
FT                   YFDTAVNRYLASAGQLDPQAGAVIGLVVETHCNFHAPAEFPETLQIGLRVAHVGRSSVR
FT                   YELGVFRPGDELCAAQGHFVHVYVERASRRPVALPAGLRACLGRLAAAGRA"
FT   misc_feature    complement(133595..133936)
FT                   /note="HMMPfam hit to PF03061, 4-hydroxybenzoyl-CoA
FT                   thioesterase, score 1.4e-25"
FT   CDS_pept        complement(134035..135189)
FT                   /transl_table=11
FT                   /locus_tag="BPP2723"
FT                   /product="Putative alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="Similar to Agrobacterium tumefaciens alcohol
FT                   dehydrogenase AttL or ATU5138 or AGR_PAT_199 SWALL:AAL45828
FT                   (EMBL:AE008938) (386 aa) fasta scores: E(): 1.1e-69, 54.94%
FT                   id in 384 aa, and to Pseudomonas putida alcohol
FT                   dehydrogenase AdhA SWALL:O68647 (EMBL:AF052750) (382 aa)
FT                   fasta scores: E(): 1.6e-36, 37.27% id in 381 aa"
FT                   /db_xref="GOA:Q7W715"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W715"
FT                   /protein_id="CAE38016.1"
FT                   /translation="MNGFEFRTHARTLAGEGTSQRLGEAVAAQWGPCRILVVTDEQLVR
FT                   LGLVAALAQSLRDAGHTVQVYDGVLADPPEAVVSQAIARGRETDVQCVIGFGGGSSMDI
FT                   AKLVAAFAGSAADFRDSYGIDRVATARLPLVQVPTTAGTGSEATPIAIVTREDASKAGI
FT                   VSPVLYCDIAVLDAALTRGLPPAVTAATGIDAIVHAVEAYTSRLRKNPISDGLARQALR
FT                   LLCRSIGPACRDGADMAARHDMLLGAMLAGQAFANAPVAAVHALAYPLGGVFHVPHGLS
FT                   NALMFGAVLRFNLPQAGAAYAQLAQIACPQVDGPQQARAEGFVQEMASLGPRLGLPRRL
FT                   AEVGVAERDLPMLAQQAMQQQRLLVNNPRELGYDDALRLYREAL"
FT   misc_feature    complement(134062..135162)
FT                   /note="HMMPfam hit to PF00465, Iron-containing alcohol
FT                   dehydrogenase, score 1.7e-84"
FT   misc_feature    complement(134587..134673)
FT                   /note="PS00913 Iron-containing alcohol dehydrogenases
FT                   signature 1."
FT   CDS_pept        complement(join(135186..136037,136036..136368))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2724"
FT                   /product="Putative ketoacyl CoA thiolase (pseudogene)"
FT                   /EC_number="2.3.1.16"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   acetyl-CoA acetyltransferase protein RSC1761 or RS02948
FT                   SWALL:Q8XYJ7 (EMBL:AL646066) (392 aa) fasta scores: E():
FT                   2e-93, 64.45% id in 391 aa, and to Caulobacter crescentus
FT                   thiolase family protein CC3462 SWALL:Q9A2U4 (EMBL:AE006005)
FT                   (395 aa) fasta scores: E(): 1.1e-80, 57.61% id in 394 aa,
FT                   and to Rattus norvegicus 3-ketoacyl-CoA thiolase A,
FT                   peroxisomal precursor SWALL:THIJ_RAT (SWALL:P21775) (434
FT                   aa) fasta scores: E(): 1e-51, 44.78% id in 393 aa"
FT                   /db_xref="PSEUDO:CAE38017.1"
FT   misc_feature    complement(135194..135566)
FT                   /note="This hit extended beyond the end of the feature by 0
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02803, Thiolase, C-terminal domain,
FT                   score 3.5e-54"
FT   misc_feature    complement(135303..135353)
FT                   /note="PS00737 Thiolases signature 2."
FT   misc_feature    complement(join(135579..136037,136036..136365))
FT                   /note="HMMPfam hit to PF00108, Thiolase, N-terminal domain,
FT                   score 1.7e-80"
FT   misc_feature    complement(136054..136110)
FT                   /note="PS00098 Thiolases acyl-enzyme intermediate
FT                   signature."
FT   CDS_pept        complement(136365..138449)
FT                   /transl_table=11
FT                   /locus_tag="BPP2725"
FT                   /product="Putative enoyl-CoA isomerase"
FT                   /EC_number="4.2.1.17"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   trifunctonal: enoyl-CoA hydratase and
FT                   delta3-cis-delta2-trans-enoyl-CoA isomerase and
FT                   3-hydroxyacyl-CoA dehydrogenase oxidoreductase protein
FT                   RSC1759 or RS02946 SWALL:Q8XYJ9 (EMBL:AL646066) (706 aa)
FT                   fasta scores: E(): 4.5e-100, 45.23% id in 692 aa, and to
FT                   Rhizobium loti enoyl-CoA hydratase/3-hydroxyacyl-CoA
FT                   dehydrogenase MLL4199 SWALL:Q98EK7 (EMBL:AP003003) (689 aa)
FT                   fasta scores: E(): 5.2e-86, 43.34% id in 699 aa"
FT                   /db_xref="GOA:Q7W714"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W714"
FT                   /protein_id="CAE38018.1"
FT                   /translation="MSVAIAMRGDIGVVTLDSPPVNALGRTLRHGLAQCLEQAYARPDV
FT                   RALLLVSARPGIFSAGADIKEFDQAGSDQDAGLAELIDRIENAPVPVVALLDGAALGGA
FT                   LELALGCHYRLASPRASLGLPEIKLGLLPGAGGTQRLPRLVGARHAVEMVLGGEPVGGE
FT                   TALRCKLADALLSADDTLEQALAWMRNAPGGLARRRVASLPALAPASIAEAARAAAIRP
FT                   VGSAAAREAALACLAAAQGPFDAGRALERESFARLRDGAEARALRYAFFAERPRPPAGD
FT                   VSARRIEQVAVVGAGTMGTGIVICLADAGLPVIWHDVDADRLAQGRAQVCQHFERLAAR
FT                   KRLTSRQAEQRVAAVATTGEMAGIARADLAIEAVFEDMAVKCAVFRELDRVLKPGAILG
FT                   TNTSTLDVDRIAHSTRRPQDVVGLHFFSPAPAMPLLEIVRGAATHADVVAAAQGLARRL
FT                   RKTAVVAGVCDGFIGNRMWHQYLRQAALMVHEGAMPMEVDAALRDWGFAMGPFQVADLA
FT                   GLDVGDSIRLRQRSEMPHRPWPDWLDRVSAAGRLGLKGGSGIHAYPDGGRQPRRDAEVE
FT                   AMIAAASREAGVSRRAIAADEIVERCLHALVVEAARLLEEGIAASATDVDAVFLAGYGF
FT                   PRWRGGPCHSADAMGLPAVVAGLRRRAATAEPEFWQPPGLLARLAAHGGRLQDHGQEGA
FT                   "
FT   misc_feature    complement(136764..137042)
FT                   /note="HMMPfam hit to PF00725, 3-hydroxyacyl-CoA
FT                   dehydrogenase, C-terminal domain, score 3.7e-16"
FT   misc_feature    complement(137046..137600)
FT                   /note="HMMPfam hit to PF02737, 3-hydroxyacyl-CoA
FT                   dehydrogenase, NAD binding domain, score 6.9e-59"
FT   misc_feature    complement(137922..138416)
FT                   /note="HMMPfam hit to PF00378, Enoyl-CoA
FT                   hydratase/isomerase family, score 7.3e-52"
FT   misc_feature    complement(138111..138173)
FT                   /note="PS00166 Enoyl-CoA hydratase/isomerase signature."
FT   CDS_pept        complement(138460..139434)
FT                   /transl_table=11
FT                   /locus_tag="BPP2726"
FT                   /product="putative exported protein"
FT                   /note="Similar to Agrobacterium tumefaciens hypothetical
FT                   protein atu4727 atu4727 or agr_l_312 SWALL:AAL45521
FT                   (EMBL:AE009401) (329 aa) fasta scores: E(): 1.5e-33, 36.95%
FT                   id in 322 aa, and to Rhizobium meliloti hypothetical
FT                   protein ra1058 ra1058 or sma1927 SWALL:Q92Y30
FT                   (EMBL:AE007292) (330 aa) fasta scores: E(): 6e-32, 37.02%
FT                   id in 316 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W713"
FT                   /protein_id="CAE38019.1"
FT                   /translation="MRKKHFVLSFLLGAASLAASGAALAQQAFPTHPIRLIVPFAPGSG
FT                   TDNTARHLAREMEAEFGSPVVVENHPGANSFIAAKMVAAAAPDGYTLLISGSSAMTVNA
FT                   AIFKALPYDPLKDFAPVARLAKGAMGLAVNAQSPYRSVDDLVQAMRQQPGTLNYGSGSA
FT                   AYQITTELFLSMAQAKASHIPYKGAAQALTDLAGRQVDFAFADYAALVPFLRSGKLRLL
FT                   AVSSAERLESEPATPTVAQAGYPGFDMVNWTSAFAPAGTPAPIVDTLSKAIVAIYEREQ
FT                   TRAFLAGTNWESFPVGPAELRRYQVDEIAKWSRAAEIAGIEKQ"
FT   misc_feature    complement(138472..139290)
FT                   /note="HMMPfam hit to PF03401, Uncharacterized protein
FT                   family, UPF0065, score 2.1e-71"
FT   misc_feature    complement(139360..139434)
FT                   /note="Signal peptide predicted for BPP2726 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.991 between residues 25 and 26"
FT   CDS_pept        complement(139465..140265)
FT                   /transl_table=11
FT                   /gene="paaG"
FT                   /locus_tag="BPP2727"
FT                   /product="Putative enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="Similar to Escherichia coli probable enoyl-CoA
FT                   hydratase PaaG or B1394 SWALL:PAAG_ECOLI (SWALL:P77467)
FT                   (262 aa) fasta scores: E(): 1.6e-27, 36.7% id in 267 aa,
FT                   and to Clostridium acetobutylicum 3-hydroxybutyryl-CoA
FT                   dehydratase Crt or CAC2712 SWALL:CRT_CLOAB (SWALL:P52046)
FT                   (261 aa) fasta scores: E(): 6.8e-25, 35.43% id in 254 aa"
FT                   /db_xref="GOA:Q7W712"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W712"
FT                   /protein_id="CAE38020.1"
FT                   /translation="MTRFLEVERRGRVCIVRMNRPEARNALTDAEQFQEFEDLVRELNA
FT                   DLDVRAAILTGNGPSFCAGGNVKKMLADYGPDSGPAARIPAKYSTGIQRIPMALAQLDV
FT                   PLIAAVNGAAIGAGCDLACMCDIRIAADDARFAESFVKLGIIPGDGGSWFLPRIIGLAR
FT                   TYEMAFTGDTLDAATALQWNLVSSVVPAAQLMDAACQLAERIAVNPPQQVRFAKRLIRE
FT                   GLHQRLEAMLEFSRLYQTLSHRTADHQEGIAALLEKRPPVFHGR"
FT   misc_feature    complement(139696..140226)
FT                   /note="HMMPfam hit to PF00378, Enoyl-CoA
FT                   hydratase/isomerase family, score 1e-47"
FT   CDS_pept        complement(140294..141052)
FT                   /transl_table=11
FT                   /gene="caiD"
FT                   /locus_tag="BPP2728"
FT                   /product="Putative carnitinyl-CoA dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="Similar to Rhizobium loti carnitine racemase MLL6015
FT                   SWALL:Q98AG1 (EMBL:AP003008) (257 aa) fasta scores: E():
FT                   1.6e-28, 40.76% id in 260 aa, and to Escherichia coli
FT                   carnitine racemase CaiD or B0036 SWALL:CAID_ECOLI
FT                   (SWALL:P31551) (297 aa) fasta scores: E(): 1.1e-26, 40.84%
FT                   id in 262 aa"
FT                   /db_xref="GOA:Q7W711"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W711"
FT                   /protein_id="CAE38021.1"
FT                   /translation="MNTSPTVRFETREQIAIITLNRPDKRNAINLEMRQALIAAWERFE
FT                   NDAALRVAILTGAGERSFSAGRDLSENTDLSQKTFLPILGDNVQASKPVIAAVNGAALG
FT                   GGWFFTQMCDLVVAADHAVFGMPESKVGRAPAWAVWLQGVIPQKLVLELLLTGNPISAQ
FT                   RAAEIGFVNHVVPAAQLMDKAMELARAIVATAPLSAAACKEMVYAAAEMERGAALRTAF
FT                   HILEPLYRSEDAREGALAFREKRAPRWSGR"
FT   misc_feature    complement(140525..141007)
FT                   /note="HMMPfam hit to PF00378, Enoyl-CoA
FT                   hydratase/isomerase family, score 2.6e-44"
FT   misc_feature    complement(140723..140758)
FT                   /note="PS00213 Lipocalin signature."
FT   CDS_pept        complement(141049..142248)
FT                   /transl_table=11
FT                   /locus_tag="BPP2729"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein PA0446 SWALL:Q9I672 (EMBL:AE004482) (407 aa) fasta
FT                   scores: E(): 1.2e-74, 47.94% id in 390 aa, and to Brucella
FT                   melitensis alpha-methylacyl-coa racemase BMEII1019
FT                   SWALL:Q8YB81 (EMBL:AE009734) (415 aa) fasta scores: E():
FT                   7.1e-72, 47.02% id in 387 aa. Note: Also similar to BPP4114
FT                   (410 aa) fasta scores: E(): 1.2e-70, 50.882% identity in
FT                   397 aa overlap"
FT                   /db_xref="GOA:Q7W710"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W710"
FT                   /protein_id="CAE38022.1"
FT                   /translation="MPMDGIRVLDLSRVLAGPWCTQMLADFGADVIKIERPGQGDDSRA
FT                   WGPPFYESADGHERVSAYFCAANRGKRSVCLDLESEADRQALRELALRSDVLVENFKAG
FT                   SLARHGLDYATLSALNPRLVYCSITGYGQTGPYAARPGYDSIIQAVGGMMSVTGLPDDA
FT                   AGGGPQKTGIPIIDLMTGVYACCGVLMALREREARGQGQHLDLSLMDVQVSALSTLAAN
FT                   FLACGQAPQRNGNEHPTVVPGDAVQCLDGPLMLMVGNDRQFQRLCRHLDRESLARDPRY
FT                   ATNELRVQGKNALMAQLREAFRGQTRQYWLERLLAEGIPCGPIQTVAEVLADPHVRHRA
FT                   LVAAAPDPVFGEIRAMGSALRMSRTPARHGRAPTVLGEHTEAVLSSLASSRLQSNPQTK
FT                   "
FT   misc_feature    complement(141448..142029)
FT                   /note="HMMPfam hit to PF02515, CAIB/BAIF family, score
FT                   5.7e-65"
FT   CDS_pept        complement(142293..143264)
FT                   /transl_table=11
FT                   /locus_tag="BPP2730"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   RA1058 or SMA1927 SWALL:Q92Y30 (EMBL:AE007292) (330 aa)
FT                   fasta scores: E(): 1e-50, 48.13% id in 322 aa, and to
FT                   Agrobacterium tumefaciens hypothetical protein ATU4727 or
FT                   AGR_L_312 SWALL:AAL45521 (EMBL:AE009401) (329 aa) fasta
FT                   scores: E(): 7.2e-49, 48.12% id in 320 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W709"
FT                   /protein_id="CAE38023.1"
FT                   /translation="MNRRDALGALAALASTTWLGRAAAAKPYPQRPVTLIVPYSPGGAT
FT                   DNVARVIAEHLQARLGQPVIIDNRAGANGRIGTLAVARAAPDGYVLLLGGIGPITIAPH
FT                   LEKVPYDPFKDFAPVSLLVKNDVVLLVNPAVPARKPEELIALLKAEPGKFNYASSGTGG
FT                   PFHLSGELFKSMAGVEMTHVPYKGDGPALVDLMAGNVQVMFTTISASAAHIQAGKAIAL
FT                   ASAGEVRSSQMPDLPTLAESALPGFASETWQVLFAPGGTPAPTIDALQAGLAGAMRDAR
FT                   LRQALQAQGNSVVASDVPACAQFVRDEYEKWGNVVRKSGLAA"
FT   misc_feature    complement(142302..143123)
FT                   /note="HMMPfam hit to PF03401, Uncharacterized protein
FT                   family, UPF0065, score 7.5e-99"
FT   misc_feature    complement(143190..143264)
FT                   /note="Signal peptide predicted for BPP2730 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.502 between residues 25 and 26"
FT   CDS_pept        143411..144307
FT                   /transl_table=11
FT                   /locus_tag="BPP2731"
FT                   /product="Putative LysR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator PA5029 SWALL:Q9HUE0
FT                   (EMBL:AE004916) (301 aa) fasta scores: E(): 6.2e-36, 39.79%
FT                   id in 289 aa, and to Bacillus subtilis als operon
FT                   regulatory protein AlsR SWALL:ALSR_BACSU (SWALL:Q04778)
FT                   (302 aa) fasta scores: E(): 3.5e-31, 32.63% id in 285 aa"
FT                   /db_xref="GOA:Q7W708"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W708"
FT                   /protein_id="CAE38024.1"
FT                   /translation="MDLKQMRYFVAVAEERSFSRAAERLHISQPPLSQQIKALEEELNA
FT                   PLFHRLPRGISLTAAGAALLKSSRAILANVRLAAQETTQIAAGMLGTVRMGTVSSALAH
FT                   LVPYILTQVKRSMPGSKVELTEMSSREQTLAVLRDELDIGLVHTPIDTADLRTRQILRE
FT                   PFYAAVPSQHPLASREAVPVAELASEEFVFFPRTLASGLFDKMVSLCMNAGFSPKIHHT
FT                   ARHQSTMLQMVAMGLGVTIVPRSLQRIYKGSAVFLPLTGTPHYLELSLIWRESTANGLV
FT                   ERLIGGLEPLRDFDSLP"
FT   misc_feature    143417..143596
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 1.1e-32"
FT   misc_feature    143459..143551
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    143666..144289
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 3.7e-42"
FT   CDS_pept        144398..145336
FT                   /transl_table=11
FT                   /locus_tag="BPP2732"
FT                   /product="Putative short chain dehydrogenase"
FT                   /note="Similar to Rhizobium meliloti putative
FT                   oxidoreductase protein R01692 or SMC00264 SWALL:Q92PP4
FT                   (EMBL:AL591788) (267 aa) fasta scores: E(): 6.4e-36, 49.23%
FT                   id in 260 aa, and to Agrobacterium tumefaciens
FT                   dehydrogenase ATU4825 or AGR_L_117 SWALL:AAL45619
FT                   (EMBL:AE009411) (271 aa) fasta scores: E(): 3.5e-34, 47.36%
FT                   id in 266 aa"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W707"
FT                   /protein_id="CAE38025.1"
FT                   /translation="MLPRPIEYTNFRCDELISVKRKYGEPLYLQRGPAGSIGKRKTMPS
FT                   NVLENKIAIVVGAGQTPGSTMGNGRATAIAFARAGASVVAVDRDMASAGETAGLILAEG
FT                   GQAMAVQADITSEAAIVAMVRQVMETHGRIDILHNNVGIAGAGGDAPVEDISAEAFDLL
FT                   ANLNLKGMMLTCKHVLPAMRAQRSGCVLNVASTAAYALYPNVAYKATKMGVLGLTQHIA
FT                   MTYAEHGVRANAILPGLIDTPMVIEARVRLTGKPREQIVAERNAMVPLRGRMGTSWDVA
FT                   HAAVFLASDQAGFITGVQLPVDGGALARLGP"
FT   misc_feature    144542..145315
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 4.3e-58"
FT   CDS_pept        145481..146497
FT                   /transl_table=11
FT                   /locus_tag="BPP2733"
FT                   /product="Putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   RA1058 or SMA1927 SWALL:Q92Y30 (EMBL:AE007292) (330 aa)
FT                   fasta scores: E(): 1.9e-38, 40.74% id in 324 aa, and to
FT                   Agrobacterium tumefaciens hypothetical protein ATU4727 or
FT                   AGR_L_312 SWALL:AAL45521 (EMBL:AE009401) (329 aa) fasta
FT                   scores: E(): 4.7e-37, 39.63% id in 328 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W706"
FT                   /protein_id="CAE38026.1"
FT                   /translation="MPDHHPEDVAAPRRRALKTLAAACSLTLAPLAALSPAHAADAFPA
FT                   KPITLVAPFAAGGSTDMLARVVAKALAAELGQSVIVENKGGAGGTIGAAYVARAAADGY
FT                   TLLLSNVTLTSAPALYKNMSYDFSKDMSAISLLGQVPCVLEINKDLPVKDGKAFLDYLR
FT                   ANDGKLYYGSSGVGAALHMATASFLSAAGLSAIHVPYKGTGPMMVDLIAGNVQFAIDTS
FT                   GSASAQVRGGNVRGVAVTSRERDPAWPGVPTLRELGVPFEMTIWYGISAPAGVPEPVRR
FT                   KLHAAIEKATRTDEVRTAYQSMGMQVDTRGGKEFEQVIAEDTARWITLVKDAGINPS"
FT   misc_feature    145481..145597
FT                   /note="Signal peptide predicted for BPP2733 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.995) with cleavage site
FT                   probability 0.992 between residues 39 and 40"
FT   misc_feature    145667..146485
FT                   /note="HMMPfam hit to PF03401, Uncharacterized protein
FT                   family, UPF0065, score 3.2e-94"
FT   CDS_pept        146577..146996
FT                   /transl_table=11
FT                   /locus_tag="BPP2734"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Low similarity to Thauera aromatica BbsA
FT                   SWALL:Q9KJF4 (EMBL:AF173961) (144 aa) fasta scores: E():
FT                   4.7e-05, 26.56% id in 128 aa"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W705"
FT                   /protein_id="CAE38027.1"
FT                   /translation="MQETSPATGGQQYADDALPIEDLKEAPLPPFEVKDTVVYLRGSRS
FT                   RSSGSMAFPEREVCLQTGARDMEPFLFGPDATLYSYTTVHVSSARPVPYTLGYVDFPNG
FT                   VRVLAHVLADPAQPLHCGQSVRLRADGERWFVTPA"
FT   CDS_pept        147016..148158
FT                   /transl_table=11
FT                   /locus_tag="BPP2735"
FT                   /product="Putative thiolase"
FT                   /note="Similar to Thauera aromatica putative
FT                   benzoylsuccinyl-CoA thiolase BbsB SWALL:Q9KJF3
FT                   (EMBL:AF173961) (385 aa) fasta scores: E(): 1.7e-57, 45.38%
FT                   id in 379 aa, and to Pyrobaculum aerophilum acetyl-CoA
FT                   C-acyltransferase PAE2471 SWALL:Q8ZV38 (EMBL:AE009878) (379
FT                   aa) fasta scores: E(): 6.1e-37, 36.01% id in 386 aa"
FT                   /db_xref="GOA:Q7W704"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W704"
FT                   /protein_id="CAE38028.1"
FT                   /translation="MSKVYIAGAAMIPMGKHRQSSYSGLAVPAVLNALRSAGIAPRDVE
FT                   AVVCGHAFGGMLTGQRIVKEMGIGAVPVFNVDNACSGGASALHLAYKDIQAGIRDIVLV
FT                   IGVDKLTQFGGGTLPLVAEDPEVRLGIVMPAVYAMRAQRYLYERDATVADLAQVSVKAR
FT                   RHGARNPYAQFRSEVTVDEVLDSRPICDPLTLLQCCPTGDGAAAVIMVSEAGRRKLAAP
FT                   AVRVAASVVHSGQVTAGYRDMLNPEISTDSARDAYEAAGFGPQDLDVVELHDAFSIAEL
FT                   VYYEALGLCPRGESAAFLRCGQSTYGGQVVVNPSGGLLSKGHPVGASGVAQAVEVYWHL
FT                   TGQAGERQVPGARRALSHVTGGGIAGLDHGACTVHLYEAV"
FT   misc_feature    147016..147657
FT                   /note="HMMPfam hit to PF00108, Thiolase, N-terminal domain,
FT                   score 3.6e-08"
FT   misc_feature    147679..148125
FT                   /note="HMMPfam hit to PF02803, Thiolase, C-terminal domain,
FT                   score 1.1e-18"
FT   misc_feature    147952..148002
FT                   /note="PS00737 Thiolases signature 2."
FT   CDS_pept        148196..149422
FT                   /transl_table=11
FT                   /locus_tag="BPP2736"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Brucella melitensis alpha-methylacyl-CoA
FT                   racemase BMEII1019 SWALL:Q8YB81 (EMBL:AE009734) (415 aa)
FT                   fasta scores: E(): 1.6e-49, 38.27% id in 405 aa, and to
FT                   Thermoplasma volcanium L-carnitine dehydratase TV1186 or
FT                   TVG1215416 SWALL:Q979H5 (EMBL:AP000995) (399 aa) fasta
FT                   scores: E(): 7.4e-49, 36.7% id in 395 aa"
FT                   /db_xref="GOA:Q7W703"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W703"
FT                   /protein_id="CAE38029.1"
FT                   /translation="MHEVQQQSPAPAAKPLAGYRVLDLTTFLSGPFCTQILADLGAEVI
FT                   KVEAPDGDSSRHIPPHFVDGDSAYYLGINRDKKSLAVDMKQPEGLALVKSLIVRSHVVV
FT                   ENYRPGVAARIGLDIAALMAQHPSLVWASISGFGQVGPLRDRPAYDMIVQAMSGVMSLT
FT                   GEAGRPAVRLGIPAGDLAAGMYAAIAVNAALADAARGGRGRHIDISMLDCQLAMLSYQS
FT                   TYALVAGVTPQRQAARHDSIPTYRSFLAGDGRELVVTANTERMWKGLCEALGLRELAQD
FT                   ARFCDAEMRLQNREPLWDLLEAAFLARPAAEWIEPLAANGVPVALIKTVPEALSEARAS
FT                   GRGMVMPLRRPGGPEIEVVGNPIKFLGEAEPPARYPPRLGEDAPAILAQWLGWSEQEIQ
FT                   AMQARKVVM"
FT   misc_feature    148433..149002
FT                   /note="HMMPfam hit to PF02515, CAIB/BAIF family, score
FT                   3.2e-53"
FT   CDS_pept        149574..150401
FT                   /transl_table=11
FT                   /locus_tag="BPP2737"
FT                   /product="Putative transcriptional regulatory protein"
FT                   /note="Similar to Bacillus halodurans transcriptional
FT                   regulator BH2137 SWALL:Q9KAZ9 (EMBL:AP001514) (251 aa)
FT                   fasta scores: E(): 4.1e-13, 26.5% id in 249 aa, and to
FT                   Thermotoga maritima transcriptional regulator, IclR family
FT                   TMm0065 SWALL:Q9WXS0 (EMBL:AE001693) (246 aa) fasta scores:
FT                   E(): 3.9e-11, 23.69% id in 249 aa"
FT                   /db_xref="GOA:Q7W702"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W702"
FT                   /protein_id="CAE38030.1"
FT                   /translation="MGTMAKTDNTLGTVARVVALLRILAERSNRVTLSDLAAELALAPS
FT                   TIHRLLALLKDEGLVARDPVTKMYYCDVEFVRIASLVVDSSQIKDLAAPLLQSLVERFN
FT                   ETTLLCLYLAQQRRYTIVSVHHGTELLRYDVKENTPLQMAWGATARSILAFLPQDDIDR
FT                   ILAEAGPSVTGADVADKTVHKDLAQIRKRGYAVTKGQRIAGSIGLGAPFFGVDGNVLGS
FT                   LCLTIPQGRFNARREAEYTQALIEHAARLSHSLGYVAPSEAKPRKPAAAARRA"
FT   misc_feature    149778..150335
FT                   /note="HMMPfam hit to PF01614, Bacterial transcriptional
FT                   regulator, score 4.3e-08"
FT   CDS_pept        complement(150341..150982)
FT                   /transl_table=11
FT                   /locus_tag="BPP2738"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1677"
FT                   /db_xref="GOA:Q7W701"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W701"
FT                   /protein_id="CAE38031.1"
FT                   /translation="MSDAQAEWAAHICPDAGAALAALPPACRIVYLADGQAPALGRAVR
FT                   ALAADLVVGLSLDYPPGLDPRERGAAAPDTELEDALLARLAGFAAIARRWDRPLRTVGC
FT                   HGALALDVADDERTTQVVARMLQRYDPALSMAVPAGRRGIAVAHHCGIAVVREAWARAP
FT                   SSGAADMSSVRVDRYRLCLDAGAPGLSPLPAQARRAAAAGFRGFASDGAT"
FT   CDS_pept        complement(150979..152373)
FT                   /transl_table=11
FT                   /locus_tag="BPP2739"
FT                   /product="probable sulfatase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1676"
FT                   /db_xref="GOA:Q7W700"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W700"
FT                   /protein_id="CAE38032.1"
FT                   /translation="MSQVTQHPNVVLILADNLGWGELGCYGGGAIRGAPTPRIDALAAQ
FT                   GTQFLNFNVESDCVPTRSALMTGRHPVRTGAMQSVPAGLPQGLVPWERTLAQAFSEQGY
FT                   ATAMYGKWHLGDKEGRYPKDRGFDEWYGIPRTTNESMFMEAVGFDPDVVEVPYVMEGRK
FT                   GSPAERRERYDLEMRRRIDEVLTQRSCEFIGRHAGKAPFFLYVPLTQLHFPTIPHREFE
FT                   GRTGKGDFADSLVEMDARIGQILDAVDQHGIADDTVFIFASDNGPEYRRPWRGSAGMWT
FT                   GTYHTAMEGALRVPLIVRWPGKVPAGRQTNEIVHVVDLFPTLAGIAGLQVPQDRPIDGV
FT                   DQSAFLLGREEKSAREGFVYYIKNELRAAKWRDWKMHFVWEVEPNAGPNHLETPYVFNL
FT                   MQDPKEETDVNTMQGWVRGPIRRMVNAFQASLKSYPPIPPGAPDDYAPSYDMTPPAAKD
FT                   GGQEAP"
FT   misc_feature    complement(151165..152352)
FT                   /note="HMMPfam hit to PF00884, Sulfatase, score 5.8e-88"
FT   CDS_pept        complement(152388..153407)
FT                   /transl_table=11
FT                   /locus_tag="BPP2740"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1675"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Z9"
FT                   /protein_id="CAE38033.1"
FT                   /translation="MQPNPYTQVFRYADEKGKRMKTVLRILLLGAGLLGAAAASAEWPA
FT                   DQPIKIIVPQAAGGTNDTVARLMGVELGKALGQTVVVENRPGASGAIGMQLASRSPADG
FT                   YTLAIASDTASILSATRKMDWRLDHDMAGVAMVGDQPIGVAVSMRAPYASLDELLAAAR
FT                   KEPGTIAFGTSGLGTSQHIVGEWLTHLAGVQMIHVPYKGGGQAVTDLVSGTTPAAVLGF
FT                   APLLGQARSGGIRIVAVTTAERNPAMPEVPTLTELGYSQITRSQWVGVVAPRDTPPAIV
FT                   KRLSDAMAAIGAQPAIQDKLREIGLTPKSMDAAQFDAFIHKDVADWGRLVTELNIKLD"
FT   misc_feature    complement(152400..153218)
FT                   /note="HMMPfam hit to PF03401, Uncharacterized protein
FT                   family, UPF0065, score 2e-77"
FT   misc_feature    complement(153285..153407)
FT                   /note="Signal peptide predicted for BPP2740 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.994) with cleavage site
FT                   probability 0.836 between residues 41 and 42"
FT   CDS_pept        153434..154420
FT                   /transl_table=11
FT                   /locus_tag="BPP2741"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1674"
FT                   /db_xref="GOA:Q7W6Z8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Z8"
FT                   /protein_id="CAE38034.1"
FT                   /translation="MITNTFHSPSAMVQRSRAALSHLKFRHIALIQYLLQEGTLRKAAR
FT                   RLSISQPAATAMLSDIENLLGVQLFTRSRQGVAPTAQTLALAPRLCILMNDFDELGAML
FT                   DRLDTGEHEVLRVGVVPQAFTVLLPRAIEGFRQAGGCHLHTVEGSAQDLLAQLLAGEQD
FT                   CVLGRLPPDVAKLGRDIASLTFVNLYEDDVCVVCGPDHPAARLKKPGYARLAQCDWVLQ
FT                   RISSSVRQALTEAFLRQGLLLPHPVVETPTYTQALDIVAATRLLTAAPRHTAMAHARSG
FT                   RVKVLDIALGVAPMQVCLILRKSAETHPQIVRFRSVFEAMPMRFPDA"
FT   misc_feature    153506..153685
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 2.7e-11"
FT   misc_feature    153548..153640
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    153755..154399
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 1.8e-30"
FT   CDS_pept        154539..155162
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="BPP2742"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1664"
FT                   /db_xref="GOA:Q7W6Z7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Z7"
FT                   /protein_id="CAE38035.1"
FT                   /translation="MSRWTFYTAPGTCALATHIALHEAGADFDLVKLDFGATQQQSPDY
FT                   LRVNPKGRVPALATEHGVLTENPALLAFIAQSFPQAQLAPLGDPFAFARMQELANYLAS
FT                   TAHVAHAHKRRGARWADDPAAHEAMRAKIPENMTAIAGYLESQIVGPWALGERFSVVDG
FT                   YLYTVGSWMEGDSVDMTRFPKLADYLARVGARPAVQRALAEMNG"
FT   misc_feature    154539..154766
FT                   /note="HMMPfam hit to PF02798, Glutathione S-transferase,
FT                   N-terminal domain, score 6.8e-12"
FT   CDS_pept        155276..155587
FT                   /transl_table=11
FT                   /locus_tag="BPP2743"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1663"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Z6"
FT                   /protein_id="CAE38036.1"
FT                   /translation="MEFIETPIFTQLITALLSDEEYSRLQQLLIDNPERGDLLRGGGGI
FT                   RKMRYGRQGTGKRGGIRVIYYWISQDCQIYMLAAYAKSKKINLTPDEIAALRELVKEL"
FT   CDS_pept        155590..155889
FT                   /transl_table=11
FT                   /locus_tag="BPP2744"
FT                   /product="putative DNA-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1662"
FT                   /db_xref="GOA:Q7W6Z5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Z5"
FT                   /protein_id="CAE38037.1"
FT                   /translation="MKKDNTVFNDLQASLKQAVAIRQGKMPPSRVFKVETVDVKATREK
FT                   THMSQTEFAKAIHVSVRTLQNWEQGHRNPTGPAVALLKIVASAPDIAVRALRTA"
FT   misc_feature    155704..155877
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   3.5e-08"
FT   CDS_pept        complement(join(155903..158119,158121..158456))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="sphB2"
FT                   /locus_tag="BPP2745"
FT                   /product="autotransporter (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1660"
FT                   /note="Similar to Agrobacterium tumefaciens hypothetical
FT                   protein ATU3276 or AGR_L_3085 SWALL:AAL44092
FT                   (EMBL:AE009257) (1052 aa) fasta scores: E(): 5.6e-52,
FT                   35.56% id in 748 aa, and to Rhizobium loti hypothetical
FT                   protein MLL1534 SWALL:Q98KC9 (EMBL:AP002997) (1008 aa)
FT                   fasta scores: E(): 7.2e-51, 35.12% id in 746 aa"
FT                   /db_xref="PSEUDO:CAE38038.1"
FT   misc_feature    complement(158385..158456)
FT                   /note="Signal peptide predicted for BPP2745 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.994 between residues 24 and 25"
FT   CDS_pept        158625..159299
FT                   /transl_table=11
FT                   /locus_tag="BPP2746"
FT                   /product="response regulatory protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1659"
FT                   /db_xref="GOA:Q7W6Z4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Z4"
FT                   /protein_id="CAE38039.1"
FT                   /translation="MQTCTPTRPAGSLRIAIVEDDPAFRHAVVAVIAHEPGMSVLAQAQ
FT                   TCAQARAMLQGPPADVLLVDLGLPDGSGIDVIRQARRLWDDCDIMVNTMFGDEAHVMRS
FT                   IEAGACGYLLKDSEPAGIVRDIRALRDGGSPINPLIARQLLDRLRQGLPAAAPPAAMAL
FT                   SPREHQVLERITLGYTYDEIARDLEVSRHTVQTFVRRIYRKLQVHSKVDAINAARGLCP
FT                   DG"
FT   misc_feature    158661..159026
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 6e-23"
FT   misc_feature    159102..159293
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR family, score 1.1e-13"
FT   misc_feature    159153..159236
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT   CDS_pept        159292..161151
FT                   /transl_table=11
FT                   /locus_tag="BPP2747"
FT                   /product="probable two-component sensor histidine kinase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1658"
FT                   /db_xref="GOA:Q7W6Z3"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Z3"
FT                   /protein_id="CAE38040.1"
FT                   /translation="MAERRRLARRAWALLAWLWLALPAAVLAEPRHFTAAQFLLQDEAA
FT                   AAAPDRVPALGPPGDWQSVALPHAGLQRRVVPDPQAGDAALAWYRLDLDASGVDDPVLY
FT                   LPRWQTVGRLAVYGDGKLLYRSGGSAQWSGFNRPVWLPLAAGGPPPATLLLRISSLDGA
FT                   GAGLSTAWVGAAGELRWRYELRRWLQQDLPYLASAVFLAIGLFALGVWAVRRKESIYGL
FT                   FFAASVVFYLRCLHYHAGPFQLLLDDEWFSWLTITSVGWLAIASYFFAFRLHGRTYPRS
FT                   ERAMLAGMGALTAAMLPVWQIHPHLVLLAPLAYLGITAVSLFACLLAVWGAWRAGSRDG
FT                   LALACWNLAAIPVAVHDMLLQNYRLSMEHVYLLPYTGIGMFVIFLYVAYRRYLNALAGA
FT                   AGAQATLQRRLAERERELEHSHRRLRDVERIRILAGERERLMQDMHDGLGSSLVSALRM
FT                   VQHGNSSEGAVAQVLQECLDDLRLTIDSLEPAQTDLALLLATLRFRLGPRLQAAGLAID
FT                   WRVGPLPPVSWLTPPAALHVLRILQEVFTNILKHARARRLTVSTRLEPAHAVITIIDDG
FT                   AGFCGPRQAPAASRPGRGLTGMQARARHRGAPSLARGGARQPF"
FT   misc_feature    159292..159375
FT                   /note="Signal peptide predicted for BPP2747 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.983 between residues 28 and 29"
FT   misc_feature    join(159325..159378,159871..159930,159943..160011,
FT                   160039..160104,160141..160197,160225..160293,
FT                   160312..160371,160399..160458)
FT                   /note="8 probable transmembrane helices predicted for
FT                   BPP2747 by TMHMM2.0 at aa 12-29, 194-213, 218-240, 250-271,
FT                   284-302, 312-334, 341-360 and 370-389"
FT   misc_feature    160885..161130
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase, score 0.0084"
FT   CDS_pept        complement(161176..162138)
FT                   /transl_table=11
FT                   /locus_tag="BPP2748"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1657"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Z2"
FT                   /protein_id="CAE38041.1"
FT                   /translation="MRPAARRLGSWLMALAACAAASAAWGQQGLRLSKDDLQKRANGVL
FT                   ALMSFSIVPDITTSALNIAGGGGSTSGSTEFYMTQLGGGDTISKSVPLYLEGVLAASRY
FT                   DPTFIATQGVESRRIPAKWNSVSATGGIGWDFPLTDELKLRPIFNVALGNVTSDLRAAS
FT                   WYVGRQTGQDIDFLDRGSLNAYGLGGSLMLDYEHYRPGYEVDVELRYSEIRLRSFDSSA
FT                   AVRGQATAQSANLWARYRAPTGATLLQRPLRYVLELTHSEFLGDQRGILGFDRLTSVGA
FT                   GLELDSSAYDVFITRTRLVGRYVFGNNVSGFSVGLAVSF"
FT   misc_feature    complement(162061..162138)
FT                   /note="Signal peptide predicted for BPP2748 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.609 between residues 26 and 27"
FT   CDS_pept        complement(join(162141..162272,162274..164688))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2749"
FT                   /product="putative membrane protein (Pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1634"
FT                   /db_xref="PSEUDO:CAE38042.1"
FT   misc_feature    complement(join(163282..163347,163369..163434,
FT                   163447..163512,163552..163617,163711..163776,
FT                   163798..163863,163894..163959,164050..164115,
FT                   164128..164193,164233..164298,164344..164409,
FT                   164449..164514,164560..164625))
FT                   /note="13 probable transmembrane helices predicted for
FT                   BPP2749 by TMHMM2.0 at aa 21-43, 58-80, 93-115, 130-152,
FT                   165-187, 191-213, 243-265, 275-297, 304-326, 357-379,
FT                   392-414, 418-440 and 447-469"
FT   CDS_pept        complement(164767..166395)
FT                   /transl_table=11
FT                   /locus_tag="BPP2750"
FT                   /product="putative arylsulfatase protein"
FT                   /EC_number="3.1.6.1"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1635"
FT                   /db_xref="GOA:Q7W6Z1"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Z1"
FT                   /protein_id="CAE38043.1"
FT                   /translation="MNARRWLTAALVAAGGLAVAAGAHAQAQGDAAKPQASGKPPNILV
FT                   IFGDDIGQANISAYTRGVVGYTTPNIDRIAKEGIIFTDYYAENSCTAGRSSFITGQSPR
FT                   RTGLSKVGVPGVDVGLQDRDVTIAQALKAHGYVTAQFGKNHLGDRDEYLPTKHGFDEFF
FT                   GNLYHLNAEEEPERPYWPKDPKDPVVKAYKPRGVIKASADGKIEDTGALTSKRMETIDD
FT                   ETVGAALDYIDKHGKGDKPFFVWMNTTRMHIYTHIRPEHQGKSGMPGNDYADGMWEHDQ
FT                   DVGKLLKKLDDLGIADNTIVVYTTDNGPNQFSWPDAATTPFRNEKDSNWEGAFRVPAMV
FT                   RWPGHIPAGVTRNGMVSGLDWFPTLLAAAGEGDIKEKLLKGWAAGNGGKNYKVHLDGYN
FT                   QLEYLTGKSDKSARNEFYYFNDDGLLVAMRMENWKIVFCEQRAPGGFDVWKDPFVCLRV
FT                   PKVFNLRMDPYERADIVSDQYYDWLSKNAYLAFIGSAKASEFLETFVEWPPSQRPASFS
FT                   VDQVQEEVDRKIMQYFEEQKKKQGK"
FT   misc_feature    complement(164992..166275)
FT                   /note="HMMPfam hit to PF00884, Sulfatase, score 1.1e-60"
FT   misc_feature    complement(166321..166395)
FT                   /note="Signal peptide predicted for BPP2750 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.956 between residues 25 and 26"
FT   CDS_pept        complement(166445..167479)
FT                   /transl_table=11
FT                   /locus_tag="BPP2751"
FT                   /product="putative nonspecific acid phosphatase precursor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1636"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Z0"
FT                   /protein_id="CAE38044.1"
FT                   /translation="MNRHTTESWRRWAARLGAAAMALLLAACAAPRQQAASVDELPSWN
FT                   DGPSRTAIVEFVRAVTRSGGPDFVAADERIAVFDNDGTLWSEQPMYFQMLFALDRVKSM
FT                   APRHPDWARRQPFKAALQDDHAALAKGGDAALMKIVGATHTDMSTDTFTRSVRYWASTA
FT                   RHPRFDRLYTELTFAPMRELLDYLRAHGFKTYIVSGGETEFMRPWTQQAYGIPPEQVIG
FT                   SSFVTTYGVRDGEPTLWRHGKLEFNDDGPGKPVAIQRYIGRRPILAFGNSDGDLQMLQW
FT                   TAAGDGKRFAGLVHHTDAQREWAYDRDSRIGRLDRALDEARRQDWTVVDMKTEWKRVYA
FT                   FEQP"
FT   misc_feature    complement(166601..167263)
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 0.013"
FT   misc_feature    complement(167168..167197)
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT   misc_feature    complement(167375..167479)
FT                   /note="Signal peptide predicted for BPP2751 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.702 between residues 35 and 36"
FT   misc_feature    complement(167387..167443)
FT                   /note="1 probable transmembrane helix predicted for BPP2751
FT                   by TMHMM2.0 at aa 12-31"
FT   misc_feature    complement(167396..167428)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(join(167482..167493,167493..168806))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2752"
FT                   /product="putative exported protein (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1637"
FT                   /db_xref="PSEUDO:CAE38045.1"
FT   variation       complement(167492)
FT                   /note="(C)1 in parapertussis; (C)2 in pertussis and
FT                   bronchiseptica"
FT   misc_feature    complement(167850..167915)
FT                   /note="1 probable transmembrane helix predicted for BPP2752
FT                   by TMHMM2.0 at aa 297-319"
FT   misc_feature    complement(168426..168449)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(168738..168806)
FT                   /note="Signal peptide predicted for BPP2752 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.784 between residues 23 and 24"
FT   CDS_pept        complement(168803..170308)
FT                   /transl_table=11
FT                   /locus_tag="BPP2753"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1638"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Y9"
FT                   /protein_id="CAE38046.1"
FT                   /translation="MDIDLSAFHFLRPWWLLAVPLTALLWWARRGERGAPGRDLRIAPA
FT                   LLPYLVLRTPGSRGPRPIDALALFLALGGVAAAGPAWQRDEPAYLDNVAPLIVALDLSA
FT                   SMDGADVPPTRLEAARRVLRDLAARRAAARTGLIAYAGSSHLVLPPTDDAGLLDLFAQA
FT                   LATGLIERPGRDADGAIALAAQALAAERAGGTLLILTDGADRARMDAVRRQAQAARDMQ
FT                   VLVMAVGVNGIDTQALQELARAAGAALGSLTGGPDDQDWIALHAQAHFRAVQDAQSGPV
FT                   HWKDAGYWLCWPLALLAVRRGWSVAWSAGVLVVAMAGMPQPARADALADAFLTADQQGR
FT                   RAFEHGRYDEAARHFHDPYWKGRAAYEAGDYKAALAAFSTLPSAEGYFYVGNTQTRLHR
FT                   YDAALAAYDRALALKPGWQPAVVNRGIVARLLAAMAQTQQDQPAEPPDQTIADRTAQAG
FT                   KMSQAPVAQAGSEEAWLRNLTLSPARFLRSKFAAEDAAAGARP"
FT   misc_feature    complement(169058..169159)
FT                   /note="HMMPfam hit to PF00515, TPR Domain, score 0.00089"
FT   CDS_pept        complement(join(170299..170364,170367..171305))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2754"
FT                   /product="putative exported protein (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1639"
FT                   /db_xref="PSEUDO:CAE38047.1"
FT   misc_feature    complement(170481..171035)
FT                   /note="HMMPfam hit to PF00092, von Willebrand factor type A
FT                   domain, score 0.00016"
FT   misc_feature    complement(171225..171305)
FT                   /note="Signal peptide predicted for BPP2754 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.779) with cleavage site
FT                   probability 0.315 between residues 27 and 28"
FT   CDS_pept        complement(171292..171783)
FT                   /transl_table=11
FT                   /locus_tag="BPP2755"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1639A"
FT                   /db_xref="GOA:Q7W6Y8"
FT                   /db_xref="InterPro:IPR025489"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Y8"
FT                   /protein_id="CAE38048.1"
FT                   /translation="MSDALPGLDQLQELPLPAAVPYWPQTWGWAVLAALVLAGAAWAGY
FT                   AGWRRRRRNRYRRQALAELQRLARAAAADPLAARALPGLLKRTALAAGQPAVAPLGGQA
FT                   WLARLAQDAAGAAFPDDSARMLALLAYAPDGAVRALDAPALARLFAASRRWVESHHVAA
FT                   "
FT   misc_feature    complement(171640..171705)
FT                   /note="1 probable transmembrane helix predicted for BPP2755
FT                   by TMHMM2.0 at aa 26-48"
FT   CDS_pept        complement(171780..172721)
FT                   /transl_table=11
FT                   /locus_tag="BPP2756"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1640"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Y7"
FT                   /protein_id="CAE38049.1"
FT                   /translation="MPRAAHPVHPPLPELMALEAAVGGLSFVAGQPLGSVLAGLHGSRL
FT                   RGRGLDFAELRRYVPGDDLRQLDPRASLRYGKPYVRAYTEERDRPAMIVADQRMSMYFG
FT                   SVRAFKCAVAARLAALAAWTAYRGGDRVGGLVFDDDGVRAFKPLRSRDRVQALLAEVAR
FT                   ANAGLSAARPERPAGAGLNAALRGALAHAPHDCLVCIVSDFAGADAETLRTLRLLARHN
FT                   DVVAMLVFDPMAQDLPRRGRLVVTQGELQLEIAVGRQRERQPLADFFSGRLREVADLLR
FT                   RSRVPLLSIDTAEDEVVQLRRALGRLQTGARR"
FT   misc_feature    complement(172215..172721)
FT                   /note="HMMPfam hit to PF01882, Protein of unknown function
FT                   DUF58, score 1.3e-07"
FT   CDS_pept        complement(join(172730..173383,173386..173667))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2757"
FT                   /product="putative regulatory protein (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1641"
FT                   /db_xref="PSEUDO:CAE38050.1"
FT   CDS_pept        complement(173750..174892)
FT                   /transl_table=11
FT                   /locus_tag="BPP2758"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1642"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Y6"
FT                   /protein_id="CAE38051.1"
FT                   /translation="MKQQLKIALAMATIVGAAGALGAYVASTSDAPQAPAVRLGDGKAG
FT                   PAGMAWIPGHQFLMGNDHKLSQPNERPAHQVRVSGFWMDVHDVTNAQFRRFVQATGYLT
FT                   TAERKPRWEDLRPQLPPGTPRPDDSQLAPGAMVFVGTRSEVSLRDYSRWWRFVPGASWR
FT                   HPQGPGSGIDGKDDHPVVQVSYEDAQAYARWAGKRLPTEAEWEFAARGGLEQATYTWGD
FT                   ELLPQGQAMANIWDTRQQQPFPVVKDEKVQVGTTPVGSFAPNGYGLYDMAGNVWQWTAD
FT                   WYRADAFRIQAQYREPPLDPAGPADSFDPDDGNVPAAAPKRVTRGGSFLCSDTYCISYR
FT                   ASARRGTDPLNPMSHLGFRTVMTPEQWKLAQARQGRLASR"
FT   misc_feature    complement(174818..174892)
FT                   /note="Signal peptide predicted for BPP2758 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.730 between residues 25 and 26"
FT   CDS_pept        175236..176198
FT                   /transl_table=11
FT                   /locus_tag="BPP2759"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1643"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Y5"
FT                   /protein_id="CAE38052.1"
FT                   /translation="MRSRFAWRFCNAGLALAALPGAARATEGALGRLVTGTTVQPNAGV
FT                   VSPQPITVLSLGQLYLDGRIGGSREVPVAGKTSLGLDAEMALTLATLMKTWDTGPGRWN
FT                   FASSLTVPYLWLKITATLAGERGRAARESDIASNLFDLNFTPLIAGYHFSETQHLALSL
FT                   SIWAPTGKYDADALANPSLNNWTFIPQVAYTGMFPEHGLQLDAVANVQFYTRNTATDYR
FT                   NAPIFGLELMGRKLFGNGVGAGLIVGTQQQLGPDKGPTADRLNGFEGRDWALGPILTYD
FT                   RKLADQRSLSFSLRWTPTISSTRRLDSDSTVLGTVALIF"
FT   misc_feature    175236..175310
FT                   /note="Signal peptide predicted for BPP2759 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.981 between residues 25 and 26"
FT   CDS_pept        176317..177369
FT                   /transl_table=11
FT                   /locus_tag="BPP2760"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1644"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Y4"
FT                   /protein_id="CAE38053.1"
FT                   /translation="MRLARARSSPAFSHDNKMETRMRLIRRFAHALAVVGSAGFLAAPA
FT                   AASTGTYPDKPIHLLVAFSTGGVLDTLARTMASELSTRYGQSIVVENRTGASGNIGTDL
FT                   LARAKPDGYTIGMGTIATHGINPALYGERLPYDPVKGFTPLALLAEQTNIVLVNNDLPV
FT                   TSIPTLIEYLRANPGKVAYGSAGNGSSQHLSGQLFKLAAGVELLHVPYRGSVPALTDLV
FT                   SGQVQLMFVDVPAALPFIKSGKVRPIAVTAAHRSSAFPDLPTVAEQGLEGFNVRAWFGV
FT                   LAPAGTPAPIAEKLSADMIAAVQQPAIRERLEALGMDIKTLDGPAFGQFIQDEIARWDE
FT                   IVKRSGTRLE"
FT   misc_feature    176317..176457
FT                   /note="Signal peptide predicted for BPP2760 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.926 between residues 47 and 48"
FT   misc_feature    176530..177357
FT                   /note="HMMPfam hit to PF03401, Uncharacterized protein
FT                   family, UPF0065, score 1.1e-107"
FT   CDS_pept        177416..178174
FT                   /transl_table=11
FT                   /locus_tag="BPP2761"
FT                   /product="probable short-chain dehydrogenase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1645"
FT                   /db_xref="GOA:Q7W6Y3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Y3"
FT                   /protein_id="CAE38054.1"
FT                   /translation="MGRLSGRNALITGAAVGIGAAMARRFCAEGASVLLGDIDAERGQA
FT                   LAAELAATGARARFARLDVTDEDSVRQALELAEAEHGPLHILVNNAGGSSLNDRSVVEF
FT                   ALEEFWRAINIDLLGTVLCCRHAIPRIAAAGGGAVVNMGSIAALRGLKGRDAYTAAKGG
FT                   VHALTRSMAVEFAEQRVRCNAIAPGAVLSERMARFIDEDPRVAAAVSRHLLGLPEPDEI
FT                   AAMAVFLASEESRHVTGSIFQIDGGRAAAA"
FT   misc_feature    177416..177484
FT                   /note="Signal peptide predicted for BPP2761 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.819) with cleavage site
FT                   probability 0.574 between residues 23 and 24"
FT   misc_feature    177428..178159
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 5.3e-75"
FT   misc_feature    177845..177931
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   CDS_pept        178364..179101
FT                   /transl_table=11
FT                   /locus_tag="BPP2762"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1646"
FT                   /db_xref="GOA:Q7W6Y2"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Y2"
FT                   /protein_id="CAE38055.1"
FT                   /translation="MVEAIETFHWGAIFQIVLIDILLGGDNAVVIALACRNLPRRQRIK
FT                   GILWGTAGAVLLRVLLIAFALVLLDIPFLKALGCLLLVWIGVKLLAPHEDAHGNITGGT
FT                   SVLAAIRTIILADFAMSLDNVIAIAGAAQNAQADHQLYYVIFGLCVSVPIIVWGSTLVL
FT                   KLIDRFPLVVTLGAGLLGWIAGGMLITDIYVVERWGEPAPMLKLAVEAAGALVVVAAGK
FT                   WLAARRRHARPTHDESASTTPGG"
FT   misc_feature    join(178394..178462,178499..178567,178784..178852,
FT                   178871..178939,178982..179041)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BPP2762 by TMHMM2.0 at aa 11-33, 46-68, 141-163, 170-192
FT                   and 207-226"
FT   CDS_pept        complement(179098..179553)
FT                   /transl_table=11
FT                   /locus_tag="BPP2763"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein PA0474 SWALL:Q9I644 (EMBL:AE004485) (134 aa) fasta
FT                   scores: E(): 2.7e-13, 39.39% id in 132 aa, and to
FT                   Caulobacter crescentus hypothetical protein CC3309
FT                   SWALL:Q9A395 (EMBL:AE005993) (157 aa) fasta scores: E():
FT                   1.2e-06, 32.37% id in 139 aa"
FT                   /db_xref="GOA:Q7W6Y1"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039298"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Y1"
FT                   /protein_id="CAE38056.1"
FT                   /translation="MAFLQPSLFMNDSIPDGFAPWRPGSPFMAHLADLGTFYVREADDA
FT                   LAVRVGPPHTNMHGIAHGGLLATLADSALGYCISRRAQASVVTVQMSVEYLSAVKPGDW
FT                   LQAQVRIDKQGRRLIYATCLLQVEDRLMLKANAVFAVRAAPAPVSDG"
FT   CDS_pept        179824..180195
FT                   /transl_table=11
FT                   /locus_tag="BPP2764"
FT                   /product="Putative transcriptional regulator"
FT                   /note="Very low similarity to Rhizobium loti hypothetical
FT                   protein MSl6954 SWALL:Q987R0 (EMBL:AP003010) (93 aa) fasta
FT                   scores: E(): 0.0023, 32.58% id in 89 aa, and to Ralstonia
FT                   solanacearum putative transcription regulator protein HipB
FT                   or RSP1252 or RS03197 SWALL:Q8XQH3 (EMBL:AL646083) (88 aa)
FT                   fasta scores: E(): 0.029, 36.98% id in 73 aa"
FT                   /db_xref="GOA:Q7W6Y0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Y0"
FT                   /protein_id="CAE38057.1"
FT                   /translation="MLIRSLLFDLCVSQHFFLGRVYFMPLAAYISMKTLPDVGARFRTL
FT                   RKQARKTQRELAAATGMRQEAISRFEAGSASDFSLNKLLTLLQALDLEFDFKPAVRRPD
FT                   LDDLLAERRGRLDDAKDPS"
FT   misc_feature    179947..180114
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   2e-09"
FT   CDS_pept        180192..181538
FT                   /transl_table=11
FT                   /locus_tag="BPP2765"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Rhizobium loti hypothetical protein
FT                   MLL6953 SWALL:Q987R1 (EMBL:AP003010) (420 aa) fasta scores:
FT                   E(): 5.9e-31, 34.54% id in 411 aa, and to Neisseria
FT                   meningitidis hypothetical protein NMB1761 SWALL:Q9JY37
FT                   (EMBL:AE002525) (417 aa) fasta scores: E(): 2.2e-14, 28.57%
FT                   id in 385 aa"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6X9"
FT                   /protein_id="CAE38058.1"
FT                   /translation="MKLNVFVHGTRVALLDSPDGFQHRLAYLPETDPARFASLTMPVRA
FT                   EPWRWPTLHPFFQVSLPEGFLLMLLKEQLGPQLGARQLDLLAVVGPNMIGRVQVSAGAT
FT                   LEPAMALESLDPLLHGPASQQVFLELMAQYAASGVSGVVPKFLTPATQALFRKGTIATE
FT                   RHIVKGSSEHQPFVALNEHLCMTAAQGTGIPVARTRVSDDGQVLVVERFDIDPATGRRL
FT                   GFEDFCSLLGLSADEKYDSTWERVARVASDYVRPEGRLQARTQLAITLLLSFALGNADC
FT                   HAKNLALVYDTIDDVRIAPVYDMLTILAYDRYAANPPGMALDGRKSWTMSKALWRYLQQ
FT                   HLGFAPAAQRELVDRVCSAIADTVPQLKAHIRHTPGFEPVGLRMLWEWNEGMKRLSERR
FT                   QIAVPDWVATARDEGLPRPAPAAHFAAQRIGESPLLAPRRRRQPARPPS"
FT   CDS_pept        complement(181585..182325)
FT                   /transl_table=11
FT                   /locus_tag="BPP2766"
FT                   /product="Putative regulatory protein"
FT                   /note="Similar to Streptomyces coelicolor putative gntr
FT                   family regulatory protein sco4019 or 2sc10a7.23
FT                   SWALL:Q9ADN8 (EMBL:AL583945) (230 aa) fasta scores: E():
FT                   1.7e-19, 36.66% id in 210 aa, and to Rhizobium loti
FT                   transcription regulator mlr4761 SWALL:Q98DC7
FT                   (EMBL:AP003004) (247 aa) fasta scores: E(): 1e-18, 34.68%
FT                   id in 222 aa"
FT                   /db_xref="GOA:Q7W6X8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6X8"
FT                   /protein_id="CAE38059.1"
FT                   /translation="MGAACATIAALLVSHIMKNAKNGRTLNAEVYAQLRAQILTGQFMP
FT                   RQRLKVSQLSEQHGVSLNVVREALNRLAGEQLVELQPQFGFAVRGLSAEDLVDLFEQRG
FT                   VVESLALRQSIARGDLNWQSDVVAAHHRLGGTAVVSPDDPQKLNPEWLARHEEFNLVMM
FT                   RACGSPRLLQIVRQLAEASAIYQRALLPLAAVAAELETEHDDLLQRILDGDADGAVRVL
FT                   LKHMEQTRDAMLPFLVQQEVAEQA"
FT   misc_feature    complement(182062..182238)
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 2.6e-09"
FT   CDS_pept        182437..183276
FT                   /transl_table=11
FT                   /locus_tag="BPP2767"
FT                   /product="Putative hydrolase"
FT                   /EC_number="3.1.1.-"
FT                   /note="Similar to Pseudomonas putida
FT                   2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase IpbD
FT                   SWALL:O51858 (EMBL:AF006691) (282 aa) fasta scores: E():
FT                   3.5e-23, 32.17% id in 258 aa, and to Pseudomonas putida
FT                   2-hydroxy-6-oxo-2,4-heptadienoate hydrolase TodF
FT                   SWALL:TODF_PSEPU (SWALL:P23133) (276 aa) fasta scores: E():
FT                   1.1e-22, 31.87% id in 251 aa"
FT                   /db_xref="GOA:Q7W6X7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6X7"
FT                   /protein_id="CAE38060.1"
FT                   /translation="MSLPDGYTLSHLPFEGTQCAYLRGGSGPTLLLVHGSGPGASSLGN
FT                   WRAVLPALVRRFDVVAMDLVGFGQSGRKPAAPYFDFDMWVRQVRAMMSHLGEGPIGLVG
FT                   HSLAGALALTVASGNPAVRGVVATGTMGIPFAPNDATRRTWKCPRSRPELVRALQGLIH
FT                   DHSVIDEAYLAVREPVIFAPGYADYFDAMFDAAPATYIAAATLSERTLRGIRCPVTLLH
FT                   GRDDAAFPPAASQRIAEQLADADLVLLAGCSHSVAFERPDVFLAMVHQRFGALPYFL"
FT   misc_feature    182605..183252
FT                   /note="HMMPfam hit to PF00561, alpha/beta hydrolase fold,
FT                   score 5.8e-25"
FT   CDS_pept        183285..184637
FT                   /transl_table=11
FT                   /locus_tag="BPP2768"
FT                   /product="Putative dipeptidase"
FT                   /note="Similar to Caulobacter crescentus xaa-pro
FT                   dipeptidase, putative CC3125 SWALL:Q9A3S7 (EMBL:AE005976)
FT                   (431 aa) fasta scores: E(): 1.3e-27, 29.78% id in 423 aa,
FT                   and to Sulfolobus solfataricus prolidase PepQ-like2 or
FT                   SSO2040 SWALL:Q97WS6 (EMBL:AE006811) (408 aa) fasta scores:
FT                   E(): 2.6e-18, 26.21% id in 370 aa"
FT                   /db_xref="GOA:Q7W6X6"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6X6"
FT                   /protein_id="CAE38061.1"
FT                   /translation="MKTGYVLKGRVIDGTLGPALEQGAVVTEGERIAWVGPQSGLPAQY
FT                   AGDRHTVVDLPGRTIMPGLIDAHTHISFGESRSEEENALYTPVEFRTAKALWYARKVLQ
FT                   AGVTSAFDAATSYNIAQAVRDAIDTGMFEGPRFTVSGKQLTNHHGLEDSFPNEMAFPPG
FT                   QSAVLVKTREDLVEAIHYQVKDEVDAIKVSGSNDNLITPDALGSSAFTYEEFKIIADET
FT                   HRLGRLCSVHARSRDAALYAAQAGFDNLFHASYIDDEGIEACLKNGCVITPTLTLLVNL
FT                   VEAKQSHAGASSAQAFRQEIEAASVNLRRAYDAGVPLLAGSESGWSPVPYGHWHAREME
FT                   IFVKLLGLTPLQAIHANTLACTRLLARHGHEVGKLEASRLADVLVLPGNPLEDITLLQR
FT                   PSRFDYIFKGGTPVDRTAPAPRVRKWYERTKIFLAGVYEYDQENACGRLVQ"
FT   CDS_pept        184694..185113
FT                   /transl_table=11
FT                   /locus_tag="BPP2769"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical
FT                   protein SCO6478 or SC9C7.14c SWALL:Q9ZBJ6 (EMBL:AL035161)
FT                   (132 aa) fasta scores: E(): 2.8e-09, 40.65% id in 123 aa,
FT                   and to Rhizobium meliloti hypothetical protein RA1232 or
FT                   SMA2289 SWALL:Q92XL2 (EMBL:AE007308) (130 aa) fasta scores:
FT                   E(): 2e-06, 31.45% id in 124 aa"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6X5"
FT                   /protein_id="CAE38062.1"
FT                   /translation="MSQAAVQYLNPEGAAPAQGLYSHATRVRAGDLYFVAGQLAVGRDG
FT                   AVAGVGDFEAQFDQVFGNLRDVLAGLGVDFNDVAKFTTYLVHSQDIPRFMRKRAELFPT
FT                   LFAGKAYAPSTLLIVDRLVKEEFLIEVEAVVRARD"
FT   misc_feature    184727..185104
FT                   /note="HMMPfam hit to PF01042, YjgF family, score 6.8e-16"
FT   CDS_pept        185138..186022
FT                   /transl_table=11
FT                   /locus_tag="BPP2770"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Bacillus subtilis YisK protein
FT                   SWALL:O06724 (EMBL:Y09476) (301 aa) fasta scores: E():
FT                   1.1e-39, 39.8% id in 309 aa, and to Ralstonia solanacearum
FT                   hypothetical protein RSC1824 or RS04254 SWALL:Q8XYD4
FT                   (EMBL:AL646066) (319 aa) fasta scores: E(): 5.1e-34, 40% id
FT                   in 270 aa"
FT                   /db_xref="GOA:Q7W6X4"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6X4"
FT                   /protein_id="CAE38063.1"
FT                   /translation="MKYISFELPDGRRHAGVMTGPDTLVDLTDAMDLPDLLTLLQRHGQ
FT                   LAGDVARLAAQARHTVALDAVRVLAPLPNPPRNVFCVGKNYHEHAREFARSGFDSSAAA
FT                   GAVPAAPIIFSKPPSSVSGPGDAIDTALDPCDSVDYEAELAVVIGKAGRVAPDDDPWSF
FT                   VFGYTLVNDVTSRGLQKRHSQWLLGKGIDGYCPMGPALVSADEIGDIGALEITCEVNGE
FT                   LRQSARLSDLIFDIPTLVRAIGASITLQPGDVIATGTPVGVGIGFTPPKYLRRGDVVRV
FT                   RAEPIGVLENPVI"
FT   misc_feature    185420..185467
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT   misc_feature    185447..185941
FT                   /note="HMMPfam hit to PF01557, Fumarylacetoacetate (FAA)
FT                   hydrolase family, score 4.1e-59"
FT   CDS_pept        186062..187615
FT                   /transl_table=11
FT                   /locus_tag="BPP2771"
FT                   /product="Putative sugar ABC transport syste, ATP-binding
FT                   protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 L-arabinose transport ATP-binding protein AraG or
FT                   B1900 or Z2953 or ECS2608 (504 aa) fasta scores:
FT                   E()=1.3e-48, 36.34% id in 476 aa, and to Ralstonia
FT                   solanacearum probable L-arabinose ATP-binding ABC
FT                   transporter protein AraG or RSC2757 or RS00097 SWALL:Q8XVS2
FT                   (EMBL:AL646071) (511 aa) fasta scores: E(): 1.3e-47, 38.15%
FT                   id in 477 aa"
FT                   /db_xref="GOA:Q7W6X3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6X3"
FT                   /protein_id="CAE38064.1"
FT                   /translation="MMHSEGAASAAPSPQPPPLLRLRQISKRFGATQALDDVSVSFEAG
FT                   KVHCLLGENGAGKSTIGKIVAGLFAPDSGALLLDGHEVRLADASEARRRGIAVVYQELS
FT                   LAPDLSVRANLCLGAEAGRRPWSPLRRGAETAQVGAVLARLGLDLDMEAPVRQLPAGVQ
FT                   QLVEIAKSLMSSPRIVIFDEPTAMLGAAEKQRFFEVVRGLRADGIACILVTHHMDDVEA
FT                   VGDCVTIMRNGRRVDSFDLHAGITSDAVLEKLTGRREVLAAAAEAPRRLGATRLRIALP
FT                   AGGGLAGIEARAGEVVGFYGVLGCGAGELMYGLVGLDGPPRADYYLDDAPYRPRNPAAA
FT                   LRQGVGLLPAGRQSHGVLTGRSIRENLMLTQLDRVSRWQCIDPAREAAWAREQLERAGV
FT                   KHGDPADPIESLSGGNQQKALLARALGAARRLLLLHEPTAGVDILAKQHIHELVRAAAA
FT                   QGLTVVVLSSDLPEVIALCDTVYTFFHGAAVARYAQPGPDCQPHILADVLGQRESQHAH
FT                   "
FT   misc_feature    186194..186760
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   6.2e-48"
FT   misc_feature    186215..186238
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    186941..187519
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.2e-11"
FT   misc_feature    187292..187336
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        187605..188570
FT                   /transl_table=11
FT                   /locus_tag="BPP2772"
FT                   /product="Putative sugar ABC transport system, permease
FT                   protein"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 ribose transport system permease protein Rbsc or
FT                   B3750 or Z5251 or ECS4692 SWALL:RBSC_ECOLI (SWALL:P04984)
FT                   (321 aa) fasta scores: E(): 6.3e-32, 39.52% id in 296 aa,
FT                   and to Clostridium perfringens probable ribose ABC
FT                   transporter RbsC or CPE1629 SWALL:Q8XJX4 (EMBL:AP003191)
FT                   (311 aa) fasta scores: E(): 6.9e-32, 35.49% id in 293 aa"
FT                   /db_xref="GOA:Q7W6X2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6X2"
FT                   /protein_id="CAE38065.1"
FT                   /translation="MLTKTLAVSRAARPAPAARLADAILPLIIALIALVASLIEPRFAS
FT                   LDNLTNLACQLVPLLILSVGQAFAILRGGLDLSMSSVLSLAGVAGVLAMPAWGVAAGLA
FT                   VMLAVGLAAGVVSGFIIARFRTTPLVVTLGMLSVTQAIALILSGGVPIYDVPAPYVNAV
FT                   GFGRTLGLPNMVWIAAAVTLAAAFALKRTVFGRYVYALGSSESAASKAGVNVQRYTVMV
FT                   YAASGLCAAVGAVVLTAWTSSAQPVAVPGLTLQSIAAVVLGGVALTGGSGSIVQVFLGV
FT                   LVLSVLSNAMNITGVSAYFQTLVVGVVIIIAVILDRFRRS"
FT   misc_feature    join(187662..187721,187749..187817,187836..187895,
FT                   187905..187973,187992..188060,188103..188171,
FT                   188262..188330,188373..188462,188481..188549)
FT                   /note="9 probable transmembrane helices predicted for
FT                   BPP2772 by TMHMM2.0 at aa 20-39, 49-71, 78-97, 101-123,
FT                   130-152, 167-189, 220-242, 257-286 and 293-315"
FT   CDS_pept        188611..189696
FT                   /transl_table=11
FT                   /locus_tag="BPP2773"
FT                   /product="Putative sugar ABC transport system,
FT                   substrate-binding protein"
FT                   /note="Similar to Agrobacterium tumefaciens ABC
FT                   transporter, substrate binding protein RbsB or ATU1899 or
FT                   AGR_C_3486 SWALL:AAL42895 (EMBL:AE009144) (309 aa) fasta
FT                   scores: E(): 6.4e-10, 28.41% id in 271 aa, and to Bacillus
FT                   subtilis D-ribose-binding protein precursor RbsB
FT                   SWALL:RBSB_BACSU (SWALL:P36949) (305 aa) fasta scores: E():
FT                   1.5e-07, 22.53% id in 284 aa"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="PDB:5IX8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6X1"
FT                   /protein_id="CAE38066.1"
FT                   /translation="MTLFGKTSRRPGLPRQAAGLALAACALASLPAQAKESDGDRLQGI
FT                   VEPIVARQPLKLGVTVVHLLDNFYKGIAYGIVDEARRSNVEVVQVAVAGAYGNVQQQFA
FT                   QLQSFKTLGVDYAVLSPAAYSGYDPVVADLARSGIKTISAGIPVNSDKIAFGVLQDDTL
FT                   IGKVLGKALCDDGAQGKQVIVVPGAAGLEWPRLRYEGFKEVASACGAKLTPAAFRGEMS
FT                   LADGMAQTQDLLMRTPDAEYVFTPVTFLGIGAVRAARQANRPVKVLTSAMVKENEAMIR
FT                   EGRLLAVASEPGVIMGRLIVQYAIREHEGLPMPPLDKPTRSVPYPHFNVPITVVDKSNV
FT                   DTHPYAFYDYPPQGWSIETAR"
FT   misc_feature    188611..188712
FT                   /note="Signal peptide predicted for BPP2773 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 34 and 35"
FT   misc_feature    188770..189603
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar binding domain of the LacI family, score 1.9"
FT   CDS_pept        189798..190535
FT                   /transl_table=11
FT                   /locus_tag="BPP2774"
FT                   /product="putative exported protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6X0"
FT                   /protein_id="CAE38067.1"
FT                   /translation="MWTLLRNRLPALLLGFWLAAPAQAFDAFECDCAQQVGTCSATVRI
FT                   LKTGGSAPSYSAELLVQSSAPACSRVSYLIDQTPYTTVLTRRNQDTESTSGTSPIKAAN
FT                   VKVQGCAICARKSAFAANESAPAPDDSGASRAFSAGLAPGGFDPASKQAGFDAAVSGGR
FT                   ARDASFNSIISGLGAAAAITSAAAQARQAGAQQPPATPSRSGYSPQYDLRSAGPQGGGR
FT                   CPDPSAPGCPYHLGTYDPLGAPK"
FT   misc_feature    189798..189869
FT                   /note="Signal peptide predicted for BPP2774 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.992) with cleavage site
FT                   probability 0.794 between residues 24 and 25"
FT   CDS_pept        190532..191317
FT                   /transl_table=11
FT                   /locus_tag="BPP2775"
FT                   /product="Putative exported protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6W9"
FT                   /protein_id="CAE38068.1"
FT                   /translation="MTADRMRRLPGALMRLCALSCALLLAACAGAPPIPPQKDAAAGIF
FT                   PGERPKSPLAKVPAGPDVKAVAVLSENTLANAAWKRKIHDNARAMAQGKRFGDATIASA
FT                   GAELFDPDYPLAWVAASLKRYFGSVEQVSLAQLPQASGDVLAIVDVYAYPADDSVARIK
FT                   VAFFDRELRHIADASGEDAQHFNMWARTGGATAIAEGYRRENEVLMRALRKFDASLAQQ
FT                   VSGPPAQAAGGYDACLQRALVAQDPQLRVAAMAACDAAR"
FT   misc_feature    190532..190618
FT                   /note="Signal peptide predicted for BPP2775 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.447 between residues 29 and 30"
FT   misc_feature    190583..190615
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(191325..192227)
FT                   /transl_table=11
FT                   /locus_tag="BPP2776"
FT                   /product="Putative LysR-family transcriptional regulator"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   transcription regulator protein RSC2497 or RS01099
FT                   SWALL:Q8XWH7 (EMBL:AL646070) (321 aa) fasta scores: E():
FT                   5.6e-27, 34.42% id in 305 aa, and to Escherichia coli
FT                   transcriptional activator protein LysR or B2839
FT                   SWALL:LYSR_ECOLI (SWALL:P03030) (311 aa) fasta scores: E():
FT                   2.9e-14, 29.63% id in 270 aa"
FT                   /db_xref="GOA:Q7W6W8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6W8"
FT                   /protein_id="CAE38069.1"
FT                   /translation="MRLRHIEVFHAVMVGGSLSAAARLLNMTQPAVSQTMNSLELQLGF
FT                   ALFQRVKGRLAPTPEAHALHAEVEKLNSQLDAVKLMAVNLRQDGPARLRILAAPALAME
FT                   VVPDALAAFMADSPNARMTVKTGYSGDILAALLLRDADIGLVYRCAPQALIRQETVGRG
FT                   MLVCVAPADRYAGRDHVTLADLRDSAVFVPERRHPMGRRLAELCAGQALDADNHVEIEQ
FT                   FHVALKLATAGLGVALVDSLTALGADLRRVRILALRPEVGFEVCVAYPEFDAHPHLSHR
FT                   FARCVREVVAARQARMAPG"
FT   misc_feature    complement(191355..191972)
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 2.8e-24"
FT   misc_feature    complement(192042..192221)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 1.1e-19"
FT   misc_feature    complement(192087..192179)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   CDS_pept        192376..193398
FT                   /transl_table=11
FT                   /locus_tag="BPP2777"
FT                   /product="putative exported protein"
FT                   /note="Similar to Comamonas testosteroni OrfJ protein
FT                   SWALL:Q9RHM9 (EMBL:AB029044) (326 aa) fasta scores: E():
FT                   3.2e-39, 39.31% id in 323 aa, and to Pseudomonas putida,
FT                   and Pseudomonas sp. hypothetical 34.5 kDa protein in
FT                   clcB-clcD intergenic region precursor SWALL:YCLC_PSEPU
FT                   (SWALL:Q47100) (329 aa) fasta scores: E(): 7.7e-37, 38.78%
FT                   id in 312 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6W7"
FT                   /protein_id="CAE38070.1"
FT                   /translation="MIRTKGKTVMLRTMPAARRLFVQSTLAITGLLAAAAACAQPATDW
FT                   PTRPIELVVPYPAGGSSDVLGRLLAKPLGEILGQPVVVLNKSGAATAIGTTFVARAAPD
FT                   GYTLLLADSPLVVNAAVNPAVTYDPVKDFAPVGIIGTSPSFLYAPAGRVKDLDDFIAQA
FT                   KAHPGRLKAASAGAGTSTHLLLELMQHEAGISLNHIPYRGSAPALTDTVAGIVDGSFST
FT                   YASAQPFVASGKLQVLAMTAPQRLPAFPGVPTFAEAGMPGLTFLTWWGILGPDGLPQPI
FT                   VDKLQQALAQVMKDPAIGEQFVRLSVVAQAGEPQAFAQTLQRDLQRWRDIARAAGVSMQ
FT                   "
FT   misc_feature    192376..192492
FT                   /note="Signal peptide predicted for BPP2777 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.790 between residues 39 and 40"
FT   misc_feature    192568..193386
FT                   /note="HMMPfam hit to PF03401, Uncharacterized protein
FT                   family, UPF0065, score 3.5e-89"
FT   CDS_pept        193464..194447
FT                   /transl_table=11
FT                   /locus_tag="BPP2778"
FT                   /product="Putative agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="Similar to Streptomyces coelicolor agmatinase SpeB
FT                   or SCC105.01c SWALL:Q9L083 (EMBL:AL163641) (302 aa) fasta
FT                   scores: E(): 6.9e-38, 40.14% id in 284 aa, and to
FT                   Streptomyces clavuligerus possible agmatinase Pah
FT                   SWALL:SPEB_STRCL (SWALL:P37819) (313 aa) fasta scores: E():
FT                   1.1e-31, 35.73% id in 291 aa"
FT                   /db_xref="GOA:Q7W6W6"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6W6"
FT                   /protein_id="CAE38071.1"
FT                   /translation="MPSPSALHDLCDTPPTFMGVPHRHAIDGARAAILGIPFDCGTHAF
FT                   RIGARQGPQSIREQSRLMRTFNPELADYNPLQRLGVIDCGNVRVVPSDILDAFERIEQA
FT                   VGAIVDGGAVPVTMGGDGSVSLPQLRAVGKRHPGLAVIHLDSHTDTNTFVKGKEYNAGT
FT                   QFTHAALEGRVDTSLAFHIGTRGTTFTQHVFRHARHFGYQIIPLNELLARGMAEVLQDL
FT                   RARLGERPVYLCLDMDVLDPSCAPGVCAPSWGGLSAREAIAFLRGLAGLNIVAIDVNTV
FT                   SPPHDVNGTTASLAAALMVEGLVLLCKRLGLDHPDPAPDFAAMYAR"
FT   misc_feature    193542..194393
FT                   /note="HMMPfam hit to PF00491, Arginase family, score
FT                   2.1e-32"
FT   misc_feature    193884..193910
FT                   /note="PS00148 Arginase family signature 2."
FT   CDS_pept        194559..195593
FT                   /transl_table=11
FT                   /locus_tag="BPP2779"
FT                   /product="Putative secreted protein"
FT                   /note="Similar to Ralstonia solanacearum putative signal
FT                   peptide protein RSC2510 or RS01072 SWALL:Q8XWG4
FT                   (EMBL:AL646070) (338 aa) fasta scores: E(): 5.4e-23, 29.96%
FT                   id in 327 aa, and to Mycobacterium smegmatis putative C4
FT                   decarboxylate binding protein SWALL:Q938B9 (EMBL:AY054120)
FT                   (353 aa) fasta scores: E(): 9.9e-16, 27.54% id in 334 aa"
FT                   /db_xref="GOA:Q7W6W5"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6W5"
FT                   /protein_id="CAE38072.1"
FT                   /translation="MSAAVRFLLRAALGACALTAAATAHAQQRWDMSLAWPAGNFHSRN
FT                   AEAFAAKVREATGGQVLITVHAGGELNVKGPDTLMAVESGIVQVADMLVSQQAGVEPLL
FT                   GMDALPGLIAGQDDMKTFLRHARPVYDRIAAAHNQRILYAVPWPSPGLFSRKALSTPED
FT                   MKGQKLRAHDKAAYEFMAQLGAAPTQMPWGEVVPALAAGTIDGVGTSASSGVDGKFWEF
FT                   TPHFLPLNWATSLSLVTVNLDAWDKLSAAQQQAVQAAAAELEPRFWQISAAQDEKDLAI
FT                   LREHKVAIATPSEALGARVAAVGRPMWDAFARQAGPAGAPAARRLSARPQAALSEPPWT
FT                   ACYA"
FT   misc_feature    194559..194636
FT                   /note="Signal peptide predicted for BPP2779 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.967 between residues 26 and 27"
FT   misc_feature    194652..195503
FT                   /note="HMMPfam hit to PF03480, Bacterial extracellular
FT                   solute-binding protein, family 7, score 5.1e-31"
FT   CDS_pept        195572..196078
FT                   /transl_table=11
FT                   /locus_tag="BPP2780"
FT                   /product="Putative membrane protein"
FT                   /note="No significant database matches"
FT                   /db_xref="GOA:Q7W6W4"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6W4"
FT                   /protein_id="CAE38073.1"
FT                   /translation="MDRLLRLIDALCAGAEHLAIALLYGIAALMLAEVGARAMGRSIPF
FT                   SWEYCAYGMAAAFFLGMGATLRHGAHIRVLFLRDALPARPARLLDIAASCAGLALSAVI
FT                   VVALARLTGKSIARGLVSNTVMQTPLAIPQAVVLAGAALLALAFVARQLTGRPAETDGG
FT                   RAAGH"
FT   misc_feature    join(195608..195676,195704..195772,195833..195901,
FT                   195959..196018)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BPP2780 by TMHMM2.0 at aa 13-35, 45-67, 88-110 and 130-149"
FT   misc_feature    195719..195763
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        196098..197384
FT                   /transl_table=11
FT                   /locus_tag="BPP2781"
FT                   /product="Putative membrane protein"
FT                   /note="Similar to Agrobacterium tumefaciens putative
FT                   transmembrane protein DctM SWALL:Q9F7C8 (EMBL:AF282677)
FT                   (416 aa) fasta scores: E(): 2e-49, 36.67% id in 409 aa, and
FT                   to Wolinella succinogenes large integral C4-dicarboxylate
FT                   membrane transport protein, putative DctM SWALL:Q9ZEJ2
FT                   (EMBL:AJ132740) (415 aa) fasta scores: E(): 3.7e-40, 33.49%
FT                   id in 415 aa"
FT                   /db_xref="GOA:Q7W6W3"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6W3"
FT                   /protein_id="CAE38074.1"
FT                   /translation="MIAITVVTAALLLLFLGASIWVSLSLFGAAYFLLLLFKPNLPLDV
FT                   LAGQIVWTASTSQELLSLPLFVLMGEVLAKTSVGRSLFAGLAPWVGRLPGGLTHVNVLG
FT                   CTLFAAICGSSVATTQIVGRVTLPELQQRGYDARLSIGSLAGAGTLGFLIPPSLIMIVY
FT                   GVLAEQSIVELFIAGVLPGLGLAAVYMAYIALRAQRPDDAGPGYTLRERIAALAQILPV
FT                   IGLIAAIMGALYLGIAGPSEVAAVGVLGALAIGLLQRSLTRASLVAVGRSAVRTCSMIG
FT                   LILAGAALISVAMSYLGLPKYVAARIGELGLSPLLLIALLLLFYVVLGMFLDGTSIIVL
FT                   TLPIALPLVVAAGYDAIWFGIFLVVVVEMAQITPPVGFNLFVIQSITGRSLSFVARATL
FT                   PFFLLLLAWAMALAVWPEIVLWLPGTLRN"
FT   misc_feature    196098..196181
FT                   /note="Signal peptide predicted for BPP2781 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.915 between residues 28 and 29"
FT   misc_feature    join(196131..196199,196383..196451,196512..196580,
FT                   196608..196676,196734..196802,196815..196868,
FT                   196929..196997,197025..197093,197106..197159,
FT                   197169..197237,197274..197342)
FT                   /note="11 probable transmembrane helices predicted for
FT                   BPP2781 by TMHMM2.0 at aa 12-34, 96-118, 139-161, 171-193,
FT                   213-235, 240-257, 278-300, 310-332, 337-354, 358-380 and
FT                   393-415"
FT   CDS_pept        197390..198133
FT                   /transl_table=11
FT                   /locus_tag="BPP2782"
FT                   /product="Putative transcriptional regulator"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   transcriptional regulator SCO6256 or SCAH10.21 SWALL:Q9RKT6
FT                   (EMBL:AL132824) (245 aa) fasta scores: E(): 8.4e-08, 28.51%
FT                   id in 242 aa, and to Streptomyces griseus GntR-family
FT                   transcriptional regulator DasR SWALL:Q8VV01 (EMBL:AB061860)
FT                   (253 aa) fasta scores: E(): 1.5e-06, 27.03% id in 233 aa"
FT                   /db_xref="GOA:Q7W6W2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6W2"
FT                   /protein_id="CAE38075.1"
FT                   /translation="MPAMTDSDKKTPLYRRVAQDLMGDIATMPVGSILPTEVELAARLG
FT                   VSRATIRDAMEILVEHRMVERVKRLGTRILRNTPGHRYVQHMDGLAHALEFAGQSLMRI
FT                   DDTAIVEGSGGEPGLAALPNATGQWLRVTGTRRLVDDDAPSTWTRVFVPGRYQGIAPLL
FT                   HGELDSVYAVIERVYSLKVARLRHRVTAVALPGYASGALGLPAGAPVLQVSAWLHEADG
FT                   ALVEYVRSLHHPEKVSIDFSAAQSS"
FT   misc_feature    197438..197611
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 1.4e-10"
FT   misc_feature    197489..197563
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT   CDS_pept        198187..198876
FT                   /transl_table=11
FT                   /locus_tag="BPP2783"
FT                   /product="carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="Similar to Caulobacter crescentus
FT                   carboxymethylenebutenolidase CC3758 SWALL:Q9A213
FT                   (EMBL:AE006033) (231 aa) fasta scores: E(): 2.6e-35, 46.93%
FT                   id in 228 aa, and to Pseudomonas putida, and Pseudomonas
FT                   sp. carboxymethylenebutenolidase ClcD SWALL:CLCD_PSEPU
FT                   (SWALL:P11453) (236 aa) fasta scores: E(): 5.3e-27, 41.25%
FT                   id in 223 aa"
FT                   /db_xref="GOA:Q7W6W1"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6W1"
FT                   /protein_id="CAE38076.1"
FT                   /translation="MTMITLKTRDGQTFEAYHAPAPTAGAPGLVLIQEIFGINPAMRAA
FT                   ADQWARLGFDVLCPDLFWRQEPGVQLDPTSEADFGQAVRLMQAMDENQAIADLDTARAW
FT                   LAERSGGKVAGLGYCLGGRLAVRLTMDTPVQCAVSYYGVMLDQLLPTVDAQAAPTLLHV
FT                   AEQDRFVPPEARAVILEAAGKLPQCEAHVYEGCDHAFARPGGEHWDAAAAALAEERSVA
FT                   FMQRHLA"
FT   misc_feature    198226..198870
FT                   /note="HMMPfam hit to PF01738, Dienelactone hydrolase
FT                   family, score 2.8e-56"
FT   CDS_pept        198888..199667
FT                   /transl_table=11
FT                   /locus_tag="BPP2784"
FT                   /product="Putative dehydrogenase"
FT                   /note="Similar to Rhizobium loti probable dehydrogenase
FT                   MLR7106 SWALL:Q987C7 (EMBL:AP003011) (257 aa) fasta scores:
FT                   E(): 9.6e-26, 42.35% id in 255 aa, and to Agrobacterium
FT                   tumefaciens 2-deoxy-D-gluconate 3-dehydrogenase KduD or
FT                   ATU6062 or AGR_PTI_126 SWALL:AAL46298 (EMBL:AE009425) (256
FT                   aa) fasta scores: E(): 2.5e-24, 41.44% id in 263 aa"
FT                   /db_xref="GOA:Q7W6W0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6W0"
FT                   /protein_id="CAE38077.1"
FT                   /translation="MTAVPSIAPVLDLSGRSAVVTGAGAGIGRAAALRLAQAGAAVAVI
FT                   DINGEAAHDTCARIAALGGAAAAYAISVTDQDALLAAARDAQERLGPCGVLVNNAGVLL
FT                   RSAFDDPRARDFWAATLDVNLNGPYLAAQAFYPQLRATRGCIVNIASIHSFVAVKNSAA
FT                   YTASKGGIKQMTQALALELGADGIRVNAVAPGLTVTDMTRATVADPEGLTRFLARVPLA
FT                   RPGSVDDVVNAICFLASDWAAYITGVTLPVDGGYVAN"
FT   misc_feature    198927..199655
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 5e-73"
FT   misc_feature    199338..199424
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   CDS_pept        complement(199678..200478)
FT                   /transl_table=11
FT                   /locus_tag="BPP2785"
FT                   /product="Putative transcriptional regulator"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   transcription regulator protein RSC3411 or RS01720
FT                   SWALL:Q8XTY4 (EMBL:AL646075) (262 aa) fasta scores: E():
FT                   1.4e-52, 54.75% id in 263 aa, and to Escherichia coli
FT                   transcriptional regulator KdgR or B1827 SWALL:KDGR_ECOLI
FT                   (SWALL:P76268) (263 aa) fasta scores: E(): 5.2e-16, 31.27%
FT                   id in 243 aa"
FT                   /db_xref="GOA:Q7W6V9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6V9"
FT                   /protein_id="CAE38078.1"
FT                   /translation="MRMLDYDEELASNAMFNQSFAKGLKALFAFQGHQSAMSLSELAAR
FT                   LDASISSVQRTVFTLERLGLISKSPKTRKYSLTLRVLELGCNYITADALVEAANPFLAE
FT                   LSNITGETVNLTEPLEREMVYVSRVVAAKFIPIHMPIGSRIPMYCTASGRAYLSALDDA
FT                   RVQAILDGSTLKRHTPWTETDPARLRALIEQARVSGVAHNKEELFLGDMTLAAPIVGGR
FT                   GAPVACVHIVAPTSRWTQEEAFARLAPPLRDCARGIANAVRAFT"
FT   misc_feature    complement(199696..200256)
FT                   /note="HMMPfam hit to PF01614, Bacterial transcriptional
FT                   regulator, score 3.5e-45"
FT   misc_feature    complement(200281..200310)
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT   CDS_pept        join(200621..200833,200833..201675)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2786"
FT                   /product="Putative ABC transporter, ATP-binding protein
FT                   (pseudogene)"
FT                   /note="Similar to Rhizobium meliloti probable ATP-binding
FT                   ABC transporter protein R02243 or SMC01631 SWALL:Q92NG2
FT                   (EMBL:AL591790) (359 aa) fasta scores: E(): 1.4e-36, 46.24%
FT                   id in 346 aa, and to Deinococcus radiodurans
FT                   spermidine/putrescine ABC transporter, ATP-binding protein
FT                   DR1302 SWALL:Q9RUT0 (EMBL:AE001977) (362 aa) fasta scores:
FT                   E(): 1.5e-33, 49.68% id in 320 aa"
FT                   /db_xref="PSEUDO:CAE38079.1"
FT   misc_feature    join(200732..200833,200833..201243)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.2e-58"
FT   misc_feature    200753..200776
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        201701..202753
FT                   /transl_table=11
FT                   /locus_tag="BPP2787"
FT                   /product="putative ABC transporter, periplasmic
FT                   solute-binding protein"
FT                   /note="Similar to Rhizobium meliloti putative ABC
FT                   transporter, periplasmic solute-binding protein Ra0969 or
FT                   Sma1755 SWALL:Q92YB5 (EMBL:AE007283) (350 aa) fasta scores:
FT                   E(): 9.2e-12, 29.06% id in 320 aa, and to Rhizobium
FT                   meliloti putative spermidine/putrescine-binding periplasmic
FT                   ABC transporter protein R02500 or Smc01966 SWALL:Q92MV9
FT                   (EMBL:AL591790) (359 aa) fasta scores: E(): 1.3e-12, 26.94%
FT                   id in 334 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6V8"
FT                   /protein_id="CAE38080.1"
FT                   /translation="MNITQRFAKWALAASMLGASAAVPAQDITMATWGGGVGKAWREAY
FT                   AEPFMKASKLEVKIVEVPTPEAQVRAQKGAPKFNAVLSSLFEAAQMYEDGLLEDFDMAD
FT                   FPALKNMPDKYLLKAPNGRLIGVSTYFAYYGIAVNTDLAKPADFASWKNLADPKWAGKL
FT                   SVTRPVYSSAYDLTIMSVAEGGSERDTAKGLELLTALGKNALTMYSSMAQMNQLLQRGE
FT                   VAAAPYYSTRIWQMQRDGQRNVELVVPKEGALMLPYLVVVPKGAQGREHYMKWLEYVGQ
FT                   PEGQQRIAEIAGYMPLNSQARLSPAAEKELGQPLDKLRDQLYQPDWNLIAKTRKTRIEA
FT                   VERAMAGAAR"
FT   misc_feature    201701..201775
FT                   /note="Signal peptide predicted for BPP2787 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.774 between residues 25 and 26"
FT   misc_feature    201800..202747
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding protein, score 6.1e-07"
FT   CDS_pept        202764..203603
FT                   /transl_table=11
FT                   /locus_tag="BPP2788"
FT                   /product="ABC transporter permease protein"
FT                   /note="Similar to Escherichia coli putrescine transport
FT                   system permease protein PotH or B0856 SWALL:POTH_ECOLI
FT                   (SWALL:P31135) (317 aa) fasta scores: E(): 6.8e-29, 36.55%
FT                   id in 238 aa, and to Rhizobium loti ABC transporter,
FT                   permease Mlr6080 SWALL:Q98AB1 (EMBL:AP003008) (592 aa)
FT                   fasta scores: E(): 5.8e-31, 38.91% id in 257 aa"
FT                   /db_xref="GOA:Q7W6V7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6V7"
FT                   /protein_id="CAE38081.1"
FT                   /translation="MMRAIRPPLLLLAPPALLVALFVVGVGYLVVESLHTGAGWGLDNF
FT                   VRFFERPDYVAVLVRTIVIAVAVTACAALVGYPIAYAIARYRGNRNFLMMLVIMPWLVS
FT                   VVVRTYGWMVILGPRGTLNSMLLSAGVIDTPLRLIFNMTGVVIGLVHVFCPFFIVSVLA
FT                   VLLYLDRSLDEASQTLSAGPFKTFWHVTLPLSMPGVITGAMLVYLLSTGAIVTPLLLGG
FT                   VRDGMLATQIYQDVLQVFDYPKAASMAVVLLLTAFTLVIPLQWLERRVAARVSGRGA"
FT   misc_feature    202764..202838
FT                   /note="Signal peptide predicted for BPP2788 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.967) with cleavage site
FT                   probability 0.803 between residues 25 and 26"
FT   misc_feature    join(202788..202856,202932..203000,203037..203105,
FT                   203196..203264,203322..203390,203496..203564)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPP2788 by TMHMM2.0 at aa 9-31, 57-79, 92-114, 145-167,
FT                   187-209 and 245-267"
FT   misc_feature    203253..203462
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 7e-11"
FT   CDS_pept        203605..204399
FT                   /transl_table=11
FT                   /locus_tag="BPP2789"
FT                   /product="ABC transporter permease protein"
FT                   /note="Similar to Pseudomonas aeruginosa probable permease
FT                   of ABC transporter Pa0606 SWALL:Q9I5T2 (EMBL:AE004497) (276
FT                   aa) fasta scores: E(): 1.1e-26, 37.34% id in 249 aa, and to
FT                   Agrobacterium tumefaciens ABC transporter, membrane
FT                   spanning protein Atu4245 or Agr_l_1232 SWALL:AAL45039
FT                   (EMBL:AE009353) (266 aa) fasta scores: E(): 4.1e-27, 37.44%
FT                   id in 243 aa"
FT                   /db_xref="GOA:Q7W6V6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6V6"
FT                   /protein_id="CAE38082.1"
FT                   /translation="MKTARLLLLCLLFGFLPLSIVIVAISSFTQSGYFSVPLDALSLRW
FT                   YVEFFTDWQWISLLLLVSAAVALGVALISTTAALLAALVLARRRFAGSGLLETLIMLPL
FT                   VFPNAALGVAFLGVLGLLGIGGTYLGIVLAHCIITLPFAYRPILNALRKLDPALEEASM
FT                   SLSATPLQVLRTVTLPMLRPGLITAFLFCFIVSFDEATVTIFLIAPDVNTLPVRILTQI
FT                   QESASPVIAVIATFLILFTLSLVLLLERTVGLELFAAPQRER"
FT   misc_feature    203605..203691
FT                   /note="Signal peptide predicted for BPP2789 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.419 between residues 29 and 30"
FT   misc_feature    join(203623..203691,203767..203862,203899..203967,
FT                   203980..204048,204154..204222,204280..204348)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPP2789 by TMHMM2.0 at aa 7-29, 55-86, 99-121, 126-148,
FT                   184-206 and 226-248"
FT   misc_feature    204052..204273
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 1.3e-11"
FT   CDS_pept        204426..204737
FT                   /transl_table=11
FT                   /gene="dmfA1"
FT                   /locus_tag="BPP2790"
FT                   /product="small subunit of N,N-dimethylformamidase"
FT                   /note="Similar to Alcaligenes sp. KUFA-1 small subunit of
FT                   N,N-dimethylformamidase DmfA1 SWALL:Q9LCC1 (EMBL:AB028874)
FT                   (132 aa) fasta scores: E(): 1.4, 37.28% id in 59 aa"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6V5"
FT                   /protein_id="CAE38083.1"
FT                   /translation="MYEIQPEDAELLRHFRTTTTKTRPLKLNRLLNRLRMEPMAGKQVI
FT                   VCTRPYSEYAIGTLGERRGDPVALHAERYATLAEAQWAILKIRWAIHSPYPWPVVGLD"
FT   CDS_pept        join(204794..205363,205367..205546,205546..207018)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="dmfA2"
FT                   /locus_tag="BPP2791"
FT                   /product="large subunit of N,N-dimethylformamidase
FT                   (pseudogene)"
FT                   /note="Similar to Alcaligenes sp. KUFA-1 large subunit of
FT                   N,N-dimethylformamidase dmfa2 SWALL:Q9LCC0 (EMBL:AB028874)
FT                   (762 aa) fasta scores: E(): 3.2e-69, 36.53% id in 761 aa"
FT                   /db_xref="PSEUDO:CAE38084.1"
FT   CDS_pept        207026..207838
FT                   /transl_table=11
FT                   /locus_tag="BPP2793"
FT                   /product="hypothetical protein"
FT                   /note="The N-terminal region of this CDS is similar to
FT                   putative oxidoreductases. The C-terminal region is similar
FT                   to biotin carboxylase subunit of acetyl-CoA carboxylase.
FT                   This hybride CDS resulted from a large deletion event."
FT                   /db_xref="GOA:Q7W6V4"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6V4"
FT                   /protein_id="CAE38085.1"
FT                   /translation="MPPPLPYDAMRSVWTDTAAPAMATAPLAGHADCDVAIVGAGITGL
FT                   SAALHLAERGLRACVLEARDPGWGASGRNGGQVIPGIKHDPDEILARHGRERGEPLLHM
FT                   VGTAADTVFDLIDRYGLDLVQAQIRLAAGERLDRVVPADLQPSGHAIELRVYAEDPVRF
FT                   IPSPGTLAVFELPQGPGVRTETGYHAGNAVSPHYDPMIAKIIVHGADRAQAIARAEQAL
FT                   ADTEIAGVKTNLPFLARALAFEPWRQGRLHTGIVARTLAEPAPAALTA"
FT   variation       207389..207391
FT                   /note="large deletion around this codon relative to
FT                   bronchiseptica"
FT   misc_feature    207479..207796
FT                   /note="HMMPfam hit to PF02785, Biotin carboxylase
FT                   C-terminal domain, score 1.8e-46"
FT   CDS_pept        207859..208083
FT                   /transl_table=11
FT                   /gene="madF"
FT                   /locus_tag="BPP2794"
FT                   /product="biotin protein"
FT                   /note="Similar to Malonomonas rubra biotin protein MadF
FT                   SWALL:O06930 (EMBL:U87980) (69 aa) fasta scores: E():
FT                   0.0032, 31.42% id in 70 aa, and to Bacillus halodurans
FT                   hypothetical protein Bh1133 SWALL:Q9KDS8 (EMBL:AP001511)
FT                   (70 aa) fasta scores: E(): 2.4e-06, 42.64% id in 68 aa"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6V3"
FT                   /protein_id="CAE38086.1"
FT                   /translation="MKKIPVKSEVTGNVWEVLKAGDNRVEEGETLIVVESMKMEIPVDA
FT                   PAAGRLVEITVQKGDAIGEGDVVAMLEVQ"
FT   CDS_pept        208130..209341
FT                   /transl_table=11
FT                   /locus_tag="BPP2795"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein Rsc1197 or Rs05729 SWALL:Q8Y047 (EMBL:AL646063)
FT                   (405 aa) fasta scores: E(): 5.4e-65, 48.73% id in 394 aa,
FT                   and to Caulobacter crescentus hypothetical protein Cc3562
FT                   SWALL:Q9A2J9 (EMBL:AE006014) (433 aa) fasta scores: E():
FT                   2.4e-70, 46.4% id in 403 aa"
FT                   /db_xref="GOA:Q7W6V2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6V2"
FT                   /protein_id="CAE38087.1"
FT                   /translation="MTQPAAGAGPLAGYTVLELGSTIAGPFCGRLLADFGARVIKVEAT
FT                   EGDALRSMGRHKGGHSLYALSLLRNKELVSIDLRQPDGQELVRELAARADILIENFRPG
FT                   ALEKWNLGYDVLSRANPGLVMVRISGYGQDGPYSGRPGYGVIGEAHSGLRSVTGDPDRP
FT                   PSRVATSLSDYITGLYGAFGALLALESRRRTGRGQVVDTALAECAFSFMEPHVMAYDQL
FT                   REVANRAGSRLPGSAPNNLYRCADGAYVHVTTLTNALFRRLAAALDAPELADDPRFAEP
FT                   GQRARHDAELDAAIQDWFSRHDCPTVLARLTQAEIPHAKIYGVDDVFADPHFQARGALA
FT                   RLPHPQLGEVTVPNVVPRLSETPGAVRSLGKDAGADTLAVLRDELGLDATRLDALRQRG
FT                   AIRA"
FT   misc_feature    208349..208918
FT                   /note="HMMPfam hit to PF02515, CAIB/BAIF family, score
FT                   1.3e-71"
FT   repeat_region   209370..209398
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS1002 element"
FT   repeat_region   209370..210410
FT                   /note="IS1002 insertion sequence"
FT   CDS_pept        209460..210410
FT                   /transl_table=11
FT                   /locus_tag="BPP2796"
FT                   /product="transposase for IS1002"
FT                   /note="transposase for IS1002 element"
FT                   /db_xref="GOA:Q7W6V1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6V1"
FT                   /protein_id="CAE38088.1"
FT                   /translation="MNNHKHARLTRLGRALLVNRVMQQNWTMRQASQAAGVSLRTGYKW
FT                   LARFRSEGLDGLLDRSSRPHRSPKACAPEQVEHFAQQRRQRLPLWRIAREAGRSLATVA
FT                   RYMERIGLSRLASLEPPAPVRRYERASPGELLHIDTKRLGRIRGVGHRITGDRAQNRNR
FT                   GIGWDAVHLAIDDFSRVSFARILDDEGGDQCAEFLHQATAYYASLGVRIDRVMTDNGSG
FT                   YVSRTFRAVCVELGIRHIRTRPYTPKTNGKAERLVQTCLREWAYARPYTSSAERQAALQ
FT                   PFIDRYNWCRPHSALGHQPPITRIPDVNNLLRIDI"
FT   misc_feature    209841..210377
FT                   /note="HMMPfam hit to PF00665, Integrase core domain, score
FT                   6.3e-30"
FT   repeat_region   complement(210382..210410)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS1002 element"
FT   CDS_pept        210612..210890
FT                   /transl_table=11
FT                   /locus_tag="BPP2797"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6V0"
FT                   /protein_id="CAE38089.1"
FT                   /translation="MCCAARSTSKAVAHMERIIGSIEQACAIARRWAIRTGNKEATCAA
FT                   LAAAWYEAQAARPPTSAALLAHLAARIQESRQRVAVPRPAPIPPAED"
FT   CDS_pept        211125..211568
FT                   /transl_table=11
FT                   /locus_tag="BPP2798"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Vibrio cholerae hypothetical protein
FT                   Vca1019 SWALL:Q9KKT1 (EMBL:AE004428) (148 aa) fasta scores:
FT                   E(): 2.1e-06, 33.07% id in 130 aa, and to Mycobacterium
FT                   leprae putative integral membrane protein Ml0956
FT                   SWALL:Q9CCC8 (EMBL:AL583920) (169 aa) fasta scores: E():
FT                   0.00026, 26.81% id in 138 aa"
FT                   /db_xref="GOA:Q7W6U9"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6U9"
FT                   /protein_id="CAE38090.1"
FT                   /translation="MPAREIQLTLIRVYIGLDFTHHFAEKFGLLGAQAYADVLHYFSTV
FT                   TANPQSMLLLAGLCEFAAFIGFTFGLFTRVAAAGTAAYLVIALFIGNHQHLGFTWANPG
FT                   GGWEFPAMWAFICLSFVLSGGGRWSLDRLLLPRLPAALRWLSR"
FT   misc_feature    join(211272..211340,211359..211427,211455..211514)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BPP2798 by TMHMM2.0 at aa 110-132, 139-161 and 171-190"
FT   CDS_pept        211724..213298
FT                   /transl_table=11
FT                   /gene="lysP"
FT                   /gene_synonym="cadR"
FT                   /locus_tag="BPP2799"
FT                   /product="lysine-specific permease"
FT                   /note="Similar to Escherichia coli lysine-specific permease
FT                   LysP or CadR or B2156 SWALL:LYSP_ECOLI (SWALL:P25737) (488
FT                   aa) fasta scores: E(): 5.9e-141, 72.91% id in 480 aa, and
FT                   to Yersinia pestis putative lysine-specific permease LysP
FT                   or Ypo1309 SWALL:Q8ZGI8 (EMBL:AJ414147) (503 aa) fasta
FT                   scores: E(): 3.7e-140, 71.07% id in 491 aa"
FT                   /db_xref="GOA:Q7W6U8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6U8"
FT                   /protein_id="CAE38091.1"
FT                   /translation="MAPPGHVVPSPANGHRHDARPATRLPEPTSLRRTLSARHLTMIAV
FT                   GGSIGTGLFVASGATIAQAGPGGALLAYLLVGIMVYFLMTSLDELAASMPVAGSFSTYG
FT                   AKYVDEGFGFALGWNYWYNWAVTVAVDLVAAQLVMAYWFPEMPGVLWSAAFLALIVGLN
FT                   ALSARGFGEAEFWFALIKVIAVLAFIAMGVLMLLGIIRGGEHGGLAYWTLDDAPFAGGF
FT                   AALIGVAMVVGFSFQGTELIGIAAGESKDPARNLPRAVRQVFWRILLFYVLAIAVIGLL
FT                   IPYTDPQLLRNEVSDVSVSPFALIFERAGLLAAASIMNAVVLTSVLSAGNSGMYAATRM
FT                   LYSLARDGKAPARFGRLSRSGVPLWALLATTAVAALCFLSFLFSPKAVYIWLLNTSGMT
FT                   GFIAWLGIAISHYRFRRGYVAQGNNLADLPYVSPFFPFGPLFAFVLCLVITLGQNYHAF
FT                   LQDRIDWTGAAATYVGIPLFLAIWAGYRLVRGSRFVRYRDMQFPDLRMRNRELNAMLSG
FT                   DCAEPRR"
FT   misc_feature    211814..213193
FT                   /note="HMMPfam hit to PF00324, Amino acid permease, score
FT                   3.4e-225"
FT   misc_feature    join(211841..211909,211922..211975,212084..212152,
FT                   212165..212233,212252..212320,212378..212431,
FT                   212510..212578,212648..212716,212804..212872,
FT                   212882..212950,213011..213079,213122..213190)
FT                   /note="12 probable transmembrane helices predicted for
FT                   BPP2799 by TMHMM2.0 at aa 40-62, 67-84, 121-143, 148-170,
FT                   177-199, 219-236, 263-285, 309-331, 361-383, 387-409,
FT                   430-452 and 467-489"
FT   CDS_pept        complement(213338..214069)
FT                   /transl_table=11
FT                   /locus_tag="BPP2800"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Synechocystis sp. hypothetical protein
FT                   Slr0841 SWALL:Q55426 (EMBL:D64003) (291 aa) fasta scores:
FT                   E(): 0.14, 26.28% id in 175 aa"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR025485"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6U7"
FT                   /protein_id="CAE38092.1"
FT                   /translation="MPARSSTAAAQPATLTTHTWRLAAAVDRQGQPIAPLQIGLERPLR
FT                   LAFSERAINISGGCNAQFGGYTYGKGRLEIANLAATMKACEAGLMALDAAVGERLKGSL
FT                   RATLGEQAGQPRLVLVADNGDTLSFDGEPTPETLYGSKGETVFLEVAAQRVQCSHPMIP
FT                   QHRCLQVRERRYDAAGLQLPAQDDWRPLYQSVQGYEHRDGVRTVLRTKRYEWKNPPADA
FT                   PSTVYVLDMVVEQEMAPGGKR"
FT   misc_feature    complement(213707..214072)
FT                   /note="HMMPfam hit to PF03724, Domain of unknown function
FT                   (306), score 2.5e-10"
FT   CDS_pept        214322..214546
FT                   /transl_table=11
FT                   /locus_tag="BPP2801"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical
FT                   protein Sco5609 or Sc2e1.26C SWALL:O69897 (EMBL:AL023797)
FT                   (65 aa) fasta scores: E(): 1.1, 42.55% id in 47 aa"
FT                   /db_xref="GOA:Q7W6U6"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6U6"
FT                   /protein_id="CAE38093.1"
FT                   /translation="MSRFRSTFWRCAFVLAFLASALVAGWLRQAAPSWGHALLYGAMVG
FT                   GIVLCLALLFDDLAWWGTRLVQALKRMRP"
FT   misc_feature    join(214337..214405,214418..214486)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP2801 by TMHMM2.0 at aa 33-55 and 60-82"
FT   CDS_pept        complement(join(214568..214798,214800..215549))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2802"
FT                   /product="putative exported protein (pseudogene)"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Ra1058 or Sma1927 SWALL:Q92Y30 (EMBL:AE007292) (330 aa)
FT                   fasta scores: E(): 7.7e-41, 38.03% id in 326 aa, and to
FT                   Comamonas testosteroni OrfJ protein SWALL:Q9RHM9
FT                   (EMBL:AB029044) (326 aa) fasta scores: E(): 3e-37, 38.55%
FT                   id in 319 aa"
FT                   /db_xref="PSEUDO:CAE38094.1"
FT   misc_feature    complement(join(214580..214792,214797..215384))
FT                   /note="HMMPfam hit to PF03401, Uncharacterized protein
FT                   family, UPF0065, score 9.9e-105"
FT   misc_feature    complement(215454..215549)
FT                   /note="Signal peptide predicted for BPP2802 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.659 between residues 32 and 33"
FT   CDS_pept        complement(215562..216488)
FT                   /transl_table=11
FT                   /gene="hmgL"
FT                   /locus_tag="BPP2803"
FT                   /product="hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /note="Similar to Rhodospirillum rubrum
FT                   hydroxymethylglutaryl-CoA lyase HmgL SWALL:P95639
FT                   (EMBL:U41280) (303 aa) fasta scores: E(): 3.2e-39, 43.91%
FT                   id in 296 aa, and to Bacillus halodurans
FT                   hydroxymethylglutaryl-CoA lyase Bh1134 SWALL:Q9KDS7
FT                   (EMBL:AP001511) (303 aa) fasta scores: E(): 2.1e-41, 41.13%
FT                   id in 299 aa"
FT                   /db_xref="GOA:Q7W6U5"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6U5"
FT                   /protein_id="CAE38095.1"
FT                   /translation="MQERIHITDVSPRDGLQNQPAQVPTQEKLRLIRLLAEAGVRSVEA
FT                   TSFVSPRAVPQMADAAELVAQVHAALPDLRTSVLVPNLKGLERALAAGAREIAVVLSAT
FT                   ETMNRKNINMGLAQAVSVSEQTLAAARGAGLRTRAYVAVAFDCPFEGATPLADVLRLAA
FT                   AMYAAGADEIVIADTIGSAAPGEVKTRLRALRDVAPLERLAVHFHDTRGMGVANAWAAL
FT                   EAGVRRFDASVGGIGGCPFAPGAAGNLATEDLVLMAERSGFASGISLDGLLRAVDAAQA
FT                   QLQRPLGGRSMAWLRRQAGSAVRVQQP"
FT   misc_feature    complement(215622..216458)
FT                   /note="HMMPfam hit to PF00682, HMGL-like, score 2.4e-66"
FT   CDS_pept        complement(216493..217689)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2804"
FT                   /product="conserved hypothetical protein (pseudogene)"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa0446 SWALL:Q9I672 (EMBL:AE004482) (407 aa) fasta
FT                   scores: E(): 3.7e-54, 40.29% id in 407 aa, and to Ralstonia
FT                   solanacearum putative transmembrane protein Rsc0796 or
FT                   Rs05041 SWALL:Q8Y194 (EMBL:AL646061) (420 aa) fasta scores:
FT                   E(): 4.4e-58, 43.73% id in 407 aa"
FT   variation       complement(216493..216495)
FT                   /note="This is the stop codon (TGA) in bronchiseptica; TGG
FT                   in parapertussis"
FT   misc_feature    complement(216910..217476)
FT                   /note="HMMPfam hit to PF02515, CAIB/BAIF family, score
FT                   8.3e-80"
FT   CDS_pept        217861..219789
FT                   /transl_table=11
FT                   /gene="prpR"
FT                   /locus_tag="BPP2805"
FT                   /product="propionate catabolism operon regulatory protein"
FT                   /note="Similar to Salmonella typhimurium propionate
FT                   catabolism operon regulatory protein PrpR or Stm0367
FT                   SWALL:PRPR_SALTY (SWALL:P74839) (541 aa) fasta scores: E():
FT                   5.1e-47, 35.59% id in 635 aa, and to Pseudomonas aeruginosa
FT                   propionate catabolism operon regulator PrpR SWALL:Q9APX8
FT                   (EMBL:AF241171) (650 aa) fasta scores: E(): 5.5e-85, 44.66%
FT                   id in 609 aa"
FT                   /db_xref="GOA:Q7W6U4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR012704"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6U4"
FT                   /protein_id="CAE38097.1"
FT                   /translation="MPALSAAQPLPRLCFVSYRQIREFAAPVIAEYRNRAAIDVVDGTF
FT                   ADALAVARDRIERNAVDAFISAGANASILRANLQAPVATIQLGGFDLLQALIRARRIAS
FT                   RVGVVMYGQTLPELDAVKELLNIEITQYAYQTPYHARQGFEQLRRDGFQVIVGSSLVVE
FT                   LAEEAGLRGILAYSLASIRQGFEDAIELARVARLEAGRYEQLNGVLHNLQEAVLAVDRD
FT                   HRIIAVNPPMRELLDMPNRTLLGQRLDAVEPELSLQPTLDSGRAERAAVQRYARRDWIA
FT                   NRTPILEYGKLVGAALTLYDAHRIQEADSSLRMQQRRRQSAARHRFDTLLGQSPAFMRA
FT                   VDTARRYAGTDLRVLIQGESGVGKELFAQSIHNASARAHRPFVAINCASLPETLLESEL
FT                   FGYEDGAFTGSRRDGKRGLIEAAHTGTLFLDEIGDMPLSLQTRLLRVLQEGEITRLGAT
FT                   TPVPVDVRVLAATHQPLQELVAQRRFRQDLYYRINALRLPLPPLRERGADIALLATRLV
FT                   ARCLDRLGSPLDAEAALAALLPRLAAYPWPGNVRELENLCERIAVFLLQFDDAEAIRHD
FT                   ALRHECPELFEHPAAMDAPRPERIAQALRQADGNRAQAAAQLGVSRSTLWRWLRQIDAA
FT                   DDGARAT"
FT   misc_feature    218848..219522
FT                   /note="HMMPfam hit to PF00158, Sigma-54 interaction domain,
FT                   score 8.5e-124"
FT   misc_feature    218920..218961
FT                   /note="PS00675 Sigma-54 interaction domain ATP-binding
FT                   region A signature."
FT   misc_feature    219496..219525
FT                   /note="PS00688 Sigma-54 interaction domain C-terminal part
FT                   signature."
FT   misc_feature    219646..219756
FT                   /note="HMMPfam hit to PF02954, Bacterial regulatory
FT                   protein, Fis family, score 3.4e-08"
FT   CDS_pept        219913..220614
FT                   /transl_table=11
FT                   /gene="marC"
FT                   /locus_tag="BPP2806"
FT                   /product="putative multiple antibiotic resistance protein"
FT                   /note="Similar to Escherichia coli multiple antibiotic
FT                   resistance protein MarC or B1529 SWALL:MARC_ECOLI
FT                   (SWALL:P31123) (221 aa) fasta scores: E(): 3.3e-17, 49.35%
FT                   id in 231 aa, and to Pseudomonas aeruginosa hypothetical
FT                   protein Pa5205 SWALL:Q9HTY5 (EMBL:AE004933) (233 aa) fasta
FT                   scores: E(): 5.4e-47, 61.77% id in 225 aa"
FT                   /db_xref="GOA:Q7W6U3"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6U3"
FT                   /protein_id="CAE38098.1"
FT                   /translation="MIIEYLQLVGLGLVTMLPVANPLTSTTLLLALGSGFTRDERNRQI
FT                   GRATVYVAAIILASFYAGNAIISSFGISIPGLRIAGGLIVAYIGFTMLFPATSQNEAQA
FT                   QVEMAPDDPHIQVPGAAHTGPRPRDISFVPLALPGTAGPGTIALIISSASTLHSHGGIT
FT                   LIHHFAVITVTLLLALLFWACLRSAERVMRMLGQSGIDAISRVMGFLLICMGVQFIIDG
FT                   VFELIRHPPGA"
FT   misc_feature    219928..220593
FT                   /note="HMMPfam hit to PF01914, MarC family integral
FT                   membrane protein, score 3.4e-46"
FT   misc_feature    join(219955..220023,220060..220128,220138..220206,
FT                   220303..220371,220399..220467,220528..220596)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPP2806 by TMHMM2.0 at aa 15-37, 50-72, 76-98, 131-153,
FT                   163-185 and 206-228"
FT   CDS_pept        complement(220803..222374)
FT                   /transl_table=11
FT                   /locus_tag="BPP2807"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa2200 SWALL:Q9I1R7 (EMBL:AE004646) (531 aa) fasta
FT                   scores: E(): 2.2e-35, 33.33% id in 519 aa, and to Brucella
FT                   melitensis Rtn protein Bmeii0904 SWALL:Q8YBJ6
FT                   (EMBL:AE009724) (530 aa) fasta scores: E(): 3.4e-27, 26.04%
FT                   id in 503 aa"
FT                   /db_xref="GOA:Q7W6U2"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6U2"
FT                   /protein_id="CAE38099.1"
FT                   /translation="MGMTQGHVMSGREANNMTIRYLPVRHRLLFFVVPVLACGLVAAAI
FT                   GYAWKGMHATSMVEHDNAHFLARSLDIAREQLDIVLEARVAPAACSEGDLAALRQRVFR
FT                   SKYVADIARIDNGALRCSAVWGVWRHPHVLPRGGRTVRDGVFLWQNMENPIQPELSGDV
FT                   LASERLAVFTIPGIFDDIVRRAGGQKTTLYSRKQGHVYKVFGASAAEDWQGWGAGFQLV
FT                   RTAAACAPVGGPDICVETTARVDARGAVAVAGLGGMALGAGVGLIVFLWWRRSFGLRAS
FT                   LVDALRKGKIQVAYQPLRVLDSGRMAGVEALARWTYDEVGPISPVTFLGWVEAMGLRQP
FT                   FTRYIVQAALDGMKTRMAGDAPFYLSINVFPEDLEDESFLDFLTQSVRERELSPGSVVL
FT                   EVTESAVFSTASPSVLFRRFRAAGFRIFLDDFGVGYSNLGNIIRWEVDGIKLDRIFMQS
FT                   LGDFDSAAPVLDQVIEMARQLDLHLVIEGIEVRSQADYIFKRAPHAVGQGWLFGRPGPA
FT                   CALPAA"
FT   misc_feature    complement(220818..221555)
FT                   /note="HMMPfam hit to PF00563, EAL domain, score 1.5e-51"
FT   misc_feature    complement(join(221559..221624,222228..222293))
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP2807 by TMHMM2.0 at aa 43-65 and 266-288"
FT   CDS_pept        222767..222901
FT                   /transl_table=11
FT                   /locus_tag="BPP2808"
FT                   /product="putative phage-related protein"
FT                   /note="Weakly similar to Maize streak virus mouvement
FT                   protein V1 SWALL:Q9WKC9 (EMBL:AJ012639) (71 aa) fasta
FT                   scores: E(): 6.1, 39.28% id in 28 aa"
FT                   /db_xref="GOA:Q7W6U1"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6U1"
FT                   /protein_id="CAE38100.1"
FT                   /translation="MKRRRKEDADERVSWSSYLHVAGIALVIMVCTVELVEWLLARGS"
FT   CDS_pept        223017..223268
FT                   /transl_table=11
FT                   /locus_tag="BPP2809"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6U0"
FT                   /protein_id="CAE38101.1"
FT                   /translation="MYVQIWSRWAASLSLVALVSGCSWVGLGDSDRKSTASRVSDECRW
FT                   NRSGCIYEGSYEADERDYAEARRLNQAEMARLRRSAGN"
FT   misc_feature    223017..223091
FT                   /note="Signal peptide predicted for BPP2809 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.953) with cleavage site
FT                   probability 0.566 between residues 25 and 26"
FT   misc_feature    223050..223082
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(223315..224478)
FT                   /transl_table=11
FT                   /locus_tag="BPP2810"
FT                   /product="probable acyl-CoA dehydrogenase"
FT                   /note="Similar to Caulobacter crescentus acyl-CoA
FT                   dehydrogenase family protein Cc2328 SWALL:Q9A5W9
FT                   (EMBL:AE005903) (387 aa) fasta scores: E(): 5.1e-94, 60.62%
FT                   id in 386 aa, and to Brucella melitensis acyl-CoA
FT                   dehydrogenase Bmeii0492 SWALL:Q8YCN6 (EMBL:AE009685) (395
FT                   aa) fasta scores: E(): 4.2e-63, 43.76% id in 393 aa"
FT                   /db_xref="GOA:Q7W6T9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6T9"
FT                   /protein_id="CAE38102.1"
FT                   /translation="MDFRLSDEQEQIKSAIERLCEPFDDEYWFNRDREGGFPHEFHQAL
FT                   AQAGWLGIAMPQAYGGAGLGISDAALMMHTIAATGAGLSGASAVHMNIFGLHPVVVFGT
FT                   AQQKQRWLPPLIAGQDKACFGVTEPNTGLNTLKLKTRAVRQGDHYVVTGQKVWISTAQV
FT                   ANKILLLARTTPIEACTGSEGLSLFYTDLDRAAIEVHEIEKMGRKCVDSNQLFIDNLRI
FT                   PVEDRIGEEGKGFSYIQHGLNPERILIAAEAVGLGRAALRKAAGYAREREVFDRPIGKN
FT                   QGVQHPLARSWMELEAAHLMVQKAAWLYDQQQPCGAEANSAKFLGAEACYAACENAIFT
FT                   HGGMGYAKEYHVERYLREAWIPRLAPVSPQMILSFIAEKVLGLPKSY"
FT   misc_feature    complement(223336..223785)
FT                   /note="HMMPfam hit to PF00441, Acyl-CoA dehydrogenase,
FT                   C-terminal domain, score 5.8e-58"
FT   misc_feature    complement(223795..224106)
FT                   /note="HMMPfam hit to PF02770, Acyl-CoA dehydrogenase,
FT                   middle domain, score 1.4e-11"
FT   misc_feature    complement(224110..224466)
FT                   /note="HMMPfam hit to PF02771, Acyl-CoA dehydrogenase,
FT                   N-terminal domain, score 7e-12"
FT   CDS_pept        complement(224515..225654)
FT                   /transl_table=11
FT                   /locus_tag="BPP2811"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pseudomonas aeruginosa hypothetical
FT                   protein Pa3592 SWALL:Q9HY34 (EMBL:AE004779) (395 aa) fasta
FT                   scores: E(): 3.7e-91, 62.6% id in 361 aa, and to Rhizobium
FT                   meliloti putative conserved membrane-anchored protein
FT                   Rb0848 or Smb21182 SWALL:Q92V66 (EMBL:AL603645) (394 aa)
FT                   fasta scores: E(): 6.8e-57, 44.06% id in 379 aa"
FT                   /db_xref="GOA:Q7W6T8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6T8"
FT                   /protein_id="CAE38103.1"
FT                   /translation="MAAGSALDGIRVVDLSRVLSGPYCTQILADHGADVVKIEPPGGDE
FT                   TRAWGPPFAGEVAAYYQGINRNKRGAWLDLSSEAGRAALLAQLDGADVLVENFKCGTME
FT                   RWGLGFEVLSGRFPRLIHCRVSGFGADGPMGGMPGYDAAIQAMSGIMSVNGDPGGEPTR
FT                   VGVPIVDMVTGMNAAIGVLLALQERQRSGRGQFVDIALFDCALSILHPHTASHFAAGVT
FT                   PGRTGNAHPNITPYDIFPTATDPLFLAVGNDRQFRILCEALGAAALADDPRYASNGQRC
FT                   ANRQALTRSLAALLSRHAAQGLAERLIRAGVPCSSVLDIPQALRHPQAVHREMVVQRDG
FT                   YAGVASPVKLGRTPARYRMPPPRFGQHQLELDFPAASGR"
FT   misc_feature    complement(224875..225444)
FT                   /note="HMMPfam hit to PF02515, CAIB/BAIF family, score
FT                   3.1e-61"
FT   CDS_pept        complement(225681..227114)
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BPP2812"
FT                   /product="succinate-semialdehyde dehydrogenase [NADP+]"
FT                   /EC_number="1.2.1.16"
FT                   /note="Similar to Escherichia coli succinate-semialdehyde
FT                   dehydrogenase [NADP+] GabD or B2661 SWALL:GABD_ECOLI
FT                   (SWALL:P25526) (482 aa) fasta scores: E(): 6.9e-54, 37.65%
FT                   id in 470 aa, and to Rhizobium loti aldehyde dehydrogenase
FT                   Mlr5236 SWALL:Q98CA3 (EMBL:AP003006) (479 aa) fasta scores:
FT                   E(): 2.3e-98, 55.1% id in 470 aa"
FT                   /db_xref="GOA:Q7W6T7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6T7"
FT                   /protein_id="CAE38104.1"
FT                   /translation="MRTITSLIDGQWAGGAGDSENINPSDLSAPVCLVAQASAQQAAQA
FT                   VEAARRAQPGWAATGLAARAQILKDIGRGIVANSQQLAHILASEQGKTLPEARGEVQRA
FT                   ADIFDYYAGEVFRLGGEMFPSIRAGVEVEISREPLGVVALITPWNFPIAIPAWKTAPAL
FT                   ACGNAVVLKPSEFTPATAVMLAEIIRAAGVPDGVFNLVLGTGADVGQVLTGHPAVAGVS
FT                   FTGSSATGRKIAASAVAGHKKLQMEMGGKNPLVVLDDADLEIALACALDGAFHATGQRC
FT                   TASSRLIVTPGIHDRFVQELAQRVMALNVGHALDERSQIGPVSNGAQFDKDLSYIALAR
FT                   DEAQRVIGGAALQRAQRGYYLQPCLALDVSLDARIAREEVFGPLACVLRAQDYEHALAI
FT                   ANDTEYGLSAGICTQSLKHATHFRRHVQSGLAMVNMPTSGVDFHVPFGGRGASSYGSSE
FT                   QGHYAREFFTSLKTSYIRP"
FT   misc_feature    complement(225687..227084)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00171, Aldehyde dehydrogenase
FT                   family, score 2.4e-167"
FT   misc_feature    complement(226260..226295)
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT   misc_feature    complement(226356..226379)
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT   CDS_pept        complement(join(227125..228768,228770..228805))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="BPP2813"
FT                   /product="acetolactate synthase large subunit (pseudogene)"
FT                   /EC_number="2.2.1.6"
FT                   /note="Similar to Escherichia coli acetolactate synthase
FT                   isozyme I large subunit IlvB or B3671 SWALL:ILVB_ECOLI
FT                   (SWALL:P08142) (562 aa) fasta scores: E(): 2.1e-34, 28.87%
FT                   id in 568 aa, and to Pseudomonas aeruginosa probable
FT                   decarboxylase Pa3506 SWALL:Q9HYA3 (EMBL:AE004771) (560 aa)
FT                   fasta scores: E(): 3.5e-80, 44.84% id in 562 aa"
FT                   /db_xref="PSEUDO:CAE38105.1"
FT   misc_feature    complement(227212..227733)
FT                   /note="HMMPfam hit to PF02775, Thiamine pyrophosphate
FT                   enzyme, C-terminal TPP binding domain, score 3.5e-19"
FT   misc_feature    complement(227764..228231)
FT                   /note="HMMPfam hit to PF00205, Thiamine pyrophosphate
FT                   enzyme, central domain, score 3e-16"
FT   misc_feature    complement(228277..228753)
FT                   /note="HMMPfam hit to PF02776, Thiamine pyrophosphate
FT                   enzyme, N-terminal TPP binding domain, score 7.2e-20"
FT   variation       complement(228769)
FT                   /note="(T)1 in parapertussis; (T)3 in bronchiseptica"
FT   CDS_pept        complement(228818..229792)
FT                   /transl_table=11
FT                   /locus_tag="BPP2814"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Ra1058 or Sma1927 SWALL:Q92Y30 (EMBL:AE007292) (330 aa)
FT                   fasta scores: E(): 3.1e-40, 38.31% id in 321 aa, and to
FT                   Comamonas testosteroni OrfJ protein SWALL:Q9RHM9
FT                   (EMBL:AB029044) (326 aa) fasta scores: E(): 4.2e-38, 37.92%
FT                   id in 327 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6T6"
FT                   /protein_id="CAE38106.1"
FT                   /translation="MKIRFKTLVAAGWLGALAFGTAVAQGGYPNQPIRLMVGYSPGGSV
FT                   DIVAREYAQHLGRLLDQSVVVENRGGASGTIAAQAVARAPADGYTLFFTASPTVTITPA
FT                   LQKTPFDPVKDFQPVASVVSYTNVLLVNAQAPYQDIQALVAAAKADPGKLTYGSAGVGA
FT                   SNHLSGKLFEDNANIKLSHVPYKGNAPAQSDLIADRITMLFDLNTTAKSLVESGRVKAL
FT                   AVTSGQRNPMFKDVPTMAEAGYPNFIFDGWLGILAPAGTPEAVVKTLADATRKILADKA
FT                   FSERMQASGYTITASSPQELGAIVAREGKQFQDLAERANLRQF"
FT   misc_feature    complement(228830..229651)
FT                   /note="HMMPfam hit to PF03401, Uncharacterized protein
FT                   family, UPF0065, score 3.8e-98"
FT   misc_feature    complement(229721..229792)
FT                   /note="Signal peptide predicted for BPP2814 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.972 between residues 24 and 25"
FT   CDS_pept        complement(230153..231118)
FT                   /transl_table=11
FT                   /locus_tag="BPP2815"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2103"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6T5"
FT                   /protein_id="CAE38107.1"
FT                   /translation="MKNVLWMALLASVLSEGALAAEFPTHPVTLVVPLAAGSTADILAR
FT                   AIQPGLSKALGQTVVVENRPGAGGQLAMSYVAKQAADGYTIVMGSNGTWAINLGLYEKL
FT                   PYRPVEDFAPVAYLAGGSNILIVKPSSPYTSVAALIAAMKAAPGKLTYSSGGNGTTHHL
FT                   SSELLKSLTNTQAMHIPYGGAPQGVSAVMAGETDFGFYNTPSVSSLVKERKLRALAATG
FT                   TIRTPMLPEVPTMMEAGVAGYVMSVDFGLLAPAGTPDDVVLKLNRAANAAMAQPKLQET
FT                   LKNYGFEVFEQGTPGDMAKRVNADIDKWVPIVRQAKAKVD"
FT   misc_feature    complement(230165..230992)
FT                   /note="HMMPfam hit to PF03401, Uncharacterized protein
FT                   family, UPF0065, score 1e-104"
FT   misc_feature    complement(231059..231118)
FT                   /note="Signal peptide predicted for BPP2815 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 20 and 21"
FT   CDS_pept        complement(231256..232161)
FT                   /transl_table=11
FT                   /locus_tag="BPP2816"
FT                   /product="putative lysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2102"
FT                   /db_xref="GOA:Q7W6T4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6T4"
FT                   /protein_id="CAE38108.1"
FT                   /translation="MMDAIESVSLRQLRALVSIGDTASFTGAAEQLGMSQPSVSHLIRR
FT                   LEAEVGQTLVVRGREVTLTRQGQALADIARRAILSIDGAVRESRDQSALKSGSVSVAVG
FT                   HVSAATLLPRILVAFNQRHPNIELIVVDCVVEQIRNKLLSHEADVGLGAVVGSDDSRLS
FT                   TELLWDGGVSLFMRDDHYLADREAIDAAILAELPCIQLNPNAPPWLVISRLLVANGIHP
FT                   RVDQRVVLVSTAVGMIQAGMGVAMLPHAAAAQAPRGVRAVPIRNPFLSWPISLVRLSNH
FT                   PLSPAAQAFAAIARDVLRRF"
FT   misc_feature    complement(231265..231888)
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 3.4e-42"
FT   misc_feature    complement(231958..232134)
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 2.8e-21"
FT   misc_feature    complement(232000..232092)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   CDS_pept        232203..234506
FT                   /transl_table=11
FT                   /locus_tag="BPP2817"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2101"
FT                   /db_xref="GOA:Q7W6T3"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6T3"
FT                   /protein_id="CAE38109.1"
FT                   /translation="MGVASIAWQKPLLHTETAMPHSDYARHLMDSATIDPTGAFEAGSF
FT                   ASFTLTYTAGYFGIDDTGSIKIVHRFASDMGKPQFTDPQGWNYTTVEAGNGAVLHVEYD
FT                   GKRNIRPWDKTLFIRVVRGYLEEGEQIIVRFGDTRQGSPGMRVQTFHEPTFEFKVLVDA
FT                   FATYNYVEIEASPTISVVAGPPVRYKAVLPSLSLAGQPLRLGFKGEDKWGNPSDQAQGR
FT                   YTLRSNLRMARMPESFEMAAGAYAHAIEGIVAAETGDLRLEVLHGDRVVARSNPCRVAA
FT                   QAARNHYWADLHGQSEETIGTNSAEELILFARDRAFLDAMSHQGNDFQITQEFWEHLNT
FT                   LTARYDEPSRFVIFPGYEWSGNTGLGGDRNVLYLHEGRPLHRSSHALVDDLSDLDSDAN
FT                   SADALFQAIKDEDAVVFAHIGGRYADITLSHDPRIERSIEIHSDWGTFEWLLEDAFKQG
FT                   YRVGILANSDGHKGRHGASHPGASLFGAYGGLSCLIADTLSRQSLAECLRQRRHYATTG
FT                   CRAYLDVAAHFDAPARRYAEDPRLAPDAASTQVRSADMGAILACDTDMVEFEFDLATEA
FT                   PIESVEVRNRMDVVQTLRPFKPADLGRRIRIVWEGSEYRGRGRQTVWDGSATLQDNAFV
FT                   DPKPINFWNLDKTLQQPQPNHLCWQSLTTGGFSGVDVMLEDAGRGTLCIDTDLIQARIP
FT                   VADIGLEPLVFENGGIRRRLQVFRLPDENPACHLKARVQVPLHTEQDNALYLRATTEDG
FT                   FFIYSSPIYIERKA"
FT   misc_feature    233649..233726
FT                   /note="PS00217 Sugar transport proteins signature 2."
FT   CDS_pept        234752..236236
FT                   /transl_table=11
FT                   /locus_tag="BPP2818"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2100"
FT                   /db_xref="GOA:Q7W6T2"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6T2"
FT                   /protein_id="CAE38110.1"
FT                   /translation="MCCQAALAPGCADAGDNRVSNILAIGVHLPRLRLSRRAMANALGW
FT                   LSGGAGAGKGSRTLAYWDEDSVTMAVAAARHALARQAAPAIDALQFASTTPPFAEPQNA
FT                   AFVRAALRLPATTLTQDVHGTPRAGLLALHMALESGTRTLVAAADLPTALPGSTAEARA
FT                   GDGGAAVLTGDEPGLLRYLGGASLSAPFTDRYRAAGHDYPQEWEERWLREAGYLELVHD
FT                   AIGRALQAASLRPEQVDHFVLPCPVPGVAAAVAAKAGLGQARLASALAENCGDTGAAHA
FT                   FVMLGRALEDAAPGQKVLVAQFGQGATALLFEADEAVAGLAAPVSPALQGGLAEDNYMK
FT                   LLAFRGRIAWDRGLRGRFLVNEALSTAWRNADALLGFVAGRCRETGQVQFPPTRLAATG
FT                   GFHLDTQEPWPLADRGGRIATFTADLLAFSPCPPNCYGLVDIDGGGRVLMEFTDPQASQ
FT                   LEAGAAVAFALRIKDLDPQTGYRRYFWKALAAPTAD"
FT   CDS_pept        236247..237443
FT                   /transl_table=11
FT                   /locus_tag="BPP2819"
FT                   /product="putative thiolase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2099"
FT                   /db_xref="GOA:Q7W6T1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6T1"
FT                   /protein_id="CAE38111.1"
FT                   /translation="MATGIKDRVAILAMGCSRFGERWDVGQEELMVEAYAEALASVGIE
FT                   PRAIEAAWYSSHYDDIGAGKAGTPMAMALRLPDIGVTRVENFCAGGTEAFRGAVYAVAS
FT                   GAADIALALGVEKLKDTGFAGLPLASRGTLAPMYLPTHSNPGNFAQLARAYQARHGVSR
FT                   EDLKAAMAHTSVKSHANALHNPKAHLRKAISREQAAGAPLVADPIGLFDCCPVSDGAAC
FT                   AIVTTPEIARSLNRGPLVLVKAIQLATSNGWELQQSDWDGSYVHTTRVAARKAYAEAGI
FT                   DDPRAQLSLTELHDCFSITELVTLEDIGLAEPGTAWRGMLDGRFDADGALPCQIDGGLK
FT                   CFGHPVGASGLRMLYEAWLQLSGRAGARQLPAPSLALTHNLGGAPAQNVCSITILGAA"
FT   misc_feature    236946..237419
FT                   /note="HMMPfam hit to PF02803, Thiolase, C-terminal domain,
FT                   score 0.001"
FT   CDS_pept        237516..238835
FT                   /transl_table=11
FT                   /locus_tag="BPP2820"
FT                   /product="putative acyl-CoA ligase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2098"
FT                   /db_xref="GOA:Q7W6T0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6T0"
FT                   /protein_id="CAE38112.1"
FT                   /translation="MLHPEIELLDRDGILKIQRERLARLGQRLQHSPQWREHFASVGMT
FT                   PGDLASPDAFEHLPFLQKADLRQQYPYPFLTVPLEDVERFVATSGTTGLPVMFGLTRRD
FT                   LHELLPSQTARLLAAAGVRRGARAYQGYGYGLWIGGLALDQGFKEMDCVNFPLGPGRGD
FT                   LAARWMRDHAYEVASMSPLWLMSLAQAARAQGINPKTDWALRTAILGGQSVSAEFRAQL
FT                   EAEMPEGFVSHNIYGTTEAGGPILAISTPYTHADDELHLINEDTVLTEILDPVTLKPVS
FT                   EGEVGEIVITTLTKEASPVIRWRTHDLVRLSSHPYDCPSGRRGMRKIGRIIGRSDDMIK
FT                   FKGVIVFPSQIEDVITGVAGVVKEAWQIYIDKECMTIGTMTVAIEASAQAGRPAEQLSH
FT                   EVGREIHARLGMKVCVECHPEGTLPRYEAKAVRVLHRPEA"
FT   misc_feature    238755..238772
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   CDS_pept        join(238832..239230,239232..239645)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2821"
FT                   /product="putative esterase (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2097"
FT                   /db_xref="PSEUDO:CAE38113.1"
FT   CDS_pept        complement(239676..240848)
FT                   /transl_table=11
FT                   /locus_tag="BPP2822"
FT                   /product="putative fatty-acyl-CoA racemase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2096"
FT                   /db_xref="GOA:Q7W6S9"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6S9"
FT                   /protein_id="CAE38114.1"
FT                   /translation="MMAQGEGMAPALQGLRIIEMVGLGPAPFAAMMLADHGADVVRVHA
FT                   AHRKGDFPLLDSRFDVLARGRRSLALDLRAPGASDLLLELVGAADGLIEGFRPGVMERM
FT                   GLAPEACLRRQPRLVYGRMTGWGQQGPLARQAGHDLNYLGLTGALHAIGPSDRPPPVPL
FT                   NYVADFGGGGMLLAFGMLAALLAVRGGAPGQVVDAAMVDGAGLLASMFWGFRAGGGWSD
FT                   RREGNLLDGGAYFYATYACADGRFLAVACVERRFHDLLVERLGLDPAVYTHDRDPAQWP
FT                   ALRARLAALFATRPRDHWAALFEDSDACVTPVLDWREAAHHPHAAARAGYIDVEGVTQP
FT                   APAPRLSATPARQPAAAPAVGAHSVEVLHEWGLAPERVASALDSGLIVQA"
FT   misc_feature    complement(240069..240644)
FT                   /note="HMMPfam hit to PF02515, CAIB/BAIF family, score
FT                   1e-60"
FT   misc_feature    complement(240126..240158)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(240845..241159)
FT                   /transl_table=11
FT                   /locus_tag="BPP2823"
FT                   /product="putative ferredoxin"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2095"
FT                   /db_xref="GOA:Q7W6S8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6S8"
FT                   /protein_id="CAE38115.1"
FT                   /translation="MTTIIFIASNEARHVVQADDGLSLMECARRANVPGIAAECGGACT
FT                   CATCHVHVGQEWMQAVGEPGDMERDMLDFANDVRAESRLSCQITVAPALEGLTVRVAPQ
FT                   "
FT   misc_feature    complement(240884..241141)
FT                   /note="HMMPfam hit to PF00111, 2Fe-2S iron-sulfur cluster
FT                   binding domain, score 3.9e-07"
FT   misc_feature    complement(241007..241024)
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT   misc_feature    complement(241010..241042)
FT                   /note="PS00814 Adrenodoxin family, iron-sulfur binding
FT                   region signature."
FT   CDS_pept        complement(241181..241903)
FT                   /transl_table=11
FT                   /locus_tag="BPP2824"
FT                   /product="putative 3-oxoacyl-CoA or-ACP reductase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2094"
FT                   /db_xref="GOA:Q7W6S7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6S7"
FT                   /protein_id="CAE38116.1"
FT                   /translation="MPRHALVTGGANGIGAATVAQLCRDGLRVTFCDRDAQAGASVAQA
FT                   TGARFVALDATDAEAVAGFCAGAAPFDILVNNVGADQHAFFSRTTPQDWRALLAVNLES
FT                   AFAFTLGVLPGMQAARFGRIVNVSSEAGRLGSRGGAVYAAAKAGLLGFTRSIARENARY
FT                   GVTANAVLPGPVDTPMLARAVDVAGAQMRVDLEALTLLRRLGRPEEVAAAIAFLCSEAA
FT                   GFITGEALGVSGGMGCGA"
FT   misc_feature    complement(241196..241903)
FT                   /note="HMMPfam hit to PF00106, short chain dehydrogenase,
FT                   score 1.3e-66"
FT   misc_feature    complement(241433..241519)
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   CDS_pept        complement(241903..242718)
FT                   /transl_table=11
FT                   /locus_tag="BPP2825"
FT                   /product="enoyl-CoA hydratase/isomerase-like protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2093"
FT                   /db_xref="GOA:Q7W6S6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6S6"
FT                   /protein_id="CAE38117.1"
FT                   /translation="MTMTTANPETWIGEGPVLLDYADHVARITLNRPDAANGMNIEFMK
FT                   ALHEAVMRCHREPDVRVVLLRGAGKHFCAGGDVREFASKGEGLGDFLREVTAWLQMAIG
FT                   ALIRLDAVVVAQVQGYAAGGGLGLVCAADIVVAAQGARFLAGATRVGMAPDAGSSVILP
FT                   HLIGFRRAMEMMLSNRTVGADEALEMGLVNQVVADAELDESAARLAATYAAGAPLAQAA
FT                   TKRLLWNTLQVERALPEEARTVSTLSATADSREGLAAVIGKRQPVFRRH"
FT   misc_feature    complement(242128..242643)
FT                   /note="HMMPfam hit to PF00378, Enoyl-CoA
FT                   hydratase/isomerase family, score 1.4e-45"
FT   CDS_pept        complement(242723..243250)
FT                   /transl_table=11
FT                   /locus_tag="BPP2826"
FT                   /product="putative dioxygenase component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2092"
FT                   /db_xref="GOA:Q7W6S5"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6S5"
FT                   /protein_id="CAE38118.1"
FT                   /translation="MTARPETRPAADDLQALDELTLHHRVSQFLYHEARLQDTHDYQGW
FT                   ESLWEDDAIYWIPANGDDIDPEQKMSVIYDNRSRIRVRIEQLLTGRRHTQTPRSALARL
FT                   ISNIEIVDVAGQEVTALANVLIYEDNLRGETHWAARNEYRLRLVDGAFRLVRKKIALVN
FT                   GAKPIFTLSFLV"
FT   misc_feature    complement(242738..243157)
FT                   /note="HMMPfam hit to PF00866, Ring hydroxylating beta
FT                   subunit, score 3.3e-10"
FT   CDS_pept        complement(243256..244521)
FT                   /transl_table=11
FT                   /locus_tag="BPP2827"
FT                   /product="putative dioxygenase hydroxylase component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2091"
FT                   /db_xref="GOA:Q7W6S4"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6S4"
FT                   /protein_id="CAE38119.1"
FT                   /translation="MRAMSSIRNEIDYRALIEPTRINSRLYVDPEIFQEELDKIWHRTW
FT                   VYVGHVSEVPNKNDYVTKSIGTTPVLLLRDRDGEIRLLLNKCPHRGNQLCAYKEGNRST
FT                   FTCPYHSWTFSNTGDLMGYALADGYEGASKAGVGLGKVARIGIYRGFVFGSFAETGPSL
FT                   DEHLGGAKAAIDQLCDNSPNGELDLRAGFLQHRAKANWKFMLENETDGYHPGFVHGSIF
FT                   QVTNSPIANLYGKDSTALTRDYGNGHTEFDLRPEWRRIDKPLYWFGSSVERMADYAVAM
FT                   DQAYGAERARQIMIDGSPHTMIFPNLFIAEIQIFVLQPVSVEETIQHVTAVQFKDAPDI
FT                   NRRLRQQTMGSVGPAGLLLADDTEMYERNHRGAKIRDPEWLMLTRGLHRERKDENGYTV
FT                   GHSTDEVPQRGIWRHYFKLMQE"
FT   misc_feature    complement(243262..244035)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00848, Ring hydroxylating alpha
FT                   subunit (catalytic domain), score 6e-11"
FT   misc_feature    complement(244075..244161)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   misc_feature    complement(244093..244392)
FT                   /note="HMMPfam hit to PF00355, Rieske [2Fe-2S] domain,
FT                   score 9.8e-24"
FT   misc_feature    complement(244192..244263)
FT                   /note="PS00570 Bacterial ring hydroxylating dioxygenases
FT                   alpha-subunit signature."
FT   CDS_pept        244873..246012
FT                   /transl_table=11
FT                   /locus_tag="BPP2828"
FT                   /product="putative ABC-transporter substrate-binding
FT                   protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2090"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6S3"
FT                   /protein_id="CAE38120.1"
FT                   /translation="MNTSKAIVAGLLALGCALPAAAEIRLGASVSATGPAGILGDPEAR
FT                   TLELLVQELNARGGIKGEQIKLVLYDDGGDANKARTFATRLVEDDEVQAIIGGTTTGTS
FT                   MSILSVAEDAKVPFISLAGAIDIIDPVKPYTFKTPHTDRMACQKVFADMRKNGWTKVAL
FT                   IGSTDGFGASMQAQCKAVAGQYGIELVDSETYEPKDADMTAQLTKIRGIPGVQAVLNPG
FT                   FGQSAAVLARNYRQLGMSLPFYASHGVASQGYIDLAGADVVEGFRLPGTALLVADLLPA
FT                   SDPQAAPSIAYKKAFEAKTGAPVGTFGGYAHDAFLILVDALNRADSTKPTAIRDAIEKT
FT                   SKLAGTTGVYTFSPTDHLGLDLSAFRVLEIRGGKWKVVD"
FT   misc_feature    244873..244938
FT                   /note="Signal peptide predicted for BPP2828 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.953 between residues 22 and 23"
FT   misc_feature    244888..244920
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        246090..246962
FT                   /transl_table=11
FT                   /locus_tag="BPP2829"
FT                   /product="putative ABC-transporter permease component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2089"
FT                   /db_xref="GOA:Q7W6S2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6S2"
FT                   /protein_id="CAE38121.1"
FT                   /translation="MSEFMQFIFSGVTVGAVYALVALGFAIIFNATGVVNFAQGEFVML
FT                   GGMITVFAHGAGLALPLAALLAIAVTAATGVALNRLAIEPARGAPVVSLIIITIGASIF
FT                   IRGAVQSLFGKQIHSLPAFSGDDPIHVLGATILSQSLWMIGGAVAVFIVLWLFFTRTLI
FT                   GRAVLATSNNRLAARLVGINTRFIMTLSFALSAAIGALAGVLITPITLTSYDVGLTLAL
FT                   KGFAAAMLGGMGSPKGALAGGILLGLLESLTAGYLSSQYKDAAAFLTILAVLFFMPQGL
FT                   FGHKSTDRV"
FT   misc_feature    246099..246947
FT                   /note="HMMPfam hit to PF02653, Branched-chain amino acid
FT                   transport system / permease component, score 5.8e-36"
FT   misc_feature    join(246108..246176,246255..246323,246360..246428,
FT                   246495..246563,246657..246725,246801..246860,
FT                   246879..246938)
FT                   /note="7 probable transmembrane helices predicted for
FT                   BPP2829 by TMHMM2.0 at aa 7-29, 56-78, 91-113, 136-158,
FT                   190-212, 238-257 and 264-283"
FT   CDS_pept        246966..247922
FT                   /transl_table=11
FT                   /locus_tag="BPP2830"
FT                   /product="putative ABC-transporter permease component"
FT                   /note="ortholog of Bordetella pertussis (BX470248)
FT                   BP2088+BP1648"
FT                   /db_xref="GOA:Q7W6S1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6S1"
FT                   /protein_id="CAE38122.1"
FT                   /translation="MRISSKHWTLIVLAALIAIAPLFFPSGYYFRVGSTIFVNALAVTG
FT                   IVILTGYAGQISLGHAGFAGIGGYACALAPVHLGLPSALSVVLGAAVSGALAWLVGRPI
FT                   LRLKGYYLGVASLGFGILVAMVLNNERQLTKGPDGIAVPDPGLRSLLKGWSLDLSNGQF
FT                   WYAMTGIALVIGAWLALNLYHSPTGRALRALHGSEIAAGTVGIDVAGAKLKAFVVSAVY
FT                   ASVSGSLLALQNRFITPDIAGFMHSIEMVTMAVLGGVGSVAGAIFGASLLTLLPQVLTV
FT                   FADYEPLILGLTMMLVMIFLPEGLVPSIMRTIRGRKK"
FT   misc_feature    246966..247091
FT                   /note="Signal peptide predicted for BPP2830 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.795 between residues 42 and 43"
FT   misc_feature    join(246993..247052,247071..247139,247197..247265,
FT                   247284..247352,247446..247514,247716..247784,
FT                   247827..247895)
FT                   /note="7 probable transmembrane helices predicted for
FT                   BPP2830 by TMHMM2.0 at aa 10-29, 36-58, 78-100, 107-129,
FT                   161-183, 251-273 and 288-310"
FT   misc_feature    247038..247895
FT                   /note="HMMPfam hit to PF02653, Branched-chain amino acid
FT                   transport system / permease component, score 2.3e-16"
FT   CDS_pept        247919..248701
FT                   /transl_table=11
FT                   /gene="livG"
FT                   /locus_tag="BPP2831"
FT                   /product="high-affinity branched-chain amino acid
FT                   transport, ATP-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1649"
FT                   /db_xref="GOA:Q7W6S0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6S0"
FT                   /protein_id="CAE38123.1"
FT                   /translation="MSLLEIHGLGITFGGLRAVHDVAFSVEPGEIVSVIGPNGAGKTTL
FT                   FNMISGIYRPGAGRVVLDRDDVTGMAPFRLARRGMSRTFQNLQIFQNMTVLENAIAGFH
FT                   LQEQGALLSDLFNLRASQARARRAEEGARALLQRVGLERAAEREAASLSYGSLKRLEIA
FT                   RALALQPKVLLLDEPAAGCNAVETEEIDHLIAEVAATGVAILLVEHDMKMVMRISSHIV
FT                   VLDHGEKIAEGPPDAISRDPAVIAAYLGTDSQPGDRPC"
FT   misc_feature    248003..248599
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   8.3e-50"
FT   misc_feature    248024..248047
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        248695..249396
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="BPP2832"
FT                   /product="high-affinity branched-chain amino acid
FT                   transport, ATP-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1650"
FT                   /db_xref="GOA:Q7W6R9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6R9"
FT                   /protein_id="CAE38124.1"
FT                   /translation="MLTVQGLRSCYGRIEVLHGIDLQVDSGEIVTVVGANGAGKTTLLR
FT                   CLSGVQPVSAGAITFRGEALAAVPAHRRLARGLAHSPEGRQIFTNLSVEENLRLGAYLY
FT                   ADDRVERDMDDAFQMFPILREKRHLAAGGLSSGQQQMLAMARALMGRPSCLLLDEPSMG
FT                   LAPIIVQQIFDVIRGLKALGVTVLLIEQNAYGALQIADRGYVMETGNITMQGAASALIA
FT                   DPRIRAAYLGI"
FT   misc_feature    248773..249321
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.8e-49"
FT   misc_feature    248794..248817
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    249094..249138
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        249635..250237
FT                   /transl_table=11
FT                   /locus_tag="BPP2833"
FT                   /product="putative TetR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1651"
FT                   /db_xref="GOA:Q7W6R8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="PDB:3CCY"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6R8"
FT                   /protein_id="CAE38125.1"
FT                   /translation="MARTRSADYENIRDTIIERAAAMFARQGYSETSIGDIARACECSK
FT                   SRLYHYFDSKEAVLRDMLTTHVDSLLERCRQVLYGSNEPKTRFLQIVKLFLEIYATSRD
FT                   RHVVMLTCLDALPEDQRKALIAKQRELIAYVRDALLQLRPDMAANRTLAHVDTMLFFGM
FT                   INWTYTWYKADGSVSPDALAERTVQLFLDGYLNLLSA"
FT   misc_feature    249680..249820
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 1.5e-13"
FT   CDS_pept        complement(250213..251442)
FT                   /transl_table=11
FT                   /locus_tag="BPP2834"
FT                   /product="putative oxidoreductase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1652"
FT                   /db_xref="GOA:Q7W6R7"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6R7"
FT                   /protein_id="CAE38126.1"
FT                   /translation="MAMDSIAIIGAGQAGAALAARLRQAGFQGGIDVFGAESAPPYQRP
FT                   PLSKKYLAGDWEQERLWLRPAQFWREQGIALHLGGTVEALDLASRTLRCGGRRHGWRKL
FT                   ALTTGAAPRPLPAAFAGRSNVFELRNLADVQRLQPAFLAGRRLLVLGGGYIGLETAAVA
FT                   AQAGLSVQVVERASRVLERVACPATAAAIRALHQRHGVLIHEGRTVAGTEGDEALTGVE
FT                   LDNGLRIACDLVVAGVGVAPQTALAEAAGIDCDDGILVDAYGRTSAPDVWAAGDCARFV
FT                   LGGEPARLESVQNAIDQAEAVADDMLGQGRPYQPVPWFWSDQYDMKLQIVGLNRGYDAV
FT                   VSHASAKGESHWYFRADRLISVDALNDGRAYMVGKKLLEAGRAVGRGEVERPGFEPMQL
FT                   LRDQAESRLR"
FT   misc_feature    complement(250588..251430)
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreductase, score 6.4e-72"
FT   misc_feature    complement(251386..251442)
FT                   /note="Signal peptide predicted for BPP2834 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.857) with cleavage site
FT                   probability 0.812 between residues 19 and 20"
FT   CDS_pept        251592..251954
FT                   /transl_table=11
FT                   /locus_tag="BPP2835"
FT                   /product="putative translational inhibitor"
FT                   /note="Similar to Yersinia pestis putative translational
FT                   inhibitor protein Ypo0628 SWALL:Q8ZI83 (EMBL:AJ414143) (134
FT                   aa) fasta scores: E(): 4e-06, 30.32% id in 122 aa, and to
FT                   Rhizobium loti hypothetical protein Mll4506 SWALL:Q98DX4
FT                   (EMBL:AP003004) (132 aa) fasta scores: E(): 5.6e-05, 38.65%
FT                   id in 119 aa"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6R6"
FT                   /protein_id="CAE38127.1"
FT                   /translation="MPRTALNPDTVFDSLQYGFSQGLIVTGQRRIMLSGQVGVDAQERT
FT                   VGPGLNEQTDAALDNIERVLAAAGAAMRHIIMLRIYICEDARGDQEVVADALRRRFPDN
FT                   PPPSSWIIVSGLSLPE"
FT   misc_feature    251628..251948
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF01042, YjgF family, score 0.00018"
FT   CDS_pept        complement(251992..252309)
FT                   /transl_table=11
FT                   /locus_tag="BPP2836"
FT                   /product="putative membrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6R5"
FT                   /protein_id="CAE38128.1"
FT                   /translation="MKTFRYAVGLAGLLVASHAMAQYGVWTKKSANGSWVAPRTGFTSL
FT                   VLSQAEINAFRECVLPGRSGGDNSATKIVETATGKEVKLLDCEAMRAERKAEQDRLNAK
FT                   K"
FT   misc_feature    complement(252235..252291)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP2836 by TMHMM2.0 at aa 50-72 and 85-104"
FT   CDS_pept        complement(252543..252950)
FT                   /transl_table=11
FT                   /locus_tag="BPP2837"
FT                   /product="putative phage-related protein"
FT                   /note="Similar to Bacteriophage P27 hypothetical 14.1 kDa
FT                   protein SWALL:Q9MBZ3 (EMBL:AJ249351) (125 aa) fasta scores:
FT                   E(): 9.7e-15, 41.6% id in 125 aa, and to Yersinia pestis
FT                   putative phage-related protein Ypo3676 SWALL:Q8ZAV6
FT                   (EMBL:AJ414158) (133 aa) fasta scores: E(): 1e-17, 42.52%
FT                   id in 127 aa"
FT                   /db_xref="GOA:Q7W6R4"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6R4"
FT                   /protein_id="CAE38129.1"
FT                   /translation="MGFQLSARDRQRLAGVYPDLAAVVEAAAGAYNGRFTVLEGARSAQ
FT                   RQSRLLAQGVSQTLRSLYIPQPDGWAHAVDLAPLVEGTISWEDWASFKRLAEVMKESAA
FT                   RLEIPLGWGGDWTTLKDGPHFQLPRGWRGKA"
FT   CDS_pept        complement(253287..253664)
FT                   /transl_table=11
FT                   /locus_tag="BPP2838"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2182"
FT                   /db_xref="GOA:Q7W6R3"
FT                   /db_xref="InterPro:IPR039060"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6R3"
FT                   /protein_id="CAE38130.1"
FT                   /translation="MNMEIRPVRTEADYKSALKEISRLMESDPELGTPDGDRLDVLATL
FT                   VQAYEARHYPIDLPDPVEAIKFRMEQGGLTPKDLEPMIGKRNRVYEVLNRKRGLTLPMI
FT                   WRLHTELGIPAESLIRPPAHA"
FT   CDS_pept        complement(253661..253963)
FT                   /transl_table=11
FT                   /locus_tag="BPP2839"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Anabaena sp. hypothetical protein Asl4856
FT                   SWALL:Q8YMS3 (EMBL:AP003597) (85 aa) fasta scores: E():
FT                   4e-20, 62.96% id in 81 aa, and to Rhizobium meliloti
FT                   hypothetical protein R00767 or Smc00822 SWALL:Q92RS9
FT                   (EMBL:AL591784) (98 aa) fasta scores: E(): 3.6e-16, 46.93%
FT                   id in 98 aa"
FT                   /db_xref="GOA:Q7W6R2"
FT                   /db_xref="InterPro:IPR018669"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6R2"
FT                   /protein_id="CAE38131.1"
FT                   /translation="MRVIALSTLRQFWEKHPAAEQPLKAWVDEASRARWAPPADLKAQY
FT                   RSASVLKNRRVVFKIKGNDYRLIVAVAFKLGIVYVKFVGTHVEYDRVDAETVEME"
FT   misc_feature    complement(253703..253768)
FT                   /note="1 probable transmembrane helix predicted for BPP2839
FT                   by TMHMM2.0 at aa 65-87"
FT   tRNA            complement(254106..254184)
FT                   /note="tRNA Met anticodon CAT, Cove score 66.21"
FT   CDS_pept        complement(254194..256476)
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="BPP2840"
FT                   /product="RNA polymerase sigma factor 70"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2184"
FT                   /db_xref="GOA:Q7W6R1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6R1"
FT                   /protein_id="CAE38132.1"
FT                   /translation="MTKSTGKSPSAIDAATAQSTTAKRAASMAAEKAPAKTAVKVAKPA
FT                   AKTAAKKTATKTVAAKTAAADKPAKTTKARAKKAEDKLADLVGAARPAPSGRRPGRPAK
FT                   NANNDSDAFDDSMDGEGEVLPDLKPPKRGGKRGKADPKDLIVRGPVSPEEYEARRNRLK
FT                   QLIKLGKDRGYLTYGEINDHLPDDLVDAEAIDGIISTFSDMGIAVYDQAPDAETLLMSE
FT                   NAPVASNDDDVEDEAEAALTTVDSDFGRTTDPVRMYMREMGSVELLTREGEIEIAKRIE
FT                   DGLKHMVMAISACPTTINEILAHITRVREGQAQIDEVVDGLVDPEDGEEYAGAGVTADE
FT                   DEADDGPAGGMSSKQLEDLRVKALAKFDEVSKQFEKMRQSYEKEGYKSDAYLKAQDIIQ
FT                   TELMGIRFTAKMVEKLADTLRAQVEEVRQLERAVLHTCVDRAGMPRSHFLKAFPGNETN
FT                   LQWVLDEVAAAHAYSETLERQIPAVQELQQKLIDLQTRVVLPLKDLKDVNKRMATGEAK
FT                   ARKAKREMTEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTY
FT                   ATWWIRQAITRSIADQARTIRIPVHMIETINKMNRISRQILQETGAEPDPATLAQKMDM
FT                   PEDKIRKILKIAKEPISMETPIGDDDDSHLGDFIEDTATLAPSDAALHGSMRDVVKEVL
FT                   DSLTPREAKVLRMRFGIEMSTDQTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRADKL
FT                   KSFLEGQ"
FT   misc_feature    complement(254239..254922)
FT                   /note="HMMPfam hit to PF00140, Sigma-70 factor, score
FT                   1.6e-125"
FT   misc_feature    complement(254245..254325)
FT                   /note="PS00716 Sigma-70 factors family signature 2."
FT   misc_feature    complement(254791..254832)
FT                   /note="PS00715 Sigma-70 factors family signature 1."
FT   CDS_pept        complement(257155..259206)
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /gene_synonym="dnaP"
FT                   /gene_synonym="parB"
FT                   /locus_tag="BPP2841"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2185"
FT                   /db_xref="GOA:Q7W6R0"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6R0"
FT                   /protein_id="CAE38133.1"
FT                   /translation="MIPESFIQDLLARVDVVDVVGRYVQLRKGGANLLGLCPFHNEKSP
FT                   SFTVSPTKQFYHCFGCGAHGSAITFLMEHTGASFPEAVRTLAAAVGLTVPEENRSPRQQ
FT                   AESARRKAEVSRHTQVLDAAQAHYLRQLRGSPQAIAYLKQRGLTGEIAAHFGLGWSGTD
FT                   RHGLSHVFDNYEDPVLVEAGLVIESEDGRRYDRFRERVMFPIRNARGSLIGFGGRIIGK
FT                   GEPKYLNSPETPLFSKGHELYGLWEARLAIRQEGQVVVVEGYMDVVGLAQQGIANAVAT
FT                   LGTSTTPDHVKKLLRASDKVIFSFDGDAAGRRAAWRALQACLPVLRDDIAIRFLFLPAE
FT                   HDPDSYVRELGAEAFRTRLGEAVALSRFLLDELASRHTMGEAEGRASCLHEAKPLLAAI
FT                   PECALRVQIERELARLVQLTPEEMAQVLAQQPARPLASAAAPAQASAPAAGREGGPGHA
FT                   DEAPPDWAFEPVHDFEPDAYSVGAVDGEPGMPAAGGWQERKGRQGGDWKGKKGDWKGKK
FT                   GDWKGKKGDWKGRRDNDTGGYEGRRTMPSLARRLLCLLLAHPELVDTMGDQQLEVIDHG
FT                   PHLGLVRDLILLAQTSGARHVGALMEAADPDSDLYVVLKGLRADVLAQEDLPHPQTEWD
FT                   DALRRMEFDAARAEMAKLAESGLATDEARRRYLELSSRIMVLKNAGAH"
FT   misc_feature    complement(258193..258441)
FT                   /note="HMMPfam hit to PF01751, Toprim domain, score
FT                   9.5e-24"
FT   misc_feature    complement(258910..259203)
FT                   /note="HMMPfam hit to PF01807, CHC2 zinc finger, score
FT                   1.1e-58"
FT   CDS_pept        complement(259226..259465)
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="BPP2842"
FT                   /product="30S ribosomal protein S21"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2186"
FT                   /db_xref="GOA:Q7W6Q9"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W6Q9"
FT                   /protein_id="CAE38134.1"
FT                   /translation="MLSIKANHFMPIVRLKENEPFEAALRRFKRTIEKTGLLTELRSRE
FT                   FYEKPTAERKRKHAAAVKRHYKRIRSQQLPPRLY"
FT   misc_feature    complement(259274..259435)
FT                   /note="HMMPfam hit to PF01165, Ribosomal protein S21, score
FT                   1.3e-28"
FT   misc_feature    complement(259364..259402)
FT                   /note="PS01181 Ribosomal protein S21 signature."
FT   CDS_pept        complement(259718..260347)
FT                   /transl_table=11
FT                   /locus_tag="BPP2843"
FT                   /product="putative transferase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2187"
FT                   /db_xref="GOA:Q7W6Q8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Q8"
FT                   /protein_id="CAE38135.1"
FT                   /translation="MARPRLLFARPPRVVPQAALSFSFAGRYPPMSSPSSDDSHLWVTW
FT                   DDYHRLIERLALQVYQSGWQFDQILCLARGGVRVGDVMSRIFDVPLGILATSSYREAAG
FT                   TKQGDLDIAQFITITRGTLSGRVLLVDDMVDTGHTFNKVHTHLSEQFPAISELRSAVLW
FT                   WKGHSQATPDYFVDKLPTNPWIYQPFEDYDSLRPHQLEAWIRKGYK"
FT   misc_feature    complement(259799..260248)
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain, score 0.00049"
FT   misc_feature    complement(259931..259969)
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT   CDS_pept        complement(260371..261678)
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /gene_synonym="adeK"
FT                   /locus_tag="BPP2844"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2188"
FT                   /db_xref="GOA:Q7W6Q7"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W6Q7"
FT                   /protein_id="CAE38136.1"
FT                   /translation="MIRKMSKNVVVIGTQWGDEGKGKIVDWLAESVQGVVRFQGGHNAG
FT                   HTLWINGKKTILRLIPSGIMHDGVTCFIGNGVVLSPEALLREIEELEAAGLDVRSRLQV
FT                   SEICTLILPYHVAVDKAREARKGEGKIGTTGRGIGPAYEDKVARRALRVQDLFNPALFD
FT                   EKLAEVLDYHNFVLTQYLGAEPVSANEVRDQAMALAPALAPMVRDVSSNLFVLQQEGKN
FT                   LLFEGAQGALLDVDHGTYPFVTSSNCVAGAASAGAGVGPQALQYVLGITKAYTTRVGSG
FT                   PFPTELVDEIGTRLATIGKEFGSVTGRPRRCGWFDGAALKRSVRLNGISGLCITKLDVL
FT                   DGLETIQLGVGYRVNGEFRDVLPYGAHAVAQAQAVLEELPGWTESTVGITEYSKLPVNA
FT                   RRYLERVAEVCGVPIDLVSTGPDRNETIVLRHPFKG"
FT   misc_feature    complement(260395..261660)
FT                   /note="HMMPfam hit to PF00709, Adenylosuccinate synthetase,
FT                   score 9.5e-256"
FT   misc_feature    complement(261235..261270)
FT                   /note="PS00513 Adenylosuccinate synthetase active site."
FT   misc_feature    complement(261613..261636)
FT                   /note="PS01266 Adenylosuccinate synthetase GTP-binding
FT                   site."
FT   CDS_pept        complement(261743..262900)
FT                   /transl_table=11
FT                   /locus_tag="BPP2845"
FT                   /product="putative tRNA synthetase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2189"
FT                   /db_xref="GOA:Q7W6Q6"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W6Q6"
FT                   /protein_id="CAE38137.1"
FT                   /translation="MGNWLLPEGLADVLPAEARRIEELRRELLDLYRTYGFELVAPPLV
FT                   EYIDSLLSSTGSDLNLRTCKLVDQLSGRTLGVRADMTSQVTRIDAHLLNRAGVTRLCYC
FT                   GSVLHARPADLLSSRELLQIGAEIYGHAGFEADLEIIQLVMDTLATAGVRNARLDLCHS
FT                   GVMRAIFDADPQASRHAGDLCTLLREKDVPGLAELASRVDGLGEDTVRALQALATLYGG
FT                   PEIIARARRELPAVPGMAQALDALQALVDAMPGVTLSVDLADVGGYGYHSGVTFAVYGE
FT                   DWHDALVRGGRYDDVSRAFGRARPATGFSLDLRKLAAGLTPAEPARAVRAPWGQDPALT
FT                   DAVRRLRRSGEIVVQVLPGHEQGLDEFVCDRELALQDGAWTVRTL"
FT   CDS_pept        complement(263084..263983)
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="BPP2846"
FT                   /product="putative inner membrane-anchored protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2190"
FT                   /db_xref="GOA:Q7W6Q5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Q5"
FT                   /protein_id="CAE38138.1"
FT                   /translation="MQRLMPILVGLLVVLAVLSSCVFVVRERDYALVFSLGEVRQVISE
FT                   PGLYFKAPPPFQNVVTLDKRILTIESSDAERIQTSEKKNLLIDSYVKWRIADPRLYYVT
FT                   FGGNERAAQERLQAQIRDALNAAVNVRTVKDVVSAERDKVMAEILTNVAKRAEPLGVQV
FT                   VDVRLRRIEFAPEISESVYRRMEAERTRVANELRSIGAAESEKIRAEADRQREVIVAQA
FT                   YARAQGIMGEGDAQAGSIYAQAFGRNTEFYTYYKSLEAYRAAFGKTGDVLVVDPTSEFF
FT                   QFFKNPGKGAAGAPAPAN"
FT   misc_feature    complement(263378..263923)
FT                   /note="HMMPfam hit to PF01145, SPFH domain / Band 7 family,
FT                   score 2.4e-33"
FT   misc_feature    complement(263906..263962)
FT                   /note="1 probable transmembrane helix predicted for BPP2846
FT                   by TMHMM2.0 at aa 7-26"
FT   misc_feature    complement(263912..263983)
FT                   /note="Signal peptide predicted for BPP2846 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.934) with cleavage site
FT                   probability 0.520 between residues 24 and 25"
FT   misc_feature    complement(263921..263953)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(264002..265306)
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="BPP2847"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2191"
FT                   /db_xref="GOA:Q7W6Q4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Q4"
FT                   /protein_id="CAE38139.1"
FT                   /translation="MSRITKLFNLNDPGWGRGNNNGNGSEPPRRPQGGGDGPPDLDEVW
FT                   RDFNNRIGALFGRKGGGGNNRPNNRGGMTPPSPRGARIGLGIIALVLVLLWLASGFFIV
FT                   QEGQVAVVTQFGKYKSTAPAGFQWRMPYPIQNHEMVNVSQLRTFEVGFRGGSRNKVLPE
FT                   ALMLTTDENIVDMQFVVQYRLRADGAPDYLFKMRDPDESVRQAAETAMREIVGKKPMDF
FT                   VLYEGRTEVAAEVQNLMQQILDRYSAGIQISTVAIQNVQPPEQVQAAFDDAVKAGQDRE
FT                   RQINEGQAYANQVVPLASGQASRMIEQAEGYKAKVIGDAQGNASRFSSILNEYEKAPQV
FT                   MRERLYLETMQEVFTRASKVMVDTKGGNNMLYLPLDKIMQQAAQDAGKPTSSSLGLPGA
FT                   NQPAIPQAPARGSASGQSSSGSSTSNTLPRDRMSR"
FT   misc_feature    complement(264434..265009)
FT                   /note="HMMPfam hit to PF01145, SPFH domain / Band 7 family,
FT                   score 7.8e-33"
FT   misc_feature    complement(264992..265057)
FT                   /note="1 probable transmembrane helix predicted for BPP2847
FT                   by TMHMM2.0 at aa 83-105"
FT   CDS_pept        complement(265272..266309)
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="BPP2848"
FT                   /product="putative GTP-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2192"
FT                   /db_xref="GOA:Q7W6Q3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6Q3"
FT                   /protein_id="CAE38140.1"
FT                   /translation="MLAKGAGAEIVGTLTARRDRPDAKFFIGSGKVEEGVAMAGALLAD
FT                   IILFDQPLSPAQQRNLEREFNLRVVDRVALILDIFALRAKSHEGKLQVELAQLQHLATR
FT                   LTRMWSHLERQRGGIGMRGPGEAQLEMDRRMIGAKVKVLRERLDRVERQRVTQRRARAR
FT                   GGALSVSLVGYTNAGKSTLFNAMTRAGAYAADQLFATLDTTTRRIWIDGAGSVVLSDTV
FT                   GFIRDLPHNLIAAFRATLEETVHADLLLHVVDAASAQRDEQIAEVDKVLAEIGAAQIPT
FT                   ILVYNKIDRAGLEPRVDRDAHGTIARVFVSATERAGLDALRGAIAEIGQIVGNNVSNHQ
FT                   TLQSE"
FT   misc_feature    complement(265770..265793)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(266466..266702)
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="BPP2849"
FT                   /product="putative RNA-binding regulatory protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2193"
FT                   /db_xref="GOA:Q7W6Q2"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W6Q2"
FT                   /protein_id="CAE38141.1"
FT                   /translation="MSNKGQTLQDPFLNTLRKEHVPVSIYLVNGIKLQGQIESFDQYVV
FT                   LLRNTVTQMVYKHAISTVVPARAVNFQVEVPAE"
FT   misc_feature    complement(266508..266687)
FT                   /note="HMMPfam hit to PF03329, Host factor Hfq, score
FT                   6.2e-40"
FT   CDS_pept        complement(266840..267910)
FT                   /transl_table=11
FT                   /gene="his1"
FT                   /gene_synonym="hisC"
FT                   /locus_tag="BPP2850"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /EC_number="2.6.1.9"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2194"
FT                   /db_xref="GOA:Q7W6Q1"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W6Q1"
FT                   /protein_id="CAE38142.1"
FT                   /translation="MSRYWSPVVGTLSPYVPGEQPKLPDLIKLNTNENPYGPSPKALQA
FT                   IAAAAGDTLRLYPDPASDDLRGAIAAAVGVQADQVFVGNGSDEVLAHVFMALFRHGRPV
FT                   RFPDISYSFYPVYCGLYEIPYQVVPLTDDFRIDPADYQPGGQAAGGIIFPNPNAPTGRA
FT                   LARDEVERIVTANPDTVVVVDEAYVDFGAESVAPLVDRHDNLLVVQTLSKSRSLAGLRV
FT                   GFALGSRALIDGLERVKNSFNSYPIDRLASAGAQAAMQDQAYFDRTRQAVMATRERMSA
FT                   DLRALGFDVLPSAANFVFARHPEHDAAQLAARLRERSILVRHFRQARIDQFLRITVGTD
FT                   AQCEALIGALKKIFSS"
FT   misc_feature    complement(266849..267700)
FT                   /note="HMMPfam hit to PF00155, Aminotransferase class I and
FT                   II, score 1.1e-45"
FT   misc_feature    complement(267254..267283)
FT                   /note="PS00599 Aminotransferases class-II
FT                   pyridoxal-phosphate attachment site."
FT   CDS_pept        complement(267914..269269)
FT                   /transl_table=11
FT                   /locus_tag="BPP2851"
FT                   /product="putative GTP-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2195"
FT                   /db_xref="GOA:Q7W6Q0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W6Q0"
FT                   /protein_id="CAE38143.1"
FT                   /translation="MSFKPVVALVGRPNVGKSTLFNRLTRSRAALVADFSGLTRDRHYG
FT                   EGRVGDTPFLVIDTGGFEPVAKDGILAEMARQTRQAIAEADVVVFLVDARAGVNAHDHE
FT                   IARLLRKSGQQRVLLAVNKAEGMGVGNATGDFHELGLGEPHPISAAHGDGIVDLIEIAL
FT                   SGLVAPPADTGEQLEQDVVDHRIKLAIVGRPNVGKSTLINTLLGEERVIAFDMPGTTRD
FT                   AIEIDFERDGRKYTLIDTAGLRKRGKVFEAIEKFSVIKTLQAIEASNVVLLMIDAQAEV
FT                   SEQDAHIAGFVLETGRAVVVAINKWDGLDSDQRERIEREFQRKLRFLGFARMHTISALK
FT                   GQGVKPLLKSVNAAHAAAFAKLSTPRLTRELQAAVEQQPPPRKGIFRPKMRYAHQGGQN
FT                   PPLIVIHGNALDAVPDSYRRYLETRFRNAFDLAGTPLRIEFKSSRNPYVQEN"
FT   misc_feature    complement(268253..269050)
FT                   /note="HMMPfam hit to PF01926, GTPase of unknown function,
FT                   score 1.2e-57"
FT   misc_feature    complement(268673..268696)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(269216..269239)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(269296..270456)
FT                   /transl_table=11
FT                   /locus_tag="BPP2852"
FT                   /product="putative quinoprotein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2196"
FT                   /db_xref="GOA:Q7W6P9"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017687"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6P9"
FT                   /protein_id="CAE38144.1"
FT                   /translation="MMRNSRPGRAWRGAVVLTGLLALSGCSMFSSDDDRYKPAELTQYA
FT                   PGMSVRTAWTASVGSGSGLGFAPTVLGESIYAATPDGSVGKFDLLSGRAIWKSSADAKL
FT                   SAGAGSDGQTTAVATPDGEVIAFDDTGKIKWRARATSDVAIPPVVGYGVVVVRSGDYRI
FT                   QAFNAENGERMWSMQRPGPALALRSAAQMVLAEGLVISGLPGGKLLAINSATGNVQWEG
FT                   TVATPRGASDLERLTDVVGAPRIAGRLMCAVAYQGRIVCFDVSAGGRPIWAKDFSSASG
FT                   MVIDDRFAYAPDQGSVVSAFALDSGNNVWKQAELKNRLLTAPALLGEAVAVGDFEGYVH
FT                   FLSRSDGRLLARLSVGGGAIVSPPQTTSQGVLVQTGNGSLVMVRAN"
FT   misc_feature    complement(269362..269478)
FT                   /note="HMMPfam hit to PF01011, PQQ enzyme repeat, score 33"
FT   misc_feature    complement(269599..269718)
FT                   /note="HMMPfam hit to PF01011, PQQ enzyme repeat, score 86"
FT   misc_feature    complement(269755..269868)
FT                   /note="HMMPfam hit to PF01011, PQQ enzyme repeat, score
FT                   0.42"
FT   misc_feature    complement(269890..270003)
FT                   /note="HMMPfam hit to PF01011, PQQ enzyme repeat, score
FT                   0.015"
FT   misc_feature    complement(270010..270123)
FT                   /note="HMMPfam hit to PF01011, PQQ enzyme repeat, score
FT                   0.0018"
FT   misc_feature    complement(270127..270240)
FT                   /note="HMMPfam hit to PF01011, PQQ enzyme repeat, score 15"
FT   misc_feature    complement(270364..270456)
FT                   /note="Signal peptide predicted for BPP2852 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.976) with cleavage site
FT                   probability 0.966 between residues 31 and 32"
FT   misc_feature    complement(270379..270411)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(270459..271097)
FT                   /transl_table=11
FT                   /locus_tag="BPP2853"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2197"
FT                   /db_xref="GOA:Q7W6P8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="InterPro:IPR026039"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6P8"
FT                   /protein_id="CAE38145.1"
FT                   /translation="MAYDLEEQEKLDAIRAWWARYGTLILTLATLVVLAWGGWSGWKAY
FT                   QNYRANQAMGYFEALEDAARLGGADAATRIKAAAATLRTDYPATGYAGRGALIAAQALQ
FT                   SQQDVDGAREQLEWLAAQAKQPALQPVARLRLAGILLDQKQYDAALAQLNNPPASFAAL
FT                   FADRRGDVLAAQGKRDDARAAWQSAIDGLGTSNPLTQVVQLKLDALSGA"
FT   misc_feature    complement(270978..270998)
FT                   /note="PS00340 Growth factor and cytokines receptors family
FT                   signature 2."
FT   misc_feature    complement(270981..271046)
FT                   /note="1 probable transmembrane helix predicted for BPP2853
FT                   by TMHMM2.0 at aa 17-39"
FT   CDS_pept        complement(271099..272403)
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="BPP2854"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2198"
FT                   /db_xref="GOA:Q7W6P7"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W6P7"
FT                   /protein_id="CAE38146.1"
FT                   /translation="MVGMTKMTQVFQKVSAIRGMNDVLPGPSARWEKFEEIVRGWLRSY
FT                   GYRNVRTPVLEHTRLFARGIGEVTDIVEKEMYTFTDALNGDSLTMRPEMTAGIVRASIE
FT                   HNMLYDRPHRVYAIGPVFRHERPQRGRYRQFHQIDVEALGFAGPDVDAEMIVMLARLWK
FT                   LLGLQDVRLELNSLGQPAERAAHRAALIEHLERHQDILDEDGRRRMYSNPLRVLDTKNP
FT                   AMQEMADSAPRLFDFLGEESRSHFDGLCQRLADAGIEYRLNPRLVRGLDYYNLTVFEWV
FT                   TDRLGAQGTVCGGGRYDGLVELLGGKPAPAVGFAIGMERLLDLWEQSVEIEQPAECEVY
FT                   IVHQGEEGQRLAARVGEQLRDAGLDVIVHAGAAGFKAQFKRADASGARIAVILGGDEVA
FT                   SRTASIKHLRGPVGADAAQQQVPLAQLADVLKSKG"
FT   misc_feature    complement(271105..271410)
FT                   /note="HMMPfam hit to PF03129, Anticodon binding domain,
FT                   score 1.5e-10"
FT   misc_feature    complement(271897..272349)
FT                   /note="HMMPfam hit to PF00587, tRNA synthetase class II
FT                   core domain (G, H, P, S and T), score 3.3e-35"
FT   misc_feature    complement(271987..272040)
FT                   /note="PS00179 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 1."
FT   CDS_pept        complement(272438..273739)
FT                   /transl_table=11
FT                   /gene="ispG"
FT                   /gene_synonym="gcpE"
FT                   /locus_tag="BPP2855"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl4-diphosphate
FT                   synthase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2199"
FT                   /db_xref="GOA:Q7W6P6"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W6P6"
FT                   /protein_id="CAE38147.1"
FT                   /translation="MRYMQDSSMPCQDASPPDVGAAPRRATRAVRVQWGGRTVTVGGNA
FT                   SVVVQSMTNTDTADAVATAIQVKELAQAGSEIVRITVNTPEAAREVAAIREQLDRMGVE
FT                   VPLVGDFHYNGHKLLTQFPECAQALSKYRINPGNMGGGKRRDDNFAQMIEVACRHDKPV
FT                   RIGVNWGSLDHELMARKMDENSRRAQPWEAQAVMRDALVVSAISNARRAEELGLRSDAI
FT                   VLSCKVSHVQDLIAVYRDLSARCDYPLHLGLTEAGMGSKGIVASTAALAVLLQEGIGDT
FT                   IRISLTPEPGGDRTREVIVAQEILQTMGLRAFTPMVVACPGCGRTSSTFFQELADSIQS
FT                   FLRRQMPLWRTRYPGVESMNVAVMGCVVNGPGESRHADIGISLPGTGEVPAAPVFIDGE
FT                   RTVTLKGDHIAEEFQAIVEDYVARRYGAGITHQE"
FT   CDS_pept        complement(join(273746..273862,273866..274252))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2856"
FT                   /product="putative membrane protein (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2200"
FT                   /db_xref="PSEUDO:CAE38148.1"
FT   misc_feature    complement(274196..274252)
FT                   /note="Signal peptide predicted for BPP2856 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.945) with cleavage site
FT                   probability 0.476 between residues 19 and 20"
FT   CDS_pept        complement(274249..275397)
FT                   /transl_table=11
FT                   /locus_tag="BPP2857"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2201"
FT                   /db_xref="GOA:Q7W6P5"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W6P5"
FT                   /protein_id="CAE38149.1"
FT                   /translation="MESVERVNLLGLDGAALSELVGQWGGKPFRARQLQRWVHQRGADS
FT                   FDAMTDLARDFRAQLARDCVIEALPVNTEQRSSDGTRKWLFDVGQGNAIETVFIPEDDR
FT                   GTLCISSQAGCVVNCRFCSTGHQGFNRNLRASEIIGQLWWAKRVLEAAADTARLPGGKA
FT                   GEDTRVISNVVMMGMGEPLLNYDQVLPALRLMLDDNAYGLSRRRVTVSTSGVVPMMDRL
FT                   SQDCPLALAVSLHAPNDALRDELVPLNRKYPLNALLAACERYLAHAPRDFITFEYCMLD
FT                   GINDTDQHARELIQLARQVRCKLNLIPFNPFPASGLKRSPSARVRVFAQRLMDAGIVTT
FT                   VRKTRGDDIDAACGQLAGEVRDRTRITERNATRTIPIQQVHA"
FT   CDS_pept        complement(275425..275850)
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="BPP2858"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2202"
FT                   /db_xref="GOA:Q7W6P4"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W6P4"
FT                   /protein_id="CAE38150.1"
FT                   /translation="MSIERTLSIIKPDAVAKNVVGQIVARFEQAGLKVIAARMQQLSRT
FT                   DAERFYAVHKERPFFKDLVDFMVSGPVFVQVLEGESAIQKNRDLMGATDPKKAAPGTIR
FT                   ADFADSIDANAVHGSDAPETAAVEVAFFFPEINIHSR"
FT   misc_feature    complement(275431..275841)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00334, Nucleoside diphosphate
FT                   kinase, score 5.6e-69"
FT   misc_feature    complement(275485..275511)
FT                   /note="PS00469 Nucleoside diphosphate kinases active site."
FT   CDS_pept        276172..279054
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="BPP2859"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2203"
FT                   /db_xref="GOA:Q7W6P3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W6P3"
FT                   /protein_id="CAE38151.1"
FT                   /translation="MTDAAPNQPVNESQKLSKSFEPAEIETRWYDEWAKRGYFDAGRHV
FT                   ETGTDPQPYVIQFPPPNVTGTLHMGHAFNQTIMDGLVRYHRMLGDDTVFVPGTDHAGIA
FT                   TQIVVERQLDAQKVSRHDLGREKFVEKVWEWKEQSGSTITGQVRRLGASADWPREYFTM
FT                   DARMSRGVAETFVRLYQQGLIYRGKRLVNWDPKLLTAVSDLEVQSEEVDGHMWHILYPF
FT                   VDGPQTITDQDGNTVTLRGMTIATTRPETMLADGALCVHPDDPRYKHLLGKLVELPLCD
FT                   RNIPIIADDFVDPDFGTGCVKITGAHDFNDYACALRHDIPLIVIFTLDAHINENGPKQF
FT                   QGLERYEARQAVVAELQAQQYLVKVEPHKMMQPKGDRTGVVLEPMLTDQWFVAMSKPAP
FT                   ASTLNPGKSITEVALEAVADGRIAFYPENWATIYNQWLNNIQDWCISRQLWWGHQIPAW
FT                   YSEDGQVFVARSEQEAQEQARAAGVAGPLTRDPDVLDTWFSSALVPFTTFGWPEDTPDL
FT                   RRYLPSSVLVTGFDIIFFWVARMVMLTMHMTGSVPFKHVYVHGLIRDADGQKMSKSKGN
FT                   TLDPVDLIDGIDLEGLVRKRTFGLMNPKQAGAIEKATRRQYPDGIPAFGTDALRFTMAA
FT                   YATLGRNINFDLKRCEGYRNFCNKLWNATRFVLMNTEGHALDGDGGELSFADRWIVSQL
FT                   QALEAEVERGFADYRFDNVANALYRYVWDEYCDWYLELAKVQIQQGTPAQQLGTRRTLI
FT                   RVLEAVLRLAHPVIPFITEELWQKVALVAGKRTAGAVASVSVQPYPRANPQAVDAEAEA
FT                   AVAELKSQVEAVRALRGEMNLSPAQRVPLVAEGPTDVLSRNAPYLAALAKLSEVEVVAA
FT                   LPDAGAPVQVVGDARLMLHVEIDVAAECARLDKEIARLEGEIAKANGKLGNASFVERAP
FT                   AAVVEQEKARLAQFSETLKKVRGQRVKLGA"
FT   misc_feature    276253..278109
FT                   /note="HMMPfam hit to PF00133, tRNA synthetases class I (I,
FT                   L, M and V), score 6.8e-246"
FT   misc_feature    276352..276387
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT   CDS_pept        complement(279147..279902)
FT                   /transl_table=11
FT                   /locus_tag="BPP2860"
FT                   /product="putative outer membrane (scaffolding) protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2204"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6P2"
FT                   /protein_id="CAE38152.1"
FT                   /translation="MKHAWWRATVVCLAGTLGTAAQAQNYIGISAAVAPRYEGAKDYRF
FT                   LPVPLIHYENGPFFISPRAGLPSAGLKWQLGEHVHAGVFVGAHLGRDADDSDILHGLDD
FT                   IDMHATYGAYIEWQYGALGLGAAYRQAARSGYGGVGELRATYRVWQTGRDSVSVGARTE
FT                   WASDDYMRTWYGISASQAARSEAGLRRYSASSGFKSGGIFASWTHRLDQRWAVNATAGV
FT                   NTLFGDARDSPVSERSTNYFGGVGLTYAF"
FT   misc_feature    complement(279834..279902)
FT                   /note="Signal peptide predicted for BPP2860 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.981 between residues 23 and 24"
FT   CDS_pept        280032..280703
FT                   /transl_table=11
FT                   /locus_tag="BPP2861"
FT                   /product="putative two-component response regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2205"
FT                   /db_xref="GOA:Q7W6P1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6P1"
FT                   /protein_id="CAE38153.1"
FT                   /translation="MTHLLLVEDDPMLGDALQTALQRELGARVDWVRDGAQAQLALVDH
FT                   AYQLILLDIGLPGQSGLALLRALREGYDTTPVLLVTARDQLSDRIRGLDGGADDYIVKP
FT                   FELDELLARLRAVLRRSHNQVAPLMRHGELLVDPAARQVSRAGRPVALSQSEYRTLLAL
FT                   MQRRGRTVSREQLEHDVYGASVALESNTVAVYVHQLRRKLGDDLIETVHGYGYRIGQEG
FT                   A"
FT   misc_feature    280035..280397
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 1.4e-35"
FT   misc_feature    280473..280676
FT                   /note="HMMPfam hit to PF00486, Transcriptional regulatory
FT                   protein, C terminal, score 7.6e-20"
FT   CDS_pept        280700..282049
FT                   /transl_table=11
FT                   /locus_tag="BPP2862"
FT                   /product="putative two component sensor kinase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2206"
FT                   /db_xref="GOA:Q7W6P0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6P0"
FT                   /protein_id="CAE38154.1"
FT                   /translation="MKSLKRRILTAVLAALLLNWGVWLGWQTFEMGRRETGTWDARLRD
FT                   VASQAVLSMPLDIMERSEPTGFRLPEPVQTSELRMSFQIWSMASRRQIVHSVNAPPGPL
FT                   NPAFADGYADVELDGEPWRVYSVTDAEGRIQAQAGHSLAARRGDILQWLGASLKASALL
FT                   FLFLALSILLAIDRAMRRLDRVGRAVQQRDPLDLAPLPDGDVPAELRPLITAINRQFGR
FT                   VHTALARERRLIADAAHELRTPLAALKMQAEVALGARHADERHSALCKLLDAARRAARL
FT                   SEQLLDQARLDAMEASVPGGEVDLATLTAMIIADHQARAQARHQRIQLDVRPAFVSGDL
FT                   DSLGILVSNLVDNALRYTPEGGRVVVYCGPLENGAVGLRVLDNGPGVPADRHERIFERF
FT                   YRQPGQAQRGGGIGLSLVAQIARLHRARIDCGAGLDGRGFGIAVGFAPRS"
FT   misc_feature    280700..280771
FT                   /note="Signal peptide predicted for BPP2862 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.978) with cleavage site
FT                   probability 0.624 between residues 24 and 25"
FT   misc_feature    join(280718..280786,281153..281221)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BPP2862 by TMHMM2.0 at aa 7-29 and 152-174"
FT   misc_feature    281144..281374
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 0.022"
FT   misc_feature    281384..281581
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 8.5e-11"
FT   misc_feature    281711..282043
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase, score 5.3e-22"
FT   CDS_pept        282091..282597
FT                   /transl_table=11
FT                   /locus_tag="BPP2863"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1843"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6N9"
FT                   /protein_id="CAE38155.1"
FT                   /translation="MGLHSLNRCTTMTASISARVAELGLTLEPANAPAANYVPFVRDGN
FT                   LLYISGQVPRVDGKPVHLGRLGDSVSDEEGVQAARQAALGVLAQLAAATGDRLQGVARV
FT                   VRLGVFVAAAPDFNRHSAIANGASDLMVNVFGEAGRHARSAVGVASLPNGVAVEVEAVV
FT                   ALAQA"
FT   misc_feature    282175..282585
FT                   /note="HMMPfam hit to PF01042, YjgF family, score 7.4e-18"
FT   CDS_pept        282623..283831
FT                   /transl_table=11
FT                   /locus_tag="BPP2864"
FT                   /product="probable class-V aminotransferase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1842"
FT                   /db_xref="GOA:Q7W6N8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6N8"
FT                   /protein_id="CAE38156.1"
FT                   /translation="MPATLTDELVAVLRARTPGAQGAFIHFNHAGASLPSAGTLQAIEA
FT                   HLRLEATQGPMEAGVRAREQAERARLLAARLLNAQPAEVALTTGNSAGWGAAFAALGPW
FT                   RAGDRILVARHEWSGNLAAMRLAAQRAGATIETIASDESGAVDPGALQAMLDERVRLIA
FT                   LTWLPANGGLVNPAAAVGRIARRHGIAYFVDAAQAVGQLPIDVAEVGCDVLSGTGRKAL
FT                   RGPRGTGLLYVRQAFLERLAPAWVDTWSAPLGEDGCPIVRGDAARFESAENSVALRCGL
FT                   AHALHEALELDIASIRARIDAVATRLRTRLAALDGITLLDQGRVRSGLIAFDVAGWQAD
FT                   AVQRELARQGIALGCNGVAYTPLDMQARGLRQIARASVSYLTTEAEIDALLDALAALAR
FT                   RTP"
FT   misc_feature    282728..283792
FT                   /note="HMMPfam hit to PF00266, Aminotransferase class-V,
FT                   score 1.3e-08"
FT   misc_feature    283253..283315
FT                   /note="PS00595 Aminotransferases class-V
FT                   pyridoxal-phosphate attachment site."
FT   CDS_pept        complement(283828..284601)
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="BPP2865"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /EC_number="2.1.1.31"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1841"
FT                   /db_xref="GOA:Q7U374"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7U374"
FT                   /protein_id="CAE38157.1"
FT                   /translation="MRFDVVTLFPDMFGLVRDQGVTGRAHAQGLWALHAWNPRDFTQDV
FT                   HRTVDDRPYGGGPGMVMMAAPLEAAVAAAQAARAAQGLQAAPVILLSPAGRRYDQAEAT
FT                   TLAAGTGAIFICGRYEGVDQRFIERCVTHELSLGDFVLSGGELAALAMMDAAVRLLPGV
FT                   LNDGDSALQDSFNAALDGLLDSPHYTRPEVYEGVPVPQPLLSGHHANIARWRREQSLRL
FT                   TASRRPELIERARGEGRLSKADERFLAGLAGERKS"
FT   misc_feature    complement(283888..284538)
FT                   /note="HMMPfam hit to PF01746, tRNA
FT                   (Guanine-1)-methyltransferase, score 6.6e-103"
FT   CDS_pept        complement(284601..285224)
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="BPP2866"
FT                   /product="16S rRNA processing protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1840"
FT                   /db_xref="GOA:Q7W6N7"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W6N7"
FT                   /protein_id="CAE38158.1"
FT                   /translation="MSEAAHSGAAPADLVELGRIASAYGVKGWVKVQPHSAQAEVLRTV
FT                   SHWWLTRPAPQAARGVVASVPRAYQVLQARVHGGAVVAQLAGIDDRDQAEALRGCLVQA
FT                   ARSAFPAPADDEYYWVDLIGCALYSDADGESRLLGVVDEVFDNGAHAVLKVLRQQLQPG
FT                   QPGPVPLVDPKGRPLEELVPFVRAHIRHVDLAARRIDSDWPLDY"
FT   misc_feature    complement(284607..285179)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF01782, RimM, score 3e-25"
FT   CDS_pept        complement(285390..285695)
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="BPP2867"
FT                   /product="30S ribosomal protein S16"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1839"
FT                   /db_xref="GOA:Q7W6N6"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W6N6"
FT                   /protein_id="CAE38159.1"
FT                   /translation="MLEFPVFHNQFKGLPMLVIRLARGGSKKRPFYNLVATDSRNRRDG
FT                   RFVERVGFYNPVAAEGTENLRIALGRVQYWTGNGALLSPAVERLVKEYSAKVSAAA"
FT   misc_feature    complement(285447..285629)
FT                   /note="HMMPfam hit to PF00886, Ribosomal protein S16, score
FT                   3.5e-25"
FT   CDS_pept        join(285954..286154,286158..286535)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2868"
FT                   /product="putative exported protein (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1838"
FT                   /db_xref="PSEUDO:CAE38160.1"
FT   misc_feature    285954..285977
FT                   /note="PS00443 Glutamine amidotransferases class-II active
FT                   site."
FT   misc_feature    285954..286046
FT                   /note="Signal peptide predicted for BPP2868 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.796 between residues 31 and 32"
FT   CDS_pept        complement(286604..286858)
FT                   /transl_table=11
FT                   /locus_tag="BPP2869"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1837"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6N5"
FT                   /protein_id="CAE38161.1"
FT                   /translation="MSASDTGGLPSYQHEVDASGLTCPLPILRAKKALAQMESGQVLRV
FT                   VTTDPNAIRDFQAFARQTGNTLLAQREAEGRGEHFLQRR"
FT   misc_feature    complement(286610..286825)
FT                   /note="HMMPfam hit to PF01206, Uncharacterized protein
FT                   family UPF0033, score 2.1e-19"
FT   CDS_pept        complement(286845..289469)
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /gene_synonym="lovB"
FT                   /locus_tag="BPP2870"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1836"
FT                   /db_xref="GOA:Q7W6N4"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W6N4"
FT                   /protein_id="CAE38162.1"
FT                   /translation="MKSSEIRQKFLQFFQSKGHTIVPSSSLVPANDPTLLFTNSGMVQF
FT                   KDVFTGKEARAYKRATSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRE
FT                   AIQYAWELLTQVYRLPAEKLWVTVYQEDDEAYDIWAKEVGVPAERIIRIGDNKGARYAS
FT                   DNFWQMADTGPCGPCSEIFYDHGPEIWGGPPGSLEEDGDRYIEIWNLVFMQFERDAAGN
FT                   MERLPKPCVDTGMGLERIAAVLQHVHSNYEIDLFQKLIAAAARETGVKDLADNSLKVIA
FT                   DHIRACAFLIVDGIIPSNEGRGYVLRRIVRRALRHGYKLGQTKPFFHRLVPDLVAEMGE
FT                   AYPELAQVAERVAQVLRQEEKRFGETLEHGMKILDGALAKVAKGDPLDGTTLFTLYDTY
FT                   GFPVDLTADICRERGVEVDMAGFEAAMQRQREQARAAGKFKMAEGLSYEGAETRFEGYE
FT                   SLELSGVKVTALYVEGTQVEQVSAGQDAVVVLDATPFYAESGGQVGDTGLLEAGGVRFA
FT                   VADTLKIQPGVFGHHGTLEAGALKVGDTLLARVDAVRRARTVRNHSATHLMHKALREVL
FT                   GAHVQQRGSLVDPDKTRFDFAHDAPMTAEQIARVEAIVNAEVLANQATEAKVMAYDDAV
FT                   KGGAMALFGEKYGDTVRVLDIGFSRELCGGTHVRRTGDIGLFKVVSEGGVAAGVRRIEA
FT                   ITGDNALAWVQDQNVLLQRAAGVLRAPAHELPERIAQVQEQLKALEKELEQARTKLAAS
FT                   AGNDLAATATVEVKGIKVLAASIGDVDPKALRGMVDNLKDRLKPAVVLLAAGSADGKIS
FT                   LVGGVTADLTGRIKAGDLVGFVAGQVGGKGGGRPDMAMGGGTDLAALPAAVASVQKWVD
FT                   ERL"
FT   misc_feature    complement(286866..287084)
FT                   /note="HMMPfam hit to PF02272, DHHA1 domain, score 4.4e-14"
FT   misc_feature    complement(287364..289457)
FT                   /note="HMMPfam hit to PF01411, tRNA synthetases class II
FT                   (A), score 0"
FT   misc_feature    complement(288741..288770)
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT   CDS_pept        complement(289541..290359)
FT                   /transl_table=11
FT                   /locus_tag="BPP2871"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1835"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6N3"
FT                   /protein_id="CAE38163.1"
FT                   /translation="MRSAHTQGGLALLELAVAAALAAMAAVWAANRLVQDAQDAAARGA
FT                   GVWLGEIQRGLDQLLQRYFDTLADGLAPRDERGRALFRDAWRPTLPELQAAGLLARSLP
FT                   RRSPLGTGVIMLVRRDPHCPRAGCRLDALAWLDRPLLDGHGQVDLMRMAPLVAATAGRG
FT                   GFAVAGGVRGAAFRFANPPWPDVARLPAGTPLAWAGLAAGKASPAFGGAYSVNSHVGCR
FT                   SYSGHTSRNPLTGQCSCPPGYASVIMAQATDRVDGAPGFTSFVCVRPGKE"
FT   misc_feature    complement(290285..290359)
FT                   /note="Signal peptide predicted for BPP2871 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.577 between residues 25 and 26"
FT   CDS_pept        complement(290356..290961)
FT                   /transl_table=11
FT                   /locus_tag="BPP2872"
FT                   /product="putative fimbrial protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1834"
FT                   /db_xref="GOA:Q7W6N2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR014911"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6N2"
FT                   /protein_id="CAE38164.1"
FT                   /translation="MSHTILSGRQAGFSLVEVSIVTAIVLLVAIIGIPAIGSYVIESKV
FT                   PRVGEELQRFVARTKANAQGDGAAPYTGIGTASLAHALRDSSVVSVRGEGASATVAHGL
FT                   GGQGAGAHGVISVAPAAPGGAPPGSAFTLTLTNVNGAACPALASVMQRVSDIIAVQGKA
FT                   GPVVVKNALAVPALPYRAQAAQAQCVAGDRNTFAFTAR"
FT   misc_feature    complement(290857..290922)
FT                   /note="1 probable transmembrane helix predicted for BPP2872
FT                   by TMHMM2.0 at aa 13-35"
FT   misc_feature    complement(290869..290931)
FT                   /note="PS00409 Prokaryotic N-terminal methylation site."
FT   CDS_pept        complement(290999..292132)
FT                   /transl_table=11
FT                   /locus_tag="BPP2873"
FT                   /product="putative general secretion pathway protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1833"
FT                   /db_xref="GOA:Q7W6N1"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6N1"
FT                   /protein_id="CAE38165.1"
FT                   /translation="MAEHAALALAWRAAGALGQRLDAWRFGAERGDYYEYLADMLEGLQ
FT                   GRQTLRDIFETDAARHGEASVRGRLARRWLQRYQDCGGDLRATWARCLPEGDCTLLALA
FT                   QSAGGGALGIVLRDLAHLTRLTQGMRREFCVTIAAGLVAMTVACALLAAVPAFSAPRLR
FT                   LVFQAVPPDYHGAWSAGLFALARYVEAAWPAAVAALTAAVALVCWSLPRYAGRARVFLD
FT                   RWQPWRLYRDMQAIRFLALATVLLRQRGNIDTRLRTALLVQGADAPPWLAWHLERMLLR
FT                   VDAGVVDASVFDTGLFEPAHAWFMADMVAAHGLADGLARARTRVEAHMLPRLRRQAQGL
FT                   RWVLLLGAVGAVLALAFWHYAAIDDLRRALVSFYASQ"
FT   misc_feature    complement(join(291050..291115,291503..291568,
FT                   291668..291733))
FT                   /note="3 probable transmembrane helices predicted for
FT                   BPP2873 by TMHMM2.0 at aa 133-155, 188-210 and 339-361"
FT   CDS_pept        complement(292125..293840)
FT                   /transl_table=11
FT                   /locus_tag="BPP2874"
FT                   /product="putative general secretion pathway protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1832"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6N0"
FT                   /protein_id="CAE38166.1"
FT                   /translation="MRIRSHRPVLHSPCTTLAPFVADHEALGRLRPAFVRALAREFDLG
FT                   ALAGRLCPVLLEGSYAALFALADYVHGDQADELERLMRKRGYRLAAPARYVLPSPLLLA
FT                   VAREAAGAPGLHAADHPAQRRTALQALFFDMVRWGVRHGASDLHLHADRRAATAQVRYT
FT                   VGGAYVAAPCFNGLSHACLLEILAVAWMDVRAGNGAVFDPRAEQQGRIALQVDEVPVVL
FT                   RWASLATDHGPSVCLRILRQDPPQGGASLAELGYLPAQAATLERACQRAGGAVVLAGTV
FT                   GAGKSTTIATMLRGLPAERKLVTLEDSAEYAIANALQNSVSRSLEGEAGAPFDAKLLTI
FT                   KRSAMHDLYLGEVRDRQTGRVFTDLAGSGVSLYTTTHAGSALLIPERLASDFIGVSRDF
FT                   LATPGVLKLLVYQTLLPRLCPACALPLAMLWHRGAGRSHAQRLAWRCWAARLRRAGVAL
FT                   AQARVRNPAGCAACAGAGLPALRGYAGRTVVAELLEPETDAVLLDLIRRRDNPALRRLL
FT                   GRRARRQPPDAPLRAVDCAWRKVEAGVVDPRLVERCFALSPALRTPVGAEDGHG"
FT   misc_feature    complement(292575..293489)
FT                   /note="HMMPfam hit to PF00437, Type II/IV secretion system
FT                   protein, score 1.9e-09"
FT   misc_feature    complement(292983..293006)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(293837..294220)
FT                   /transl_table=11
FT                   /locus_tag="BPP2875"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1831"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6M9"
FT                   /protein_id="CAE38167.1"
FT                   /translation="MRELLRRETLAAAQPPRPAAPAPWSDAPAARKAAPAAPGPRADRI
FT                   VLLAIYGVGAALRAEVSINRRHWRYLAGQRRPSGQAPEARYQLEAIAVPCVHLRSGAVR
FT                   RTACLAAAASLDNGAASAAGAAP"
FT   CDS_pept        complement(294318..295592)
FT                   /transl_table=11
FT                   /locus_tag="BPP2876"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1830"
FT                   /db_xref="InterPro:IPR009663"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6M8"
FT                   /protein_id="CAE38168.1"
FT                   /translation="MRAATHPPLVLQQTQGGPMLAFGLTWFAVLGSHAALQGRARARAL
FT                   RATHYLVGGRHAVAAGCARLPRRYGALALHSAAQAYASLHPDGAQAGVASLPDGQGWLI
FT                   AVQDGAVLASADRLFADVAQAQACLRTLLAQRPDLREVPAQAALDTLLARPDPSARLAP
FT                   LASRWSRAPVAARAVVLALAVAGGASLWRGLRQGPPPAAPDPRAVWRAAQAEFLRGWPV
FT                   HTSSELARVLDTLQALPLRVAGWALRQAQCVPGPAWHCDADYHRVDAAATSLAFAAAVP
FT                   PGWQMRLHTLEHTRVAWTLAGDQHGLDRTAPASPADTLALAATLQRASAAFTHVSVGAA
FT                   QALAGPAWDGPPELAPPAAPELRRREVVLDGPLRSLALVWPLPAPIGWATVSLRVVPDA
FT                   IATLRASVLSLHLQGSLYEQTTSRS"
FT   CDS_pept        complement(295596..297173)
FT                   /transl_table=11
FT                   /locus_tag="BPP2877"
FT                   /product="lipoprotein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1829"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6M7"
FT                   /protein_id="CAE38169.1"
FT                   /translation="MKARRLAMAGLSLALGGCSLSQQMQAMRDAATSLRARLLEGQQAV
FT                   GRAGERPAREAAQDVARPWLAGRAQPLAREVLLPPALRADVDTTLLFAGKATLLVLAER
FT                   LHRATGIAVRVHPDALLPRAAFLPRLAGPAELAAEPPAQAELRAGPRPLADTLDALAAQ
FT                   LYVHWRYHRGAIEFYRTETRVFDVRTLALAASAQARLGRAGSGETGSFGHASSTVLSAD
FT                   AGKALQAVRDRVAAFLTRAGVIAEIEAGGSTLAVTDTPEALARIEKYLQGENRALTRRV
FT                   RLVFEELTVRTTAAAEGGIDWQAVYASARAAASYVMPGGAGAAGALGARVLAGPWRDAR
FT                   ALIAALSTMGAVLRHRSIPMLTLNRRAVTHAVRTTFSYVDQVQRLSPTAAAPGGRDAVP
FT                   GLAVQQKRETVGTFLTLLPKARDDGRILLSISYDNTIAQPLRTLTFGEGGQQVSLQQIA
FT                   IDGSGIVQQVELLPGQPVILSGFDHSEDQYERHRLFPDAPLAAGGHDRTARERVTTVVM
FT                   VTAQIDEG"
FT   misc_feature    complement(295602..296441)
FT                   /note="HMMPfam hit to PF00263, Bacterial type II and III
FT                   secretion system protein, score 0.0024"
FT   misc_feature    complement(297111..297173)
FT                   /note="Signal peptide predicted for BPP2877 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.463 between residues 21 and 22"
FT   misc_feature    complement(297120..297152)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(297170..297931)
FT                   /transl_table=11
FT                   /locus_tag="BPP2878"
FT                   /product="putative lipoprotein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1828"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR018927"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6M6"
FT                   /protein_id="CAE38170.1"
FT                   /translation="MVRSLSIVCLLAVLQACAGPRPAAVAAAWDEAPAGQYRFDWQLSG
FT                   DPAVAPLQVFDDARRIWLQFAPGQPIPAIFAHGAGGERPVPYLRRDPYIVVDGAWPALS
FT                   LRGGRYVARIQRSGAPIPAGAPVVRAEGPAPVPATPSAVAPAEAAEAAPPAPRFRAAPP
FT                   DLTLRAVLARWARAAGWTFEAEHWALDVDIPLAGKAELPGDFKTAVRALLAATELSEPP
FT                   AQPCFYANRVLRVVPLAQACDRTRAAAPGLT"
FT   misc_feature    complement(297671..297703)
FT                   /note="PS00133 Zinc carboxypeptidases, zinc-binding region
FT                   2 signature."
FT   misc_feature    complement(297854..297931)
FT                   /note="Signal peptide predicted for BPP2878 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.403 between residues 26 and 27"
FT   misc_feature    complement(297881..297913)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(298109..299464)
FT                   /transl_table=11
FT                   /locus_tag="BPP2879"
FT                   /product="putative amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1827"
FT                   /db_xref="GOA:Q7W6M5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6M5"
FT                   /protein_id="CAE38171.1"
FT                   /translation="MTSTDQHIARAGVAELARGIARGAFTPAEVTDVFLRRIQDLNPAI
FT                   GAFVAVYEDEARHAARQATQALAQGQRLSPLHGIPFAVKDIVDVAGRFTTYGSRTGAGR
FT                   QAGATAEYVRALLDAGMILLGKTHTVEFAFGGWGTNQRMGTPRNPLRADVPCATGGSSS
FT                   GSGAAVGAQMVPFAVGTDTGGSIRIPSAFCGLTGMRPSMGRHSGAGVMSLSHTLDTIGP
FT                   LARTVEDVQMLDDLLTGKTATDTAQPGSQAVARVRDARIGVLGAQWLGAIEPEVAHAYA
FT                   QSLRAFEAMGATLVELALPFDREAFAQLTSTLIACEGLQFAGKYVHDPLSGMDEDVRAR
FT                   FLVGDRYDAAAYAELLGRRSAMIDTFTQAMAGVKALLMPTTPCVAQPLAGLEQSPYNPA
FT                   VYTRMPAWLGCCALAVPNGSGAHGLPTSLQIVGLPESDRLVMSLGRAYQEYA"
FT   misc_feature    complement(298142..299380)
FT                   /note="HMMPfam hit to PF01425, Amidase, score 5.6e-95"
FT   misc_feature    complement(298370..298420)
FT                   /note="PS00216 Sugar transport proteins signature 1."
FT   misc_feature    complement(298895..298990)
FT                   /note="PS00571 Amidases signature."
FT   misc_feature    complement(299084..299107)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(299461..301095)
FT                   /transl_table=11
FT                   /locus_tag="BPP2880"
FT                   /product="probable ATP-binding component of ABC
FT                   transporter"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1826"
FT                   /db_xref="GOA:Q7W6M4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6M4"
FT                   /protein_id="CAE38172.1"
FT                   /translation="MIENTPKQRVLEVSGLAIRAGARTLVQDVTLSLAQGEILCLVGES
FT                   GSGKSLTASAVMGLLPGNLGVSAGSIRLDGEDLTAASPARMQALRGDRMAMVFQEPMTS
FT                   LNPLMRVGRQIAEVLQVHRPDLGAGQVRARVLELMGDVRLPTPEALMDAFPHQLSGGQR
FT                   QRIMIAMALALEPALIIADEPTTALDVTTQAQVLKLFRQLLAKHSSAVLFITHDFDVVR
FT                   DIADHVAVMQLGRIVEQGPAGQVLDAPRHDYTRKLLAAVPSGVPKTQQNASSDELLSVS
FT                   GLNLVYESRGLLGPARRTHAVADVGFTLKKGETLGVVGESGSGKSTLGRCITRAHAPTS
FT                   GRIVFDGVDIAGLSGKALRAVRRRVQMVFQDPYRSLNPRRRILHALIEGPIESGVDRKA
FT                   ACARAAELMALVGLPADGLQRYPHQFSGGQRQRICIARALAMEPDLIVADEAVSALDVS
FT                   VQAQVLELFEDLQKRLGFAMIFITHDLRVAAQVCDRIGVMQKGRLLELGPVRQVIHAPQ
FT                   HPYTRHLFDSLPGRVGQAAEPAMELQA"
FT   misc_feature    complement(299593..300162)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   5.7e-61"
FT   misc_feature    complement(299779..299823)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(300118..300141)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(300394..300990)
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.6e-57"
FT   misc_feature    complement(300580..300624)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(300946..300969)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(301088..301918)
FT                   /transl_table=11
FT                   /locus_tag="BPP2881"
FT                   /product="probable probable inner membrane component of
FT                   binding-protein-dependent transport system"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1825"
FT                   /db_xref="GOA:Q7W6M3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6M3"
FT                   /protein_id="CAE38173.1"
FT                   /translation="MTSILRHNRLALLGGGVLLLMVAISVAASWIASMDPAMMQPRMRL
FT                   TPPGEAFLLGTDALGRDVYSRVVHGSRMSLAIGALVVVITIAIGTLIGLVAGASRIMDR
FT                   VLMRIMDGVMAIPGILLAVALVSLFGASLASVVIAIAVPEIPRVVRLVRSVVLSVREEP
FT                   YVEAAVGLGVPYPKVVWRHILPNCFAPLIVQASYVFAAAILLEAVLGFLGVGFPPEIPT
FT                   FGNILAEARPVFQRAPWATVAPGLLLAVTVLAVNLLGDGLRDSLDPKLARRAND"
FT   misc_feature    complement(join(301142..301207,301271..301336,
FT                   301496..301561,301625..301690,301817..301882))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BPP2881 by TMHMM2.0 at aa 12-34, 76-98, 119-141, 194-216
FT                   and 237-259"
FT   misc_feature    complement(301232..301453)
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 6.1e-05"
FT   misc_feature    complement(301364..301450)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   misc_feature    complement(301838..301918)
FT                   /note="Signal peptide predicted for BPP2881 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.690 between residues 27 and 28"
FT   CDS_pept        complement(301936..302880)
FT                   /transl_table=11
FT                   /locus_tag="BPP2882"
FT                   /product="probable inner membrane component of
FT                   binding-protein-dependent transport system"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1824"
FT                   /db_xref="GOA:Q7W6M2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6M2"
FT                   /protein_id="CAE38174.1"
FT                   /translation="MQILRLLFLRLASAIPVVLVVVTVVFLLVRLTGDPATILAGDMAS
FT                   PEVVASVRADLGLDRPLLGQYAQWLWDLLQGNLGTSIVTKQPVATLIGERLESTLVLSL
FT                   SALVVTVLLAVPLGVLAAWRHNTLVDRVVMIYAVIGFSLPSFVVGYLLILMFSVWLGWL
FT                   PVQGYVSITDDIWLAAQHLVLPTLALAIFYMSLISRVTRASVLEALNEDFVRTAKAKGV
FT                   PSLRILSQHVLRNAAIPIVTVIGIGLAFLISGVVITESVFNLPGLGRLTIDAVLSRDYP
FT                   VVQGVILFFACVYILVNLLIDMLYVVIDPRIRY"
FT   misc_feature    complement(join(301957..302022,302107..302172,
FT                   302290..302355,302416..302481,302518..302583,
FT                   302794..302859))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BPP2882 by TMHMM2.0 at aa 7-29, 99-121, 133-155, 175-197,
FT                   236-258 and 286-308"
FT   misc_feature    complement(302053..302268)
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport systems inner membrane component, score 7.3e-07"
FT   misc_feature    complement(302089..302163)
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT   misc_feature    complement(302179..302265)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   misc_feature    complement(302821..302880)
FT                   /note="Signal peptide predicted for BPP2882 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.692) with cleavage site
FT                   probability 0.226 between residues 20 and 21"
FT   CDS_pept        complement(302933..304507)
FT                   /transl_table=11
FT                   /locus_tag="BPP2883"
FT                   /product="probable extracellular solute-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1823"
FT                   /db_xref="GOA:Q7W6M1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6M1"
FT                   /protein_id="CAE38175.1"
FT                   /translation="MRYLKSTYAAVLLAIGTAVPHATTLAQEVKVAAEAPLRLLDPVGT
FT                   TAYITRNHAYMVYDTLFALDAQLKPQPQMVSTWSVSPDKLVYRFTLRDGLKFHDGSPVT
FT                   AADCVASIKRWAQRDLTGLRMMAAAKEITAKDDKTFEIVLEQPFGAVIEGLSKASSLPA
FT                   FIMPKRIADAPASQAITEVIGSGPFRFVASEYRPGLQVVYERNTDYVPRSEPPSGLAGG
FT                   KVVNVDRVVWLSLPDIQTEANALAKGEVDYVQTVYPDVVQTLQASKDVVIQKLASTTTP
FT                   TLRLNWLQPPFNNQKVRQALLHAVSQRDYMDAQVGDPKAYRVCWAMFGCDSPLASTAGV
FT                   VSQDDEADLNAAKALLKESGYKNEKAVVLHATDYPPTSAIAPFTAQILRSIGMKAEVQS
FT                   MDWATFLTRRGKQDPVEKGGWSVAYGSWNTLDLMSPIANLNLDGRGKEGYAGWTESAEM
FT                   ESLRTQYAQATEPASRQQIAAKIQQLAYDQVFYIPLGTYSNYAARRSNVTPLLDAPVTV
FT                   FWGISKN"
FT   misc_feature    complement(302939..304492)
FT                   /note="HMMPfam hit to PF00496, Bacterial extracellular
FT                   solute-binding proteins, family 5, score 4.3e-17"
FT   misc_feature    complement(304430..304507)
FT                   /note="Signal peptide predicted for BPP2883 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.782 between residues 26 and 27"
FT   CDS_pept        complement(304555..304905)
FT                   /transl_table=11
FT                   /locus_tag="BPP2883A"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1822"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6M0"
FT                   /protein_id="CAE38176.1"
FT                   /translation="MLVPLFRVAHARTGDKGDRSNISVIAWDRALYPLLVEQLTPEVVL
FT                   AQFAHRRPAGAQRYLLPKLGAMNFVLDAVLDGGVNGALNLDAHGKALSYLILKTEIAVP
FT                   SDLVCRLAGSPG"
FT   CDS_pept        complement(join(304907..305110,305117..306283))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2884"
FT                   /product="conserved hypothetical protein (Pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1821"
FT                   /db_xref="PSEUDO:CAE38177.1"
FT   misc_feature    complement(305513..305536)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        306380..307330
FT                   /transl_table=11
FT                   /locus_tag="BPP2885"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1820"
FT                   /db_xref="GOA:Q7W6L9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6L9"
FT                   /protein_id="CAE38178.1"
FT                   /translation="MRPQADLSTRQLRAFVMLADLRHFTKAAQACHLSQPAFSALIQSL
FT                   EATLAMQLFDRSTRRVVLTQEGELFEPLARRLLADLGHAMTHIASFVELRRGRVHVAAL
FT                   PSLAAGWLPKVLHEFHAEHPDIELMLSDVLSDECIELVRSGQADFALASRGIRASDPAV
FT                   LHARELCSDTFHLICRKDHPLAREPRLTLKHLAPWPFIHLTRNSSVRQTVEAALRPQVA
FT                   KTILEVAQLATVAGMIEAGLGISVVPTFTLYQFERPGLLIRPISLPGLTRQIYIVRRQE
FT                   ERLSIAAQALYDLVVAKLGTPAAAKPRRRRTEKGR"
FT   misc_feature    306404..306583
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 2.3e-23"
FT   misc_feature    306446..306538
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    306653..307279
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 2.6e-49"
FT   repeat_region   307559..307571
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS1001 element"
FT   repeat_region   complement(307559..308865)
FT   CDS_pept        complement(307562..308782)
FT                   /transl_table=11
FT                   /locus_tag="BPP2886"
FT                   /product="transposase"
FT                   /note="transposase for IS1001 element"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6L8"
FT                   /protein_id="CAE38179.1"
FT                   /translation="MLDRKLLESLGGWQGYGVERVEWPEDPGRTLSIYLKPTAKVMLCE
FT                   QCGARCRQVHETTVRRVRDLPLFEYRVVLHVPRRRLWCEQCGGPRLERLAWLGRYQRVT
FT                   DRLAQACSQLLQSSNVQAVARFFELGWHTVKTLDKARLRASVREPDWSKIEYLAMDEFA
FT                   LHKGHRYATVVVDPISRQVLWIGPGRSRETARAFFEQLPPGAAQRIKAVAIDMTTAYEL
FT                   EIQAHSPQAEIVYDLFHVVAKYGREVIDRVRVDQANQLRQDRPARRIIKSSRWLLLRNR
FT                   DNLDRQQAVRLDELLQANQPLLTVYVLRDELKRLWFYQRPAWARQAWNHWYEQAEQSGI
FT                   AALNTFAQRLKGYLHGILARCRHPLNTSIVEGINNTIKVIKRRAYGYRDQEYFFLKIRA
FT                   AFPGNAR"
FT   misc_feature    complement(307703..308692)
FT                   /note="HMMPfam hit to PF01610, Transposase, score 1e-128"
FT   repeat_region   complement(308853..308865)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS1001 element"
FT   CDS_pept        309009..310418
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /gene_synonym="glnF"
FT                   /gene_synonym="ntrA"
FT                   /locus_tag="BPP2887"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /note="Similar to Escherichia coli RNA polymerase sigma-54
FT                   factor RpoN or GlnF or NtrA or B3202 SWALL:RP54_ECOLI
FT                   (SWALL:P24255) (477 aa) fasta scores: E(): 6.3e-42, 38.58%
FT                   id in 482 aa, and to Ralstonia solanacearum probable RNA
FT                   polymerase sigma N RpoN2 or Rsp1671 or Rs02230 SWALL:Q8XPG9
FT                   (EMBL:AL646086) (500 aa) fasta scores: E(): 9.5e-64, 49.6%
FT                   id in 504 aa"
FT                   /db_xref="GOA:Q7W6L7"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6L7"
FT                   /protein_id="CAE38180.1"
FT                   /translation="MSHVLQDLRLRQQTTLAPRLQQSIHLLQMSALEFTTTVQQALATN
FT                   PFLEDADETEAQDDAPAPPAASEPPATSEPPPEPPSYAGDYPTRSAAAQPGVASDAAAW
FT                   VPATLSLHERLSQALGAYVLSERDRALAEFIVDGLDDDGYLRQELAQLAGVADFDPPPD
FT                   ASEWQAALHLVQQLDAPGLAARDLPECLALQIRACSRLDPAVRDAALAIVAAHLPRLAR
FT                   SDYPGMRRALRCSEPVLRQACGVIRGLDPKPGRRYAHEPPSYVVPDVVVSKQRQQWLVV
FT                   PNRGAMPHARLHQAYADLFRRARMDERSPMAQELQEARWLVRNVEQRYATIRRVAEAIV
FT                   QRQQMFFEFGQIALRPLMLREVADELEMHESTVSRATANKYMSTPRGVFEFRHFFSREL
FT                   STESGGTCSAAAVRALIREYIDAEDPRMPLSDVTLAKRLAGDGIVVARRTVSKYRLQLR
FT                   LPAADTRRQYY"
FT   misc_feature    309009..310409
FT                   /note="HMMPfam hit to PF00309, Sigma-54 factors family,
FT                   score 6.2e-157"
FT   misc_feature    310074..310133
FT                   /note="PS00717 Sigma-54 factors family signature 1."
FT   CDS_pept        complement(310447..310863)
FT                   /transl_table=11
FT                   /locus_tag="BPP2888"
FT                   /product="putative membrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="GOA:Q7W6L6"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6L6"
FT                   /protein_id="CAE38181.1"
FT                   /translation="MADRHAACEMEGPYLEDIDMKQRSLIYLVAGAMAALLAHGGALAQ
FT                   SGTAPTTPSTTPNDSTAVPPNRPVPPGQVPPAPGTTTHDGMPKTPQQHMNEHRGNDTRG
FT                   DMPRRQPDINDNPPATPAQGASPPPGYPNTGGSK"
FT   misc_feature    complement(310735..310791)
FT                   /note="1 probable transmembrane helix predicted for BPP2888
FT                   by TMHMM2.0 at aa 24-43"
FT   CDS_pept        311121..312653
FT                   /transl_table=11
FT                   /gene="glgA"
FT                   /locus_tag="BPP2889"
FT                   /product="glycogen synthase"
FT                   /EC_number="2.4.1.21"
FT                   /note="Similar to Escherichia coli glycogen synthase GlgA
FT                   or B3429 or Z4791 or Ecs4274 SWALL:GLGA_ECOLI
FT                   (SWALL:P08323) (477 aa) fasta scores: E(): 8.8e-59, 40.08%
FT                   id in 489 aa, and to Ralstonia solanacearum probable
FT                   glycogen synthase protein GlgA or Rsp0242 or Rs03725
FT                   SWALL:Q8XT73 (EMBL:AL646077) (541 aa) fasta scores: E():
FT                   1.1e-84, 52.39% id in 502 aa"
FT                   /db_xref="GOA:Q7W6L5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W6L5"
FT                   /protein_id="CAE38182.1"
FT                   /translation="MTTIRTLVVAAEAFPLAKTGGLGDAVSGMVQALGHRPGGVDVQCE
FT                   LLMPAYRGTLDMVYRPRTVARLGGLPGGPASLVRGHCPGSGLSVLLLRNDALYDRPGIY
FT                   VDDSGQGYPDNARRYAALAHAAARLAQGLPGLRPPHVVHAHDWHAALAPLLIHAAGLHY
FT                   VKTLLTIHNLAFQGTFPAELASALGIPLACRHDDGALSDDSVNFLKAGIRYATRVTTVS
FT                   RAYAREILTPAFGCGLHGLLRARGADLSPVPNGIDTALWNPAADPHLGGLRFDALDMRN
FT                   KACCKAALQAELGLQPRADATVLAMGSRLTGQKMADVAIAALPALLEAHEHLQFALIGR
FT                   GEPALETALRALAARYPGRCAVHIGYDEPLAHRLHAGADLLLHGSRFEPFGLTPLYAMR
FT                   YGTLPVASRVGGMVDTIRDPGPAVEESCAGQGTGFLFDGSEPADMQLAVARALRALAKP
FT                   AVCDAMRRNAMQADFSWRASAQAYAGLYASLASAPQRGRVPAPTLPLLANAA"
FT   misc_feature    311907..311936
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT   misc_feature    311979..312533
FT                   /note="HMMPfam hit to PF00534, Glycosyl transferases group
FT                   1, score 1.5e-11"
FT   CDS_pept        join(312665..314998,315002..315853)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2890"
FT                   /product="putative alpha-amylase (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1330"
FT                   /db_xref="PSEUDO:CAE38183.1"
FT   misc_feature    join(314486..314998,315002..315529)
FT                   /note="HMMPfam hit to PF00128, Alpha amylase, catalytic
FT                   domain, score 2.1e-05"
FT   misc_feature    315173..315202
FT                   /note="PS00019 Actinin-type actin-binding domain signature
FT                   1."
FT   CDS_pept        join(315865..317673,317677..319206)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2891"
FT                   /product="alpha-glucosidase (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1329"
FT                   /db_xref="PSEUDO:CAE38184.1"
FT   misc_feature    315925..317121
FT                   /note="HMMPfam hit to PF00128, Alpha amylase, catalytic
FT                   domain, score 3.8e-65"
FT   CDS_pept        319203..321398
FT                   /transl_table=11
FT                   /gene="glgB"
FT                   /locus_tag="BPP2892"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /EC_number="2.4.1.18"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1328"
FT                   /db_xref="GOA:Q7W6L4"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W6L4"
FT                   /protein_id="CAE38185.1"
FT                   /translation="MMRDSPSIQGTLDAATQHALLAGRHADPFSVLGPHQAGAHTVVRV
FT                   LAPGARTVMAVLPGGQRTPLLPMQPGLFENTVPGLQPGAPAAYRLCIEWEGGIQHTADP
FT                   YAFGPVLDTAQLDHCAAGGWRYLAGLLGAHAASVDGCAGTRFALWAPNARRVAVVGDFN
FT                   GWDGRRHAMRLRYPAGVWELFLPDVGPGARYKFQVLGADGHTVLKADPLARQAEAPPAT
FT                   ASIVPDERPFAWTDEAWMEQRAARQRCDAPISIYEVHAGSWFDDAGAPRWQSLAARLPE
FT                   YARSLGFTHIELLPVMAHPFGGSWGYQPLGLFAPAAAHGAPADFAHFVDRCHEAGLGVI
FT                   LDWVPAHFPDDAHGLARLDGTPLYEHADPHEGRHPDWNTLIYNYGRREVRAFLIASAIH
FT                   WLRHYHVDGLRVDAVASMLYRDYSRPAGQWIPNRHGGRENLEAIDFLRELNAAVGVQCP
FT                   GAITVAEESTAWPGVTAPVANGGLGFDYKWNMGWMHDTLRYMRRDPIHRRHHHHDLSFG
FT                   MVYAYAERFVLPLSHDEVVHGKGSLLGKMPGERAAQLAQLRLYYAFMWAHPGKKLLFMG
FT                   GEFGQQGEWNHDAMLQWSLLDDPAHRGLQRLVADLNHVYATLPELHCRDADPSGFAWIV
FT                   GDDADNSVLAFARVDASHCLVAVCNFTPVPRPGYRFGVPHAGDWRVRVDTGATRYGGAG
FT                   GGPPICLRSEPIPAHGHPQSLVLDLPGFTALYLRHSE"
FT   misc_feature    319287..319541
FT                   /note="HMMPfam hit to PF02922, Isoamylase N-terminal
FT                   domain, score 0.0034"
FT   misc_feature    319584..319862
FT                   /note="HMMPfam hit to PF02922, Isoamylase N-terminal
FT                   domain, score 5.8e-32"
FT   misc_feature    319968..321005
FT                   /note="HMMPfam hit to PF00128, Alpha amylase, catalytic
FT                   domain, score 1.1e-07"
FT   CDS_pept        321403..>322902
FT                   /transl_table=11
FT                   /gene="glgX"
FT                   /locus_tag="BPP2893"
FT                   /product="probable N-terminal region of glycosyl hydrolase
FT                   (partial)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1327"
FT                   /note="The C-terminal part of this CDS is BPP2895. This CDS
FT                   lacks a stop codon"
FT                   /db_xref="GOA:Q7W6L3"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6L3"
FT                   /protein_id="CAE38186.1"
FT                   /translation="MYPSLPDRLLPGLPAPLGATSDGLGVNFAVFSANAARIELCLFDA
FT                   RGRKELARLPMPECTDEVWHGYLPDAQPGLVYGYRAHGPYNPRAGHRFNPHKLLLDPYA
FT                   TALTGALRWSDALFGYRMQHPRADLSMDRRDSAAGVPKAVVTEPAFHWGATRRPAAAWA
FT                   HTVIYEAHVRGVSMLRSDLREPIRGTCAALADPRFIDHLHRLGVTALELMPVHAFLQDR
FT                   TLVERGLRNYWGYNTLAYFAPEPAYLADGQPHDLRRAIRRLHAAGIEVILDVVYNHTCE
FT                   GNELGPTLSWRGLDNASYYRLVPGDERRYIDDTGTGNTLNLSHPRVLQMVMDSLRYWAV
FT                   HYRVDGFRFDLGVTLGREGTGFDAGSGFFDALLQDPVLARVKLISEPWDVGPDGYQLGR
FT                   HPPGMAEWNDQFRDTARRFWRGDPGMAGALATRLTASRDVFDHRHRRPWSSINFAAAHD
FT                   GFTLQDVVSFAERHNEANGEDGADGHGENYSSNWGVEGAASS"
FT   misc_feature    321442..321735
FT                   /note="HMMPfam hit to PF02922, Isoamylase N-terminal
FT                   domain, score 1.4e-25"
FT   misc_feature    321964..322896
FT                   /note="HMMPfam hit to PF00128, Alpha amylase, catalytic
FT                   domain, score 1.6e-06"
FT   CDS_pept        complement(<322907..323587)
FT                   /transl_table=11
FT                   /locus_tag="BPP2894"
FT                   /product="probable N-terminal region of alpha amylase
FT                   (partial)"
FT                   /note="The C-terminal part of this CDS is BPP2896. This CDS
FT                   lacks a stop codon"
FT                   /db_xref="GOA:Q7W6L2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6L2"
FT                   /protein_id="CAE38187.1"
FT                   /translation="MNRPAAMGATVCAPGKIRFRLWAPSAPPALALEIEGRAPIALRPG
FT                   PDGYAQAIVDGAPGLRYRYRLAVDCAVPDPASRLQDGDVHGHSVVVGPDRYPWRHTGWR
FT                   GRPWQDSVIYEAHAGLCGGYAGLRRRLPEVARLGVTLLELMPIADFPGPRNWGYDGVLP
FT                   YAPDTAYGTPDELKALIDAAHGLQMGVMLDVVYNHFGPDGNYLHRYAADFFDARADTPW
FT                   GAAID"
FT   misc_feature    complement(323336..323578)
FT                   /note="HMMPfam hit to PF02922, Isoamylase N-terminal
FT                   domain, score 0.15"
FT   misc_feature    complement(323495..323587)
FT                   /note="Signal peptide predicted for BPP2894 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.704) with cleavage site
FT                   probability 0.692 between residues 31 and 32"
FT   CDS_pept        complement(323584..324198)
FT                   /transl_table=11
FT                   /gene="glgX'"
FT                   /locus_tag="BPP2895"
FT                   /product="C-terminal region of a probable glycosyl
FT                   hydrolase (partial)"
FT                   /note="This CDS is the C-terminal part of BPP2893."
FT                   /db_xref="GOA:Q7W6L1"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6L1"
FT                   /protein_id="CAE38188.1"
FT                   /translation="MRETRARVQRALLATVMLADGTPMLLAGDEFGNSQGGNNNAYCQD
FT                   GPMGWLDWAVAQSTPGRALTAYAVRLAALRRAHPSLRATRYGDPAHQWQEGLGAIDWFN
FT                   ARGAPMTSADWDAPEGRLLVLRRALPDPAQPGRVDVTLLLCNAAAEPRPCVLPAPTLAW
FT                   TLALDSASPEAPAAPCGGPEAIVGARAVLLLTASVDGAHTP"
FT   misc_feature    complement(324118..324198)
FT                   /note="Signal peptide predicted for BPP2895 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.837) with cleavage site
FT                   probability 0.738 between residues 27 and 28"
FT   CDS_pept        324216..325274
FT                   /transl_table=11
FT                   /locus_tag="BPP2896"
FT                   /product="C-terminal region of a probable alpha amylase
FT                   (partial)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1326"
FT                   /note="This CDS is the C-terminal part of BPP2894."
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6L0"
FT                   /protein_id="CAE38189.1"
FT                   /translation="MQRYFIDNALYWLREYRFDGLRLDAVHAMGRTDWLAGLAREARAA
FT                   CPDRRVHLVVENDANQASLLEQGFDAQWNDDAHHVLHHLLTGERQGYYADYAQAPAALL
FT                   ARALGEGYVYQGQAAPTRGGRARGEPSAHLPPWAFVLFLHNHDQVGNRADGLRLTSLLA
FT                   PGSPALRAAIALQLLAPHIPLLFMGEEYGSTAPFFYFTSHGPELAAAVRAGRAREFAAS
FT                   MHDCDPPPDPNDPDTYRRSCPWPPPGAERQAWFEYYRELLRLRARLLGGRLTGARADGA
FT                   AALGPAAVRAAWRLGDGARLTLYANLLPGSVIVPAPPAGQLAYARLAGAGQDLAAGVLR
FT                   GGCALALWEPAP"
FT   CDS_pept        325271..327289
FT                   /transl_table=11
FT                   /gene="malQ"
FT                   /gene_synonym="malA"
FT                   /locus_tag="BPP2897"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1324"
FT                   /db_xref="GOA:Q7W6K9"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6K9"
FT                   /protein_id="CAE38190.1"
FT                   /translation="MSENQALARLCALAGVSPRWTDVWGRTRAVAPPVLRAVLAALDLP
FT                   AATPAQAADTLARWRARRPAMLTARAGGMLRVPGDAAAPYAIELDNGQVAHGLAEPDGA
FT                   GGLALRAPRQPGYHTLRLGSASIALAVAPPRAPTLARLLASPRPRRWGVAAQIYSLRGT
FT                   ADPDGGHGDFGALAELAVAAAGHGADAVALSPAHALFAAAPRRCSPYSPSTRLFLNILY
FT                   ADPLDTFSDAECAAARRPSSGADAPLIDWPQAAGARLAMLRRLHRGLAADDPRAAELAR
FT                   FRAEGGQALRDHALFEALHAANGATDWRGWPAAWRRPAAALAAGCAREHAREMDFHVFA
FT                   QWLARRSLAHAQAAARAAGMGVGLIADLAVGVDPAGSQTWAQPDAMLGGLNVGAAPDLR
FT                   HPGGQDWRLTACSPATLATQGYAAYIDMLRRALASAGGVRIDHVLGLARLWVIPEGAPP
FT                   DQGAYLAFPVEDLLRLAALEAWRHRAVLIGENLGTVPRDFNARLRAHGVLGMDVLWLQR
FT                   ETGPGGAGRFRPPGRWPASAVAMTSTHDLPTLRGWWQARDLDWCVPAHEADAQRRQRDQ
FT                   DRRALWRQAAPPGLAATAPPAEPPCAALLSHVARSRAPLMLVPLEDLAGLAEQPNVPGC
FT                   PDHPNWRRRMPATAAAMLVQPAARLALAAIAAHRGRP"
FT   misc_feature    325733..327268
FT                   /note="HMMPfam hit to PF02446, 4-alpha-glucanotransferase,
FT                   score 2.7e-62"
FT   CDS_pept        join(327286..328827,328826..329827)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2898"
FT                   /product="probable alpha amylase (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1323"
FT                   /db_xref="PSEUDO:CAE38191.1"
FT   misc_feature    327310..328578
FT                   /note="HMMPfam hit to PF00128, Alpha amylase, catalytic
FT                   domain, score 1.6e-07"
FT   CDS_pept        complement(329818..332790)
FT                   /transl_table=11
FT                   /locus_tag="BPP2899"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1322"
FT                   /db_xref="GOA:Q7W6K8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6K8"
FT                   /protein_id="CAE38192.1"
FT                   /translation="MLRKGDRVSSPWTNTLARLEDERVMLQRIAAGVPLTDVLLHVMQA
FT                   VEAQSSVELLTSIAFVDDSGMRLRHVATPSLPAAYVQATDGAAIGPGVASWGAAAFLGT
FT                   PVYVEDLTVHPNWPPWREAATQHGLRACWSTPIKATDGRTLGVFSNYYRQPRLPTREDI
FT                   EAIALVTRTAALAIERHLTEQALRNSSVRWRGMFERMQEGFFLAEAQRDSTGSVDDFTL
FT                   LEINPAFETQSGLAVGQTLGPMLRVMSPAAADSIMRIFVGVIESGEPAQFEVEAPGPPQ
FT                   ACYECRAGKEGHDRVAALFLNVTARKLAESELWERQYRKNFLLTLGDRMREIHQQDQIE
FT                   QMVCEELGRHLELGAVAVMESVPQRGDRIAASWGPRPPYDGRSMLESAPLTPDYYEAVR
FT                   KGRTAYLSPYLAGPAGNQQPSAIVVPLRRWGRADGTLLVRPDPTHPLKGTDIAFIEEAA
FT                   ERMCEAIERSQYARVLEQRVEHAIAERDRIWRLSPELLAVADHGGRLVSVNPAVRAILG
FT                   WSPEQFLAMGLDEGVHPEDLASMQATLEAEPAEGMQPVRHLESRLLHKDGSYHWITWSL
FT                   SRAEGNVYLAGRDDTDLKAQAEVLRQTEDALRQSQKLEAVGRLTGGIAHDFNNMLQGIS
FT                   GALYLIDRKLRRSKPEEVGKYVRTAQESTDRAARLTQRLLTFSRQQAIDPQVFDPGDIL
FT                   RSMDELFRRYTGEQVRLTLKLPAQSWRVRCDMNQFENAVLNLVINACDAMPAGGDLEIE
FT                   VAHRELDAAAVQTNPCAEAGEFVEVCVSDMGCGMAPDVLARVFEPFFTTKPMGQGTGLG
FT                   LSMIYGFAQQAGGMVTIASVQAEGTAVRLFLPRHVGEPVALPAPESSEPPAAPAHAAVV
FT                   ALVEDDEHVRDMVRAALEELNLTVLTAADGDAGHRLLQSDARIDLLLSDVGLPGMNGHA
FT                   LAQAARALRPALRIILMTGYADERENGWARQERDVSLIRKPFSPGELTARVCRLLAASQ
FT                   D"
FT   misc_feature    complement(329824..330186)
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 5.8e-18"
FT   misc_feature    complement(330253..330621)
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase, score 2.5e-28"
FT   misc_feature    complement(330742..330948)
FT                   /note="HMMPfam hit to PF00512, His Kinase A
FT                   (phosphoacceptor) domain, score 8.4e-09"
FT   misc_feature    complement(331150..331344)
FT                   /note="HMMPfam hit to PF00989, PAS domain, score 3e-07"
FT   misc_feature    complement(332260..332664)
FT                   /note="HMMPfam hit to PF01590, GAF domain, score 0.0019"
FT   CDS_pept        complement(332891..333745)
FT                   /transl_table=11
FT                   /gene="pdxK"
FT                   /locus_tag="BPP2900"
FT                   /product="pyridoxine kinase"
FT                   /EC_number="2.7.1.35"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1321"
FT                   /db_xref="GOA:Q7W6K7"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR023479"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7W6K7"
FT                   /protein_id="CAE38193.1"
FT                   /translation="MMKLAAPNPQALAPLPIDVVSIQSQVVYGQVGNSVAVPVFNGFGL
FT                   RVAAVPTVVLSNTPHYPSMHGGAVPLDWFEGYLADLGARGALAGVRVVQLGYLGGPAQA
FT                   EALGRWIAGLVAVRPDLRVHIDPVIGDHDSGVYVAPGMVAAYRDHLLPLAQGLTPNGFE
FT                   LECLTGLPTGTMEQTIAAARTLLGGRARWVIVTSAAPATWPPGRVRVAVVTHDDAQVLE
FT                   HAHVDTAPKGTGDMFGAALTGHLLAGQPVAEAARRAALQVIEALERTREAGCGELLLAG
FT                   PLR"
FT   CDS_pept        complement(333742..334545)
FT                   /transl_table=11
FT                   /locus_tag="BPP2901"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1320"
FT                   /db_xref="GOA:Q7W6K6"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6K6"
FT                   /protein_id="CAE38194.1"
FT                   /translation="MHADTAQDAPDAAARYPRADSVADFEHNLAAVRARMAAACQRAGR
FT                   DPAGVRLLPVSKTVDEARIRMSYAAGCRELGENKVQEAYRKWEAMADLADLRWSVIGHL
FT                   QTNKAKLVARFAAEFQALDSVRLAEALERRLQAEGRALDVYVQVNTSGEASKYGLHPDE
FT                   AAAFIRQLPSYGALRVRGLMTLAVLSADAARVRQLRTLRDRLRQEAPAGVSLDELSMGM
FT                   SGDYEIAIEEGATVVRVGQAIYGARALPNDYYWPDSGAADRAEDE"
FT   misc_feature    complement(333802..334467)
FT                   /note="HMMPfam hit to PF01168, Uncharacterized protein
FT                   family UPF0001, score 2.8e-53"
FT   CDS_pept        334605..335936
FT                   /transl_table=11
FT                   /locus_tag="BPP2902"
FT                   /product="GntR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1319"
FT                   /db_xref="GOA:Q7W6K5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6K5"
FT                   /protein_id="CAE38195.1"
FT                   /translation="MSITGASAAEIFDSVRQLAQARRLLPGQALPPVRELAQTLGVNRN
FT                   TVAAAYKRLVGAGLALSQGRRGTIIRGPSEPGEQDGAHPGSPLIDLASGNPDPARLPDP
FT                   LAIMAGRASPPRLYGEATVDPRLQAYASQWYAGDCPAAFEVDLTHGAIDAIERLLGANL
FT                   AAGDTVAVEAPGFLGSINALRALGLHAEGVALDAAGMLPDALERALADGAQAVLLTPRA
FT                   QNPTGASLTRARARALRQVLQRYPHVMVIADDHFAHLSASPYHSPIPAAALRWALVRSV
FT                   SKALGPDLRLAFVASDPDTSRRLRLRLASGTTWVSHLLQDVVAGCLASAPVQARMAQAR
FT                   RAYAQRRTWLADALRAEGIAAQWPADGLNLWVPLAQDSPALLLELAHRGWRLRNGRSFG
FT                   VREDVHGLRITIATLEHATARRLARDLRLCLDALDGLKKYPTLL"
FT   misc_feature    334635..334814
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 4.6e-16"
FT   misc_feature    334692..334766
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT   CDS_pept        335975..336481
FT                   /transl_table=11
FT                   /locus_tag="BPP2903"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1318"
FT                   /db_xref="GOA:Q7W6K4"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6K4"
FT                   /protein_id="CAE38196.1"
FT                   /translation="MGRLFSERPQMSRTSLSSLAPRPHRLLSLAWAATVLSLRVGMGIS
FT                   GLFCAWRYLVDLRPVRPLFDGVAAGATPLALYAAFEAGCAVLLMAGASTRIAAAGMTAA
FT                   HIAGVALALPAHGLWIPLPSALWLACLALLWCHGPGPCSVDACLHPAAIAPLSPPPDDP
FT                   AQRPI"
FT   misc_feature    join(336077..336136,336179..336247,336266..336334)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BPP2903 by TMHMM2.0 at aa 35-54, 69-91 and 98-120"
FT   CDS_pept        336523..337077
FT                   /transl_table=11
FT                   /locus_tag="BPP2904"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1316"
FT                   /db_xref="GOA:Q7W6K3"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6K3"
FT                   /protein_id="CAE38197.1"
FT                   /translation="MRAMSKFSRIGLAGVVGAALHAILANHLAPAVQQRLPIGRVSLTF
FT                   FLALLSALAAGAVLARLAPRARVAALAVAALAFLLLAAATTWLQQCTPAQLAAIDAATP
FT                   LGCNLGLYNRARAHLPPDGRPAELAPGVWFDRHGLSYACLPPEAQATHLRVALADYALA
FT                   LVGMSLGALLGARQRRRRDQD"
FT   misc_feature    336523..336588
FT                   /note="Signal peptide predicted for BPP2904 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.919) with cleavage site
FT                   probability 0.361 between residues 22 and 23"
FT   misc_feature    join(336541..336609,336637..336705,336724..336792,
FT                   336979..337047)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BPP2904 by TMHMM2.0 at aa 7-29, 39-61, 68-90 and 153-175"
FT   CDS_pept        337149..337574
FT                   /transl_table=11
FT                   /locus_tag="BPP2905"
FT                   /product="universal stress family protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1315"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6K2"
FT                   /protein_id="CAE38198.1"
FT                   /translation="MLKILVPVDGSECAVRAVREAIKVANDSKGAQLHLLNVQLPLISG
FT                   HAKMFLRHNELQSYYQAEGEAALATVLPVVAESGIPFESEMRTGQYGETIANYAKEKQC
FT                   DRIVMGTRGLGAVGGLLLGSVARKVIHLADVPITLVK"
FT   misc_feature    337149..337568
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 1.7e-08"
FT   CDS_pept        337607..338494
FT                   /transl_table=11
FT                   /locus_tag="BPP2906"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1314"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6K1"
FT                   /protein_id="CAE38199.1"
FT                   /translation="MSRARFLRLAGAAALGLAAPRVPAAPSLLTRPVPADGSPLPVIGC
FT                   GTYIGFDVARPSAEYDALGEVVRTLFAAGGTVLDSSPMYGRAEAVTGRLLAEAGLRQRA
FT                   FVATKVWTSGRAAGLAQMQASLRQLGGERIDLMQIHNLLDWRTHLPVLREWQAAGRIRY
FT                   VGISHYTASAYDEVEAVLRAERLDFLQINYALDDRQAAQRLLPLAADRGVAVLVNRPFG
FT                   GGGLLRRLAGRPLPSWAADIGATSWAQVLLKFVLSHPAVTCAIPGTGRAAHMRDNLAAG
FT                   MAAPPPLSFWNDKA"
FT   misc_feature    337607..337678
FT                   /note="Signal peptide predicted for BPP2906 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.995) with cleavage site
FT                   probability 0.792 between residues 24 and 25"
FT   misc_feature    337706..338473
FT                   /note="HMMPfam hit to PF00248, Aldo/keto reductase family,
FT                   score 1.1e-09"
FT   CDS_pept        complement(338497..338820)
FT                   /transl_table=11
FT                   /locus_tag="BPP2907"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1313"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6K0"
FT                   /protein_id="CAE38200.1"
FT                   /translation="MIALPSLEQAAEVRVSRQGGVAFVPALVRTRRFELGACSATLRAQ
FT                   IDAALYSAAGQARDACGQGDQRYFRVEVHFGAGSRAEPLRFDVPEELAPHDLVWLWRSA
FT                   PAR"
FT   CDS_pept        complement(338817..339854)
FT                   /transl_table=11
FT                   /locus_tag="BPP2908"
FT                   /product="putative metalloprotease"
FT                   /EC_number="3.4.24.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1312"
FT                   /db_xref="GOA:Q7W6J9"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6J9"
FT                   /protein_id="CAE38201.1"
FT                   /translation="MKRPTSKAARPSVVPPYLLDRLAQAADARLSARAVNTLRIDTSQR
FT                   AVRLAAPPAPASARPPGQVDRQVHDAGGGLQLPGALVRSEGQPAHADVAVNEAYDHLGA
FT                   TYALFWQAYGRHSLDGAGRALVASVHYGEEYDNAFWNGAQMVFGDGDGDVFNRFTIAVD
FT                   IVAHELTHGVIDHEGGLRYEGQSGALNESLCDVFGSLAKQHVAGQRADQADWLIGAGLF
FT                   TAKVRARALRSMAQPGSAYDDPLLGRDPQPGHMRDFVQTGEDNGGVHINSGIPNRAFHL
FT                   AATALGGHAWEVAGRIWYDTLRLPALTPQADFALFARLSVEQAGRHGAAQAAVRQAWTD
FT                   VGVLT"
FT   misc_feature    complement(338826..339323)
FT                   /note="HMMPfam hit to PF02868, Thermolysin
FT                   metallopeptidase, alpha-helical domain, score 2.7e-27"
FT   misc_feature    complement(339327..339854)
FT                   /note="HMMPfam hit to PF01447, Thermolysin
FT                   metallopeptidase, catalytic domain, score 3.6e-17"
FT   misc_feature    complement(339336..339365)
FT                   /note="PS00142 Neutral zinc metallopeptidases, zinc-binding
FT                   region signature."
FT   CDS_pept        340059..340463
FT                   /transl_table=11
FT                   /locus_tag="BPP2909"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1311"
FT                   /db_xref="GOA:Q7W6J8"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6J8"
FT                   /protein_id="CAE38202.1"
FT                   /translation="MIKSDDAGKLILRLALGILVIMHGLAKLSSGVGGIAGMLSSHGLP
FT                   GFLAYFAYVGEIVGPLLIILGIYCRLGALLVVLNMVVAILLAHMGQLFSISNTGGWALE
FT                   LQGMFLFGALALAFMGAGRFSLAGSGGRWN"
FT   misc_feature    join(340077..340136,340194..340262,340275..340343,
FT                   340371..340439)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BPP2909 by TMHMM2.0 at aa 7-26, 46-68, 73-95 and 105-127"
FT   CDS_pept        join(340637..341767,341767..341829)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2910"
FT                   /product="putative membrane protein (Pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1310"
FT                   /db_xref="PSEUDO:CAE38203.1"
FT   misc_feature    340637..340720
FT                   /note="Signal peptide predicted for BPP2910 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 28 and 29"
FT   misc_feature    join(340655..340723,340901..340969,341027..341095)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BPP2910 by TMHMM2.0 at aa 7-29, 89-111 and 131-153"
FT   CDS_pept        341922..342461
FT                   /transl_table=11
FT                   /locus_tag="BPP2911"
FT                   /product="putative bacterioferritin comigratory protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1307"
FT                   /db_xref="GOA:Q7W6J7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6J7"
FT                   /protein_id="CAE38204.1"
FT                   /translation="MSRPALLLAALLSIAAPAAHAALPVGAPAPDFSAQASQGGNTFTF
FT                   ELAQALRQGPVVLYFYPAAFTQGCTIEARNFAEAIDQYRALGATVIGVSGDDIETLRKF
FT                   SVGECRGKFPVAADADGAIMKAYDAVHDRRPEYAQRISYVISPQGRIVYEFTDMSPDRH
FT                   VANTLQALRDWQARKK"
FT   misc_feature    341922..341984
FT                   /note="Signal peptide predicted for BPP2911 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 21 and 22"
FT   misc_feature    341994..342431
FT                   /note="HMMPfam hit to PF00578, AhpC/TSA family, score
FT                   1.9e-13"
FT   CDS_pept        complement(342568..342912)
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /gene_synonym="arsG"
FT                   /locus_tag="BPP2912"
FT                   /product="putative arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1306"
FT                   /db_xref="GOA:Q7W6J6"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6J6"
FT                   /protein_id="CAE38205.1"
FT                   /translation="MSATIYHNPRCSTSRNVLQMLRDAGIEPTIIEYLKTPPSRQTLAG
FT                   LIQQSGLSVREAVRAKEPIYQELGLDGVDDEGLLDAMVDNPILINRPFVVTERGARLCR
FT                   PAESVREILP"
FT   CDS_pept        complement(join(342970..343224,343228..343926,
FT                   343925..344320))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="BPP2913"
FT                   /product="conserved hypothetical protein (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1305"
FT                   /db_xref="PSEUDO:CAE38206.1"
FT   misc_feature    complement(join(343072..343224,343228..343584))
FT                   /note="HMMPfam hit to PF02515, CAIB/BAIF family, score
FT                   1.5e-09"
FT   CDS_pept        complement(344550..344873)
FT                   /transl_table=11
FT                   /locus_tag="BPP2914"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1304"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="PDB:2KAT"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6J5"
FT                   /protein_id="CAE38207.1"
FT                   /translation="MQAMTERLEAMLAQGTDNMLLRFTLGKTYAEHEQFDAALPHLRAA
FT                   LDFDPTYSVAWKWLGKTLQGQGDRAGARQAWESGLAAAQSRGDQQVVKELQVFLRRLAR
FT                   EDA"
FT   misc_feature    complement(344616..344717)
FT                   /note="HMMPfam hit to PF00515, TPR Domain, score 13"
FT   misc_feature    complement(344688..344711)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(344718..344819)
FT                   /note="HMMPfam hit to PF00515, TPR Domain, score 0.83"
FT   CDS_pept        345049..346641
FT                   /transl_table=11
FT                   /locus_tag="BPP2915"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1303"
FT                   /db_xref="InterPro:IPR014917"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6J4"
FT                   /protein_id="CAE38208.1"
FT                   /translation="MQEPTVPSIVLFPSWMKVWRRLACAALLAGAAASAPAAPAAAQAA
FT                   PAGPQRLAAQVDRVSWGVTPTELARAQRLSWTVYLQEQLRPRPAALPPAVQAGIDALSI
FT                   TRVPARDALLAQRARTAKIRQIEDPARKLAASRENRMVSRQRANETMQRAVWLALYSPN
FT                   QLQEQMTWFWMNHFSIYAGKANVGTVLDAYEDQAIRPHALGKFRDLLAATARSPAMLIY
FT                   LDNIRNSAGHINENYARELLELHTLGVQGGYSQRDVQELARVLTGVGLNQTGEAPRVKP
FT                   AQREQLVEDGLFLFDPGRHDHGDKTVLGHTIRGGRGLAELDEALDLLARHPATARHVSR
FT                   KLAQYFVADQPPDALVQRMARAFRGSDGDIAATLAAMFESPEFEASLARGKFKDPAHYL
FT                   YSALRLAYDGREPLRNPDAALDWLKRMGQPLYQRLTPDGYPMNESDWAGSGQMTTRFEA
FT                   ARAIAAAPATFYRADRDDRPRVPPLPPLVQAYGAGAGPFSALSPATRRAIESAPNVRDA
FT                   NTYLLASPEFMRR"
FT   misc_feature    345049..345180
FT                   /note="Signal peptide predicted for BPP2915 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.612 between residues 44 and 45"
FT   CDS_pept        346665..347843
FT                   /transl_table=11
FT                   /locus_tag="BPP2916"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1302"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="UniProtKB/TrEMBL:Q7W6J3"
FT                   /protein_id="CAE38209.1"
FT                   /translation="MHRRQLLKLAAAAPLTLYGTRLLAAGPPDTRLLVVFMRGAYDATS
FT                   LLVPTTSEFYYESRPHIAIARDAAAALSDGWALHPAVKDSLLPFYQRGELAFVPFAGTD
FT                   DASRSHFETQNRIELGRAGGSGAAPASGFLNRLAAQFDGKAGRPAAFTEDVPQIFRGQA
FT                   RVPNIDLGGAKRKSRLTADSSSAIAQMYQGTGLDASVNEGLAAMGQARAALEAEMREAN
FT                   GGAGSTEKLEQEARRIGTFMAERYNLGFVDVGGWDTHVGQGAANGVLATKLGQLGRALA
FT                   AYAQAMGPAWRHTTVVVISEFGRTLRENGNKGTDHGHGSVYWVLGGGVRGGRIAGEQVA
FT                   VKRDTLFQDRDYPVLTDYRALFAGLFGRLYGLDAQRLQAVFPGARPLDLKLV"
FT   misc_feature    346665..346736
FT                   /note="Signal peptide predicted for BPP2916 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.971 between residues 24 and 25"
XX
SQ   Sequence 347894 BP; 53756 A; 122354 C; 118235 G; 53549 T; 0 other;
     cggcctgtgc cggcggcgcg gcccccccgg gggcgccgcg ccgccatttg ccgcagctgc        60
     gccgccgccg ggcgccgcgc gctgccagtg gcgtcgcgtt tccgatcgct gcgtcgcttc       120
     gtctccctcg gctggaacga acgctcgtat ggatattttc actcaacaga taatcaatgg       180
     cctgacgctg ggcagcgtgt acgcgctggt cgcgctgggc tatacgatgg tgtacggcat       240
     catcggcctg atcaacttcg cgcatggcga cgtggtcatg atcggcgcga tggcggcgac       300
     catggtcgcc gccgccctgg tgggcggcga tccgtccacg tcggccttcg ccgtcctcgg       360
     cgccggcctg ctggtctcgg tgcccctgtg catggccgtg ggctggaccg ccgaacgcgt       420
     ggcgtaccgg cccttgcgcc gcgcgccgcg gctggccgcg ctgatcaccg ccatcggcgt       480
     atccatcatc ctgcagaacg tggcgatgat ggtgtggggc cgcaattacc tcaactttcc       540
     ccaggtgctc acgcccgccg tgttcgagat cggcggggcg cgcatgagca tgctgcagat       600
     cgccatcgtg gtcatcgccg cgctgatcat gggcgcgctg ctgctggtcg tgcacaagac       660
     gcggctgggt accgccatgc gggccaccgc gcagaaccgc gaagtggccg gcctgatggg       720
     cgtgaacatc aacactgtga tctcggcggc cttcctgatc ggttccgcgc tggcggccat       780
     cgccggcatg atggtcacca cctattacgg cgtgtcgcag tacaccatgg gcttcatgct       840
     gggcctgaag gcgttcaccg cggcggtgct gggcggcatc ggcaacctgg tcggggccat       900
     ggccggcggc ctgctgctgg gcatcatcga atcgctgggc tcgggctata tcggcgacct       960
     gaccggcggc ttcctcggca gccactacca ggatgtcttc gccttcgtgg tgctggtgat      1020
     ggtgctgatc ttccggcctt cgggcttgct gggcgagcgc gtgggagacc gggcatgaca      1080
     cgacaaccga acacgtccgg gctgtcggcg cgcaacctgg tcggcatcgc gctcatcggc      1140
     atcgtgctgg ccgtgctgcc cttcgtgctc ggcatggccg ggcagagctg ggtgcgcatc      1200
     ctcaacttcg cgctcctgta cgtcatgctg gcgctgggcc tgaatatcgt ggtgggcttt      1260
     gccggtctgc tcgacctcgg ctatatcgcc ttctatgccg tgggcgcgta cacctgggcc      1320
     ttgctggcct cgccgcattt cggcctgcac ctgccgttct gggccattct gccgatggca      1380
     ttgggcgtgg cctgcgtatt cggcgtgctg ctgggcgcac ccaccctgaa gctgcgcggc      1440
     gactacctgg ccatcgtcac gctgggattc ggcgagatca tccgcatttt cctcaacaac      1500
     ctgaatgcgc cggtcaacat caccaacggg ccgcagggca tcaaccgcat cgacgccttc      1560
     aaggtcggag acttcgcctt cggacgcacc gagaccatcc tgggcatccg cttcacgggg      1620
     cccgagaagt actactacct gttggtgctg ctgacgctgc tgatcatcgt ggtgtgcgtg      1680
     cgcctgcaga attcgcgcat cggtcgcgcc tgggaagcca tacgcgaaga cgagatcgcg      1740
     gccaaggcca tgggcatcaa cagccgcaac atcaagctgc tggccttcgc catgggcgcc      1800
     tcgttcggcg gcgtggccgg cgcgctgttc gccgccatgc aaggtttcgt cagccccgag      1860
     agcttcagcc tgacggagtc gatatcggtg ctgtgcatgg tggtgctggg cggcatgggc      1920
     catattcccg gcgtgatcct cggcgcggtg atcctggccg tcctgcccga gtttctgcgc      1980
     gcggtggtcg agcccgcgca gcacctgctg ttcggcgccg tggtgctcga tcccgaaggc      2040
     atccgcatgc tgctgttcgg cctggcgatg gtgtgcgtca tgctgttccg gccggccggc      2100
     ctgtggccct cggcggtgcg caagcgcgaa ctgagcagca cgcgccaggg aggtgccgca      2160
     tgagccgcat cctgcacgcc cagggactgg gcaagcgctt tggcgggctg cgcgcgctgt      2220
     cggagatcag cttcgatatc gaggccggcg agatctacgg gctgatcggc ccgaacggcg      2280
     ccggcaagac cacgctgttc aacgtgctga ccgggctgta cgtccccgaa gagggacagt      2340
     gcgagttcaa cggcatgtcg ctgatcggca agaagccgca cgaggtggcc gccgccggcc      2400
     tggcgcgcac cttccagaac atccgcctgt tcgccaacct gagcgcgatc gagaacgtca      2460
     tgatcggccg ccatgtgcgc acgcacgcgg gcgtgctcgg cgccgtgctg cgcactcgcg      2520
     ccgagcgggc cgaggaggcc gccatcgaac ggcgcgcgca ggagctgctg gaatacgtcg      2580
     gcatcgggca ccgcgccaac gacgtggcgc gttcgctgcc ctacggcgac cagcggcggc      2640
     tcgagatcgc ccgcgcgctg gcgaccgatc ctcggctgct ggcgctggac gagcccgccg      2700
     ccggcatgaa cgcctcggaa accgtggtgt tgcgccagct gatcgagaag atccgcaccg      2760
     atggcgtgac ggtgctgctg atcgagcacg acatgaagct ggtcatgggc ctgtgcgacc      2820
     gggtgctggt gctggaatac ggcaaggtgc tgtcgatggg ccggccggcc gaggtgcagc      2880
     gcgatcccaa ggtcatcgaa gcctacctgg gggccggcgc ggcgcacgat cccgaactgc      2940
     atacgacgga gcaagcacca tgacggcatc gcaagcgcta ctcgaattgc gtggcctgca      3000
     agtggcctat ggtggcatcc gggccgtgcg cggcatcgac ctgcgcgtcg atcccggcga      3060
     actggtctgc ctgatcggcg ccaatggcgc gggcaagagc acgaccttgc gcgccatctg      3120
     cggcctggtg ccgctggccg gcgggcaggt gctgtacgac ggccactcca tcggcggcca      3180
     gccgtcattc gccctggtgc gcaagggcct ggtgatggtg ccggaaggcc gcggcatctt      3240
     cggccagctc accatcgagg aaaacctcgc catgggggcc cacgtgcggc gcgatgccgc      3300
     gcaggtgcgc caggacaccc agcgggtgtt cacgctgttt ccgcgtttgg ccgagcggcg      3360
     ccgccaggct gccggcacgc tgtccggcgg cgagcagcag atggtcgcga tggggcgcgc      3420
     catgattgcg cggccgcgcc tgctgctgct ggacgagccg tcgatgggcc tggcgccgct      3480
     gatggtcgac aaggtgttcg aagtggtgcg caccatcgcg gccgagggcg tgaccatatt      3540
     gctgatcgag cagaatgccc gcctggcgct cgaacatgcc gaccgcggct atgtgatgga      3600
     atcgggcgag atcacgctgt ccgggccggc ccgcgagatg ttgcacgatc ccaaggtgcg      3660
     cgcggcctat ctgggcgaag tcgaggcctg agcctgtccg cacgcacggg cgccggttct      3720
     tcttgcggaa ccggcgcccg tgccgcgttc aggcttcggc cagcgctgtc gggcgcggct      3780
     tgcgattgat catcagggca atgaccgcgg cgatcaggcc ggtgctgccg gccagtacga      3840
     aagccatcag gtagctgccc gtggtttcgc gtaccacgcc gcccatccag gcggcgctgg      3900
     ccgcgcccaa ctggtggccg gcgacgatcc agccgaagac gatgggggcg tcgcgatcgc      3960
     caaaggcttc ggtggtcagg cgcagtgtcg gcggcacggt ggcgatccag tccagcccga      4020
     agaaaatcgc gaacagcgac aggctgtaga acgagaagtc cgagtagggc aggtacatca      4080
     gcgacaggcc gcgcaggctg taggtgcccg accggcccgc cgatgtcggc ctgcgctcct      4140
     atggcagcgc accggacacg cccgagccgt cggtcgcgcc gcgtaccggc ctgctggccg      4200
     ccaccttcgg cgccttgcgg cgcgcagcgc gcacccgcac gttctggtat ctgttcgcga      4260
     ccttcttcgt gtgcggcttt accaccaatg gcctggtggg cacgcacctg atcgccctgt      4320
     gcggcgacca cggaatcgcc gaagtgcagg cggccggcct gctggcgctg atgggcatct      4380
     tcgacctggt gggcacgacg gcctcgggct ggctgaccga ccgctacgac ccgcgcaggc      4440
     tgctgttcgt ctattacaac caggcaaggg gcgccatcag cgcggcgccg gcagctaccg      4500
     cccagaccac gcgggtccag tcgccggaag ccgccagggc cgccagcacg ggcaggaaca      4560
     gcagattgcc ggtggccgtg ctggccgtca gcaagcccat catcagtccg cggcgcgtgg      4620
     tgaaccagcg attgacgatg gtcgcgccca ggaccaccgc gaccgctccc gagcctatcc      4680
     cggagaacac gccccaggtc agcagcaggt gccacgattc ggtcatgaaa gcgctggccg      4740
     cgctggaggc ggccatcagc agcagggcgc cgatcaacac gcggcgcagg ccgaagtgtt      4800
     ccatggcggc ggcggcgaac ggacccgcca ggccatacag gaaaataccg atcgccgccg      4860
     ccagggagat cgtgctgcgg ctccatccga aggcctgctc cagcggcacg atcagcacgc      4920
     tgggcgtgga gcgcaggccg gccgacacca gcagcgagaa gaaaattacg gccaccacga      4980
     cgaaggcgta cttttgtccc aggtggcgaa acggcggtgg cagacgcgtt atactcatgt      5040
     tactgaccgg tacgtagtgt ggagctcgca tcgtacgtac cggtcagtaa catcgtcaag      5100
     cagtttttgg cgaccccgat ttccaggagc ccgcatgtcc cgtaaatccg ctccgtcgtc      5160
     caccgccgcg ccggcgccca agctggccgc cgaccgtatc cgcgccaccg cgcgcgaact      5220
     gttctaccgc gaaggcatcc gcgcggtggg ggtcgacgcc atcgtatcgg ccgctggcgt      5280
     caccaagccc agcctgtacc gcagcttctc gtccaaggac gaactggccg cgtcgtacct      5340
     gcgcgactac gaggcggagt tctggagccg cttcgatgcc ggcgcgcaac gctatcccga      5400
     cgatccgcgc gcgcagctgc ggctgtatct ggaaagcctg gccaggcgcg ccgtggcggc      5460
     ggggccgtac cgcggttgcg gactgagcaa cgcggccgtg gaatatcccg acccggacca      5520
     tcccgcgcgc ctggtggccg agacgcacaa gcgcgaactg cgcaagcgtc tcgtcgagat      5580
     ggcgcgccgc atgggcgcgc gcgagcccga gatcctcggt gacggcctga tgctgctcat      5640
     cgagggcgct ttcatctccg gccagttgtt ccacggcgat gggccggcgc gccatgtcgc      5700
     cttgctggcc gacagattaa tcgaagccag cctgtagtca ccccgtttcg tattcgttcg      5760
     atttccaaac cgcctctcga ggcggttttt ttttggttca tcgcgcattg ccggggaagg      5820
     cggcacggat tttgaggaag aagtattcct ggtcgcggta gccgtaagcg cgccgcttga      5880
     tgaccttgat agtgttgttg atgccctcga caatgctggt gttcagggga tgtcggcatc      5940
     tggccaggat gccgtgcaga tagcctttca agcgctgagc gaaggtgttc aaggcggcta      6000
     ttccgctttg ctcggcctgc tcgtaccagt ggttccaggc ttgtcttgcc caggcaggtc      6060
     tttggtagaa ccagagccgt ttgagttcgt cacgcaggac atagaccgtc agcagcggct      6120
     ggttggcttg cagcaattcg tcgagccgga cggcctgctg ccgatccagg ttgtcacggt      6180
     tgcgcagcag cagccagcga ctcgatttga tgatcctgcg tgcgggacga tcctggcgta      6240
     gttgattggc ctgatccacg cgcacccgat caatgacctc tcgtccatac ttggccacga      6300
     catggaacaa gtcatagacg atctccgcct gtgggctgtg ggcctggatc tccaactcgt      6360
     aggcggtggt catgtcgatg gcaacggcct tgatgcgttg ggcggcccca ggcggcaatt      6420
     gttcgaagaa cgcccgggcc gtctcgcgtg agcgtcctgg gccaatccac agcacctgcc      6480
     tgccgatcgg atcgaccacc actgtcgcgt agcgatgccc tttgtgcagg gcaaactcgt      6540
     ccatcgccaa atactcgatc ttggaccaat ccggttcgcg caccgacgca cgcagccgag      6600
     ccttgtccag cgtcttgacg gtatgccaac ccagctcgaa gaacctcgcc accgcctgca      6660
     cgttgctcga ttgcagcaat tggctgcagg cctgcgccag ccgatccgtc acccgttgat      6720
     atcgccccag ccaggcaagc cgctccaggc gcgggccgcc gcattgctca caccacaagc      6780
     gtcggcgcgg cacgtgcaga acgacccgat actcgaataa cggcagatct cgcacccgtc      6840
     gaaccgtggt ctcatgcacc tggcgacacc gcgcgccgca ctgctcgcac agcatcacct      6900
     tggccgttgg cttcaaatag atcgacagcg tgcgccctgg gtcttcgggc cattccacgc      6960
     gttcgacgcc atagccctgc cagcctccca gcgactccag caacttgcga tccagcatct      7020
     ccctgcactc ctgatggcaa atacctgccg tcaagaatac gaaaacttgc caaacccctc      7080
     cacgctattg cgcgatgaac cttttttttg gggggggagg gcgatgtgct gcgcgtaagt      7140
     ccgccatttt cgtacgtatt cgggtgctga ttgctggtac cgcgatatat gggcttattt      7200
     gaaactggag cggctttttc gctgggtgcc acgcacctgt tcgcagcaat tttttcacgg      7260
     tcgtttgttg gcctcctatt tgatatgaat gacagaaaat ccaacagcgt gtcgccagtg      7320
     gcgagatatt tgcgtttcgg cgttgccgcg gtagcgggtg tggcggcggg cgcgttgcct      7380
     tcgtcggatg tcgatgcaca ggccgcgccg gccgccgccg cggccgccaa gatcgaggcc      7440
     ttgtcggata cggatatcta cagcgactac gagcatggca tcgtgatggc tcccgataac      7500
     aaggactaca tcagttacaa gcccgccgaa ggcggtcccg aagcccccct cccccttcaa      7560
     acccgcgccc tatgtttcat tgggtaatga tgtcgtagcc gagcggatac gggtggacgt      7620
     gcgcggcaac gaaaccctcg gcgtgtatgt cgactcagag caccgttcgc tcaccgtgcg      7680
     tgacagcagg atagacgcgt acggcaagcc gccttccatc gagtctccca attattacgg      7740
     tgccgcggct gtctatgccg gcacgctgaa tatcgagaat tccacggttc gccataacta      7800
     tgcggcccag ccgttcgaag acgcggtagg agtcggagta acagcgctcg gcgagaaggc      7860
     catactcaac gttaccgaca gcgaggtatc gggtacgagg ggcgcggtcg tcggctgggg      7920
     gggcgaggcg acattcacca attcgatcgt gcgtggttcg accttcgggc tgtacgctga      7980
     aatgtgcgat acctgcagag acgatgacgg cacctcgcct tcgattcgca tcaaaggcgg      8040
     ggtcgttcag ggtggcgtgg gcgcgaataa cgtcgccgtg gcggtggcgg gggccggaaa      8100
     ggtcgcgatc gagaatgcgg aactgctcgg agccagcggc gtgtacgcca cgttcggcgt      8160
     cggggtcgat atgaagggcg ggcgcattct ggcgcacaac accaatgtcg tcgcaagcca      8220
     ggattacgcc gatggtccct atggcggcgt ggtcctgacc gacggcagcc aagtcaacct      8280
     ggagggcgtc aaggtccgtg cgaccggcca ggaggcggct ggcctatggt tgctgggcgg      8340
     caaggacacc agcccgcgag ccagcctgcg caacaccgac gtccacggag aggtcgccgc      8400
     cattgcgctg ggcttcaatg gcgaggcgga catctcgggt ggtagtctga gcgcggagga      8460
     ggggggcgcc gtgcttacca ccctggcgcc cgatgaagtc gagtattact acgactactc      8520
     cctctccatg gagcgtccgg ccgctgatgc gccgttgacg ccggttcacg tcacgctgtc      8580
     cgacggcgcg cgcgccagcg gagaaacgtt gatcgcgcat ggcgggctgt tgccgatgac      8640
     gctgcgcttg agcagcgggg ccgacgcccg cggcgacatc gtcacgctgc cgccttccgc      8700
     gccacccgat ttcgcggagc aaccggatgc cgagccgaaa ccggacgccg cggcgcagtc      8760
     ggacgccaag gcgaaagcgc gggtcatggc gcaggtagat ggcggggaac ctgttgccgt      8820
     accgatcccg gcctcttcgc atcccgatgc cccgatcgac gtgttcatcg acagtggcgc      8880
     ccaatggcgg ggcatcacca agaccgtcaa tgcgttgcgc atcgaggacg gcacctggac      8940
     cgtcaccggg tcgtccgcgg tgaacagcct gcacctgcag gctggcaagg tggcgtacgc      9000
     aacgcctgcc gaaaccaacg gaaaattcaa acacctgcgg gtcaagaccc tgtcgggaag      9060
     cggcctgttc gagatgaacg ccagcgccga cctgagcgat ggcgatttgc tggtcgtgtc      9120
     cgacgaggcc agcgggcagc acaaggtgct ggtgcgagga gccggcacgg aacccaccgg      9180
     tgtagaaagc ctgacgctgg tcgagctgcc caagggcagc caggcggggt tcacgcttgc      9240
     caaccggggc ggggtggtcg acgccggcgc gttccgctat cgcctgacgc cggacaacgg      9300
     tgtctggggc ctggaacgga ccagccaact ttcggccgtc gccaacgcgg ccttgaatac      9360
     cggtggcgtg ggcgcagcca gcagcatctg gtatgcgaaa ggcaatgcgc tctccaagcg      9420
     cctgggcgag ttgcggctcg atcccggcgc gggcggcttc tgggggcgca cgttcgccca      9480
     gaagcagcag ctcgacaaca aggctggccg acgcttcgac cagaaggtgt acggtttcga      9540
     gctgggggcc gaccatgcca tcgcaggaca gcaagggcgg tggcacgtgg gcggcctgct      9600
     gggctatacc cgcgcaaggc gcagcttcgt cgatgacggc gccgggcata ccgacagcgc      9660
     gcatatcggg gcctacgcgg cgtacgtggc ggacaacggc ttctatttcg attcgaccct      9720
     gcgcgccagc cgcttcgaga acgacttcac ggtaacggcc accgacgccg tctccatacg      9780
     gggcaagtac cgggccaatg gggttggcgc cacgttggag gccggcaaac gtttcacgtt      9840
     gcacgacggc tggttcgtcg aacctcagtc cgaggtgtcg ctgttccatg ccagcggcgg      9900
     aacctaccgt gccgcgaaca atctgtcggt caaggacgaa ggcggcacct ccgccgtgct      9960
     gcgcctgggc ttggcgaccg ggcggcgcat cgacctgggc aaagatcgcg tgatccagcc     10020
     ctatgccacc ctgagctggc tgcaggaatt caaaggcgtc acgaccgtcc gcaccaacgg     10080
     gtacgggctg cgcaccgacc tggggggcgg ccgcgcagag ctggcattgg gcctggccgc     10140
     cgcgctgggg cgtggccaca gcttgtacac ctcgtacgaa tacgccaagg gcagcaaact     10200
     gaccctgcct tggacgctcc atctgggtta ccgctacacc tggtaggaag cgtatggcgc     10260
     gacaacgggg gcgcaatgcc cccgttgtcg ccttgtcgct cagctgtgat aagccgattc     10320
     tccgtggctg gtcacatcca gtccttcacg ctcctgatct tccggtacgc gcagtccgca     10380
     cagcttgtcc gcgatcttgt aggcgatcca ggccaccacg gcggaccaca cgatcgtcag     10440
     cagcacgcct tcgaattgca cccacacctg gccggcaatc gcgctggcgc tgtccaggcc     10500
     cgggccgccg agcaccttgg cattgaacac cccggtcagc agggcgccga cgatgccgcc     10560
     cacgccatgc acgccgaaca catcgagggc gtcatcggcg cgcagcagac gcttcaggcc     10620
     gtttactccc cagacgcaga ccacgccggc ggtcacgccg atgaccaggg cgccgaccgg     10680
     gccgaccagg ccggcggcgg gcgtgatgcc gaccaggccc gccacggcgc ctgaggccgc     10740
     acccagcatc gagggtttgc ccttgacggc ccattccgtg aacagccagc ccagcactgc     10800
     gcccgcggtg gcggtcatgg tgttgaagaa cgccagggtg gcgccgtcgc tggccgccag     10860
     cgacgagccg gcgttgaagc cgaaccagcc gacccacagc agcgccgcgc cgatgaaggt     10920
     catcggcagg ttgtgcggct gcatcgcttc gcggccatag ccgatgcgtc ggcccaccac     10980
     gtacgcgccg accagtccgg ccacccccgc attgatgtgc accacggtgc cgccggcgaa     11040
     atccagcgcg ccgcgggcat tgagcaggcc cggcgcggtt tcggaggcga accagaccat     11100
     gtgcgcgatc gggatatagg caaaggtgaa ccagatcgcc gtgaacacca gcacggccga     11160
     aaaacgcgcg cgctcggcga agctgcccac tatcagggcg caggtgatgc ccgcgaaggt     11220
     cgcctggaac gaggcgaaca agagctcggt gagcgtgccc gacagcgtgt acgtgccatc     11280
     ggccggcgtg aacatgccgg agaagaacgt gcgcgacagg ccgccgaaga aggcgttgcc     11340
     ttcggtgaag gccagcgagt agccgtaggc gaaccacagc agcagcccga gggcgaaggt     11400
     gcacagcact tgcagcagca ccgacagtac gtttttgctg cgcaccaggc cgccgtagaa     11460
     cagggccagg ccgggcaccg ccatcatcag taccagcagt gtcgaaacca gcagccagga     11520
     gatatcggct ttatccattt ttatgggctc cagggagtcg tgtttacagg gcggcctcac     11580
     cggactcgcc ggtgcggatg cggatgactt cctcgagcgg ggcggtgaat atcttgccgt     11640
     ccccgatctt gccggtgcgg gccgactgtt cgatcgcttc gatcacctgg tcgaccagat     11700
     gatccggcac ggccgcctcg acccgcagct tgggcaggaa gtcgacggcg tattcggcgc     11760
     cgcggtaaag ctcggtgtgg cctttctggc gtccgaagcc cttcacctca gtgacggtca     11820
     ggccctggac gccgatatcg gacagggcca tccgcacttc gtccagcttg aagggcttga     11880
     tgatggcgat gacgagtttc atggcggttc ctctcatggt tacgcgtagg catcaagacc     11940
     tatgcaaatt ccatgccata ttttttcgta cctgcgaccc cggccccgca gggcggcggg     12000
     catcctggac gtgcgtgcat gcgccacaac agggcacacc gggtggcgta tgcgccacgc     12060
     tggtgcatga cgcgcccaaa gccgcttaat attgaaacta attgtgtttt ttcgggctgc     12120
     tttgtagcta attgcgtgga aattgcagat tgctgcagga cgggcagggg ttgtttcgcg     12180
     ctgcccgtgg cgcgctgatg tcgatcgcgg acccaatgcc cgtgcggctt tccgtcatgc     12240
     cggcaagccg gccggggcgc ctgccgcgcg catttgcttg tcataaatgt atccatgcct     12300
     tgatacgcgg gtttacacgt aagcgcttgg cgttgccgtg cccctcggga agaatggcct     12360
     gcatgggtgg cggcgttgcc gctatccatg caggcctgga acggtgtcgc ggcaatcgac     12420
     ccccttccgt tgggccacgg ggcgtagctg acggctgctt ctcgggatcg ccggctggcg     12480
     atttagtttt tctcctgtgc tttgaaaggc ggcgccgctt gcgggccgct tttttttcgc     12540
     ttggcgtcgg cgctgcgcga ggctctacac tgtgaggtca agcaacaacc gacacgaagg     12600
     cgaggaagcc atgaaccgca cacagcaatg gatggaagac ctgcagaaga acatttccga     12660
     tctgatcgcc cgcagccccg cggcggatgt ggagcgcaat gtgcgcgcga tgatgacgca     12720
     gacgttcgcc cggctggacc tgatcacccg cgaagaattc gaggtgcagg tggacctgct     12780
     tgcccgggcg cgtacgcggg tcgatcaatt gtcggcgcag gtgcagcagc tggaagcccg     12840
     cctggccacg ctcgaagccg gcaagccgca agcataggca accctccggc cgctcccgcg     12900
     gcgtgacgtt tccggcacgg cgcgccccca cgccagctcc gtcttggcca tactggcgca     12960
     tcgtcatcgc aggggagttg gccatgaccc tggccgtatt ggccagccgg gcgatcgccg     13020
     gctggcaggc gcccgccgtg cgcgtcgaga cccatctggg cagcggcctg cccgcttttg     13080
     ccatcgtcgg gctgcccgac gtcgaggtcc gcgaaagccg cgaacgggtg agggcggcaa     13140
     tccagaacag cggcttcgat ttcccgcccg gccgcattac cgtcaacctg tcgcccgctg     13200
     acctgcccaa ggcctcggcg cgcttcgatt tgcccattgc gctgggtatc ctgctggcca     13260
     gcggccaggt ggccgccagc gccgcgcaaa cggcggcgct gcccgattgc gtgtgggcgg     13320
     ccgaactgtc gctgtcgggc gccctggtgc cgctggccgc gcccttggcc ctggcgctgg     13380
     ccgtggcacg cgagcagccg ggtgcgacgc tggtgctgcc ggctggcagc gccgccgtgg     13440
     ccgcatgggt gccgggcatc cgggtgctgg ctgcccatac gctgggcgag gcggcggcgt     13500
     acctggccgg gcacgccgag ctggcgccag ccgagcgccg cagctggccc gaggtcgagc     13560
     ccggtccgtg cctgtccgac gtgcggggcc agccggctgc ccggcgcgcc ttggaagtgg     13620
     cggccgccgg cggccacagc ctcttgatgt gcgggccgcc cggggcgggc aaaagcatgc     13680
     tggcgcaacg cctgccgggc ctgctgccgc cgctggagca gcgccaggcg ctggaagtgg     13740
     cggccatcgc gggcgccggc ggagcgcccg aggtcctgcg cggccagccg ccgtttcggg     13800
     ccccccatca ctccgcctcg gccgccgccc tggtgggcgg cggcgccagg cctcgcccgg     13860
     gcgagatcag cctggcgcac catggcgtgc tgttcctgga cgaactgccc gagttcgagc     13920
     gtcgcgccct ggagtctctg cgcgagccgc tggagaccgg caaggtcgtc atctcccagg     13980
     cgctgcacag cgtcgagtat cccgccgtat tccagctggt ggcggccatg aatccgtgcc     14040
     cctgcggctg gcgcgggcat gcgtcgaagg cctgccgctg cacgccggac caggtgcgcc     14100
     gctatgcggc gcgcgtgtcc gggccgctgg tcgatcgcat agacctgtgg atcgagctgc     14160
     ccgccaccga gccgcagtgg ctggccgaac cgccgggcga gccctccctt ccggtgcgcg     14220
     agcgcgtggc gcgctgccgc cagcggcagt tggcccgcca gggctgcctg aacgccaagc     14280
     tgtccggccc ggcgctcgat gcgcattgcg ccctgggcgc cgcggcccgc acgctgctgc     14340
     agcaggccat gcggcgcctg ggcggctcgg cgcgcgccgc ccatcgcgcg ctcagggtgg     14400
     cgcgcaccct ggccgacctc gcgcacgagc cggagatcgg cgccgcccat atcgccgaag     14460
     cggtacagta ccgccgtccc acgtagccgg ccgcaatcgg gggcggaaca gcgcggggca     14520
     gacaagggcg ctgcgcaggc cgctcgacaa acggggcgaa atcgccatat aattaaaggc     14580
     tttccggcgc ttgtgcgacc ttttttgccg caggggccgg gagagcgggg cattaatgag     14640
     gggattgccg ccaggcaagg cctcaggaat cgcgcccgaa gcagtaccca tgagcagcac     14700
     caataagtgg acacaggttc gaccaagttt tgtcgcccgg ttggcaactt gcagtagccg     14760
     gcgccaagca cctgtagcca tgtacatcaa catcctctag gaatcatcat gcccaagatg     14820
     aaaaccaaga aaagcgccgc caagcgcttt aaggttcgcg gcagcggatc catcaagcgt     14880
     ggtcaggcgt tcaagcgtca catcctgacc aagaagacca ccaagaacaa gcgccagctg     14940
     cgcggttcgg ctgcggtcca cgaaaccaac gtcgcttccg tgaaagcgat gatgcctttc     15000
     gcttgataag ggagatctac tatgcctcgc gttaaacgcg gcgttaccgc ccgcgcccgt     15060
     cacaagaaag tcattgccgc cgccaagggt taccgtggcc gtcgtggcaa cgtattccgc     15120
     atcgccaagc aagcggtcat gcgcgccggc caatacgcct accgcgaccg ccgcaacaag     15180
     aagcgcacgt tccgtgccct gtggatcacc cgtatcaacg ccgccgtgcg tgagcagggc     15240
     atgagctaca gcgtgttcat cgccggcctg aagaaggctg cgatcgaact cgatcgcaag     15300
     gtgctggccg atctggccgt gcgcgacaag gccggtttcg cggccatcgt gcagcaagcc     15360
     aaggctgcct tggctgcctg atcgcgtaca tacatcgcgg atcgctgcaa acggggctgt     15420
     aatggccccg tttgcgtttt gaaggctcaa attccatgac attactggtc gacgacctgg     15480
     tttctcaggc tcaagaacga ttcgccgctg cctccgacgc cgccgcgctc gaaaacgcca     15540
     aggcgcgctt tctgggcaag gaaggcgcgc tgacggtcct gctcaaggca ctgggcaagc     15600
     tggaccccga gcagaagcgc gagatgggcg cccgcatcaa tcaggccaag cagcagatcg     15660
     aagcgctgct caacgcccgc cgcgccgcgc tggcgcaggc cgagctggat gcccgcctgg     15720
     cctccgaaac catcgatgtc accctgcctg gccgcggcaa ggccgccggc gggatccacc     15780
     cggtcatccg tacctgggaa cgcgtcgaag aaatcttccg ctccatcggc ttcgacgtgg     15840
     ccgacggtcc cgaggtggaa aacgactgga ccaatttcac tgccctgaac aacccgctgg     15900
     accacccggc gcggtcgatg caggacacct tctacgtcga catgcacgat gccgacggcc     15960
     tgccgctgct gctgcgcacg cacaccagcc cgatgcaggt gcgctatgcg cgcatgcaca     16020
     agccgcccat caaggtcatc gcgccggggc gcacctatcg cgtcgacagc ggcgccaccc     16080
     actcgcccat gttccaccag gtcgaggggc tgtggatcgc cgaggacatt tcgtttgccg     16140
     acctcaaggg cgtgtacacc gacttcctgc gctgcttctt cgaaagcgac gatctggtcg     16200
     tgcgcttccg gccgtccttc ttcccgttca ccgaaccgtc ggccgagatc gacatgatgt     16260
     tcacctccgg acccaatcgc ggccgctggc tggaaatctc gggttcgggc caggtgcatc     16320
     cgcaggtcgt gcgcaacttc gggctcgacc ccgagcgcta catcggcttt gccttcggct     16380
     ccgggctgga gcgcctgacc atgctgcgtt acggcgtcaa cgacctgcgc cagttctacg     16440
     aaggcgattt gcgcttcctg cgccagttca acgaataaat acgggcaatc atgcaatttc     16500
     ctgaatcctg gctacgttcg ctggtcaacc cttcgatcgg caccgatgag ctcgcgcacc     16560
     ggctgaccat ggccggcctg gaagtcgaag aaaccgagcc ggccgccccg ccgtttaccg     16620
     gcgtggtggt ggcgcgcatc gtcgacatcg cgccccatcc cgacgccgac aagctgcgcg     16680
     tgtgccaggt cgacgacggt tcgggcgcct tgctgcagat cgtgtgcggc gcgcccaatg     16740
     cggccgcggg cctgaccgtg ccgctggcgc gcgtgggcgc cgaactgccc ggcggcatga     16800
     agatcggcgt ggccaagatg cgcggcgtgc aatcctcggg catgctgtgc tcggcgcgcg     16860
     agctgggcct gtcgcaggat cacgcaggcc tgctcgaact gccggccgcg ttgcgcccgg     16920
     gcaccgatat ccgcgccgcg ctggacctgg atgacacctt gttcacgctc aagctgacgc     16980
     ccaatcgcgc cgactgtctg tccatcttcg gtgtggcccg cgaagtcgcc gcgctgaccg     17040
     gcacgccgct tacggcgccg gcggccgagc ccgtgccggt cacgatcgac catcgcctgc     17100
     cggtcgccat ccaggccccg gatctgtgcg gccgctttgc cgggcgcgtg atccagggcg     17160
     tcaacgcgcg cgccgcgacg cccgaatgga tgaagacgcg cctggagcgc gccggccagc     17220
     gttcggtgtc ggccctggtc gatatttcca actacgtcat gctcgaggtg gggcgtccct     17280
     cgcatgtgtt cgatctcgac aagatcggcg gcgatctctc cgtgcgctgg gcgcgcgaag     17340
     gcgaaacgct cgaattgctc aacggccagg ccgttgcgct ggaccccaag gtgggcgtgg     17400
     tggtggccgg cgaacaggta gagagcctgg ccggcatcat gggcggcgaa gcgacctcgg     17460
     tgacgctgga tacgcgcaac atctatctcg aggcggcatt ctggtggccc ggcgcgatcg     17520
     ccggccgcgc gcgccgctac aagttcagct ccgaagccag ccaccgcttc gagcgcggcg     17580
     tggactacgc ctcgatcccc gagcacatcg aactgatcac ccggctcatt ctcgacatct     17640
     gcggcggaca ggccggcccg gtcgacgacc agtgcgtcaa cctgcccgta cgcgagcccg     17700
     tgcgcatgcg gctggcgcgc tgccaccgtg tgctgggcgt ggcggtggag cgtgccgaag     17760
     tggcgcagat cttcacccgc ctgggcctgc cgttccagga gcagggcgac gacttcgtcg     17820
     tgacgccgcc gtcgtaccgc ttcgacatcg agatcgagga agacctgatc gaggaagtcg     17880
     cacgcgtcta cggcttcgag cggattcccg acgtgccgcc ggtggcgcgc gccaagatgc     17940
     acgcgcagcc cgaagcgcgc cgcggcgcgc acgccgtgcg ccgcctggtg gccgcgcgcg     18000
     actatcagga agtggtcaat tacagcttcg tcgaagccgc gtgggaacgt gactacgccg     18060
     gcaacgacaa cctggtgcgc ctggtcaacc ccatcgcgag ccatttgtcg gtgatgcgct     18120
     ccagcctcat cgcggggctg gtcgccatcg tgcgccacaa cgccaatcgc aagcaaagcc     18180
     gcgtgcgcct gttcgaactg ggccgcgtgt tccatcgcga tccgcaactg gccgacggcc     18240
     cgctggaagt ggcgggcgtg cgccagccgc tcatgctggc gggcgtggcc tggggcgggg     18300
     cggtcgaaga gcagtggggc gtgccgcacc gccaggtcga cttctacgac gtcaagcagg     18360
     acgtcgaggc cctgttcggc gcgcgcgccg acgcgttgcg cttcgtcgcc gaccgctatc     18420
     ccgccctaca tcccggacgc agcgcccgca tcgagctgga cggccagccc atcggctggc     18480
     tgggcgaact gcatccgcaa tggacgcagc aagccgacct gcaccatgca ccggtcgtct     18540
     tcgagctgga cttcgaggcg ctggccgagc ggcgcctgcc ggcggtgcgc gagctgtcgc     18600
     gccagcctgc ggtcgtgcgc gatctggcct tgtgggtcga tgcgaaattg ccggcccagg     18660
     ccatgctcga tacggtggcc gcggccatcg cgcgcgatcc gcaactgtcg gtggtgcagg     18720
     atgcgcaggt gttcgacgtc tggcgcgaaa agccggtggc cgggcaaact gttaccgaga     18780
     aaagccttgc tttccgattc tggctacagg acactgaggt cacgctggac gaagcccgcg     18840
     ttgccgattg cattgcccgc atcaaggatg cgctggttgc cgcgcacaac gcgcgccaac     18900
     gggcctgatc atcatgggga ccactatgct tgccgagccg cgtacgttga ccaaggccga     18960
     gctggccgaa ctgctcttcg agcgggtcgg cctgaacaag cgcgaagcca aggacatcgt     19020
     ggacaccttt ttcgaagaga tccgcgacgc gcttgcgcgc ggtgactcgg tgaaattgtc     19080
     ggggttcggc aatttccagg tgcgggacaa gccgcccagg cccggccgca atcccaagac     19140
     gggcgagacc atccccatcg cggcgcggcg cgtggtcacc ttccacgcca gccagaaact     19200
     caagagcgtg gtcgaacagc ccagctcgcc gccggacccc gcctctgcgg agtgatacgc     19260
     tttgtcggca attgtcatcg gctcattcag gcctcgcggc ataaaatccc cttatgacac     19320
     gtaccgaacc cactgtaacc acgctaccgc ccattcccgc caaacgctat ttcaccatcg     19380
     gtgaggtcag cgatctctgc ggcgtaaaac cccacgtgct gcggtactgg gagcaggaat     19440
     tcacgcaact caagcccgtc aagcggcgcg gcaatcgccg ctactatcag catcacgaag     19500
     tgctgctgat ccgccgcatc cgttcgctgc tgtacgaaca gggcttcacc atcagtggcg     19560
     cgcgcaaccg cctgggcgat gcgcgcgacg ccgcgcacga tgcagaagcc gcggtgcggc     19620
     tgagcgcggg cgagctgcag gccctgcgca acgagctcgg cgacatctcc tcgatgctgg     19680
     gcgaggcgct gggcggccag tccgagaacg cggccaacgc ctgagcaaag cccggccgct     19740
     caggtacggc aggccgcgac gccgcctggt tcttcgcgaa ccggcggcgt tttccttggg     19800
     cgctcgcaaa cgcggccgtc caggcacggc gtgccggcaa aatttgcgat gcagtgcgtg     19860
     cacgcatttt tcagttctga tatactttcg ttctttcggg gcgtagcgca gcctggtagc     19920
     gcacttgcat ggggtgcaag gggtcgcgag ttcgaatccc gccgtcccga ccagtagttc     19980
     caaggccgtc agtgatcaca tcactgacgg cctttctctt ttggcttttc tcttttgcgg     20040
     cttcagtttg cccggtgcaa gagcgggcac gagcgcaacg aaggggggcg gtagtggctt     20100
     gtggttaagc cattacacgt ttagtcaagc gcggccgcgc ggacgggact acagtggaga     20160
     atcccccaca acccgaagga gagtttgatg atgatcgaaa acctccccag aatgcgtcgc     20220
     gccggatggg cggctgcggc gattgccgtc gccggcctgg cgtttaccgg atgcacgacg     20280
     actacgccca acaaccaggc ggcggccgac cagcgcaacg agatcaacgc cggcgccgac     20340
     gcgacgctgt cgaaactcta caccgcttcg ccgcaggcca aggatctggt gcagcgcgcg     20400
     cgtggcgtgc tggtgttccc gtcggtgatg ggcgccagct tcatcgtcgg cggcgagcac     20460
     ggcaagggcg tgctgcgcac gggcggcaag aatgcgggct actacagcac caccagcggt     20520
     tcggtgggac tgcaggcggg ggcacagtcg cgcgcctacg tgctgttgtt catgaccgat     20580
     gaggcgctgg cgcaattccg ccagagcagc ggttggacgg cgggcgccga tgcgtcggtg     20640
     gcggtcgcca ccataggggc caatggccgt atcgatacca acacggccaa gcagccgatc     20700
     gtgggcttcg tactcaacaa cgcgggcctg atggcgggcg tgtcgatcga aggcgccaag     20760
     atcaacaaac tggatctgta gtccgcgccg ggctgcccgt gggcagtccg gcacgcttcc     20820
     tcggcccgtg cgcgcgtgga caggcgcgcg ggcgcctggt tttgcgcccc caggggggcg     20880
     gtcattccag ggacatgaac atcgcgaacg cgatggggat gatgagcagg aaggcgaagg     20940
     tcgaactgat gaccgttgca gaaatcttga ccagcgtttc actaccggcg gactgaatcg     21000
     tcttggcaag cagcgccaga atactcagta tcgccaacga cgaaaaaact gccacgtatt     21060
     ccatgttgcc tcctagcgtc catgccagct tggcgtagga cgtcccgttg tttacggctt     21120
     gctgttcttg tgtccccatt gtgcgcctca atgtgtagga agtgtctgag ggttttccag     21180
     gggcggatgg gcaggcgccg gcgcgcagca gcaaggcatg gcaggcgcgc tcttgcgccg     21240
     cgctgcagca acggatgatg ggaggaggga aaaaagtgtt gccggggcag gcccggcgac     21300
     gattgtgcgg cgcgccgtgg tcagggcgcg gcgggtttgc cgatccagca cagcaaatgg     21360
     gtgcgcagga acgggcacag gctgttgaca ggtgcgtaca gtgtggcggg caggcgacgc     21420
     gccaagggcg gggccagcgt gatcctggcg gtgtggatgc gggcgtgggg gaacagcgcg     21480
     cgtacttcgc gcagcggtac gccgcgcaca ttcgggttgc gcgggttgtt ataggcgaag     21540
     tcgtaccaca gcacgccgcc gcctggtttg gtccagtgcc acatccgttg cgccagatcg     21600
     cgccgcgcct gggcatccag tatggacgtg aacacggtcg attgataaag cacgtcgaag     21660
     ccttcgcgct ccaggtccag gtccagggca ttgcccgcca ggatggggac ggcctgcggc     21720
     aggcggtggc gcgcctgttc gacgcggctg tccatgaggt cattgcccat caggttggcg     21780
     ggatcgaagc ccaggcgaat caggtcgagc agattgctgc ccgagccgca gccgacctcc     21840
     agcacgcgag cctgcgcggg cggcaccgac aggtgctgcc gcagcatgta ggccagcgcg     21900
     cgatcgcgct cgtgttgaat acgttgattg accggcagca gagggatgta gcgcgcattc     21960
     aggtcggcgt tggccgcgcg cgctgtatag acatctttca gcgtgtcggt ccactcatgg     22020
     gaagacgggg ccatcggcgc tccgttaggt gaatggacaa ctgacaaacg ccttaacaat     22080
     agcgtgccga ttgcgtggca tgcaagaacc gatgcacggc gatgcggcac cgaattttcc     22140
     cgatccgggc aataacctag gcgggtttat gcgggctggt gtgcaccacg tagcgaacga     22200
     acccgctatg cggtgtgtat tggtcgtaca gcgcccgggc gcgatagttg ttttcccggg     22260
     tgttccagta caggcgcgac cagccgcgtg tccgggcctc gtccaccagc cagtccagca     22320
     tgcgccgccc tgcgccctgg gcgcgcgcct gcggatcgac atacagatcc tgcaggtagc     22380
     acaccggcgc cagggtcgag gtgttctcgt gcagcaggta gttggcgatg ccgagcacgc     22440
     cgtgcgtggc gctttcggcc acgatggcgt agacggcctg ggccgggtcc atgatgcggc     22500
     gccaggtatg gcgggtcacg gcctcgacgg gttcgcgttc gtagaagcgc gtatagccgt     22560
     cccagagttc gcgccagcgc ggttcgtcgc ccggccgtac ggggcggatc agcaggtcgc     22620
     ggggcgccat ggtcagcggg tcagttcggc gcgcgcgttg tccaggtcct gctgggcctc     22680
     gcgcagcttg cgctcggcct tggcgatgtc gtcggcgtcg ccttcctgcc gctcttcgtc     22740
     cagttcacgc tggcgttcgg ccaccttgtc ggtggcgtcg cgcacatcgc gctcgcggtc     22800
     ggcccgcagg cttgcgtcgt cgcaatgccg ggcgcccgcc agcgcctctt cgaggccctt     22860
     gatgcggccg gtgttgccat gggcgcgcgc ctgcgccagc tcggtctcga tgcggtcctg     22920
     cttggccgcg cagccggtca agggcgcggg gggctgcgcc agggcctggt cgcatgccag     22980
     gatggttgct gcccagacta gtcgtgacat aagctacctc gtcgcggtcg caaaggcttg     23040
     atcatacgct gacgcagaca ttgccggcac atgggtggat cgcggcgccc gcaatccggc     23100
     atcgcggcgt tttccctgcg tgaggtgaac catcatgaat cgacgtggat tcggggccgg     23160
     catgctggcg gccctggggg cggcgtgcat gccgccatgg gcgcgcgccg gcatgcggcg     23220
     cgcggcgcgg ccggccgatg cggcggcgca agcgcagcgc cagcttgcgc tgctggagca     23280
     gcggcatggc gtgcgcctgg gcgtccaggt gcacgatcgc gacagcgatc gcgcgttcag     23340
     ccatcgggcc gacgaacgct ttccgatgtg cagtaccttc aagctgctgg ccgccggcgc     23400
     cgtattggcg cgcgcagacc gcggcgacga tagcctgcgg cgcctgatcc gctacggcgc     23460
     ggcggacatc gtggcgtatt cgccggtcac cggaccgcgc caggccgagg gcatgacgct     23520
     ggagcaattg tgcgaggcgg ccgtcacgcg cagcgacaac accgcgggca acctgctgct     23580
     gtcgacgctg ggcggcccgc ccgggttgac cgcctacgcg cgcggcctgg gcgaccggat     23640
     gacgcggctc gatcgcatcg agaccgcgct caacgaggcc aggcccggcg atccgcgcga     23700
     taccaccacg ccggccgcca tggccggcaa cctgcagcgc ctgttgctgg gcgatgcctt     23760
     gcagtcggct tcgcgccagc ggctggccga ttggttgctg gccagccaga ccggcgatac     23820
     gcgcctgcgc gccggcctgc ccgcgggttg gcgtatcggc gacaagacgg gcgcgggcgg     23880
     ccatggcacc aacaacgata tcggcgtcat ctggccgcgc gatggcgcgc cggtgctgat     23940
     ctcggcctat ctcacccagt ccagcgcctc gcgcgaggcg cagaatgctg tgctggcaga     24000
     agtgggtcgc atcgccgccc atgcggtggc ggcgtggcgg cttggcagct agcctcgggg     24060
     cgccgttcag ttcttctcgg cgggcggctg cggcttttcg tcgcaataga aggtgaccac     24120
     ggccttcttg ggcatcagtc cggtcgcgtg gttggacgtg atttccggac gcgcgaactt     24180
     gcgcccctgg gcttcgcagt actggcgcgc gcgttcgcgc gcctggttct tgatctcgac     24240
     ccaggtcgcc gccttcatgc ccgcgttgta gctgaccgtg tactgattct tggcgaccgg     24300
     cgtgacctcg ctcatgctgg agcaggcggc cagaaacagg acgagcatgg gggcgagcag     24360
     acgtagcggc ataggtgcat ccggacgggc cggggactgg gggttggtgg cggttcccac     24420
     agtgtagcct tgtcgcgtca gcccggcgcg atggcgctgc ggcggtccag cctgcggctg     24480
     agcacgatgg atgtctgcgt ctgtttcacg ccgtcgatca ggccgatgtg gtcgagcagg     24540
     tcgtcgagct gctcatgggt ttcgcagcgc accccgtagc cggcgatcac gccgtcgcgc     24600
     tccagacgtg caatgcgtgc gacgacagtg ctgcgcgcaa gatgcagctt gcgcgccagg     24660
     atggcggcgg gttcgcgcgc gttggcctgc agcaggctga gcaattgccg gtcgatggcg     24720
     tcgagtcttg gatccatggc gggcgcaggg cggttgcggt ctggcgcacg gtacagggcg     24780
     gccggcggtg gcgtcaaccg cgccgcctca atcgggttcg gtgggcagcc cgccctggta     24840
     gatcctgccg ccgaactcga agtggccgat cgcgcgcgca gcggcctcga aaagacggtc     24900
     ttgctggccg tccacggcgg gcgtggcgtg ccgtggctcg aagcggcata tatcgtcgtc     24960
     gcgcccgaac caggcgcggg ccaccagggt gtcgacgccg gcctcatgcg cgaagtgggc     25020
     gaactcgcgc aattgctcca tctcgtggaa ggcgccggac aggctgctca gggtgatgcc     25080
     gaatttgact tcggtcaccg gctccggcgc cacggcgccc ggtgcgggca atggctcgcc     25140
     atcgtcgtag tcgaaccgcg cgccgatatt gcgcatgcgt tccaggacca gccgccattg     25200
     ggcttccggc aaggccagcc gggcggccat gtaaagcagg cgctggcggc ccagcgcatg     25260
     cggttcggct ccgtcgacat agcgcggcca gggcgtctgg tcgtcgaggc ctgccagctg     25320
     gttcatctgt gcggtactgt agtgcagggt ttcctgcagt cgacgcagcg cggccggact     25380
     gggcggcgca tagttgcgta tcgtcttcat ggttggcctc cgcttccacc cggcctggcc     25440
     ggcttgcctg gccgtcgatc catgctagcg ccgccatcgc ggcctgcata gcggtaacgg     25500
     gctgcgtgct agcatgcgac ccagaaaatt ctgcgacata gagggtgata tggatattca     25560
     agaacagatt gcagtgattg tgcatacggt gtcgcatcaa ggtgggcgta tcgatgcgct     25620
     tcattcgacg ctggcgtcgg tgttgcacct ggtcaagggg tcgcctggat tgcgcgaggc     25680
     gatcgaggcg cacctggagc aaagctacgc caacctgctg gcacgctcgg agaacccgca     25740
     gtacgtggcc ggcttcgaga gcgtgcgcga taccgtggtg gccgcgctca agtagcaagt     25800
     tgcccacatc ttctgtggac aagccttggg atagcctgcg cgtagatcga aaattcctcg     25860
     ctggaacaag gacttgtccg gggcgggcaa tccgggagcg ggcggcgggc tacaggccgg     25920
     cggcgacgat atccgccagg cgcttcatgg ccgcggcaat atcggcggta taggggacgc     25980
     cgcagctgat ccgcaggaaa tgatcgtagc ggttcgagtt cgagaacatc gggcccggcg     26040
     tgatgcggat gccggcccgc agcgcctgct cgaacacgcg catggcgggc atgcacgcgg     26100
     gcaattccac ccagagcagc atcccgcccg tgggcacgct cagccgcgtg ccgtccggaa     26160
     agtggcgcgc gacggcggcc gccatggctt cacgctgcac gcgcagcgtc tggcgcaggc     26220
     gcgccaggtg gcggtcgtag gccttggtgc ccatatagtc ggcggccgcg gcctggggca     26280
     gcggcgggtt gggccggctt tgggcgaatt tcagcatgcc gatgcgccgg ctccagcgtc     26340
     cgcccagcat ccatcccagc cgcatgccgg gagccagcgt cttgtgcagc gatgcgcaat     26400
     agatcacgtt gccgctgtcg tcccatgatt tgagcgccag cggcgtgcca tggtcgccca     26460
     gcgcgccata ggtgtcgtcc tcgatgaggg cgataccggt gcgttcgcac agcgtgacca     26520
     gccgggcttt gtcgctatcg tccatgacgc aactcagcgg gttctggaag ttgggcacga     26580
     cgacgacggc gcgaacgttc gcgtgcgtct gcagcgccag ctccagcgct tcgatcgaaa     26640
     tgccgcgctg cgggctggtg ggtatttcca gcgcgcgcag gcccaggctt tcgaggattt     26700
     gcagcaggcc gaagtaggtc ggcgattcga ccgcgatcgt atcgcctggc cgcgccaccg     26760
     cgcgcagggc caggttgagg gcttcgatgc agccgtgcgt gaccagcact tcgtccgggg     26820
     ccgcactgat gccgcattcc atcgcacggc gcgccagcac ggcgcggaac tccggatggc     26880
     cgtagggcgg cacgggcgct gtcagcagtt ccggcgtgtg ccgcgccgcg cgcgtgagcg     26940
     ccagctgcag cgctcgcatc ggataggcct gcggcggggc ggcggccagc gcgaagtcgg     27000
     cgctcagcgg atgctgctgg cacgacgcaa tgaaatccga gacccggtcg tggatgccga     27060
     cgtattgcgc gggatcgagc gcgcccttga tatcgggctc gggcaccggc gcaagagccg     27120
     gacgccgcgg gcgcaggaca aaatagcccg agcgcgggcg ggcctcgatc aggccgtcgt     27180
     cctcgagctg gcggcatgcc tgcagggcag tggacaggct gacgtgatgg gcgcgcacca     27240
     gattgcgtac cgaaggcatg cgttgcgccg gggccagtac gcccgtctgg atggcgcggc     27300
     gatagtggtc tgctaggcgc agatacagcg gctgcgtgtt catggcgcga tggtgcatcg     27360
     gcagggctgg ccgcaacagg cacagttgtg gtgaaaaaca accataacag agttcgattt     27420
     ccagatctgt atcgatacag acagcctgtt gctgtgcctg ttgcggcgcg gcgcggaccg     27480
     gtagcctgaa gacctgtcta ccgatgtcat acgaggctgt catggatcgc tcgctgtatt     27540
     ccacggaacc cgcggaccgc gctgttgcgc atgccacgcg cctgcaactg gctgccgggg     27600
     cggggctgtg ccgccatgcg cgaggcggcg ctcaattgat ctgcctggaa gggcgggtgc     27660
     gggtggtgga gcattgcgcg ggccaggacg gcgcgggcgt gccggtcgac gttccgctgg     27720
     tggcggggca ggcgcaccgc gtggaattcg gtggcgccgt gacggtgcgc gcacaggcgg     27780
     cggcgctggt cgtgtgggta gagccggcgt cgcggttgcg cgcgatgctg gctgtcgcgc     27840
     tgcaaggatt ttcaaaatgg gttatgatta cgttcatcag acgcggggtg gagcagtctg     27900
     gcagctcgtc gggctcataa cccgaaggtc gtaggttcaa atcctgcccc cgcaaccaga     27960
     tcaaaaaggc ttggcgattc atcgccaggc cttttttgtt ttcgcagtcg cagtcgcagc     28020
     tttgcgcgct tggcgcggcg gggcttcttg ccagccctgc tcatgcgcta ccatgggcca     28080
     cccgagcgac cttgtcgcat ccaaggaggg gacatgggaa ctgccaagta cgatcatccc     28140
     ggttatctgg ccgacgccgg cgccgccggt acgtatcacg tcggtgtctg gtgcccgcac     28200
     ggttatcccg cccacgtcca tatcggccgc gccggcagcc aggacgatgc gcgcctgcgg     28260
     ctgcgcattc ccgacggcgt attccagtcc atgcccgacg acatggaaac attgtgccgg     28320
     cgcgctttcg ggcaggcgct ggccgaaggc ctgctggccg cgagcgaagg cgatttccag     28380
     gaggtccggc tgcgcctgga cgcccagccc tggaacggcc cgttggcggc ggcgcaaccc     28440
     gcctgagcgc ggttacccac aggcgatgtg gacaaccctt gggatagggt gcgcacatct     28500
     gcctaatccc gcgtcaaaac aaggacttgc gcaacgtgct caagaaaggg gctgagcaag     28560
     gcggccggca ggcgcccgcc ggcatgctca gccgcactgg cgctggatcg cggcgggatc     28620
     ggtcacgtag tgattgccgt tgccttgcag cgtccggatg cgctggtcgc gcgcacgttc     28680
     ccagtcgtcc accgggtagg cgtgcgccca tacgcacagc acgcgccggt cctcgcgcga     28740
     cagcttcagc ctgtagcgct cgaccatgta gaactggatg cgcgcgatac ggccgcgcac     28800
     gtacttgcgc ggctgtatgc ggcgggtctt gaagtccacg atggtttcgc actggccgta     28860
     catgggggcg ggccgatcgg cccagacggc gtagcggaag ttctgccggt cgccgttgac     28920
     ctcgccgacc gacggcacca ggttcaccag gtcgccttcg gcgcgcgcga acacggggtc     28980
     ggtccggccg caatgcttgc gtccgcccgg cttgccgttg acgcgctgtt gccagcactg     29040
     gcgctggtgg cccagcgtcc aggccggcac cacatgctcc cattccagtt gctgcgcacg     29100
     ccggggctgc ttgcgcggcg cgtagccaca ggcttgcagg tcgatgcgct tgccctggta     29160
     cgggcagccg cagtagaagt cgcgctccag gctctggtag acgcgtggca gcactttctt     29220
     ggcgtgccgg aagtcgcggt gtccgacggc gttcggacgg gtgaccagct cggcctgggc     29280
     ggccagcggc aggctgagca gcgcagccaa tacaacagca tatttcatgg cgcagcattg     29340
     taggtggatt gcctacgcca tgcgtcacag gatggcgcgc gcatgcaact gattgcgagt     29400
     gcttgctgca gaaagcacgc cgctgcgtta tcctgagccg gtccggctcg gacccgccgg     29460
     ctttcccgtc gctcgttcga cgcttcccag tccaggagat gtcatgaaga acaaagctct     29520
     cattgttgtg ctgcttgcca tggccgcgct gtccgcgggt tgcaatacgg ttgccggcgc     29580
     gggcaaggat atcgagcgag gtggcgaaaa aatccagggt gcggcccaga agtagcgcaa     29640
     ggcggcgtag ctagccgcgc catgcgcagc cgcctgccgc gatagggcgc caaggcggct     29700
     ttttcattgg gcgcgttgat gcataatccg tccgttgcat tacttggagc aggagtcgat     29760
     atgcgcaggg tagggttgat cggagcgctg ctggccgccg gtgtgttgag cgggtgcgcc     29820
     agccagggcc tgctgtcggg cgatacgccc ggactgtccg aaagtttcat cgtcacggcc     29880
     gatttccagg cggcgtatcg ccgcgccggc gaatacgtgc gcgtctgcca cgagcagcga     29940
     ccgcatccgt acggcgtggt gtaccagtcg tcgcggcgcc tgggcgaccg tggcgcgccc     30000
     aacgaggtgc atgtgttcaa gcgggaagag cccaccaaga tcctcgaaat catccagtcg     30060
     cagaccgaga cgccatcgac ggcccgggtg acggtcaggg tgctgggcga tggcaagtgg     30120
     gatgcggcgg agattgccgc ggccaaggcc tcgatccagt cggccacgcc ggtgtgtaga     30180
     caggacgtcg gctgagatgg agcacggcgc ggacgagcgt acgggcgaca gcgggcaggg     30240
     cttgctcgcc ggccccttgc gtctgctggc tggcctgaac ggcctggcgg cgttgatgct     30300
     ggtcgcgttt tctctgggca tcgtcggcgg cgaggtggtg ccgcccgcct tgcaggcgcc     30360
     tctggccctg tttctggcag ggctggccgc cgcgatggcc gcgatgttgt tcggcacggc     30420
     cgcccgctat ctgcggcgcc gcaaggccgc cggcgtgcgc ggtcgcggcc atctccccgc     30480
     cgtggtgctg gcgattgccc tgtatctcgc cagcgtcgcg gcctttggcg cgggctgctg     30540
     gctggcggtc gccccggccg ataccgacta cgaccagcta cccacggtat acgcaacccg     30600
     cgtctgaccc gcgccacagt gccggttata tacgcaaaaa atcatggacg tcggtttttt     30660
     ggtcgaataa tatgcgcatt gcgtatattt gcattccttc ctggggccgc ccatgtccat     30720
     ttcccaacaa gcctttctgc gcgacgcgat gcgtcgcctc aacctgacgc gcgacgtgtt     30780
     cgccggccgc atcggcgtca aacgccgcgc gctggatacg tggctgttgc ccgaagggtc     30840
     gcaggaattt cgcgcgatgc ccgaagtggt agagcgcttt gtcagcgaaa tcgtgcagaa     30900
     ccgcgacttg ctggagaaat atacgcagag cgggcaggtg ggccccttgc gcgaccgcat     30960
     tgccgtcgaa gggcgtcatc agctgctgtc ggtcgaccag ttcacccgcg aatcggtgga     31020
     agacctgttc cgcgtggcgg acatgatgca acccattgcg cgccgccaga aggtgtcgcg     31080
     ggtgctggaa ggcgcggtgc tgggcaacct gttcttcgag gccagcacgc ggactcgcgt     31140
     cagcttcggc gcggcgttct gccgcctggg cggctcggtc tgcgacacca cgggcttcac     31200
     gttctcgtcc atggccaagg gcgagtccat ctacgatacg agccgcgtga tgagcggcta     31260
     cgtggacgcc atggtcatcc gccatcccga gcaggggtcg gtggcggagt tcgcccaggc     31320
     gaccaatatc ccggtggtca atggcggcga cggcccgggc gagcatccca gccaggccct     31380
     gctggatctg tacaccatcc ttaccgagtt ctcgcgcctg ggcaagctgc tcgacggcgc     31440
     gcacatcgcc atggtcggcg acctgaagta cggccgcacg gtgcactcgc tgatcaagct     31500
     gctggcgttg tacaagggcg tgaagttcac gctgatctcg ccgcaggggc tggagatgcc     31560
     cgactacatc gtcgagcagg ccagccgcaa cggcaatgtg atcgagcaga aaagcacgct     31620
     ggccgagggc ctggcgggcg cggacgtcat ttacgccacg cgtgtgcaga aagagcgctt     31680
     cgccaacgaa gaggcgggcg aaggctatac ggcggacttc caggtcagcc gcgccatcat     31740
     cgacgcctac tgcggtccgg ataccatcgt catgcacccc ttgccgcgcg acagccggcc     31800
     ggggtccaac gatctgagca cggatctgaa ccacgacccg cgcctggcga ttttccgcca     31860
     gaccgacaat ggcattccga tccggatggc gatcttcgcg gtgctgctgg gcgtggaagg     31920
     gctggtgcag cattcgatgc gcgacgtgac gtggcagcat ccgtcgcaca tcggccccga     31980
     cgactcggta ttccacggcc tggactaggc cgtgccgcgt ggcgcgtcga cgccacgcat     32040
     ttccgcctca gacgcgcttt tccccgccca gcgagtcgac cagctcggcc agcagcttgg     32100
     ccacttcgcc ggtcatgagc gtcatgtccg aatcgaactt ctcgtcgtcg ttctgggtgg     32160
     ccgcgtccgg gttctccttg agcacgtcca gcggcgcgac gcgcttgacg tccagcgatt     32220
     cggtcagcac gaacgacacc cgatcggccc aggtcatggc caggcgcgtg cattgcttgc     32280
     cggactggat atggcgccgc acatcgtcga cgtcgatcga gtgcttgacg tagcggatcg     32340
     cggcgcggct ttcgccggag gcgcgcagct ccgtatcctg gtcgatcgag aagttggcgg     32400
     gcgcttcgtc ggccgccagc caccccgtca tcgccgcggc gggcgattgc tcgacataga     32460
     gattgtccag cggcagcggg tcgatcgtct tggccagcag gccgatgacc tcgtcggcct     32520
     tcgcggacgc ggccgcatcg atcaccagcc agtggttgac ggtatcgatc cagacgcgcg     32580
     tgtcgcggta gatgctgaag gccttgggca gcagctcgtc ggtgacgcgc tccttgattt     32640
     ccttcatctg cttgcggcca ggcttgtagc cttgctgctc ttcgatttcc tgcgcgcggg     32700
     ccttggcgac ctgattgacg accgtggtcg gcagcagctt cttctcggcg cgcagcgtca     32760
     gcaggatctg gccgttgagc gtatgcgcaa gcaggccgtt ctcgcgcggg gatatccacc     32820
     ccaggctctg catttcgagg ttattgccgc cctggtaggc aaagcgggca aggcattctt     32880
     ccagctggtc gccattcaag gcccagggcg cggaaagccg gtaaatcttg agattcttga     32940
     accacatggc gtcgggcaaa aggattgatt ctatacgacc ggggcccact catgcacccg     33000
     cgccgtcgca ggcattgaca cgacaccttc tgtcactgac agtgtgcagg cgttcgggta     33060
     tcgtccggcg catctaccac ttgccgcaag gggagagaag atgaagccag ccaccatcgt     33120
     aggcgccgtt ctgatcgtgt tgggcgctgc cgccctggtc tacaaggggt tctcgtacac     33180
     gtcggaggag accgtgctgc aagtcgggtc cgtcaaggcc accgcgcaga cggagaaaga     33240
     cgtcgccata ccgagctggg ccgggatcgc cgcgatcgtg gtcggcgtgc tcatcatcgg     33300
     ggtgggcatg cgccgctgag gcggcgccgc gaggcaaaaa aaggcccgac acatcgtgcc     33360
     gggcccgtac ggggcacgca atgccgcgtc aataaggctc gcggggaaca cggcattggt     33420
     gtcagagtac tggccctgca atccgcggac aggggatcgt ttgtccatgg attggcgcaa     33480
     ggccgtgatc tgagcgatca gtctaatcct ggaggtctga cagcgtcctg aatcggacgg     33540
     cgtctccagg ccttggtgtc gggcctgcag cgcgggccgg cttacagtac gccggtgcgc     33600
     tgcagatcgg cgatctgcgc ttcgctgcgg cccagttcgc gcaggatcga cacgctgtcg     33660
     gcgcccaggg cgggcgggct ggtctcgccg cccaccggcg cgcggttgta gtgaaagggc     33720
     gcgcccacat acttgacgcc ctcgttatcg accaggatcc ggcggtgcgc cacctgcggg     33780
     tcccgggcca cttcgggaat gctgttgatc gggctgcatg gcacatcggc cgcctccagg     33840
     cgcgcgatga agtcatcgcg gcggccgctg gcgaacacgg cattgagcag cggctcgagc     33900
     tggctgtgat tgagcgcgcg catcgggccg tcctggaacc gcgggtcgtg cagcaggggc     33960
     tccaggtcca gcgccgcgca gaagcgctgc cattgcggtt cggtatcgac gcataccgcg     34020
     atcgggaagt ccttggtctc gaaagactgg aacggggcaa tcagagggtg ccggctgccc     34080
     aggcgctcgg gaacgtcgcc cgcgttcagg tagcgcgaaa tcgcgttttc catcagcgcc     34140
     atctggcaat ccatcatcga gacgtcgatg aaggcgcctt cgccgctgcc gtgcctgcct     34200
     tcgatcgccg ccaggatcgc caccgtggcg aacaggccgg aagcgatgtc gccgatcgag     34260
     acgcccacgc gggccggcgg gccgccttcc tggccggtga tgctcatcat gccggatatg     34320
     gcctgggcaa tcacgtcgaa ggcgggtttg tggcgataag ggccggtttg gccatagccg     34380
     gagatcgagg cgtagaccag gcccgggttc agtgccttgg catcgtcata ccccaggccc     34440
     agccggtcca tgacgccggc ccggttgttc tcgaccagga tgtcgctgcg agcgatcagg     34500
     tcgcgcagga tctgcttgcc ttcctcggtt ttcagattga ccgcgatgct gcgcttgttg     34560
     cggttgacgc tcatgaaata caggctttca ccgccgtgaa agggcgcgat ggcgcgggcg     34620
     aagtcacctt cgcccggccg ctcgaccttg atgacctcgg cgccgagcag ccacagcagc     34680
     cacgtgcagt aggggccggc gagcatatgg gtgatgtcga ggactttgag gccagccaga     34740
     ggcttggccg gtgcagattg tgcaagcatg gagagatggg cgacagggcg ccatgagggc     34800
     tgagatgcaa cgatgttgca gcctgcttcg ctccagcaca atcgcttagt ttgtcgcgca     34860
     tccgtgcatt tgatgcactg cttgtgcaat caggcccggc gcgggcctag gagagggctt     34920
     cggtcagcca ttggcggacg gtcgcaatgg ccgggtcgtt ccatttgtgc tcgggggcga     34980
     cgaagtagta gccgcccatc tgtacggaga cgttgggcag cacctccacg agatcgccac     35040
     gcgcgatccg gtcgttggcc aggagctcgc tgaccagcgc gatgccctgg cccagttgcg     35100
     cggcctccat cgtcaagtgc ccgtgccaca agcgcgggcc gcgcaggatg ggcagctgcg     35160
     ccacgcccac ggagcccagc cattgctccc actgatccgt ggactgctcg tgcaatagcg     35220
     gcaagtgaac caggtgttcg ggttcgccga tgtcgggaaa gcgctcccgg aatgccgggc     35280
     tgcacacggc caggatgcgc gggcgcgaga acatctccgc gcgcaggccg tcgccgatga     35340
     acggctgggt caggtagatg atttcggcgt cggcctcatc cttgttgaag tcgggccggg     35400
     cagtggtggg ttggaggatc agctccttgc cgtcgagccg gctctccagc tcgggcaggc     35460
     gcatcaacag ccggcgagag gcgaggccag ccatgcagca gacatggatg gcgtcgcccc     35520
     ggccatggac gagttcaccg caagcgtccg cgatgaggtc cagcgcgcgc cgcgtcttgg     35580
     cggcgaagcg ctggccttcg cgcgtaaggg ccaggcctcg gccgtccttt ttcaccaatc     35640
     gcgtgccgac ggcatcttcc aggttctgga tatggcgcga tacgacggta tgggaaatcg     35700
     ccagcaggtc ggccgcggcg cggatgctgc cgctgcggct gaacgcatca aatgcacgga     35760
     cggcaatcaa ggggggaagg cggcgataga tcacgatgat tgaaggttgc ctcgaaaacc     35820
     agatatagcg ccatttttgg aggagttgcc gcaataggtg taatcccgag tctgggtgcg     35880
     tacggcgcaa taggtgcgta aaagctgccg atagacgtct cgcaaactgc ttgttggccc     35940
     tgggggattc ggacattctc tgcctcagca gcgcggccat gccgcgcctg gtcagaacaa     36000
     ggggaagtca tgagtatttc caatcgcgcg gccatcgtcg gcctgtgcga atcgccgcgc     36060
     cgccatgcgc ccgaggtgca tccgtaccag atccagatgg agtgcgtgca gggcgccctg     36120
     gtcgacgccg ggctgagcct ggcggacgtg gatgggctgt gcgtggcggc cggcgactgg     36180
     gccgaggggg gcggggtcaa cagcgtgacg gagtttgccg aatatgccgg cctgcgtccc     36240
     acctggttca acagcacgga cgtggggggt tgctcctaca tcgtgcacgc gggccacgcc     36300
     gccgcggcca tcgcggcggg cctggccgag gtcgtcgtga tcagttatgc ggccacgccg     36360
     cgttggtggc cgctgagcac gccgtccttc gacccctttg tcttccccgc cggcccgggg     36420
     cagtacgagc ttccctatgg cccgaccctg atctcggcct acgggctgta tgcgcagcgc     36480
     cacatggcgc gatacggcac gacggccgag caactggcca gcgtggcggt gaccttccgg     36540
     acccatgcgg ccgccaatcc tcatgccagg ctgcgcacgc cgatcacggt ggacgacgtg     36600
     ctggcttcgc ccatgatcgc ctcgccgctg cacaagctgg attgctgcgt cgtgaccgac     36660
     ggcggcggcg ccgtggtgat gaccagcgcc gagcgcgcgc gggacttgcg ccacaagccg     36720
     gtgctgctgt ccggtttcgg cgcggcgacg gcgcgcacgc agctctcgca gatcgcgccg     36780
     gacctctcga cactggcgac gctgtcgggg ccgcgggcct tcgcgatggc gggcctgtcg     36840
     ccggccgaca tcgatgtcgc gcagctctat gacgctttca ccattacgcc gctgctggcg     36900
     ctggaagacc tggggttctg caagcgcggc gaaagcggcg ctttcgccgc cgacggccaa     36960
     ctgacgctgg gtggcgcgct gccctgcaat acggacggtg gcggcctttc ctccaaccat     37020
     cctgggaagc gcggcatttt cgccctgatc gagggcgcgc ggcaattgcg cggccagggg     37080
     ccgggcgtgc aggtgcccga tgccgggcgg gccctggtcc acggcctggg cggcactttt     37140
     tgcgccgcgg ccactgccat tcttaccgtg tgaggacgcc atgttcgacg taacgatgcc     37200
     ccctgtgcag gacgtctgca gccagccttt ctgggaggcg gcctgccaac agcgcctgct     37260
     ggtccagcaa tgcccgacga ccggccgcca tcagtggtat ccgcgcgccc attcgctggc     37320
     cgaccccggc gcggcgccgc gctgggtgca ggccagcggg cgcgctcgtt tgttttccta     37380
     caccgttatt cacaagggcg gtgtgcagaa ggcgccttac acctgcgtgc tggtcgagct     37440
     ggaggaaggg cccttgatgc tgacccgctg cccgagcgag cggccgctgc aggtcgacat     37500
     gccgatgcgc gtggccttcg agaagatcgg cgatacgctg accttgcccg tatttgttcc     37560
     catggagtcc tgaatgcctg tcgaattcga gcggatacag ttgggcgagc gccatgtctc     37620
     gtcgcgcatc aagatcaccg aaagccatat cgtcacgttt gccggcctga ccggcgattt     37680
     caacccgctg cacatggacg aggtggcggc acgcgaaaac ggctacggcc agcgcatcgc     37740
     gcatgggatg ctggggcatg ccgtgagcac cggcctgcgc tcgggcatcg acgattggga     37800
     catcgtggcc ttcctggaaa cccggcgccg ttttgtcgcg cccatcctgg ccggcgattc     37860
     ggtacggtac gaggccgagg tgctggagct gcggcccagc cggtccaagc ctttcggcgt     37920
     ggtcaaggta tccatgcagc tgcgcaatca ggatggcgtg acagtgcagg acggcgaaga     37980
     cgtgttcgcg gtcgccatgc gcggtggagt agcgtaaatg aagaacgaac gattgcaggg     38040
     gcgggtggcg ctggtcacgg gcggcgcggg tggcataggc ctggcggtgt gtcgacgctt     38100
     gcaggccgaa ggcgcgcgca tcgtggtggg cgacattggc gaggagcgcg tgcttgccgc     38160
     ggcggcgtcg ctgggcgagg gggcgcttgg cgtattcctg gacgtggcgg accgtcagag     38220
     ttgggccgcc gccaagcggg cggtggatgc gcagggctgg caggtggaca ttgtggtcaa     38280
     tgtggccggc atcgtgcgcg atcgttcgct ggccaagatg tcggacgccg aatggagcgc     38340
     cgtcatcgac gtgaatctgc gcggtacctg gctgggctgc cagagcgcct ttgcgtggat     38400
     cggcgaacgc ggctgggggc gcatcatcaa tgtggcgtcc accgccattt tcggcgccta     38460
     tggccaggcc aattattccg ccgccaaggc cggcatcgtg gggttgacgc gaaccgcggc     38520
     gctggaaggg gccaagcgcg gcatcctggt caacgccgtg gcgccaggta tcgtcgaaac     38580
     cgcgatcctg gccgatgtcc ccgaccaggt ccgcgaaggc tggctggccc ggatgccgct     38640
     caagcgtacg gcgcggcctg aagaaatcgc cgctgtcatt gcctttctcg cctctgacga     38700
     tgcgagctat atgaccgggc agaccctcgt cgtcgacggc ggggcaacca cgggcgacta     38760
     ctgagcgcca cattacatcg cataggaaaa ggggaaccat catgaatcag tattctcgtc     38820
     gggacatgtt gcgtctgggc gtgtccgcct cggcagcgtt ggcaggcagc gtcttcctgc     38880
     cggtgcgcgc gcaggacaat ccgctctacg aggcggcgcg caaggaaggg gccctcaacc     38940
     tgtattgggg gtcctacgaa cagaagtcca tcgaggacat tcgtgacgct ttcgtcaaga     39000
     aataccccgg catccaggtc aatctgctgc gccagggttc gcaaacggtc tatacccggc     39060
     tgcgcctgga gctgcagaac aacgccgcca actgcgattc gctgggcacc accaatctgc     39120
     tgcactacac cgaactgaag aagatcaatg ccttgatggc gtaccgcccg acgggggccg     39180
     agcatttgcc ggaggccttt cgcggcctgg acccggacaa cactttccat gtcggcgcaa     39240
     tcagcattac gtcgatcaac ttctagtcgc agaaggtgcc caatccgccc gagagctggc     39300
     aggcgttgct ggatcccgcc tgggccggca agatcacggt cgggagcccg gcgtcgtcgg     39360
     gcgacgtcgc gcattgggcg ctggccatgc gcctgaagta cggcgatggc ttcttcaaga     39420
     aattcgccgc ccagaagccg aaggtcggcc agtccaacgt cgataccgtt accgatatcc     39480
     tggcaggcga gcgcgtggtg ggtgccgccg cgccgttcag ctattcgctg acgcagaagg     39540
     cggccggcca gccggtggac gtcaaggtgc ccaccgatga tgccatcctc aacctcgggc     39600
     tgaccgcgat tcccgccaag gccccgcacc ccaacgcggc caagctgttc acggatttcc     39660
     tgtattcgac cgaggtgtcg cagatcctgg cgcgcaacta ctggcccacg ctgcgcacgg     39720
     acgtgccctg ggccgaaggc cgcagcctcg agtccttgaa gtggttccgc aatccgaccg     39780
     atgacctgac caagcagatc aatgacacga ttgccctgtg gcgctcgacg gtcggttgag     39840
     tccgcagggg aagaaacagg ggattccatg tctgtcgcaa tgactgaaaa acccgccgta     39900
     gcgcgggagc cgcgtgccgg gcgtcatgcg ctgccagcca tcgccgtcac cgtgctggtg     39960
     gcggcagcgc tggcattgct ggtcctgtag cccgtcggca tcatcgcgct caacagctgg     40020
     cgcgacgacc tgaccgggca atggtcgctg gtgaattacc tgcgcatatt caccacgccc     40080
     aacctgatcg agcccatgct caattcgctg gtgctggccg gcagcacggc ggtgatcgcc     40140
     actgcccttg gcgtgcccat ggcgtggttg gtgtcgcgca cggatatgcc cgggcgcggc     40200
     ctggtccggg tactggtgct ggcggcgttc atcacgccgt cttttatcgg cgcgctgggg     40260
     tggatactgt tggcggcgcc caactcgggt tggctcaacg tctggctcag gcaatggctg     40320
     ggcggggatt cccccttgaa tatctactcg atgtgggggg cggtcttcgt gtgcgccgtc     40380
     tataccgtgc cgttcacgtt caccattgtc gccaccgcgc tcgatgagat ggccgtggag     40440
     ctggaggatg cctcggccat gctgggagga ggcatcctgc ggaccatgcg cagcgtcacc     40500
     ttgccgttgg tcatgcctgc catcgtggcc ggtttcatcc tgtcgttcat ccagggcatg     40560
     acgctcttcg gcgttcccgc gttcctgctg acgccggcgc gtgtcccggt ggtcacgacc     40620
     aagctggccg agttctatca gatgttcccg ccggagctca atctggcggc ggcctactgc     40680
     atgccgttgc tgctgatgac cggcggcctg ttcttcctgc gcaggcgcat tctcggccgc     40740
     cggcagtacg tcatgatagg cggcaaggcg cgcggatcgc ggctggtcgg gctgggccgc     40800
     tggcgctggc cggccctgct gggcgcgctg ctggtgcccg cggtgaccgt gttcctgccg     40860
     tatgcctcgc tgacgctggt gtcgctcagc aaggcctggg gtcaggggcc ctcgtgggac     40920
     aacctgacgc tgcattggta tcgctgggcc gtgctggaca acccgcaaac ccagtcggcc     40980
     atcgtcaatt ccctgctcta tgccacgatg gcggcgacgg tttgcctcct gctgggcgtg     41040
     gtggtggcct atatggtcga gcgcaagttg ttccgtggcg cttgggccct gggcgcgacg     41100
     gcgtccgtgc ccatcatcat cccgggcatc gtgctgtcgg tggggttctt ctcggccttc     41160
     acccagccgt tctatggcct ctatggaacg ggcgcgttgc tggtgctggc cttcgtggcg     41220
     acgttcctgc cgatcgccta ttcgcacggc ggcgccatca tcaagaccat cagccccgat     41280
     ctggagcggg cgtcgcgcat cctgggcgcg gggcaggtcg gcacgttcgg ccgcatcacg     41340
     ctgccgctca tgaagcccgg cctggtgtcg gggtggatgc tggtgttcat cccggtgatg     41400
     cgcgagctgt cggtggcggt attcctgatc accccgcaga ccaatgtcat gacgacgctt     41460
     atctacaact acaaggacgg cggcaactac gaagccgtct gcgctaccag caacgtgctg     41520
     ttgctgggca ccatcctgat tgtcatgctg ggccgcctgc tgacgggcct tgcccgtcgc     41580
     cgcggcgcgg cgcccgttac cgccggagtt acgtcgtgaa ggcaattcgc atccaaggtc     41640
     ttaccaagca ctatggcgca caccaggttc tgcgcggcat cgatctggag ctggcccaag     41700
     gcgagctgct ggccttgctc ggcccctcgg gctgcggcaa gtcgaccacc ctgcaaatgc     41760
     ttgcaggctt cgaccagccg accgacggcc agatatggat cggcgatcgc caggtttcgg     41820
     gcgcgggcgt catggtgccg cccgagcggc gcaatatctc gctggtgttc cagaactacg     41880
     ccgtatggcc gcacatgacg gtcttcgaga acgtcgccta tggcctgcag gtacgcaagg     41940
     tggcccgcac ggagctcgcg cagcgggtca agcgcgcgct cgacacggtc cgcctcacgg     42000
     cgctcgcgca acgctatccg tcggagctct ccggcggaca gcagcagcgg gttgcgctgg     42060
     cgcgggcgct ggtggtcgag cccgacatcc tcctgctgga cgaacccttg tccaatctcg     42120
     atgcgcatct gcgcgaggag atgcgctacg agatccgcca ggtgcacgat cttctgggcc     42180
     tgaccacggt ctatgtcacg cacgaccagg gcgaagcgct ggtcaccgcc gacaagatcg     42240
     ccgtcatgca gtccgggcag gtgcagcagt tcgacagccc cgtcaatgtg ttctcgcggc     42300
     cggccaacac gtttgtcgcc tcgttcatcg gcaccaacaa cgagctgcat ggccagcttg     42360
     ccgaaccggg ggccttgcgg gtcggggaca gggttctgca tggcgacgac cgcaggcagg     42420
     ccggtgccgg cggcgcggcc tgcctgtgca ttcggccttc ggccgtcaag ctgggcgccg     42480
     cgcccggcgc caatacgctg agcggcaccg tgacacgggt cgcgtacctg ggcgagtacc     42540
     gtgacgtcca ggtcgagctg gcggcggggc aattcgtgcg cgcctacgtc gacccgtcct     42600
     cgacgctgga gccgggccag cgtgtcgagg ttcatctgcc catcgagcat tgccagatcc     42660
     tgagcgtcac cacttcctag gagtcagtct tgagcagtca tacgtccatg gtccacagcg     42720
     aaatccggga gggcgcgctg tggatattgt ttgaccggcc ggcggcacga aacgccatga     42780
     cggccgagat ggaacacgcc atcctggccc tgtgcgagtc ggtcgcccat cgcccggaaa     42840
     tcaaggcggt cgtgttcagc ggcgcgcctg ccagcaagcc tgccttcatg gccggcgccg     42900
     acttcggcgc gctggaaacg gccacgacgg ccgaagagtt cgttgcgctg gagcgcagca     42960
     gcgaggcctt gctcgaggcc atcgaaggca tgcgagtgcc gaccatcgcc gccatggcgg     43020
     gcgcatgcgt cggaggcggg gccttgctgg cgctgtgctg cgatatccgt atcgccacgc     43080
     cgtcgctgaa gttcggcttc ccgattgccc gcacggtggg caactgcctg agcgtgaaga     43140
     actacgcccg cctggcggag aatctggggg cgcaacgagt acgggacatg gtgttttccg     43200
     cgtccttgct ttcggccgat gccttgctgc acgcgggcac catcagggag atcgttccgg     43260
     aggacgcgct gcatggccgg gcccaggcca tcgccgccca ggtcatggcg ctggccccgc     43320
     tgacactctg ggccaccagg acgtcgctgc tgcgcctgcg cgacaaggcc gtggatggca     43380
     ttgcggacga cgacatcctg tccgcctgct atatgtccgc cgatttccag gagggcgtgc     43440
     gtgccttcat ggaaaagcgc gcgccggcct ggatcggcgc gtaagcgcag gcatcgcggc     43500
     aaccccgcat gctgcgccgg ccgcaggtgc ctgtccccgc cgggacaggc acaccgctgt     43560
     acgctattgc gcgattaacc aaaaaaaagc tccctgtggg agcttgaaaa agccggattg     43620
     gcgcagcggt ccaacccggc gggggatggt tgtcaggcgt tgatgtcgtt gtccttggtt     43680
     tcgcgtacga acagcgtacc gatgaccagg gtcatgacag cgatgatgat cgggtaccac     43740
     aggccgtcgt agatgttgcc tgtcgccgcc accaccgcga aggccaccgg aggcaggaag     43800
     ccgccgaacc agccgttgcc gatgtgatag ggcaggctca tcgaggtgta gcggatccgg     43860
     gtggggaaca tctccaccag catggccgcg atcgggccgt acaccatggt gacgtagatc     43920
     accagcagcg tcagcagcac gaccaccatg aagtagttgg tttgggccgg atcggccttg     43980
     gccggatagc catggctgcg gatcgccgcg gtcagcgcct tgtccagctc ggtggccttg     44040
     gtcttgaact cggcaggcgc caggcccttg ccgtcgaacg atgcgaactc gtcgttgccg     44100
     atcatgacct tggcgaccga gccggccgcg gcggactggt tctcgtagtt caccgagttg     44160
     cgcgccatga acgacttgac cacgtcgcag gagctggtga acgaggccgt gcccaccggg     44220
     ttgaactgga acgagcaggt ggcggggtcg gcgatcacgg tgaccggcgc ggtggcctgg     44280
     gccttttcca gcgccgggtt ggcgtagtgc gtcaggccct tgaagatggg gaagtaggtc     44340
     agcgcggcga tcaggcagcc cgccatgatg atgggcttgc ggccgatcct gtcggacagc     44400
     gcgccgaaca gcacgaagaa cggcgtgccc accagcaagg caatcgcgat catgatgttg     44460
     gcggtgttgg aatcgatctt cagcgactgc gtcaggaaga agagcgcgta gaactggccg     44520
     gtgtaccaca ccacggcctg gccggcggtc aggcccagca gcgccaggat caccaccttc     44580
     aggttgcgcc attggccgaa cgattccgcg atgggggcct ttgagccctt gccttcttcc     44640
     ttcatgcgct tgaaggtcgg cgactcattg agctgcagac ggatccacac cgagatgccg     44700
     agcagcacca ccgagatcag gaacggaatg cgccagcccc agtccttgaa ggcttcttcg     44760
     cccatgaagg tgcgcacgcc caggatcacc agcagcgaca ggaacaggcc cagcgtcgcg     44820
     gtggtctgga tccagctggt gtagaagccg cggcggccat gcggggcgtg ctcggccacg     44880
     taggtggcgg cgccgccgta ttcaccgccg agcgccagcc cctgcagcag gcgcaggatg     44940
     atgaggatgg cgggcgcggc gatgccgatg ctggcgtagc tgggcaacac gccgaccagg     45000
     aaggtcgaca ggcccatgat gacgatggtg atcaggaagg tgtacttgcg gcccaccagg     45060
     tcgcccaggc ggccgaacac cagggcgccg aacgggcgca ccgcgaagcc cgccgcgaag     45120
     gccagcagcg cgaagatgaa ggccgcggtg ggattgaccc cggagaagaa gtgctgcgcg     45180
     atgatggctg cgagcgaacc gtagaggtag aagtcgtacc actcgaaaac cgtgccgagc     45240
     gacgacgcga agatcacgcg ccgctcctcg cgggtcatgg ggcgccgttg cgccgacggg     45300
     ctttggcccg atagggttgc tgtgctcatg ttgtctcctc gtgttaggcc agtggtgtgc     45360
     caccgtgctc tgcaccctcc gccggccgcg ccgacatcaa gctaccgaac aaggtagggc     45420
     tccaggctga cgaggttctg acgtaaccct tacctgaatc ttaaatttga aacaataagt     45480
     aactgttgcg cggaccagcc cggatcgacg cgccggctgg cggctacagc gtgccgggca     45540
     gggggaagcg cacctggatg cgggtgccgg gcaggtccga gtagggagtg gggtgttcgt     45600
     cgatcacgac ttccgcctgg tgcttctggg cgatctcccg cacgatggcc agccccaggc     45660
     cgctgccgtc ggacgccgtg cccaggacgc ggtagaagcg gtcgaagacc cgctcgcgtt     45720
     cttccggggc gatacccggc ccggagtcct cgacgtcgag gacggcgtga tcgccctgtg     45780
     cgctcacccg taccgtgatg tggccgccgc gcggggtata gcgcagggca ttgtcgatca     45840
     ggttgttcag cagctcggcc agcaggatgg cgttgccgct gatgccgacc ggtcggtcgg     45900
     cgccctcgaa gccgaggtcg gtcgacaggg cgagcgcctg cggcacccat tgcatcgtct     45960
     gttcgtaggc gatggcgttg aggtcggtca gcgcctggcc gggcgagtcc gggttttccg     46020
     cccgcgccag cagcagcaac tggttgacca gccgggtggc ccgttcggag ccggtgacca     46080
     gctggcgcag gctggactgc atttcctcgg ggctggcgtc gcgcagcgcc agctcggcct     46140
     gggtgcgcag gccggccagg ggcgtcttga gctggtgcgc ggcatcggcc acgaagcggc     46200
     gctgcgtttc gatgttggcc gacaggcggt cgagcaggtc gttcatggcg ccgaccagcg     46260
     gcgcgatctc ggagggggcg gcctgttcgt cgatgggcga gaggtcgtcg gggcggcgcg     46320
     cgcgcaggcg ctgctgcagc gcgttgagcg gcgccacgcc gcgcgacagg ccgaaccaca     46380
     ccagcagcac cgcgatcggc agcaccacga actgcgggat gatgactccc ttgatgatgt     46440
     cgttggccag ctgggcgcgc ttttccacgg tttcggccac catcaccagg gccggctggg     46500
     tatccggcag gccgaggtcg atccaggtgt aggccagccg cacgccgaag ccgcgcaagg     46560
     tgtcgtcggc gtacaggatc tcgcccggcc ggggctggcc gacgttgggc ggcagcggca     46620
     gggcgcgatc gccgcccagg tattcgccgc ggctgcccag ggccagccag aacacgcttt     46680
     ccgtctcgtc cacgcgcagc acgtcgcggg ccgcgtcggt catgcgcagc gcggcgcgtc     46740
     cgtccacggc gtgcacctgg tggctgagca cgttcaggtt gttggccagc gcgcggtcgt     46800
     acggcacgtt ggcgatgttc tgcgccacca cgtaggtgat ggccacgctc atgggccaca     46860
     ggagaaacag tggcgccagc atccagtcga ggatctcgcc cagcagcgag cgctgcggcg     46920
     gcgcgaaact cggcccgcgc ggcccgccgc gcagcgcatc cagggcttct tggttcagcg     46980
     gttcgcgcga agccgtttca gctggcgaga tacgaggcac cctggtcccg ctcgaggcaa     47040
     tagcccagac cgcgcacggt gatgattttc acgccgctgg gctcgagttt cttgcgcagg     47100
     cggtgcacat agacttcgat ggcgttggtg ctgactgcct cgccccattc gcaaaggtgg     47160
     tcgaccagtt gcgtcttgct gaccatgcgg ccgctgcgcg ccagcaggat ctccagcagg     47220
     ctgacctcgc gcgcggacag gtccagggtc tggtcgtcga ccgtggcgat gcggcccgtc     47280
     tggtcgaaca ccaggcggcc gtgccgcacg atcgtcgcgc cgccgccggc gccgcgccgc     47340
     gtcagggcgc gcacgcgggc ctcgagctcg gacagcgcga aaggcttggc catgtagtcg     47400
     tcggcgccga gatccaggcc cttgacgcgc tgttcgatgc tgtcggcggc ggtgaggatc     47460
     agcaccggca gcacggagtt gcgggcgcgc agcctgcgca gcacctccag cccgggcagg     47520
     tggggcaggc cgagatcgag gatcagcagg tcgaagggtt ggacggccag cgccgaatcg     47580
     gcggccagtc cgtcgcgcac ggcgtcgacc gcatagccgt tgtgccgcag cgagcgggac     47640
     aggccgtcgg tcaggatgct gtcgtcttca gctatcagga tacgcatgcg tgcaacatcg     47700
     gcggaaccgc cagcgggcgc tggctacgcc ggccattctg gcacagggga tggagcttgc     47760
     ccactcaggg tatacgtgga aatatatggc atactggatt tttatccagt acaatccaat     47820
     gccataatcg ccaaggttcg agttttctcc aggctctttt tctccggcta gacaacggct     47880
     gcctgcttcg cacccctgca ggcgccgctt caatacagga ctttacatgg acgacaaaac     47940
     cagcaaggcc gccgcggccg agaaagccaa ggcgctggcc gccgcgctgt cgcagatcga     48000
     aaagcagttc ggcaagggct cgatcatgcg ctatggcgac aacgaggtcg aacacgacat     48060
     ccaggtcgtg tccaccggtt cgctggggct ggacatcgcg ctgggcgtcg gcggcctgcc     48120
     gcgcggccgc gtgatcgagg tctacggccc cgagtcgtcc ggcaagacca cgctcacgct     48180
     gcaggtcatc gccgaaatgc agaaactggg cggcacctgc gccttcgtcg acgccgaaca     48240
     cgcgctggac gtgcaatacg cctccaagct gggcgtcaac ctgaccgacc tgctgatctc     48300
     ccagccggac acgggcgagc aggccctcga gatcaccgac gcgctggtgc gctcgggctc     48360
     ggtcgacctg atcgtcatcg actcggtcgc ggcgctggtg cccaaggccg aaatcgaagg     48420
     cgagatgggc gactccctgc cgggcctgca ggcccgcctg atgagccagg cgctgcgcaa     48480
     gctgacggcc accatcaagc gcaccaactg catggtcatc ttcatcaacc agatccgcat     48540
     gaagatcggc gtgatgttcg gcaaccccga aaccaccacc ggcggcaacg cgctcaagtt     48600
     ctattcctcg gtgcgcctgg acatccgccg catcggcgcc atcaagaagg gcgacgaggt     48660
     ggtcggcaac gaaacccgcg tcaaggtggt caagaacaag gtggcgccgc cgttcaagca     48720
     ggccgagttc gacatcatgt atggcagcgg catctcgcgc gaaggcgaaa tcatcgacct     48780
     gggcgtgcaa gccaatgtgg tcgacaagtc cggcgcctgg tacagctaca gcggcaaccg     48840
     catcggccag ggcaaggaca atgtgcgcga gtacctgaaa gagcacaagg aaatggccat     48900
     cgagatcgaa aacaaggtgc gcgagaacca gggcatagtc agccgcgccg ccacctttcc     48960
     ggccagcgaa gccgaagacg gcgaataagc cgtcaggcct gcatccacac ccactccggc     49020
     atggcgactt tcaaccgccg tccgccatcc gccgcccgag ccgggcggcg gaccgcaaat     49080
     cccgacgatg agttcgagac actggcccaa tcccgggacg acgcggcggc accgtcgcgc     49140
     ccgggccgga ctctgaaggc gcgcgcggtc ggctatctgt cgcggcgtga atactcgcgc     49200
     cttgaactgg cgcgcaagct gcagccttac gccgaagagg gcgatgacat cgaggcggtg     49260
     ctcgatgatc tgcagcgcga agggtggttg tcgaatgcgc gttttgccca aagcctggcg     49320
     catcggcgcg cgccacgcca gggcgcttcg cgcatcgtcc aggagttgaa gcaacagggc     49380
     gtggccgacg accaggtggc cgagttgcgc gaacaactgc gcgtcaccga atacgcacgc     49440
     gcgctggccg tctggcagaa gcgctttggc gaaaagcccg ccgaccgcgc cgcgtacgcg     49500
     cggcaggccc gcttcctggc gggccgtggc ttcgcccatg atgttatccg ccgcattctg     49560
     ggcggtggcg acgacgaact cgactgaacg atgccgcttc gtgcgggcgg cggcgcgcga     49620
     tgcgggcccg cctgcctggg gcttgcttgc ggcccgttcg atcaggccgg caggcccttg     49680
     gccgccttga tgccgctaag cgtcttgaag cagacgtcac gggcaatcgt caaaaactcg     49740
     tcgatatagg aactgtcgct gtcttccgtg cgcaccgcgg cgtagagcgt gggccagacg     49800
     ccttgcggcc cgaggtggca aacacgcagc cagccctggc ccagatactc ggtcaacgcc     49860
     cagttgggca gggcggcgac gccccgattg ctggcaacca gttgcgcaat gatgggcgtg     49920
     agttcggcgc gccggatcgc ggcgggttcg atatcggccg gatcgagaaa gcccgtgaaa     49980
     atatccaggc gctggcggtc caccggataa gtgatcagcg tctggtcggc cagttgttcc     50040
     ggcatcacgt ggcggttggc ggccagcgga ttggattcgg cgaccgccaa taccagctcg     50100
     tacttgaaca gcggcagata ggtgacggct tccagcgctt gcggatcgga cgtgatgacg     50160
     aggtccaggt cgccgcgcac cagcgcgggc aggggcgcga acgagaaggc ggccgacagg     50220
     tccagcgcca catccggcca ttgcccgcga aaggcgtcca gtgcgggcat caaccactga     50280
     aagcacgagt ggcattcgat cgccaggtgc agccgtccgg ttcgcccggc agccaggcgt     50340
     tgcagctcgc gttcggtggc gcgcagccgg ggcagcacgt cgtcggccag cgcgagcacg     50400
     cgcagtcccg ccgtggtcag gcgggccggc cgcgtgcggc ggttgagcag cggcgtgccc     50460
     aggcgggttt ccaggtcgcg cagctgatgc gagagcgcgg actgggtcag gtgcaggcgc     50520
     tcggcggctt cctgcaggct gccgccatcg cggatggcgg ccagggtttc gagatggcgg     50580
     atttcgagca tggcggcaat agaggtcgcg gcgagcgggc atgaatcgtc gcctttggtt     50640
     ttatatgaat aatactcaac ttatgaatgt agattttgat tttgattcat gtgttgatga     50700
     tcgcacaata gcggcctgac ttgaataact tttgcgaaag gccggtattg tcatgactat     50760
     tattcataat ctgggttttc cgcgcatcgg cgcccagcgc gaactcaagc gcgccgtcga     50820
     agcctattgg gcgggccgcc agaccgccga ggcgctgcat gagaccggcc gtgccttgcg     50880
     cgcggcccat tggcagcgcc aggccgacgc cggcgtggcg ttcgtgccgg tgggcgattt     50940
     tgcatggtat gaccacatcc tggagtggac cacgctgctt ggcgccgtgc cggcccgctt     51000
     tggccatccc gaaggcaagc cggtggacct ggacaccctg tttcgcatgg gccgtggccg     51060
     cgcgcccagc ggcaagccgg ccgctgcctg cgaaatgacc aagtggttcg ataccaacta     51120
     ccactacatc gtcccggaac tgacgcccgg acagaccttc cgcgtcgccc gcgaagacct     51180
     gttcgagcag gtcaaggagg cccaggccct ggggcaccgc gtcaagccgg tcatcccggg     51240
     gccgctgacg tggctgtggc tgggcaaggg cgatgccttt gcccaggggg ccggcgacat     51300
     cggcaagctg cagttgcttg acgccttgct gccggtctat ggcgaagtgc tcgagcgcct     51360
     ggcggggctg ggcgtcgaat gggtgcagat cgacgagccg gcgctggtgc tggacttgcc     51420
     gcaggcttgg cgggatgcct atcaggctgt ctacgccaag ctggcggcca gcccggtcaa     51480
     gctgttgctg gccacctatt tcgatggcct gaaggacaat ctggccaccg ccctggccct     51540
     gccggtggcc ggcttgcacg tggacctggt gcgcgcgccc gaccagctga gcgacgtggc     51600
     aagcgggctg cgccccggcc aggtgctgtc ggcaggcgtg atcaacggcc gcaacatctg     51660
     gcgcaccgac ctcgatgcgg cgctcgcgat gctggcgccg gtgcgcgagc aattgcagga     51720
     acgcctgtgg ctggcgccgt catgctcgct gctgcacgta ccggtggacc ttgccggaga     51780
     aaccgagctt gatgccgagt tgctcggctg gctgtcgttc gccgtccaga agctggacga     51840
     gctgtgcctg ctgggcaagg cgctgggcgg cgatgccgac ccggcggtgc agcaaggact     51900
     ggccgcccag cgtgccgccc tgcaggcgcg tcgccaatcg cctcgcatcc acaatccggc     51960
     cgtggcgcaa cgcatggccg ggcaggccgg ggtgtcgcgc gaacgcgcgc cgttcggcca     52020
     gcggatcgcg cgccagcaaa gcgagttgcg gctgccggcc tttcccacca ccacgatcgg     52080
     ttcctttccg cagaccgcag aaatccgtgc cctgcggcgc gactggaagt ccggcgcgct     52140
     gaccgattcg gcgtacgaga acgccattcg caaggaaatc gaggaagtca tccgcttcca     52200
     ggagaaggtg ggcctggacg tgctggtgca tggcgaaccc gagcgcaacg acatggtcga     52260
     gtacttcggc gagttgctgg ccggatttgc cttcaccaag aacggctggg tgcagagcta     52320
     cggctcgcgc tgcgtcaagc cgcccatcat tttcggcgac gtcgcccggc ccgcgcccat     52380
     gacggtgggc tggtccgcct acgcccaatc gctgaccgac aagccggtca agggcatgct     52440
     gaccgggccg gtgacgatcc tgcagtggtc gttcgtgcgc gacgaccagc cgcgcgaagc     52500
     cacttgccgc caattggcgc tggccctgcg cgacgaagtg gtggacctgg aggctgccgg     52560
     aatccgcgtg atccagatcg acgagccggc catccgcgaa gggctgccgc tgcgccgggc     52620
     cgactggcgc gcctatctgg actgggcggt cgactgcttc cgtctgtcga ccgccggcgt     52680
     gggcgaggcg acgcagatcc atacccatat gtgctactcc gagttcaacg acatcatcga     52740
     gtcgatcgcg gccatggacg ccgatgtgat cactatcgag acatcgcgtt ccaacatgga     52800
     gctgctcaag gcgttcgagg atttccacta tcccaatgac atcgggcctg gcgtgtatga     52860
     catccattcc cccaacgtgc cggaggtgga ctggatggtg gaactgatgc gcaaggctgc     52920
     cgcgcgcctg cccaaggagc gcctgtgggt caatccggac tgcggcctga agacgcgcgc     52980
     ctggcccgaa accgaagccg ccctgatcgg catggtgcag gcggcccgca cgctgcgcgc     53040
     cgcctgacgg cgggtaatcc gtatccgtcc ccttgcggcg gcgcgggggg aggctgtccc     53100
     ggccggggcg ggcccccggc gccgcgcctg aaatttgtgc ggcgcgtgct ccgggggagg     53160
     gtcggcccgg gccgcgtcgc cggcaatcgg ctgcgttata ctccccagga tttgctgcct     53220
     tgcgtcaaaa tcgcgcccag caggttcgac catgcccttg ccaccgccgg atacccctcg     53280
     ccagcccctg cacacgcgtt cgatacgcgt gcagtcttat gggcgcgagg atggcctgtg     53340
     ggatctcgaa gccgagctga tcgattacaa gggttacgat tttcccaagc gcgacggcca     53400
     gcttttcaag gtcggcgaat tcatccatca catgcacttg cgcattacga tcgacgaggc     53460
     gtataccatc attgcggcac aggccgtcta tgatgccgcc ccgtacgacg gcgtgtgcac     53520
     gaacatcgaa caagcctatc gcgacctggt cggcatgaac ctgctcaagg ggtttcgtcg     53580
     ccaggtcaag gagcgcttcg gtcatgtcgc gggctgtacg cacatgaccg agctttcgca     53640
     ggtgctgccg acagccgccg tccagtccat ggccggccgg cgccgtcaga acagcaaccc     53700
     agacaagcgc ccgttccagc ttggcggttg ccatgccttg cgcaccgacg gtccggtcgt     53760
     gcaggagcac taccccaaat ggtatacggg cgccaacgcc gggtcgtcgg ccgatacgtc     53820
     ttccgattca ccctctctct catacgtcct gacaggtatc acatgaaaat ccacgagtat     53880
     caaggcaagg aactgctgaa gcagtttggc gtgaccgtgc cgcgcgggat ccccgctttt     53940
     tccgtagacg aggccgtggc tgccgctgaa aagctgggtg ggccggtctg ggtcgtcaag     54000
     gcgcagatcc acgcgggtgg ccgtggcaag ggcggtggcg tcaaactggg gcgttcgatc     54060
     gacgaagtgc gccagctgtc gtcggagatc ctcggcatgc agctggtcac gcaccagacc     54120
     ggcccgcaag gccagaaagt gcgccgcctg ctgatcgaag agggcgcgga catcaagaag     54180
     gaatactacg ttggcatcgt gaccgaccgt ggcacgcagc gcgtgtgtgt catggcttcc     54240
     agcgaaggcg gcatggacat cgaggaagtg gccgcgcaca gcccggagaa gatcctgaag     54300
     gtcttcgttg atccggccgc cggcctgacc gacgccgagg ccgccgaact ggcgcgcggc     54360
     atcggcgtgc ccgaagcctc cgtgggcaag gctgccgccg aattccagaa gctgtacaag     54420
     gcgtactggg acaccgacgc ctcgctggct gaaatcaacc ccctgatcct gaccggcagc     54480
     ggcgacatca tcgcgctgga cgccaagttc aacttcgatt cgaacgcgct gttccgccac     54540
     cccgagatcg tggcctaccg tgatctggac gaggaagacc cggccgaaat cgaagccagc     54600
     aagttcgacc tggcctatat ccagctcgac ggcaacatcg gttgcctggt caacggcgcc     54660
     ggcctggcca tggccaccat ggataccatc aagctgttcg gcggagagcc ggccaacttc     54720
     ctggacgtcg gcggtggcgc cacggccgag aaggtcaccg aagcattcaa gatcatgctc     54780
     aagaacaaga gcgtgaaggc gattctggtc aacatcttcg gcggcatcat gcgctgcgac     54840
     gtgatcgccg aaggcgtgat cacggcgtgc aaggcggtca acctgaatgt gccgctggtc     54900
     gtgcgcatga agggcaccaa cgaagagctc ggcaagaaaa tgctggccga atcgggcctg     54960
     ccgatcatca gcgccgacac gatggccgaa gcggccacca aagtcgttgc cgccgtcaaa     55020
     taaaattgcc aaggattcac aaatgtcgat tctgatcaac aaggacacca aagtcatcac     55080
     ccagggcatc acgggcaaga cgggtcagtt ccatacccgc atgtgccgcg agtacgccaa     55140
     cggcaaggcc gccttcgtgg ccggcgtgaa ccccaagaag gccggtgagg atttcgaagg     55200
     cgtgcccatc tacgccaacg tcaaggacgc caaggcggat accggcgcta ccgtgtcggt     55260
     gatctacgtg ccgccggcgg gcgccgcggc cgcgatctgg gaggccgtcg aggccgaact     55320
     ggacctggtg atctgcatta ccgaaggcat tcccgtgcgc gacatgctgg aagtgaagaa     55380
     ccgcatgcag gccatgaaca gcaagacgct gctgctgggc ccgaactgcc ccggcctgat     55440
     cacgcccgac gaaatcaaga tcgggatcat gcccggccac atccaccgca agggccgcat     55500
     cggcatcgtc agccgctccg gtacgctgac ctacgaagcc gtggcgcaag tcaccgagct     55560
     cggcctgggc cagtccagcg ccgtgggcat cggcggcgat cccatcaacg gcctgaagca     55620
     cgtcgacgtg ctcaagctgt tcaatgacga tcccgacacc gacgccgtca tcatgatcgg     55680
     cgagatcggc ggtccggacg aagtcaatgc cgcgcagtgg gccaaggaca acatgaagaa     55740
     gcccgtggtc ggcttcatcg ccggtgtcac cgcgccggcc ggcaagcgca tgggccatgc     55800
     tggcgccctg atctcgggcg gcgccgacac ggccgatgcc aagctggaag tgatggaagc     55860
     gtgcggtatc cgtaccacgc gcaacccgtc ggaaatgggc aagctgctca agtccgtgct     55920
     gtaatcacgc gccggacagc ccgcctgtcc caggacggcc cgcgatcgcg ggccgttttt     55980
     tttcgcatgc cgcggccggc tgaaagcgga ctgaaagaat attgaaagtg aattgaaaag     56040
     agaggaattc gcgcgaacct ataatcaaaa gcgaggggct tttcgatttg cctgtccacc     56100
     cacgcaccaa gaatgccgcc agggctcgcc tggtcgaagg cggccacgcg tgtcttgtgt     56160
     ttgttcaatc ctaggggatc atcactagga aagagaggaa tggaacttag ttctgcggcg     56220
     ttctggatcg ccttgctcca gattatttgg gtaaacatac tgctatcggg agacaacgcc     56280
     gtggtgatcg cgctggccgc gcgctcgcta cccccggatc agcagaagaa ggccatcgtg     56340
     gtcgggtcgg ccgcggcaat cgtgatgcgt atcgtgctga cgctggtggc cgccaagttg     56400
     ctgctgttgc cctggctgaa gctgatcggg gccgcgctgc tggtctatat cggcgtgtcg     56460
     ctgctgctgc ccgagggcga ggacgatggc gcggaaaagg gccatggctc gctgcttgtc     56520
     gcgatccgga ccatcatgat cgccgacctg gtcatgagcc tggacaacgt ggtggctgtc     56580
     gccgccgcgg ccatgggcga caccacgctg ctggtgctgg gcctggccat cagcatcccg     56640
     ctggtcatat tcggtagcgc actgttgctc aaggtgatcg agcgttttcc catcatcgtc     56700
     tgggtggggg cggcgctgct gggtttcatc gccggcgaac tgctggtggg cgatcctgca     56760
     ctggaagaat cggtggcgcg gatcgacacc atgctgggtg tcacgcaaca cgatttcgcg     56820
     ctgatggtag gcgcaattgg tgcaatcctg gtgctggcgc tgggcaaaat tttccaggcc     56880
     aggcaacggg cctgacgcaa agctgaacta caatagcggg ctgttcgggc cccgccttca     56940
     ggcggggctg accagcccgt tttcttttgg ccgcgttttg ccacggcgag gctgacggcg     57000
     gtcttcccgg tatttctccg gtttttacaa ataacgcctg ttgggggttc caagtgcttg     57060
     agtttttcca gacgctgagt tgggcggcag tcttccagat catcctcatc gacatcctgc     57120
     tgggtggcga caacgcggtc gtgatcgcgc tggcgtgtcg aaatctcgcg cccaagcagc     57180
     gcatgcaagg catcctgtgg gggacggccg gcgccatcat cctgcgcgtg gtgctgattg     57240
     ccttcgccct cacgctgctg aacatcccgt tcctgaaggt cgtgggcggc ctgttgctgg     57300
     tctggatcgg cgtcaagctg ctggtgcccg aggacgaagg gcatgacagc atcaagggcg     57360
     gcacgtccat cgtcgccgcg gtcaagacca tcatcatcgc cgacttcgtg atgagcctgg     57420
     acaacgtcat cgccattgcc ggcgcggcgc agaacgccca tgccgaccac cagatcggcc     57480
     tggtggtctt cggcctggtg gtcagcgtgc ccatcatcat ctggggcagc acgctggtgc     57540
     tcaagctgat cgaccgcttc ccgatggtcg tcaccttcgg cgcggcgctg ctgggctgga     57600
     tcgccggcgg catgctgatt accgacgtgt ttgtcgtgcg tcaattcggc gaacagccca     57660
     gcgcggttaa aatcggcgtt gaaattgccg gtgcgctgct cgtcgttctc ctcgggcggt     57720
     ggctggcaag ccgtaaaacc gcttccaagg aatccgtcaa tgagtctgcg taagacttcc     57780
     aacccccagc aaaacgaatc gggcctgagc ctgctgcaag gcctgttcgt gctggccatc     57840
     ctgggggtgg tggcttcggt catcgtctcc agctttctct gacgccctga cgtggccgct     57900
     gtagaacgcc tgaccatcgc cacgcgcgcc agccggcttg ccttgtggca agccgagcat     57960
     gtgcgcgatc tgctgcgcgc gcgctacccg gcgtgcagcg tcgagttgct gacgctgacc     58020
     acgcgcggcg accagatcct ggaccgcacc ctgtccaagg tgggcggcaa gggcttgttc     58080
     gtcaaggaac tcgaaaccgc cttgctcgat ggccgcgccg atctcgcggt gcattcgctc     58140
     aaggacgtgc cggtggacct gcacgcgccg ttcgagctga gctgcgtgct cgagcgcgcc     58200
     gatccgcgcg atgcgttcgt ctccaacgat tacggcagcc tggccgacct gccgcccggg     58260
     gcggcggtcg gcacgtccag cctgcggcgc gagtcgcaga tccgcgcccg ctatccgcac     58320
     ctggtcgtca agccgctgcg gggcaatctc gatacgcgcc tgggcaagct ggacaacggc     58380
     gattacgccg ccatcgtgct ggccgcggcg ggcctggagc gcctgggcct ggccgcccgc     58440
     atccgtgcgc tgctggaacc ggccgacagc ctgcccgcgg ccgggcaggg cgcgctgggc     58500
     atcgagatcc tgcagggccg cgccgatgtg cgcgccatgc tggcgccgct gggcgacgcc     58560
     gccaccctgg cctgcgtgac cgccgagcgc gcggtctcgc gcatgctggg cggatcgtgc     58620
     caggtgccgc tggcggccta tgcccgtatc gatggcgatg agctcgcctt gcgcgcgctg     58680
     gtcgccgcgc ccgacggccg ccgcatcgtg cgggccgagc gccgcggtcc gcgcgaccag     58740
     gcccaggcca tcggcgagtc ggccgcgcgc gacttgctgg ccgacggcgc cgacgcaata     58800
     ctggccgaat tgctgccaac ctcgcccgcg ccttgacagg gcggtcgggc cctcgcgggg     58860
     gcttgcctat gtcgcagatt gccatcctga cacggccgca aggccgcaat ggcgcgcttg     58920
     cgcaacgcct gcacgaggcc ggctggcaga ccctttgcct gccggccttg cgcatcgagc     58980
     cgttgccgcc cgaaaatggc gcggtgccgc tgccgcgcga ctacgacctg gtggtgtttg     59040
     tcagcggcaa cgcggcgcgc ctgtacctgg agcagctggg ggagcggggg caattgccat     59100
     ggccggcagg cgcggtcgcc gccaccgtgg gcccggccag cgcccgcgcc ctgctggatt     59160
     cgggccagtt tggcgccgat acaacagttt tgcaccctgc ggaaaccgcg ctcacccacg     59220
     attcggaagc cttgtgggcc ttgttgcggg cgcgcccggc attgccgcgc cgcgcgctgc     59280
     tggtgcgcgg cacccaaggg cgcgactggc tggccgatcg cctggccgcg gctggcgtgg     59340
     aggtcagccg ccacgcggtc taccgccggc ggcccgcgcc ctgggcgcag gaggggcgcc     59400
     agcgcctgcg cgactgggcc cgggcgggcg agcgcccgac ctggctgctc accagcggcg     59460
     agggcatcga cgcgctggtt cagggcctgc gcgaggagca attgctggac tggtggctgc     59520
     aaggccgttt cgtcgtcacg caccccgtgc tggccgagcg gctgcgggcg ctggccggtg     59580
     gcggggccga tgcgccaatg gtaaaaaact gcatgcctgc cgatgaggcg atcttcgcga     59640
     cttttgttgc ggcttgaatc gtcgttacat gccatcaccg aatacaatcg cgtcatgaca     59700
     gacaacacct ccgctacttc gcccggcacc gtaccgggta cgccgggcac ggccgccgcc     59760
     gacgaggccg tcgcgagcca gtcgcgcaag ggcaagggcg taaacagtac gctcgttacc     59820
     gcgcttatca tcgtcatcct gctggccgtc ggcctggggt gggccgcgtg gctgcagcgc     59880
     aagcaattcg tcagcgccgg ccaggaagtg gccgcccgtc tcaatacgct gggcgccgag     59940
     ctgacgcagt cgcgcaacga catgcgcgag gcgctggcgc tggcgcaggc gcagtccggc     60000
     aaggtggccg agctcgaagg caaggtgcgc gaagcgcaaa gccagtacag cgcgctgcag     60060
     caggcgctgc agaacctcaa cgacggcgcc agcgacgaaa tgctggccaa cgacatcgag     60120
     cgcctgatca ccatcgccag ccagcaactg cgcctggccg gcaatgtcag caatgccatc     60180
     gtggccctgg aaacggccca ggctcgcctg gcgcgcgccg accggccgcg ctttgccagc     60240
     ctgcagcaaa gcatcaacgg cgacctggac cgcctgcgcg cggtcggcgt ggtcgacatc     60300
     gcggctcaat cggcccgcat cgatcgcctg gtggccctgg tgggccgggc gccgctgctg     60360
     gtgcccgacg cggccgcgcc tggcgtgacc gccgtgcccc aggcgaacga ggccgtgccg     60420
     gccagcgtcg atccgggcgc cgacctgccg gccgacgccg cctggtggca gcgctggcag     60480
     gccgagatcg cctcctggcc aggccgcgcc ggcagtgcgc tggcccatga gctgggcgac     60540
     ctgatccgcg tgcagcgtgt cgatcagccc acggcgctgc tgctttcgcc cgagcaggcc     60600
     ggccagctgc gttccacgct gcgccagcgc ctgctcacgg cgcagttgtc gatgctgatg     60660
     cgccagcccg ccgtctggaa gagcgaactg gacgcggtgg ccgcgaccct ggcccagtat     60720
     ttcgacggca aggcgcctga taccgtcgcc gcgctggcgc tggcccgcga actgggacag     60780
     gtcgagatcg ccgtgcgcgt ccccgatgtg gccgacagcc tcaacggcat tgcggccctg     60840
     cgcgcggccg gcttcaacgc cgacgggcaa caggactgac gcatgcgtac ctggttctgg     60900
     actctattgt tggccgttgt cgcggtggcg ctggccgtcg tgctgcgcgc ccacgcgggc     60960
     aacgtcttgc tgctggtctg gccgtggcgc atcgagttgt cgctgacgct gacggtattg     61020
     ctgttggtgg ccgccttcgt cacgctgtac atcggcctgc gcctgctggc ctggctggtg     61080
     gccattcccg atcgcttgcg cgcctggcgc ggccgccgtg cccaggaacg cgaccacgag     61140
     ctgctcgaac gcggctggat cggcctgctg gaagggcgtt tcgcgcaggc cgagaaagac     61200
     ctgtcgaagc tgttcgacca gaccaaggtg cgcagccgcc gcgtcctggc ggcgctgtcg     61260
     ggcgcgcgcg cggcgcataa cctgggcgag tacgagcgcc gggaccgcat gctggaatcc     61320
     gctcgcgaac aggcaggcga ggatgccggg ttgcaggaag ccaccgccac ggtatcggcc     61380
     gacatgctgc tggaccaggg gcgcgcccag caggcgctgg acctgctgga gccgctgcag     61440
     gacggcggcg cgcgccatct gcacaccatg cgcctgctgc tgcgcgccga gacggccttg     61500
     cagcatcacg agcgcgtctt catgctggcg cgcggcctgt tgcgccgcaa tgccatcggc     61560
     aaggccgagg ccgagcagct gatcgacagc gcgggcgccg cgcgcctgcg cgcaggcatg     61620
     gccgtggacc aatggcgccc catctggaaa gacctcaaga gcgatgagcg gctgttgccg     61680
     aacatcgcgc tggccggcgc cgccgccttc gaggacgcgg gcgaggccag cgaggccgcg     61740
     cgcattctcg aggccgcggt agcggtcaag ttcaaccccg cgctggtggc cgcctatgcg     61800
     cgctgcgatg ccgcccaggt gccgcaccgc cttgccaagg ccgagacctg gctgcagcag     61860
     cgtccggccg ataccgacct gctgacggcg ctgggcctgc tgtgcctgaa cggacagctg     61920
     tgggggcagg cagagcgcta tctgcaacgc agcgtcagcc ggcgcaacga tccgcaggcg     61980
     catgccttgc tgggcagcct gtacgacagg ctggaccggc ccgccgacgc ggcgcgccac     62040
     tggcgccagg ccaccgcggc gcgcgtggcg ctgccggtgc tggcggcgga catcgcgttg     62100
     ccggcggccg acaccaaggc cgaccccgcg tggctggacg ccgagcgcga gtacgtgccc     62160
     aatatgtcgg aatacaccgc gcccgtcatc gccgacgcgc cgcccgaggt cgagccgggc     62220
     gctgtcgact atgtgctcga tccggatgcg cgcgcagcgg gcgaacacga gcccgcgtcc     62280
     gccgtcgcgc ccgaacccgt cagcgtgccg ccgcgcaccg ccatcgatat cgaagactac     62340
     ttcgacagcg cgcccattcc ggcggccgcc atcgaagcgc cggtctcgag ctatcgcgcc     62400
     ggcggggacg acgagcaacc ggccaagccc ggcggcgccg tatcatccgc cggcccggcg     62460
     tccggcgaca aagcctgatt tcattttcat caagacaagg tcaatcatga gtctagatcg     62520
     tgtcgctcct ggcaagaagc tgccggacga tttcaacgtc atcatcgaaa tccccatgaa     62580
     cgccgacccg gtgaagtacg aggtcgacaa ggagtccggc gcgattttcg tcgaccgctt     62640
     catgctgacg gccatgcact atccgtgcaa ctacggctac atcccgcaga cgctgtcgga     62700
     agatggcgat cccgccgacg tgctggttct cacgccgttc ccgatccaga ttggcgccgt     62760
     ggtgcgctgc cgcgccattg gcgtgctgga gatggacgac gagtccggcg gcgatgccaa     62820
     gctgctggcg gtgcccatcg agaagctgta ccccccgtac cgcaacatca agtcgtacga     62880
     ggacctgccg gccgaagacg tcagccgcat ccagcatttc ttcgagcact acaaggatct     62940
     ggaaaagggc aagtgggtca aggtcaaggg ttggaagggc gtggacgccg cgcacgagga     63000
     aatcgtgcgc agcgccgagc gctacgccaa gggccaggcc tgagatagat tggccgcctg     63060
     gggcggccgg cggcgcggaa gcgacggcag gcagccgctc gcatccgcgc cgttttgcgt     63120
     catgcgccgg gcgcgccgcg cgcggcctgg cccgaagcgt ataaactcgc gcattgaata     63180
     ttctcgccgg cgttgtccgg ccttgtgtgc tacgaggtca aatcacatgg attacgtatt     63240
     tcccccttcg ccgccggcgg ccgtgccggt ggcaggcggc aacgcccgct ttccggtgcg     63300
     ccgcgtctat tgcgtgggcc gcaactacgc cgagcatgcc aaggaaatgg gcttcaccgg     63360
     ccgcgaagat ccgttcttct tctgcaagcc tgtcgacgcc atcctgtcgg tggccgatgg     63420
     cgccacgggc gaaatgccgt acccgcccaa aacggccaac ctgcactacg aaatggagct     63480
     ggtcgtcgtg ctgggcaagg gcgggcgcga cctgaccgtc gagcaggccg acgaatgcgt     63540
     atggggctac gccctgggcc tggacatgac gcgccgcgac ctgcagggcg aggccaagaa     63600
     gcagggccgt ccctgggaag tgggcaaggc tttcgatctc tcggcgccgc tcggccccat     63660
     ccatccgcgc agtgccgtcg gcacgctgga caaaggcgcc atctggctgg acgtcaatgg     63720
     cgagcgcaag caatccagcg acatttcgca gatgatctgg aacatcccgg aaagcatcgc     63780
     ctatctgtcg ggcctgttcg agctgcaacc gggcgacatc attttcaccg gcacgccgga     63840
     aggcgtgggc gcggtggtca agggagacgt catcgtcggt ggcgtcgagg gcctgggcga     63900
     gctgcgcgta cgcatcgcct gaacagagcg taacggcgga gatctcatat gcgcagcaag     63960
     atagtgctga cggctttcgt ggtgtttgga ttcgtcctgc agggctgcaa caccgttgca     64020
     ggaatgggca aggatatgtc cgatgcgggc agtgccatta cccacgctgc cgagaagtag     64080
     ccggcccgcg ccggcatgat gcaagccccc ggttgctccg ggggtttttt ttggttcatc     64140
     gcgcaatagc gtggaggggt ttggcaagtt ttcgtattct tgacggcagg tatttgccat     64200
     caggagtgca gggagatgct ggatcgcaag ttgctggagt cgctgggagg ctggcagggc     64260
     tatggcgtcg aacgcgtgga atggcccgaa gacccagggc gcacgctgtc gatctatttg     64320
     aagccaacgg ccaaggtgat gctgtgcgag cagtgcggcg cgcggtgtcg ccaggtgcat     64380
     gagaccacgg ttcgacgggt gcgagatctg ccgttattcg agtatcgggt cgttctgcac     64440
     gtgccgcgcc gacgcttgtg gtgtgagcaa tgcggcggcc cgcgcctgga gcggcttgcc     64500
     tggctggggc gatatcaacg ggtgacggat cggctggcgc aggcctgcag ccaattgctg     64560
     caatcgagca acgtgcaggc ggtggcgagg ttcttcgaac tgggttggca taccgtcaag     64620
     acgctggaca aggctcggct gcgtgcgtcg gtgcgcgaac cggattggtc caagatcgag     64680
     tatttggcga tggacgagtt tgccctgcac aaagggcatc gctacgcgac agtggtggtc     64740
     gatccgatcg gcaggcaggt gctgtggatt ggcccaggac gctcacgcga gacggcccgg     64800
     gcgttcttcg aacaattgcc gcctggggcc gcccaacgca tcaaggccgt tgccatcgac     64860
     atgaccaccg cctacgagtt ggagatccag gcccacagcc cacaggcgga gatcgtctat     64920
     gacttgttcc atgtcgtggc caagtatgga cgagaggtca ttgatcgggt gcgcgtggat     64980
     caggccaatc aactacgcca ggatcgtccc gcacgcagga tcatcaaatc gagtcgctgg     65040
     ctgctgctgc gcaaccgtga caacctggat cggcagcagg ccgtccggct cgacgaattg     65100
     ctgcaagcca accagccgct gctgacggtc tatgtcctgc gtgacgaact caaacggctc     65160
     tggttctacc aaagacctgc ctgggcaaga caagcctgga accactggta cgagcaggcc     65220
     gagcaaagcg gaatagccgc cttgaacacc ttcgctcagc gcttgaaagg ctatctgcac     65280
     ggcatcctgg ccagatgccg acatcccctg aacaccagca ttgtcgaggg catcaacaac     65340
     actatcaagg tcatcaagcg gcgcgcttac ggctaccgcg accaggaata cttcttcctc     65400
     aaaatccgtg ccgccttccc cggcaatgcg cgatgaacct atttttttcc gggtccgcgc     65460
     cggcgcccac gccataggcg ttgaggcggt tgtagagcgt cttgaggctg atcgcgaggg     65520
     tgcgggcggc gcgccgcttg tcgccgcctg cgcgcgccag cgtggcgagg atgagctcgc     65580
     gctggacgca ttcgagggga gttcccaccg gaaaggccaa cgtatcggca tcctgccggg     65640
     ccgggcggcg caacaccgta tcggccagcg cctgcggacc gatcgggccg tcttgcagga     65700
     tataggcgcg ctgcaccgcg ttgcgcagct cgcgtgcgtt gccgggccag tcgtgggcgg     65760
     ccagcgcgtc gagcatggcg ccggaaaagc gcttggcggt gccgtggcgc gcattgagtt     65820
     cgtcgagaaa ccgctgggcc aggaagcgga cgttttccgg ccgttcgcgc agcggcggca     65880
     cccgcagggg cagcaccagc aggcgatgca gcaggtcttc gcgcagccgg ccctcggcca     65940
     ccgcggcgtg cgggtcgcgg ttggtggcgc cgatgatgcg cacgttggca tgcagcaatt     66000
     ccaccccgcc gacccggcgg tacgcgccgg tttccagcac ccgcaggaaa tgcacttgca     66060
     tgtcgggcgg catctcggtg atctcgtcca ggaacagcgt gccgccgctg gcgttctcga     66120
     aatagccggc gttgtgcgac aaggcgccgg tgaagctgcc cttctcgtgg ccgaacagct     66180
     gggcatgcgc cagcgtcggg ctgattgccc cgcaattgat ggccatgaac ggcgcgtcgc     66240
     ggcgcccgcc caggtcgtgg atggcgcggg ccagcacatc cttgccggtg ccgctttcac     66300
     ccaccagcag tacggtggcg tcgctgtcgg cggcgcgctc gatgctggcg gccagcttgc     66360
     gcatgcatgc gctggggccc agcgccgcaa ggcgttcgag cgggtcggaa gtcgttgcag     66420
     gcgtagttgc ggtttggttg ggcacgatac agcctcgcgg caagaaacca ggcgacgggt     66480
     ccattgtcat gcgccgaccg tgcaaggggt gagaccagat gcaaaggttg gaaaaaaatg     66540
     ttgcgccgta gggtgttgtt actgccatat cgaccccgcc acgctacgct atcaaggcag     66600
     cacgggtact tcactcatgc acactgactg cacggcaggg cggctggcgc cgccatgcgc     66660
     aattcttgca ttgcggggga acgatgcctc acttgctgat cgttgacgat gacgatgcgg     66720
     tacgcgacaa cctggtggaa atcggccgcg agcacggcta caccgtggcg caggccggca     66780
     cggtgcgcga tgcgctgatc caggtggaac ggcaactgcc ggacctggtg ctgaccgatg     66840
     tgcgcctgcc cggcgccacc ggcatggacc tgttctcccg catttcgcat gccggggtcg     66900
     aggtggtggt gatcaccggc tacggcagca tggaaaacgc catcgaagcg ctgcgcgccg     66960
     gcgccaccga ttacctggtc aagcccatct gcatggaacg cctcgaacag attcttgcgc     67020
     gcgtggcgtc ggcggggcag gacggcgact gggatccctc ccagccgttc cagcaggaag     67080
     accgcttcgg acgcctggta ggggcgtcgg cgcccatgca ggcgctgtat cgccagatct     67140
     cgcgcgtggc gcctaccgag gtcacgacgc tgctgatcgg cgagagcggc accggcaagg     67200
     aactggccgc gcatgcggtg cacgagctca gcgcgcggcg cgccggcccc ttcgtggcgg     67260
     tcaactgcgg cgcgatctcg cccaacctga tcgagagtga actgttcggg cacgaacgcg     67320
     gcagctttac cggcgccgag cgccagcaca agggctattt cgaacgcgcc gacaacggca     67380
     cgctgttcct ggacgaagtg accgaaatgc cgctggactt gcaggtcaag ctgctgcgcg     67440
     tgctggagac cggcgccttc atgcgggtgg gcaccaaccg cgagatttcc tgcagcgtgc     67500
     gcgtggtggc cgccaccaac cgcagccccg agcaggcggt gcgcgacggc aggctgcgcg     67560
     aggacctcta ttaccgcctg agcgtgtttc ccatcgagct gccgccgctg cgcgagcgcg     67620
     gcgacgacct cgccatgctg gccgggcgtt tcctcgacgg actgaatcgc gagtacggca     67680
     aggacaagcg cttcgcgccg caggcgctgc agaccatggc ggagtacgcc tggcccggca     67740
     atgtgcggga actgaagaac ttcgtgcggc gcgcgttcat cctggccgaa tccgacacgc     67800
     tggacgccag cgcgctcacg ccgcagatct cgcccagcga cgcggctggc ggcgggcagg     67860
     tgatcgtgcc ggtgggctcg acgctggccg aggcggaccg gcgtctgatc ctggccacct     67920
     tgcagcgttg cggcggcgtc aagaaacaga ccgccgcgat gctgggcatc agcgccaaga     67980
     cgctctacaa ccggctggaa gagtatggcg aggcaggtcc gccggacgcg gcgcccggcg     68040
     cagagggggc cgcctcgcgc gcgcagcact gaaacccgga cgggcatggc gcatgctgac     68100
     ccgccagcca ggcgccccag gggcgccggc acttttcggg ggcaggcatg gaaaccgtat     68160
     cggacttcgt actggaacgt ctcgcgcaat ggggcatccg gcgcatcttt ggctatcctg     68220
     gcgacggcat caacggcctg atgggcgcat tcgggcgcac gcgccagccg ctggagttcg     68280
     tgcaggcccg ccacgaggag atggccgcct tcatggcctg cgcgcatgcg aagttcaccg     68340
     gccaggtcgg cgtctgcatg gcgacctccg ggccgggcgc gatccatctg ctcaacggcc     68400
     tgtatgacgc caagctggac caccagcccg tgctggcgct ggtgggccag caggcgcgcc     68460
     gcgcgctggg cggcgacttc cagcaggaag tcgacctggt atcgctgttc aaggatgtcg     68520
     cgcacgactt cgtacagcag gccgccagcg ccgagcaggc gcggcacctg atcgaccgcg     68580
     cgctgcgcat cgcgctggaa cggcgctgcg tgacctgcgt catcctgccc aatgacgtgc     68640
     aggatctgcc ggcagtgcgt gaactgccgc gcgaacatgg cagcgtgccg accggcatcg     68700
     gcgtcacctc gcatgcggcg gtgccgccgg atacggcgct gcgcaatgcc gccgacattc     68760
     tcaaccgcgg cgagcggatc gccatcctgg cgggcgcggg cgcgctggaa gcggccgagc     68820
     ccctgcaggc ggtcgccgag cggctgggcg ccggggtcgc caaggccttg ctgggcaagg     68880
     ccgccttgcc cgacgccttg ccctacgtaa ccggcgccat cggcctgctg ggcacgcagc     68940
     ccagctggga gatgatgaac gagtgcgaca ccttgctgat ggtcggcacg gcctttccgt     69000
     acagcgaatt cctgccgagc gaaggccagg cgcgcgcggt gcagatcgac cgcgacggcc     69060
     gcaacctgaa cctgcgctat ccggtggaag taggcctggc tggcgacagc cgccagaccc     69120
     tgcaggcatt gttgccgctg ctcgagccca agccgcaggt gcgctggcgc gaacgcatcg     69180
     aagcgtcggt ggcgcgctgg tggcgtaccg tcgaggcgcg cgccatggtg gacgcctcgc     69240
     cggtcaaccc gcaacgcgtg ttctgggaac tctcgcagcg cctgccggac cgcagcatcg     69300
     tgacggccga ctcggggtcg gcggccaatt ggtatgcgcg cgacgtgaag ctgcgcgagg     69360
     gcatgatggc gtcgctgtcg ggcgggctgg ccacgatggg ctgcgccgtg ccttacgcgc     69420
     tggcggccaa gctggcctat cccgagcgac cggtggtggc gctggcgggc gacggcgcga     69480
     tgcagatgaa cggcatcaac gagctgatca ccatcgccga ccgctggcgc gcctgggccg     69540
     accccacgct ggtggtcctg gtgctgaaca acggcgatct caacctcgtc acctgggagc     69600
     agcgcgtgat gggcggcgat ccgcgcttcg aggattcgca acgcctgccg ccgttcgcct     69660
     atgccgatta cacccgcatg ctgggcctgc atggcttgcg cgtggagcgc gcgcaggatc     69720
     tcggcgcggc ctggggcgag gcgctgaccg ccggacgccc ggcggtgctg gaagtcctca     69780
     ccgaccccga gatgccgccg ctgccgccgc acatccgggc gcgccaggtg cgcgcctacg     69840
     tacaggcgct gcgggcggac ccggccggtg gcgcggcgct gcgcgccacc ctcaaacaat     69900
     ggtgggccgg ctgaggccgg ccgacatgcc gctttctttc cgccatcagc aggagccgca     69960
     tcatgaaagc atcgaacgat actccatcgt ccaaaccgtc cgcgccacgc cgcgacgagg     70020
     cgcccgcggc aagaaagccg cggccgggcg aagagcaggc cgacggcagc ccgggcgaag     70080
     cgggcgccat ctccaacccc atgcccgggc tgagcccgca acgcacgccg ggcatagacc     70140
     gctggtcgga gaacgacttc gaggcggtct ggcggcgcgc tacgcgggag ctgtgacaga     70200
     gaccgcaacg gccgtgccgc ggggcggcac gcgacttgcg cactgcggcc ggcgagcgtt     70260
     cgccacctcg gcggcgccgg cattttctgc aaggagacgt catgcatgca cataccgaag     70320
     accgcgcccg catgcgcgaa tcgaaacagc aggtcaaatc cggcctgcat gaattgatcg     70380
     ccggcgccga ggcgctgctg cgttcgaccg cgtcgtacgg cggctccgaa ctcgagtcgg     70440
     tgcgcgaccg gctcaagcac caactggaag cggcgcgcga ccaggccggc ggctgggaac     70500
     gcagcgccgt cgagcgctac cagcgcgcct cgcgcgtcgc cgacgggtac gtgcacgaga     70560
     acagctggaa gctgatcggg gtggccatcg tgctgggcgc gctgctgggc gcctgcgcca     70620
     tgtccgaccg cgggcgcaga cgctagcgtt ccggacagcg cccggctaca gcggatcgcg     70680
     tacgcggatc tcgttgcgta cttcgcgcac gccgggcacc gagcgggccg ccgacagcgc     70740
     ttgcgcagcg gcctcgtcag tgtcggccgt gccggacagg cgcaccgcgc cattgcggct     70800
     ttgcacctgc accgtttcgg aacgcaggcc gggcgtttcg accagcgcct ggcggatctg     70860
     ggcggcaagg gccatgtcgt tgccgctggc cgggccggaa caggccgcca gcagcagggc     70920
     aagcagggcg ctgcgcagcg cgcagggaag ggaagcggtc gtcatgcggg ctcctgtgat     70980
     ctgggtgggc tgccgggatg gccgccgcgg ccggcgtgag cggcaagcgc cgtgcccgct     71040
     ctcgcgccag ggcgggcaag gccggcacag cacttgcgca ccgcagcgga tacgaagccc     71100
     ggcggccgcg cgccgccggc ccgatccgca acccaccacg caggagaacg cgatgcgtaa     71160
     cgacaaccga cgccagccgc cgtatggcga tgacgatttc ggcccccatg acgaattcga     71220
     gcgcgacttc cggctgggcg gccgcgatgt ccggcaaggc aggccttcgt ggcatggcaa     71280
     cgaccgtccc gaggcgcagg agtacagtcg cggcagcggc cgctgggggg ccgaagaacc     71340
     ggactacggc cgtccctacg gcgaacgccc caatcgcgca acgggcggcc agccgaaccg     71400
     ccgcggcccg caatacgaac agggcgggcc ttatcccggc acgcgccgcg cgcaatggaa     71460
     cgaacctatc acgagccgca gcgccgatcc gggccagagc agctacggcg ggttccgcga     71520
     cgaggacccg cgctggcagc ggcagcaatt ccatgacggc ccgctggccg gcgactacgg     71580
     cggctaccac ggcgacggcg gcgaatgggc cggcctggcc ggcgccgggc accgcgcagg     71640
     cagccgccgc atcctgccca agggctacac ccgctcggac gagcgcttgc gcgaggatgt     71700
     ctgcgaacgc ctggcgcaca gcggcctgga tgtcagcgat gtatcagtct cggtgaccga     71760
     cgggcaggtc gaattgagcg ggacggtagc ccgccggcgc gacaagtacg ccatcgagaa     71820
     ctgcgcggac gactgcctgg gcgtggccga catcgacaac cgcattcgcg tcgtcgcgcc     71880
     cacggccgcg ccatgaacaa ggagccggac atggacatct cttcccgaca ggcgccgctg     71940
     gccgcggccg ccgcagccag cgggccgacg cgcatcgtcg gccgcgcaaa gttcagcgcc     72000
     gtcggccccg gtccgcagat catggccgcc gacacgctgg agggcaaccg cgtgctgaac     72060
     ccccagggcg agcatctcgg ttcggtgcag cacatcatga tcgatgtgcc gcaaggccgc     72120
     gtcgcctacg cggtgctgtc gttcggcggc gtgctgggca tgggcgacaa gctgttcgcg     72180
     ctgccctgga gcgcgctggt gctggatacc gaccataaat gcttcgtgct cgacatcgcc     72240
     aaggaacgcc tcaggcaggc cggcggcttc gacaagaacg actggccgag catggcggac     72300
     aagcgttggg ccgaggaact ctacgattat tacgaccagc cagccgtact ggtaggccgg     72360
     tcctgcaggc cgacaccggg acggccgcgc ccggcgccgg cctgctcaac cgtgccgacg     72420
     caacgcgctg atgttgccgt cgggttccat ataggcgcgg tgtacgtcgt ccaggctgtc     72480
     gtatcccttc aggcgcagct cgctcatcag ttcagcttcg gtgatgtatt cgcgccgcat     72540
     attgcgccgc tgcaactcgc cgtcgcgcac caggcagacc gtggagggcg ccagcacgcg     72600
     gcccaccgcg ggcaggaaat aactggcgcg gtcgatggcc acggtccagc ccacgatggt     72660
     cagcagcagg atggcgccgt cggtgacgga cttgtattcg cccgccatgg cgttttgcgc     72720
     cgcgtcggcg atcagcacca gcaccagcat gtcggccacg cccagggagc cgatgtcgcg     72780
     tcgtcccgcc agccgcaaca gcgccagcag gaaccagtag atcagcgttc cgcgcaggaa     72840
     cagctccaga ggcggtacgg tcaacgcgaa catgccgttc cagtccacgt ccatgatgcg     72900
     ctcctgtgca ggcctggggc cgaagtggat tttttacacg ccgggtcaag actggtccgg     72960
     cggcccgccg ttgcgcacgg ggtcggggcg atggcgggaa accccggcat gcccggcgtc     73020
     ggtctgcgtg tcgggcgcga tatcggcgcc gtcgggcggt tgccggtcat actcgacgtc     73080
     ggggcgctcg ccggtgccgc cggtatcgct gtcggtctcg gccgccgcgt cgggcaggtc     73140
     gctggcggag tccgatgagt cgctggggcc caggccgggg cggggctcgg catcgggagg     73200
     ggaaacgggc cagagtgaac gcttgggcac gatggctctc cggagtgggg gatgcctcat     73260
     gccctgcaag cggcgtgcct gcggcgcggc ggcgcctgcc ggctcgcgcg ggcgccacgg     73320
     gcacggcgtt tgcggcctgc gcactcgttc aggagccgcg ctcatgttcg agcaatactc     73380
     tcactccgcc cgatgggcag tacgccccgt tccacgggcc agcggcgcga cctgtgagcg     73440
     cgccgtcgat ggaccatgga gcgggatggc gccggcttgt cggccctgac ccgggcacgg     73500
     ccatggcgca acgcctgctg gtggtgtccc cgcacttcga cgatgccgta ttcagttgcg     73560
     gcggcctgct ggcggccacg cccggcgcca cggtgctgac ggtgttttcc ggcgtgccca     73620
     gcgtcgccgc cgccttgccg gactgggacc ggcgctgcgg tttcgaacgc gccgaccagg     73680
     ccatgcaggc gcgccaggcg gaggatcgca acgcgctggc cgaactgggt gcgtcaggcc     73740
     tgggcctgga cctgctcgac agccagtatc cgggcagcga agcgatgctg gcgcggctgc     73800
     ccacagtcct ggcggcggcc gtccagtcga tcaggcccgg cgccttgctg attcccctgg     73860
     gcctgttcga tgaagaccac gtgcgggtgg ccgacgccgc gctggcggtg cgcgggttgt     73920
     tcgatggctg cgactggctg gcctacgagg aggtcctgta ccggcgccgc cgcggcgcgg     73980
     tgcaggcacg cctgacccag ttgcacgggc gcaaggtgta tgccacgccg gtggccctgc     74040
     cgggcgatgc ccgcggcgcc agcaagacgc gggcggtggc cgcctaccac agccagctcg     74100
     aacccttggg actggtgcct gggcatggcg acgacgcggc cccggagcgc tactggcgcc     74160
     tgacctggcc ccggccggac gccggatgaa cactgcaggc atgccgcttg cgggcctggc     74220
     agccctggat acaggaggac ggactatgtc gatgatcgtc gccgctcgtt tcatgacttt     74280
     cgatgccgcc gcggccgccg ccgggcgctt gcaggcggcg ggcgtttcgc aggaagatat     74340
     ccatacgttc tacgtcaaca gcgccggcgc gcacgatcgc tacccattgg gcggggaccg     74400
     gcgcgccgac cccgatgccg ggccggccca gtacggcgcc atcactggcg ccgcggtggg     74460
     cgggctggcg ctgggcgcga tcgcgggcgt ggtggccagc gccctggcgg ctacggcgct     74520
     ggcgctggtc gcggcggtgg gcgtgggcgc ctatgtgggc gcgctgttcg gcgcgctgtg     74580
     ggtggccggg cgcggccgcc ggccgttgcg gccggccacg gccagtccga cggccagccc     74640
     gccgggcgcc gacgaacacg cgccggtgcg tcatgccggc gtgatgctgg ccttgcatgt     74700
     ggacggtgtg caggccgaac ggacgctggc ccttctgcgc gatgccggcg gccaggatct     74760
     cgaacgcgcc caagggcgct gggtggacgg caaatgggaa gacttcgatc ccttgcaacc     74820
     gccgcaactg gcggccggcg gctagccctg gccgcccgtt ggctggccgg cctgctgtgc     74880
     ctggggatat gggcggcgca ggccagcccg gcggccgacg aagcatggct gcggcgcgcc     74940
     gcgcaactgg cgcagacctc ggcgcaagcc gccgcgttgg cgcggcagca cggggccagc     75000
     ggcgacgtcc aggcctatgc gcgccaggcg gccgcccggc tgcaagacct gggccgcgga     75060
     ctggccgacg tggcgcacgc gcaggcggtg acgctgccgg ccggccccga cgtgacgcaa     75120
     cgcacccatt tgcaggaact ggcgcagcag cgcgaggccg ccttcgaccg gatgtacctg     75180
     cattgggccg gcgtggccct gggcgaggaa acgctgcggc actaccagca ggcggccgag     75240
     gaggcgcaag cggcgccggt gcgggagttc gccgtgcata cgctgcccat gctgcagaac     75300
     ctgctgcagg acgcccggcg gctggcccgg ccgccgccgc aggccgaacc gcgcaagctg     75360
     ccgcccggcg gcccgggcga gcccgcgccg ccttcgccgg cttcgccgag cgcgccgccg     75420
     tccatcgacg ccacgcgccc gggccgctag ggccttactc gcccggggtg cccgtcacgg     75480
     gcagtacgat gcccgtgatg tagctggcgc aggccgggct ggccaggaac acataggcgg     75540
     gcgacagttc ctcgggctgg gcggcgcgct tgagcgcggt cttggcgccg aagtccttga     75600
     tctgctcggg cgcctggtcg gcgggattga gcggcgtcca gaccggtccg ggcgccacgg     75660
     cgttgacgcg gatgccgcgc tcggccacat tggccgccag cgaccaggtg aaggcgtgaa     75720
     tggcgccctt ggtgctggag tagtccagca gcttgggatg gccgcgcagg ccggtgaccg     75780
     agccggtgtt gacgatgctg gcgccttctt tcaagtgggg cagcgcggcg cgcgccatgt     75840
     ggaagtagcc gtagatattg gtgcggaagg tttcgtccag gcgctcgtcg gtaatgtcct     75900
     gcagcgacga agcgtgctcc tggtaggcgg cgttgttgac caggatgtcc agcttgccga     75960
     actcgcgcag cgtgcgcgcg acggcctcct cgcagaagac cgggtcgcgc acgtcgccgg     76020
     cgatcagcag gctgcgccgg ccttcggcct cgacgtggcg ggcggtttcc cgggcgtcct     76080
     cgtgctcctg caggtacacg atcgcgacat cggcgccttc gcgcgcatac agcaccgcga     76140
     ccgcgcgtcc gataccggag tcgccgccgg tgaccagcgc ggccaggcct tccagcttgc     76200
     cgctgccgcg gtaggccggc gccaggaact gcggctgcag cgccatgtcg gcttcgttgc     76260
     cgggtttggc cagatgctgg cgcggcatgg gcggctcggg atggtcgcgc gcgccggtgc     76320
     gcggcgcctc gcctggccgg cctgccgcgg gcttgcgctg gtcgcgctgg tcctgctcgc     76380
     gctggatctc gcgctggcgc tcggcggtcc ggtcggcggc ctgccgggtc ttgggggacg     76440
     cgtcggatgg ggtcttgggc atggcggggc tcctgatgcg tgacgacgcc gcgaggcgcg     76500
     gcaccgccga tcagcaacgc gcatgcctgc ggtcaatcgc gcggcagccg cgcctgcatg     76560
     cgcggaccca gcgtgcgccg gctggcggcg tagtcggccc aggggtcggg tttgcgccgg     76620
     gcctgctcca gcgcattggc gatgttccag cgcgcgcggc gcaaatcgtc gccggcgtcc     76680
     agcgcgtccc aggacagcgg catggaaacg ggcgcgccgt cgcgcgcccg cgccgagaag     76740
     gcggccaccg cggtggcgcc gttgccgttg cgcaggtagt caacgaagat gcgccgctcg     76800
     cgccgggcct tggccatgtt ggcggtgaac cggtccggca gggccacggc cagctggcgc     76860
     gccagcgcgc gcgcgaaatc cttgaccgtg tcccagggct gcgtgggccg cagcggcgcc     76920
     accaggtgca ggcccttgcc gccggtcgtc ttgagaaacg gctccagccc gacttcctgc     76980
     atcagcaggc gggccatctg cgcgccttcg acaatggccg gccacgccac gccggggccg     77040
     gggtccaggt ccagggtgat ccggtcgggc gtgtcgggat ggcgggtatc ggcgccccag     77100
     gtatggaact cgatggcgcc atactgcacc agcgcgatca ggccgggcag cgattcgatc     77160
     accagatgcc cgccgtcgcg ccgcacgccg gcaggcagcg cctggctcag gtgcttctgg     77220
     aagaagcagg tcgtgccggc gccgtcggga cagcgcaaca gggccacgcg gcgctggcgc     77280
     aggtgcggca ggatattcgg tccgatggcc gcgtagtact cggccagctg cagcttggtg     77340
     tagtcgggct cgcgataggc cagccggtcc gggtgcgaga tgcgcacgcc ggccacctcg     77400
     gcgcggccat cgccggcgcg gcgcgacggc gtggccgccc tggccgccgg ccacctcgcc     77460
     gcgcacttcg ctggcgggct tgtcggcgcg caggccggca aacgaagcct ggcgcagcag     77520
     cgccgtcgcg cgtgatgccc gcataattca cttcggccac cagctcgggg ctgacccaat     77580
     gtatggcggc gtcgccgcgg ccgcgcggca cgtcgcccga aaacggcttg gcatcctggc     77640
     gcagcgccgc cagccgctgg cccagcgtgc gcagcgtggc cgcgccgaag cccgtaccca     77700
     cgcggcccgc atagcgcaat tggcggcctt cgcgcaggcc caccagcaag gcgcccaggt     77760
     ggcggcgcgc gccggccggt tcggtatagc cgccgatgac gaattcctgg cgcgggcggc     77820
     acttcagctt cagccagctc tgcgagcggc cggaccggta aggcgcgtcc aggcgcttgc     77880
     agatcaggcc ttccaggctc agccggcagg cttcgttcca ggccgccttg ccttcggtgt     77940
     cgtcggccac cggcagccgt tgcgtgagca tcagcggcgc gtcctcgggc acctcccgca     78000
     gcaggtcctc gagccgctct tgcctggctt gcaggggcag ggcgcgcagg tcctcgccat     78060
     tccagaaggg aaggtcgaac gcgacgaaca ccagcccttc ggcctggccg tccagcgcat     78120
     tctgcaacag ctggaaatcg gccacgccgc gttcgtcgag cacgacgacc tcgccgtcga     78180
     gccagccgcg ccccagcttc agcgcgccca gcgcgcgcgc cagcggcgcc atgcgagcct     78240
     gccaatcctc gttgccgcgg ctgacgaggc gcacgccgcc ggccgagcag gccgccagga     78300
     tgcggtagcc gtcgtacttg acctcgtacg accagcccgg cccatgcggc gggctgtcca     78360
     ccagcgtggc cagctggggc gccaacgtgc gcggcatcgc ggcgcggcgc ccgcgcggcg     78420
     tggccgccgg ggcgggcggc ggggtggccg gcgcgcgttc ggcgtcatcg cccggcaccg     78480
     ccgcctcgtc gtcttccttg cgcagcagcc attggtcctg cccgccgctc atgcgcacca     78540
     ggacccagtc gccggcaaga cgccggccgc gcaacgcgaa atgcagcttg ccgcgccgca     78600
     agccctggcg cggatcgccg cgcgggatcc agacgccgct gtcccagatg tcgacatgtc     78660
     cggcgccgta ctggcccttg ggaatgtcgc cggagaatcc gccatactcg agcggatggt     78720
     cttccacatg cacggccagg cgcttgacgg aaggatcgcg cgacgggccc ttgggcaccg     78780
     cccagctcac cagcacgccg tcgatttcga gccggaaatc gtaatgcagg cggcgcgcct     78840
     gatggcgctg gatgacgaag gacaggcctt cgcttgcgcg ggcggccgcg cgcgggcgcc     78900
     gagcggcgcc ggccggttcg gcggtggcgc ggaaatcgcg cttctcgcgg tactgccgca     78960
     gtggctgtgt catgggcgcg gtgctctcct gtcaggccgc cttgcgggcc ggggcgcgcc     79020
     gcgcgggcgt cttgcgcgcc cgcttggcgg cggccccctt ggccgtggct ttccgggccg     79080
     acgcggccct tttcgccggg gccgcgggcg cgccggcgcg ccgcttgccg cgctccaggc     79140
     tctgctgcag catggccgcc aggtcgatga ccttggcgct ggcgcgcggc gcggcttcgc     79200
     ccggctcggc cagctcatgc gtcttgccgg cgcgcacttt cctgtcgatg gcggccagca     79260
     ggtcgtcgcg ataggcgtcg cggtattgcg cggggtccca cttgcgcgtc atgtcgtcga     79320
     gcaggcgcat ggccatgcgc agttcgcgcg cgccgggcct gtcgtgcgtg gccgcgtcat     79380
     ccaggccgaa ttcctcggcc ggcacgatct cgtcggcgta gcgcatggtg accagcatca     79440
     gcacctcgcc caccggcatc acggccgcca ggtgctggcg cgtgtgcagc acgacctggg     79500
     caatgccgat gcggccgctg tcgcgcaggg cgcggtgcag cagcgcgtag cccggcccgc     79560
     cgcgccggtc gggcgccagg tagtatggcg tgtcgaagta atacagcggc acttcctcgg     79620
     ccttgacgaa gtcgaggatc tccacggtct gcgtggcggc gacgttggca cgggcgaaat     79680
     cctcgtcgtt catgtagacg tattcgcctt tctcgtattc gtagcccttg acgatatgct     79740
     cgctgtcgat cgcgcggccg gtgcgcttgt tgatgcgctg gtagcccacc ggcgcattgt     79800
     cgcgccggtc gatccagtcg aaatcgagcc ggctggggcg gcttgccgca tggaccacga     79860
     tgggtacgtg caccagcccg aacgcgatcg cgcctttcca gacgattctg gccatcatgc     79920
     ctccttgtcg ggacggcagg ctcagcaaac ggcgtgcccg tgccaggtca gcgtcggcac     79980
     agcagggcgc ccaccagcat gcccacgcca gccgcgacgc caaccgcctg ccagggccgc     80040
     gcatggacga actcgtcggc gcagtcggcc gcttcgctgg ccaggctgct ggtggtatcg     80100
     gcaagctggg accaggcttc gcgcgccgcg tccagctgtt gccgcaggcg ggccttcagt     80160
     tcttcgatat cggcgtattg gggatcgtcc agcgtggcgt ggatttcatc gagccagcgc     80220
     tggcgcgcgc cggcagacat gggcgcggtc gggtcggcgg ggaagttggc ggggcgcttg     80280
     gaagtaggca tggcgggctg ctccggttgg gggaaggggt tggggcggga cgaagccggt     80340
     ggggcgtggc ctcagggccg ggccatggcg cggcaggcgc tggcgcaggc atggcaggcc     80400
     gtggcgcatt cctggcagtg gcgcggctcg tggcgggcgc actcgtcgcc gcacacttcg     80460
     cagatgcgcg cgcacaaggt gcacatatgt gtagaaaatt cgctttcgcg cgccatcatg     80520
     gcggcacaca ggcgacaggc ggcggcgcag tccaggtcca gcgcgatgca gcgggccata     80580
     tcggcgccgt ggccttcgcg caggcagctg ctggcgcagt agtcgcacgc ggcggcgcaa     80640
     cggccgcagg cctgcaggca ttcgacaacg tgagtattga gcatgaccat ctcctggggg     80700
     caaaccacgc atgccgcaag cggcgagcct ggcacgccgc gctcagactt gcttgcaaat     80760
     ggagaccagc cgtgatgacg gcgcgccgcg ccgtccacta ccatgcactg tacgcaatct     80820
     cttgcgcgag gtgcaagatg tccaagcccg aacccgcgcg cggcgccgac gcgcacgatg     80880
     atccgtcact cgatcaagcc aaggtgctgc cgccgcgtag cccggtgctg gtgcccaacc     80940
     tgccgcccaa gccgccggcg cgcgcgcagg cggacaagca cgggccggcg gtggacaacc     81000
     agaccgagtc caactgggcc gatggtgcgg cgccgcagcc acgcgccagg aacgcgcgtt     81060
     catcgatttt ctgagtgcgg ccaggccgcc acgaaggcca gcaggcggcg ttcgtcggcc     81120
     gccaggccgc gcggcccggc cggcgcggcg ccgcctgccg gcaaggcgcc gtccaggtag     81180
     gcctggacaa tgccaggatg gatgtagcag gctcggcaca ccgccggcgt gttggccagg     81240
     cgggcggcca ccagcttgac gacctcgacc acggccgcgc ggcgcgccgc ggcaccctcg     81300
     gccgggcagc gcagcagcag cgaaagcgcc agcgccgagg cggcccaggt ccggtagtgc     81360
     ttggcggtga aatcgccgcc gccggcctcg cgcaaatagg cgttgatcag ttccgagtcc     81420
     accgggcgcg gctcgccgtc ctcgtccagg taatggaaca gctgttgccc gggcaggtcc     81480
     aggcagcgct tgaccacgcg cgcgatgcgg cggtcgcgta cggtgacatc gtgcgccacg     81540
     ccgctcttgc cggtgaagcg caggcgcagc cggctgccct gcagccaggc atggcggcgc     81600
     gtgacggtgg tcaggccgaa cgaaccgttc tcgcgcgcat aggcgcggct gccgacccgc     81660
     gccagcgtgg tttcgagcag gcgcaccacc gtggcggcga ccttgtccgg agccaggccg     81720
     cggctggaca ggtcgcgcgc cacgcggcgc cggatgcgcg gcagggcgcg gccgaactcg     81780
     cgcagctggc cgtacttggc cgcgtcgcgc caggcccgcc agtcggggtg gtagcggtat     81840
     tgcttgcggc cgcgggcgtc gcgtccggtg gcctgcagat ggccgtcggc ccgcgcgcag     81900
     atccacactt cgcggtaggc gggggggatg gccagcgccg cgatgcgcgc caacgtggca     81960
     ggatcgcgca cccggcggcc gtccgcgtcg tagtaggcga actttccgcc gggcagccgg     82020
     cggcgcgcca ggccgggacg gctgtcgtcc acatagcgca gcgcggcggg cgcggcgggg     82080
     ctcacgagcg gcgcgcgccc tggccccggt tgcgttggct ggactgatcc tggttgctgc     82140
     ctatctgcga tacatggccg tccttcttgg tgcgcgactg ctggctgcca tggctgcgtt     82200
     gggcttcgcg ctcggtgtcg tcatcctgct tgcggtcgtg ggaggtaggg gtaggtttca     82260
     tagtcgaggg ctccgggttg cccgccacgc gccacagggc gtggtaatgc ggcaggcgtt     82320
     gcaaggcata gcgggcgctg tcgcggcgta tggtgttgcg cgcgccgtcg aaccgcgccg     82380
     tttcggtata gatcgtgggc tgggcgtcgg ccgggccggc cttgaacagc cacgcatagc     82440
     actgggtgcc cgccggggtg ccatcggcgg gctcgtcggc aacaccagtg ttggcgattg     82500
     ccacattggc gtcgctgtgg cgcgccgcgc ccagggccat ggcgcgcgcc acggcttcgc     82560
     tggtgaggtt gtggcggcgc agtatgtcgg gcgccacgcc caggcagcgg gtcttggccc     82620
     gcggcgaata gaccacatag gcgcagtcga gcaaggcccc ggcgccgggt tcctcggcca     82680
     gcaaggaggc aatcaggccg gccgtgcagg attccgcggt aaccagcgtc agccgctgtt     82740
     cctgcatgta aagggcggtg cgttgcaagg cgttcatggc gtctccctgg acagttggcg     82800
     gcaagcggcg tgcccgcgcg ctcaggcggg ccggcccgcg cccacccgcg cgcccaccac     82860
     catttcggtg gcccagttca gcaggatgga cgaataggcc tgctggcagc gcttgtcgct     82920
     cagcgcgtgg tcggcgccgt cgacgatgcg atgggtcagc gagtgggaat gcaggaacgc     82980
     gccgcggtag ctcatgatgg tcgagtgcgg aatgtagtcg tcgtgctcgg cctccacgat     83040
     cagcacgtcg ccgcgaaacg acgagcaggc gctcaaggcg cggttgccct ccggcgccac     83100
     ggtggcgtgc cggtaggcgg agatggcggc gcggtcgagc tgcagcttgg gctgggccca     83160
     ttcgtcgtcg cggtacagcg ccggcacgtg cagcgccagc cagcgcaccg cgcgcagcgt     83220
     ggtcaggatg gcggccagat agccgccata gctgctgccc accaccgcga tggcggacgt     83280
     atcgacggct gggtgggcga tcagcgcgtc ataggcggcc atgatgtcgc gcaggctgtc     83340
     ctcgcgcgtg acctggcgcc gctgcgcctc ggtggcggcg tggccgcgca ggtcgaaggt     83400
     caggcagatg cagcccagcc cggcgatgtc gcgcgcgcgg ctcaggtcga agcgctggct     83460
     gccgccccag ccatggacga acagcacgcc gggcagcttg gcgcgcggcg tgagcagggt     83520
     gccggccacc tgcgtgtcga acacggggat cgtgatggtt tcgctatgtg tcgtcatcgt     83580
     ccgtgccgtt gtcttgcgtc atgccgccgg ccttggaaat gaagccgacc tcggcgtcgt     83640
     gggcgtggaa tacgatgcgc gtgccgggcg ggtgcgccgg gtccggaccg tagtgttcgc     83700
     tggtggcggc gtgcgcgcgc cgcaggccgc catcctgcgc gaacgcgcgc agcgcggcga     83760
     tctcggtcag gctggccccg ccggcccgcc acgattgttc cagcacgccg gtgcgccagc     83820
     ggccctgcgc atcgcggccg cgcgccacgt catagttgcg gcgcgacgcg tacaggcgcg     83880
     gatagcaggc gaacgcctgt tcgtcgtaac gcatggcatg ctccagcgcg gcgcgccgcg     83940
     gcgcgtccag ttccagctgc agcagggcgg gcaggggacc cggcacgaac cacaggtccg     84000
     agccgccgta gacttccagg cccgcgtggt ccagcgtcag cgactgcgtg ccgatatagc     84060
     tggccagatg gacgcccacc tgcgccacgc cgacgctgta ggtcgagatg tcttccaggt     84120
     gttcctccag caccaggcca tagcggcgca cctcgccggc atcctgttcg gccagcgcct     84180
     ggtccagcgc cgccgcgtcg gcgaccttgc gctggccgcg gccggcggtg gcgcgcaccg     84240
     gcttgacgcg cagcgcaccg gtgcgcagca tccgcgcgcc ggcctggcgc gcctcgtcca     84300
     gcgcgaagac cgtgcagccg ggcagcacgc agtcggacag ccgcgcgccc agttcgcgcg     84360
     accaggccgc aggggcggcg cagccgtcat gcggcaacgc atgggtgatc gccttggtgg     84420
     cgacgaagcc atgcggcgcg acgccgccga acaggtcgtc cgggccctgg atgcccaagg     84480
     ccagcgcgcg gccgtccagc agggtgcgcg caggtacgta atacacgcgc aagcgcgggt     84540
     cgcgcgccgc cgcaggcagc gcgtcggcgt actcgcagcc cagcagctcg gcgatgtccc     84600
     ggcccagcgc gcgcaggctg gcgcgctcgt ggcgcggcgc gtcgcgccgg ccgggatggg     84660
     cgaccaccag atcgacggga cggcgcggta cggcggcggc agggttcatg ggcggatccg     84720
     gaagcgggaa cagcgccgca gcagcaagcg ccgtgcccgg gctcaaccgg ccgccgcgcg     84780
     ccggtggcgc cattcggcgc ccaggtaggc cggcagcgcc acgcacagcg gtatccacgc     84840
     atacagcaag cggtacatca gcaccgcgcc caggctttcg ctggccggca tgcgggtggc     84900
     caacgcggcg gcgagcaggg cctcgatcac gcccagcccg cccggaatgt gggccagcag     84960
     cgcggcgatg ctgctgaaca acaggatggc caggacttcc ggatacggcg cgcggccctg     85020
     cagcaggacg tagatgatgc cgcccatgat ggcccacgac acgccggcca ggcccatctg     85080
     ccgcagcgcg gtcggcaggt cgggcagcac ccagcggtgg ccgcgcaagg tataggcgcg     85140
     ccgccgcgcg taccggcaca ggtacaggta ggccagcgcg ccggccagca gcgccgcgcc     85200
     cacggtgcgc agcaggccgg cgcccaggtg ccagccggcg ggcgtgggca tctggccggc     85260
     cagtagaagg gcgccggcca gccaggcgta gcccacccaa ttggtggcgg tggcgaacgc     85320
     caccacgcgc agtccgcagg cggtgcgcaa gccgtggcgc ccgtacagcc gcaggcgcac     85380
     ggcgaccccg cccagcagga cgcccaggtt caggttgagc gcatagctgg tcatggcgat     85440
     ggccgccacc tgccaggcgg gcaggcggtg gccggcatag cggcgcgcca ggatgtcgaa     85500
     gccggcgtag gccaggtagc cggccagcgc cagcgcggcg gccagcgcca cggccgggcc     85560
     ggggatatcg tgggcggcgc gcgccaccgc gtgccagtcg atgcggcgcg cctggtacag     85620
     caataccccg acgacggcca ggccgacgat gccggccagc caggcgccca ggcggcgccg     85680
     gcggtgtcca tgatggtgcg cgtgcctcat gtcgcctcgt ccggttggcc ctggccatcg     85740
     ggccgcaggg tctggatgcg gggcttgtgg gcgggcaggc tgccggccca ggcgggaaag     85800
     cgccgcagga agtggtagac cagcgcgccg gcgaacagcc gccgcagctg gcgccctgcg     85860
     ccatcgcttt gcggcgccgg gcggcaatgg tcgatcgcca accgttccag ccgctctcgc     85920
     aggccgctgg cgaaggcgct gtcgcgcacc tcgacattgg cctccaggtt cagcgccagg     85980
     ctgaacggat cgaggttgct cgacccgacc gtggcccact cgtcgtcgat gctggcgacc     86040
     ttgccgtgca acggacgctc gcagtattcg aggatttcca cgccggcctc ggccagggcg     86100
     tcgtacagca ggcgcgcgcc cagctgcgcg atgggcatgt cgggctcgcc ctgcaggatc     86160
     aggcgcacgc gcaccccgcg cgcggccgcc gcgcgcaggt cgcgcagcaa gcggtagccg     86220
     ggaaagaaat acgcgttggc gatcacgatg tcgcggcgcg cggcccggat cgccacgcgg     86280
     tagctttgct cgatatcgtt ggtgtgctgg tcgttgtcgc gcaccaccag gcgcgcgcgg     86340
     cgccagcgcc gccgcggcac ggcggccagc gcggcgcgcg cgaaatcgcg gatgtcggcc     86400
     gccagcgggc cggcgatttc gatggcgtag tcctgcttgg actgggggcc gtagtcgtcg     86460
     agatgatcgg ccgagaaatt caggccgccg acgtaggcca gcgtgccatc gatggcgacg     86520
     atcttgcggt gcaggcggcg aaacagattg gtgcgcatgc ccagcaggcg cgggcgcgga     86580
     tcgaatacat ggaaccccac gcccagttcg accaggccgg cgatgaagtc cggcggcagg     86640
     ctgtccgagc catagccgtc gaccgtgacg tcgatgcgca cgccgcgccg ccgccatcag     86700
     cgcctcgcgc agttcgcgcc cgaccgcgtc gtcgaacagg atgaaggtct cgatgaggat     86760
     ttcctcgcgg gccttgccga tggctgtgta gacccgcggg aaatagctgg cgccattctc     86820
     gagaatggcg aagcggttgc cgtcgcgcca gggcgtgctc acaacgtcac ctcggcggcc     86880
     agcggcacat ggtcggacag ccgcgaccat ggacgccggc tcaggcggcg cggctcggat     86940
     ccggcgacgt tgcgcacgta gatgcggtcc agccgcagca gcgggcaggc ggccggaaag     87000
     gtacgcgccg cgtgccccag cgccagccgg tggacgtcgg ccagcccgca gcgcgccagc     87060
     gttgcgtcgg cccgctggcg ccagtcgttg aagtcccccg ccagcagggc cgcggcctgc     87120
     gccggcacgt gctggcgcag gtactggcac aggcgccgca gctgctcctg gcgatgcgcc     87180
     tcgcgcaggc ccaggtgcac gcacagcgca tgcaggggcg cgggcgcgtc gcgcacgtcc     87240
     agcacgcagt gcagcatgcc gcgcggctcg tgcgccgcgc ccacgcttag gtcctcgttg     87300
     cggtgcgaga cgatcggata cttggacaat acggcgttgc catggtggcc atcggggtag     87360
     acggcgttgc ggccataggc ataggcgctc cacagggtgt cggccaggaa ctcgtattgc     87420
     gagaccgccg gccagcgcgc gtggcgcgcc gcgtgccgct ggtgttcgcc cagcacttcc     87480
     tgcaggagca cgagatccgg ccgtgcctcg cgcagggcct cgcgcagttc gtgcaggatg     87540
     aaacggcggt tgaagctggt gaagcctttg tgtgcattga cggtcaggat cctgagccgg     87600
     atcggttctg gcggcatggg cgctccggac ggcgagatgc cgcagcccag caaaccgcgt     87660
     gcccgccaca cgatggcgcg ggcacgacgc ttgcgctacg ctggttcccg atggttcgcg     87720
     cccgccccaa ggagacgacg atgtccgcca cgctgtgctg tcacgtaccc cccaaacccg     87780
     atcccatccc gcccgattcg ccgcccgggg acctgccggt cgacccggat accgacgatc     87840
     ccgatatcga cctgccgccg cccgacgcgc cgggcgatcc cgccaggcgc ctggcggcct     87900
     cggttcgctt cctgctctcc tgacggcgcc tgcgcgcggc ttgccgcggc ggtcgatata     87960
     tcgtaagaca tatatcttac gatataggtg accctatgca tccatttcac gtctttgcca     88020
     tgtccgcgca cggcggccgc ggcggcggcc atgccggggg acggcacggc ggcggccacg     88080
     gcgccggcgg cgacggcccc gactggcggc gcggccgcaa gttttcggcc gacgacctgc     88140
     agttgatgat cctggcgctg ctcgaagaag gccccagcca tggctacgag ctcatcaagg     88200
     cgctgggcgc gcgcagccgc ggcttctata cgcccagccc gggcatggtc tatccgaccc     88260
     tgacctggct ggaagaggcc ggccacgcca cggtcagcca ggacggcgcg cgcaagcact     88320
     accacctggc cgaaccgggc cgcgcgcatc tgcaggccaa ccgcgagcgc gtcacgctgc     88380
     tgatggcgca actggcccat gtcgggcgca agatggagtg gatgcggcgc gcctgggccg     88440
     ggcagcccat cgaaaccggt tccgaaggcg aggacctggc caccggctgg ctgcccgagt     88500
     acgtgcaggc gcgcatggcg ctgaaacagg cgctggcgcg ccacgccgac gccacgcccg     88560
     cgcggcagcg gcaattggcc gccatcctgg cgcgcgcggc cgccgaactg gacgacctgt     88620
     cgtcctgaca caaatttccc tggaagacct gcaatgctcc caaccgaact gaacgtgcag     88680
     cgggtacgcc atccgctgaa aatgcgcctg ctcgaagtca agcgcgtgac gcggcccacg     88740
     ccgcatctgg cgcgcatcac cctggccggc gacgctctgc gcgacttcgt ctcggcatcg     88800
     ttcgacgacc acgtcaaggt gttcttcccg ccgcctggcg cggcgcggcc ggtcctgccc     88860
     gaactggggc cggacggcct ggtgttcgcc gagggcgaac cccgcccgcc catgcgcgat     88920
     tacacgccgc gccgccacga cgcgcgcgcc ggcgagctcg acctggagtt cgtgctgcat     88980
     ggcgaagggc cggccgccag ctgggcggcc cgggcgcagc ccgggcagca gctgggcgtg     89040
     gccgggccgc gcggctcgtt cgtggtcccg ctcgaatacg actggcattt gctggtgggc     89100
     gacgaaagcg ccttgccggc gatcgcgcgc cgcctcgagg aattgccgcc cggcaagccc     89160
     gtcatcgccc tgatcgaggt cgccgacccc gcggcccggc tggcgctgtc gacccgcgcg     89220
     caggccagcg tgcaatggct gctgcgcgag ccggccggca gccgtctgcc cgaggccgtg     89280
     cgcgcgctgc gcctgccgcc gggcgaaggc tacgcctggg ccgcggccga gtcggccgtt     89340
     gcgcgcgccg tgcggcaggc gctggtcgac acgcacgggc tggacaaaag ccgcatccgc     89400
     gccgccagct actggaagcg cggcgaggcg gccgtgcacg aaacgcatga ttgaaccggc     89460
     gccggccttg tgacatcgat gcaacggagc gccgggcccg cgcccctgca aaatcgacag     89520
     aaaatggcgt aatttttaca aattgcacac atttctcgcg tatccggccg ctactctcgc     89580
     acaaaccatg caagatgttg cgaactggag ccccgatgcg taccgcccga cgccgtaccc     89640
     cagcacgact tgccccgttg ccggccatgc tggccgccgc cggcctgctg caatccttgg     89700
     gcgcgacgcc cgcggccgcg gcctgcgcgc ccacgctggc gccagccagc gggcagagcg     89760
     tgcaatgcga cggcgccgtg gtcaaccagt cggtcgaggc ggcggccggc agccaggacg     89820
     taaccatcac ggtggcgccc ggcgcgctgt tctcgatcaa cgccacgcgg gcgctgtcgg     89880
     tcgatgaccg cagccgtatc gtcaacgagg gcacgatcca gatggccggc ggcgccggcg     89940
     cctcgcgcgg cgccatggtg ggtttcggcg acaacaacca gttgatcaac cgcggatcga     90000
     tcacgacctc gggcagcggc gtgcgcggca tctcggtgcc caacgtcggc agtaccggga     90060
     cgctggtcga caacagcggc agcatccgca cccagggcgc cagcgcgcac ggcatcgcca     90120
     tcaacggccc gggcaaccgc gtcgaaaaca gcggcgccat caccgtcaac ggcaccgacg     90180
     ccaagggcgt gtacctgcaa ggcggcagcc ccgcggccaa cgtactggtc aacagcggca     90240
     ccatccatgc gcgcggcgcc agcagcaacg gcgtattcgg cccggacggc gtgcatgtga     90300
     acaccaccaa cgccaacggc tttcatgccc gcgtcgagaa cctgcccggc gggcgcatcc     90360
     tcagcgatca ctcgtatgcg ctgcgcgggc agaacggcaa cgataccttc atcaacgccg     90420
     gctacctgca agggcacggc ggggccggcc gcgacacggc cgtctacatg ggcccccagg     90480
     gcacgggcac gctgatcctg cgcaccggct cggccatcgc cggcctggcc gacggcggcg     90540
     gggcggccag ccatgcctat ctggagggca gcggcacggt ggacaaccgg ttcgccaact     90600
     tccgcaccct gaccatgcgc ggcgccgact ggcgctggac ctcggacgcc gcgttcaccg     90660
     aaagcgtgga cctgcgcacc gggatgttct ttcttgccgg cacgctggcc agcccggcca     90720
     acagcctggc cgccggcgcg gtgctggccg gcaccggcac gctggccggc gcattgcgca     90780
     acgccggcga gatccggccc ggcccgaacg acggcagcgg ctacggcgcg ctgacggtgc     90840
     gcggcgatta caccggcgcg ggcggcgcgc tgcgcgtcaa cacggtgctg gccggcgacg     90900
     gggccgcctc ggacaggctg gtcatcgatg gcgggcacgc cggcggcagc accccggtca     90960
     cggtggtcaa ccggggcggg cagggcgcgc tgaccgcggc cgacggcatc ctggtggtcc     91020
     aggccatcaa tggcgcaagc tcggacgccg gcgccttctc gctggccgcg cccctcaacg     91080
     ccggcgcata cgagtacagg ctgtaccgcg gcgacgccac gggcgccgcg ccggacagct     91140
     ggtacctgcg ctcgcgcgcc tatctggtcg aggaccaact ggccggcagc cttgccgaag     91200
     ccgaggcgat cgccgacgac atcggccggc gcaccggcga gcggccgagc atcgaggaca     91260
     cgccgctgta ccggcccgag gtggcgctgt acagcagcat tcccatgctg gcgcggcgca     91320
     tgggcctggc ccagctgggc accttccacg agcggcaggg caaccaggcg ctgctggcgc     91380
     gcgacggcga acgcgtcgcg gcctgggcgc gcgcctatgg cggcaacagc aagcaggcgc     91440
     tcgacggcga tgcgcaaccc ggcatcgacg cccgcctggc cggcgtgcaa ttggggcagg     91500
     acctctacag cagcgtgcgc ccggacggcg gacagcaccg cttcgggctg ttcggcggct     91560
     atggccacgc gcgcggcgac acccacggct cggccggcgg cgagcgcgac gccgcgaccg     91620
     gccggctgac catcgacggc tacagcgtcg gcggctactg gacctatgtc ggcccgcgcg     91680
     ggtggtacgt ggataccgtg ctggccaaca cctggatgga catcgacacc gactccaagg     91740
     ccgggcgcga cgccgatacg cgcggctagg cgttcacggc ttcgctggaa agcggctacc     91800
     cgctggcgct gtccgagcgc tggacgctgg agccgcaggc gcagctcatc taccagcgca     91860
     cgcgcgtcga cgacttctcg gacgccgtgt ccgaggtgcg catccgcgac gacaacgcgc     91920
     tgaccgcccg cctgggcgcc cggctgcagg gcgagtacgc ggccgccgcg caggtgtggc     91980
     gcccctacgc ggcgctgaat ttctggcgca ccttcagcgg cgagaacacc gtcgtgctgg     92040
     gcgaagacag cgtcgatacg cggcgcggcg cgacctcgct cgaactggcg gccggcgcca     92100
     gcgtgacgct ggcccgcagc ctggccctct acggcaggct ggcctacgcc accagcatcg     92160
     acagccagta tctgcgcggc gcttccgcgc aactgggcat gcgctacacc tggtagggcg     92220
     acgcgctgcc cgtctcggcc acccagcaca aggtgttgac cagggccatc tgctcggcgc     92280
     tgcggcagcg caccgccgtc agcgccgggc tggcgaccag aatggccagc gtgcgcgcgc     92340
     gcgatatcgc cacattgagg cgattgcggc taaacaggaa ctccaggtcg cgcggcaggt     92400
     aatcgccgct ggaggtcgcc atggacacga tcacgacctg ggcctcctgg ccctggaact     92460
     tgtcgaccgt gcccacgcgc gcgccgtcgg gcagggcggc gcgcagggta ttgacctgta     92520
     cgttgtacgg cgcgacgaac aggatgtcgt ccagcctcag cggcgcgggc gcgccggctt     92580
     cgcccacata gcgctggcgc agcaggagcg cgcacagttc ggccacgcgc gcggcttcct     92640
     cgcggctgga ttgcgtattg ccgtcgtgcg gcacgggcac gtagcggatg ccgtgcgcgg     92700
     gcagttcgcg gccggccgcc tcgtcgagca gcaggcggtg ggccgcggtg gccggcgccg     92760
     cgcgcagcct gccgtcgtag atggcttcgg aaatgaaacc gcagatctcc ggatgcatgc     92820
     ggtacgaggt gtccaggaag acgccctgcg acgccgcgat ggtggcctgg ccgtcgagca     92880
     ggtactccag cgccgattcg cccgaacggc ccggatgcgt gccctggctg ggctggccga     92940
     gctgcatctg gtcgcccagc agcacgatgt tgcgcgcgca ctggcccatg gcgacgaggt     93000
     tggccaggct gacctggccc gcttcgtcga cgaacagata gtcgaacgcc tgctcgaact     93060
     cggggcgggc gaacagccac gcggtgccgg ccaccagttg gtggcgcgcc ggatcgacgt     93120
     ccttgttgtc gaacacatcc tcgatctgcc tgccgcccag gcagctgtcg tcgccggcgc     93180
     tggcggactt cttggcgccg cgcaaggcaa agccttcccg ctcggccagc cgctccaggc     93240
     cgcgcagcag attgttgatg gcgtggtggc tgttggacga cacggccacg cgccggccgg     93300
     cgcgcagcag ctgcagcagc acccgcgaac cggtgtaggt cttgccggcg ccgggcggcc     93360
     cttgcaggaa caaggtggtt tcgtccatgc gcgccacgac atccagcacc tggggcaaca     93420
     gctcggcgtg cggcgcaacc agcggcgcgc cgcgcgccag accgcggatg cgcgggggct     93480
     cgcggcgcag cagcgcgtcc acggcgcgca tcggcgtgga catgccgtcc ggcgcccggc     93540
     acaccgcgtc gccgtagcgg aacaccgcgt tgaccagctc cttgctgttg accggcgccg     93600
     cgggccccag cgccatgcgc ggcggcggcg cgggtttgcg cgcgctgcag gtgaagctgg     93660
     ccaggcgcgc gtgcgggtcg accaccaggt tggccaggct ggcgccggtg cgcacgtcgg     93720
     tgcagcgcgc gccggtgcgc agcttggttt cctgcgcggg atagcggtag gtatagcgca     93780
     acgactgcgc ctgccgcacg ggcggcgccg cgtcgtcgcg caccagcccg cccaggcatt     93840
     cggcgtcctc gatcagctcg ccgtcggtgg cttcgccgcg ggcgaaccag gcccaccagg     93900
     cgggcttctg ttcgcgccgg tggaagtcca gcaggtgcca cgccaacgcc cggaacgcgt     93960
     cgcgcggcga ccaggcggct tcgtcggccg gcagatcgtc ggccagcgcg gcccggtagg     94020
     gcagcaggcg gcgctcggcc tcggtcatct cgccgatgac cgcccgcgcg gcatcgaggt     94080
     cctgctggtc ggcctcgttg tgccacggca ggccggcggg gcggatgccg cacagccagt     94140
     cccgcaggcg ccaggtggag accacgtcgt cgcggttgta gtcggcgatg tcctgcagca     94200
     ggcgcggctc gccggcggct ttccagcgct cgtagtacac gatgctggcg ccggcattgg     94260
     tgacctcgcc cgcgcgccgc ggcaggtaga agcgctcgac gtacttgatc gaatagctgg     94320
     gctcggagat gcgcagccct tcgcgcacga cacggtacag gtccaccagc ttgccggcgc     94380
     gcagcaggtg gtcgacctcc gcttcccggg tgccgtgcag cgacatcagc ttcttcaagg     94440
     ccgtggcctc gtacggcgca tagtgataga tgtgcgcatc ggggtggcgc cgcagccgtt     94500
     cggccacgaa atccatgaag gcttcgaacg cctgcctttc ctggcgccgg tcgtgggccc     94560
     agaacggcac gaagcgttcg gcaccgtcgt cgacgacata caggccgaac aggtactcga     94620
     ggccgccgtc ctcgagcgga tcgccctcca tgtcgaagaa catgtcgccg gggtccgggc     94680
     ggggcaggcg cgccaggccg cgcggtccct cgtcctgcgc cgccagcagc tcgtagtggc     94740
     gcgcgccatc gacgcgggca cgccattgca gggcggcctg cgcgcgcagc cgctgcagcg     94800
     tgccggcctc gatgccggcc acctgcgcgt gctcgggcag ggcgccgagc tgcgccagcg     94860
     tggccacgcc ctgggcgttc aggcgccggg cctgctggcg cgacatgccg gccaccagcg     94920
     aaagatggtc gtcggcgacg cggcgcgctt cgcagcccac gcgccagcgg cactgcgggc     94980
     aatgctcgca gggctcggga taggtcggtg gcgccggctc ggcggcgatc gcggcctcga     95040
     agcgccgcag gacctgccgc aggtaatggg cgtagtcggc cacgcgcagc gccagctcgc     95100
     ggccgctgcc cagcaccaca tgcatgctgc gcggcgcgac gccttgcgca tgctccagca     95160
     accaggcgta gaacgacagc tgcagcacga agctggcgcg cgggctgcgc gccagcttcg     95220
     tgtccagcgc ctcgtagccg tagtcgccca gcgccgatgg gcactcggtg cgcaacagga     95280
     aatcggcatg ccccacgtag gggccgtgac agagcgcggc ctggtagatg accggggcgc     95340
     ccgcggccat cgccgcgcgc gtggcggcca gccgcgccgc caggtccggg ccggcgcgcg     95400
     tgacgtcggc caggtcgggg tggcgggcgc gcaggcgctc cagccaggcc tgctcgtgcg     95460
     cctggccctt ggcctgcacc agcgccatct gttcgtcggc ggccgccgcc ggcgcctggc     95520
     ccgcgttgag cgcgcgcagg tccagctggg tgaggtgttc gcaggccagg aaacccacca     95580
     ggtccgaggc ggcgtagcgc cgcgttgcgc cgagctgctg catggcgggt tcagtcttcc     95640
     tgcagggccg cgaagcgctc ggccaggaaa tcgaccaggg tgcgcaccga cgacagcagg     95700
     ccgcgccgcg acggaaatac cgcgtggatc aattcgcggc acggcgccca ttcgggcaac     95760
     aggcgcacca gggtgccgtc ggccagctgg ccgcgcacca tcatcgaggg cagctgcacc     95820
     acgcccacgc cggccaccgc cgcgctgcgc agcgccagca tgtcggtggt gaccatgcgc     95880
     ggggccaggg gcaccgtggc ttgcgcgtct tgcgggccgg tcagcagcca gctgtgcggc     95940
     tggttcggct ggcccagcgc caggctgggc caggcggcca ggtccgcggg cagggcgggc     96000
     gcgccatggc gcgcgagcag ggcgggactg gccaccaggc attggccgcg gtcggcgaac     96060
     gggcgcatga ccaggtcgct gttctccagc ggcggcggac gcacacggat cgccacgtcc     96120
     acgccttcgc ccagcacgtc gacgcggcgg ttgctggcgt ccaggtgcag ggtgacgcgc     96180
     ggatagcgca gcatgaattc gcccagcatg gcgccgacat gggtgtgcag cagggccacg     96240
     ggacaggaca gccgcaccac gccgcgcggc tcgacctggg ccgcgtcgat cgcctcctgg     96300
     gcggcctcgg cctccaccag catggccttg cagtgttcgt aataggtctg gccgatgtcg     96360
     gtgacggaga agtggcgcgt cgagcgctgg atcaggcgca cgcccaggcg ctcttcgagc     96420
     acggcgatgc gccggctcag cttggatttc ggcatcccca gggcgcggcc ggccggcgcg     96480
     aagcctcggt gatcgaccgt ctgtacgaaa taatagaggt cgttgagatc ctgcatggac     96540
     gcccctcgat agttctgaaa ataggacagc gcggcccgga atcgcagtct acccgcattt     96600
     tcgcttcggc agcatgctgg cgagtgcctg ctgctatgct gcctggcggg gcagcgacac     96660
     gcgaggattc gaacatggcc agactccaca tcatcatctg cagcacgcgg cccgggcggg     96720
     tcgggccggc cgtggccgac tggttccacg cccaggccct ggcgcatggc ggcttcgagg     96780
     tggcgctggt agatctggcg caggtcgggc tgccgctcta cgacgagccg cgccacccca     96840
     tgctgcagca atacgaacat gcgcacacgc gcgcctggag ccgcagcgtg gccagcgccg     96900
     acgcgttcgt gttcgtcacg ccggaataca actacgggcc gccgccggcg ctggtcaatg     96960
     ccctgaacta tgtctacaaa gagtggaact acaagccggc ggcgttcgtc agctatggcg     97020
     gcgtctccgg cggcatgcgc gccgtgcagg ccgagaagca gaccctgacg accttgcgca     97080
     tggtgcccat cttcgaatac gtggccatcc cgatggtggc cgagcgcctg gacgcggccg     97140
     gccgcttcca gccccaaccc atccacgaca gcatggccca gggcctgctg accgaactgc     97200
     gccggttcag cgacgccttg caggtgttgc gcgaaccggc ctccacgcca tgattccgga     97260
     ccccgccacg gccccctcca tgaaccctac gcaaaccacg aaccccatgc gccccttccg     97320
     ctcggtgctg tacacccccg gcgccaacgc gcgcgcgctg gcgcgcgccc gcgaactcga     97380
     cgccgatgcg ctgatcctcg acctggaaga cgcggtcgcg gtgtcggcca aggaagaggc     97440
     gcgcgtccag gtgacgcacg ccttgcgcga gggcggcttc ggacggcgca gcgtcatcgt     97500
     gcgcgtcaat ggcctggaca cgccctgggg cgaggacgat gtgcgggcgc tggcgccgct     97560
     gggtccgcat gcgatgctgc tgcccaaggt cgaacatccc gcgcagctgg cgcgcgccgc     97620
     cgcgctggcg gccgaggccg gcgcgccggg cctggcatgg tgggccatga tcgaaacgcc     97680
     gctggccatc ctcaatatcg gcgccatcgc cgctgcgggc cctggtggcg ggcacgtcgg     97740
     acctggtcaa ggcgctgcat gcgcgccaca cgccggggcg cgccgaagtc caggcggcgc     97800
     tgtcgatgac ggtgctggcc gcgcgcgcgc atggactgct ggcgctggac ggcgtgcacc     97860
     tggacctggc cgacgccgaa ggcctgcgcc acgcctgccg gcagggccgc gacctgggct     97920
     tcgacggcaa gacgctgatc catccgcgcc agatcgacag cgccaacgcc gccttcggac     97980
     cgtcggaagc cgaggtcgtg cgcgcgcacg ccatcatggc ggcctggcag gacgcgcagg     98040
     cgcgcggcgc gggcgtgacc gtggtcgacg gcatgctggt ggaagcgctg cacgtcgagg     98100
     acgcgcagcg cgtgctggcg ctggcccagg ccatcgccgc ggactgagtc cctcgcgcgt     98160
     tcagggccgg aagatatccg gcggcatgcg ctcgaccaga taggcgcggc gggcatccgc     98220
     gcgcagtagg gaaggggcgg ggcggctcag cgcgccagcg ggcgcgtcga accgcggatg     98280
     gccagcgtgg cgggaaagcg cgaggcggtc gcgtgcgccg ggtcggcggc ggccggcacg     98340
     gcctcgccct ggatgcgcgc cagcagcaga ttgatggcgt aggcgcccag gggatagacc     98400
     ggcggcgaca ccgtggtcag gccatcgccc accagttcga accagtcggg gtcgccatag     98460
     ccgaccaccg acacatcggc cgggcaagac aggcccaggc cgcgcagcgc cttgagcgcg     98520
     ccgacggtca ggcgcgagct gccgatgatc agcgcggtgg gcggcttggg gccgctcatc     98580
     aggccgtgca cggcgcgatg ggcgaactcg acccgcggcg ggccgacggc ggtcaggctg     98640
     gcgtccagcc cggccttgct catggcgctg ctgaaaccgg acaggcggtc ttcgcccagg     98700
     ctcaggtccg tggtggtgcc gacataggcg atgcgccggt ggccgtagtg gatcaggtgc     98760
     tcggcggcgg cgcgcgtggc ggcccgttcg tcgatcacca ccgcttcggc ggccaccgcc     98820
     gcgtgctggc ggatcagctg gatggcgcgc acgcccttga gcagggcgat ggtctcgggc     98880
     ttgggcttga tggtgggcgt gatgatcacg ccggccgcgc gcgacaccac gaacgcgcgc     98940
     aagtcgttga actcgcgctc ggggttgtcc tcggtgatgc tcagcgccag ctggaagccg     99000
     cgcgccaccg ccgcgtcggc cacgatcttg gccacggccg cgtagaaatc gttctggatg     99060
     tcgggcacga tcagcccgat caccgggctg tgcgccgtgc gcatgttctg cgccgtgccg     99120
     ttgggcacgt agcccatggc ctgcgccgcc tcgcgcacgc tggccttggt ggcggcgctg     99180
     atcttgggat ggtcggccag cgcgcgcgac accgtggcat gcgacagctt caggcgggtc     99240
     gcgatgtcct tgatggtgac gttggtgcgc gccgctatgc cagccatggc tgatcctgtt     99300
     gctggcgccg ctggaacgcc gcgatgtcgg ccgcgcgcgc cagcgccagg tcgatgtcgt     99360
     cgacgccttc gagcagcaac tggcgccggc ccgcgtcgat ctcgaacgga taggcgcggc     99420
     cgtccgggcc gatgacgcgc tggctgacca ggtccacctc gcaggcgcag cccgggtcgg     99480
     ccagcgcctg ggccatcagc gtcgcgacgt cggccgcggg cagggtgatc ggcagcaggc     99540
     cgttcttgag gcagttctcg tggaagatgg ggccatagct ggccgcgacg atggcgcgta     99600
     tgccgtatcc ctggtgcgcc cagaccgcgt gttcgcgcga cgagccgcaa ccgtagttct     99660
     cgcgcgccag cacgatggcc gcgccctggt aggcgggctg gttgagcacg cactcggggc     99720
     ggggctggcc atgttcgtca tagcgccagg cgcccatgaa gccgtcggcc agcccgtcgc     99780
     gttcgacggt taccagccag cgctgcggga tgatcgcgtc ggtgtcgacg tggtcctggt     99840
     tcatgggcag gatgatgccg tgggctcgaa tgaaggcttg catattagac cagatccctg     99900
     tgatcgacga tggcgcccgc gatggcggcg gccgcggcgc tggccgggct ggccaggtga     99960
     gtgcgcgcgc ccggcccctg gcggccttcg aagttgcggt tggaggtgga gacgcagcgc    100020
     tggccggccg gcaccttgtc ggcgttcatg cccacgcaca tcgagcagcc cggttcgcgc    100080
     cattcgaagc cggcgtcgag gaacacgcgg tccagcccca gcgcttcggc ggcgcgcttg    100140
     acccgctgcg agcccggcac caccagcgcg cgcacgccgg cggccacgcg ccggccgcgc    100200
     gccaccgccg cggcggcttg caggtcggac agcctgccgt tggtgcatga accgatgaac    100260
     gcccactgca ccggcacgcc cgccagcgga cggcccgccc gcaggcccat gtagtcatag    100320
     gcctgctgca tggcggcgcg ctcgccggcg tcggcggcgg ccggatcagg cagcggttcg    100380
     tgcacgtcca cgacctgggc cgggttcacg ccccaggtca tctgcggcgc ctgcagtccc    100440
     agggtgatcg cgcgctcgga ctcttagcgc gcgccggcgt cgctgcgcag cgcgcgaaac    100500
     gccgccagcg ccgcctcgtc gccacgcacc gcgggggcat ggcggcgcag gtagtccagg    100560
     gtcacgtcgt cgggcgcgat cagcgcggcg cgcgcgccgg cctcgatggc catgttgcac    100620
     aaggtcaggc gttcttccat cgagagcgcc gccaccggct cgccggccag ctccaggaac    100680
     cccacggccg cgccgcgcac gccgagctgg cgcaggacat gcagggtcag gtccttggcg    100740
     ctcaggccgg cgggcagggc gccttgcagc gtcaggcgca tcgcgcgcgg gcggcgcatg    100800
     gccagggtct gggtcgccag cacatgctcg gcctccgagg tgccgatgcc ccaggcccag    100860
     gcgcccagcg cccccagcgt cgaggtgtgg ctgtcgccac aggccaccgt catgcccggc    100920
     agcaccaggc ccagttcggg cgcgatcacg tgcacgatgc cctggtcggg gtcgtccggg    100980
     ccgtagtggc ggatgccggt gcgcgcggcg ttggcggcca gcgcatcgat catcgcctgg    101040
     ctgccgtcca cgtgttcgcc gcgccgcccg ggcgcggtgg agacgatgtg gtcggcgatc    101100
     gccacgttgc gcgccggact gtgcacggtg cggccctgcg cgcgcagcgc ggagaaggcc    101160
     tgcgggttgg aaagatcgtg cagcaggtgc cggtcgatgt ggatcaggct gcggccgtcg    101220
     ggcaggtcgg ccacgtggtg gctgtcccac aggcggtcga acagggtgcg cggcggcgca    101280
     ctggcggcgc cggacggggt ggacggggtc attctgcctc cttggtgcac acgtatgaaa    101340
     ttttcatcgt ggcagtatgt atcgggtaaa ccagtatgtt ctgttgtatt gacgccctaa    101400
     ctctggctaa ttgtagttcg attagtgcaa acgtgtgcac taagaaaaac atcgtagcgc    101460
     cgacacagcg aggagacaac catgaatagc atcaagcgag tacgcggcaa gaccgccgcc    101520
     ttgttcgcgg cgctgggcct gtgggccgcg gccgtgcccg cggcaggcgc ggcgaccccg    101580
     tatcccgagc gcccgatccg gctcatcgtg ccgttcggcg cgggcggcac caccgacatc    101640
     ctcggccgcg tgctgggcca gcaactgggc gaggccctca agcagaccgt catcgtggag    101700
     aaccgccccg gcgccaacgg caacatcggc agcgacgccg tggccaaggc cgcgcccgac    101760
     ggctatacgc tgctgttcgc cgccgacgcc accctggtca tcaaccccac gctgtacagc    101820
     cagttgccat tcaagcccga aagcgacttc gcgcccatct cgcgcatcgc ggtcgtgccc    101880
     ctggtgctgg tcgccaaccc cgcggtcaag gccgacacgc tgcccgaact ggtgaagctg    101940
     ggcggcaagc ccgacgcgcg cctggacttc ggcagcgccg gcgcgggcag catgggccac    102000
     ctggtgggcg agcgcctgaa ccgcgccact ggcatgagca tgacgcacat tccctacaag    102060
     agcggcgccc aggccatctc cgatgtggtg tccggccaga tcccgctgct gatcaccggc    102120
     ctggcggtgg ccgagccgtt cctgcgcgac ggcaagctga aagccatcgc ggtgacctcg    102180
     ggacagcgtt ttcccggcgc gcccaaggtg cccaccatcg ccgaaggcgg cgtgaaggac    102240
     ttcgattcgc ccagctggta tggcctgctg gcgccggccg gcacgcccgc gcccgtgctg    102300
     gagaagatcc acgccgccct ggccagcgcc ttgcagaccg aagacatgaa gaaacgcatg    102360
     gtggagctgg gcgcttggcc cgtggtcgat acccaggcgg cgttcgccga actcatcaag    102420
     gccgatacgc agcgctggtc gcagatcatc caagccgccg gcatcaccgt ccagtaaccc    102480
     ttcctatcca gtatccatgc gcatcaccgc catacgagaa atcgccgttc ccctgcaggg    102540
     caacatctcc aactcgctgg tcagtttcgc cgagcacacg gtctcgctgg tcgccctggt    102600
     cagcgacgtc gtgcgcgacg gccggccgct catcggctac gccttcgatt cgatcggccg    102660
     ctacgcccag cccgggctga tgcgcgagcg cttcatcccg cgcctgctgc aggccgcgcc    102720
     gcacgagctg ctcgatgacg gcgggcaggc gttcgacccg gcgcgcgcca gcgccatcat    102780
     gctgcgcaac gagaaaccgg gcgggcacgg cgaccgggcg gcggccgtgg gcgcgctgga    102840
     actggcgttc tgggacctga acgccaagct gcgcgacgag cccgcctatt gcaccatcgc    102900
     gcgccacgtc ggacggccgg cgcaagccgg cgccacccag gtctatgcgg ccggcggcta    102960
     ctactacgac agcggcgatc cgctgcagcg gctgcgcgac gagttccgcg gctatctcga    103020
     ccagggcttc gtcaagttca agatgaagat cggcggcgcc tcgctggccg acgacctggc    103080
     ccgcatcgag gccgcgctcg gcgtggcggg cgagggcgcc aacctggcgg tcgacgccaa    103140
     cggacgcttc gacctggata ccgcgctggc ctatgcgcgc gcgctcgagc cctatggctt    103200
     gcgctggtac gaggaaatcg gcgacccgct cgattaccac ctgaacagcc tggtggcgca    103260
     ggcctacgcg ggcaccatcg ccaccggcga gaacctgttc tcgctgcccg acgtcaggaa    103320
     cctgctgcat ttcgccggcg tgcggcccgg ccgcgatatc ctgcagatgg acccggggct    103380
     gtcgtacggc ttgaccgagt acctgcgcat gatggcggcg gtcgaggcgg ccggcttcgg    103440
     gcgctcctgc ctgcacccgc atggcggcca cctgatcaac ctgcacatcg ccgccggatt    103500
     ggggctgggc ggctgcgagg cctatccggg cgtattccag cccttcggcg gctaccccgc    103560
     ggcgtgcgca ttgggcgcag gccaggtgcg gccgaccgac gcgccgggct tcgggctgga    103620
     acagaaacaa gaattggcgc cgtacatctc cgtactggcg cacggcaagg cgtaaggaag    103680
     aaatcatgaa gattgcaatt atgggatgcg gtgcgatggg ctcggtgtac gccggcctgc    103740
     tggcggccaa cggccatgag gtcatcgtcg tcgaccgctg ggccgaacac gtccaggcca    103800
     tgtccgaaca gggcctgcgc gtcgaaggcg ccagcggcga ccgcgtggcg cgcctgcggg    103860
     cctaccggga ggccccggcc gaacccgtgg acctgatcat catcgcggtc aaggcggccc    103920
     aggccggcag cgccgcggcg caggcgcgcg ccatgctcgg tcccgacacc ctggtgctga    103980
     ccatccagaa cggcctgggc agcgccgaca gcgtggccga ggccatcggc gccgagcgcc    104040
     tggccgtggg catcgcggcg gccttcggcg cctcgctgag cggtccgggc catgtccacc    104100
     acaacggcat gtcggcggtg cgcatgggcg cctacgccgg cctcggcgcc gagaagctgg    104160
     atggcatcgc cgaagtgtgg cgcggcgcgg gcttcacaac gcgcaggcgg tcgacaacct    104220
     gccggccatg caatgggaaa agctgatctg caacgtcgcc tacagcgcgc cgtgcacgct    104280
     gaccggcctg accatcggcg aagtgctgga tgctccgcat gccagcgcgg tcagccaggc    104340
     cgccgccacc gaagcctgga acgtcgcgcg cgcgctgggc gtgccggtcg ccgtggaaga    104400
     cccggtggcg catgtgcgcg cattcggcga acgcatccgc ggcgccaagc cgtcggtcat    104460
     gctggaccac gaacagcggc gcgtcagcga aatcgactac atcaacggcg ccatccccag    104520
     gcaggcggcc cgcgccggca tccaggcccc ggtcaaccag acccttaccg cgctggtcaa    104580
     gcagcgcgag gaggcgtgga agtagcccgt cgcccgcgct gcctgtccct gcggggacag    104640
     ataccgtctt ggcaggctag cgttcatggc gtacggcagt gtgcctgtcc ccgcggggac    104700
     aggcaccccg gattcagcgc gagccagtcc ccatgcgggg acaggcacgc gggaagcagg    104760
     cttaggcttc cgacacgggc cccggcgtgt agctcgcgcc gccgcgcggc gtcttgtcgc    104820
     cgatccaggc ctggacctcg atctccacgt ccacttccat ggccagcttg gcttcgacgg    104880
     tgctgcggca cgggaagccg tcctggaagt gctgtttgta ggcgtcgttg aaatcggcga    104940
     acagcgccag atcggacagc cacaccgtca ccttcaccac gtcctgcaga ccggcgccgg    105000
     ccagcgccag cgtttcgcgt atgcgggcga tggcggcgtc ggtctgggcg cggatatcgc    105060
     cgcgcaccac ctggccgttg gcgtccatcg gaatctggcc ggacaggaac aggaagccgc    105120
     cggcgatggt cgcgcgcgaa aagggcaggg gcagggggct ggcaatgcgg gtgatggcag    105180
     acatgtgggt ttccttctgc aaagcatgaa aaagtccgaa gcagccattc tcggggcgat    105240
     ggcgcggcag ggcaagccga cgcgccgttc agcgcccggg cggcgcaatg ctttgcctta    105300
     cggcctgtcg agcaggcgca gcccgccgtc gccggtcagt tcgatgtatt gcgtgttgcg    105360
     gtacgcgccc gaaccggcgg tttcgctgac cagtcgcagc acgcgcttgc cctggcgttc    105420
     gtccagcgcc cattccacca gcacgccgtc gcgcgcgatg gccagcccgg cgcgaaaggc    105480
     gccggcgtcc aggtcgtcgt agcggttgac gacgtacgag ccgatcgaag ccggctcgca    105540
     ggcgccgttg ctgacgacga ccgcgccgcc gctcgacagc ggcgcgctga cggcctgtgc    105600
     ggcgggcggg cagggcgcgg cgcccgatgg cgcggccagc acaggcgcgg caggaacggc    105660
     cagcaggacg gccaggcagg ccagggcaag gcgtggacgg caagacggca tggcggctat    105720
     tcctcggaca gggcggcagg cgccggcccc gccactgtat gggctgggcg gcaatggcgc    105780
     aagcgcgcgt cagcgcacca ccgtgtcggc caccaatcgc aggccgcggc tgcccaccgc    105840
     cacgccgcgc agcacgccga ccaggtcgcc aggccgggcc tcggcggcgc cggcgcggct    105900
     cacgcggatt tccacgtcca ccgtgctcgc ctgggccagc gtggccgccg gcgacatggc    105960
     ctgggcgcgg tcgagggtga agtccagcgg cagctcgcgt acctgcttgc gcaggatggc    106020
     cagcggcatg cgcccgccgt cggccgggcg cgccaggatg aacacggtat cggtatcggc    106080
     cacctgcgcg cgcagcgccg cggcgatcga cgcatggccg gccaggctgt ccggcgccgc    106140
     cgcctgcggc gcgggcgcgg gcggcgcgcc cgtggccatg gcgcgcgcct gcgcgatgtt    106200
     gttgtcgatc tgcgcggcgg ccggcgaatc gggcggcagc agcgtcttga ggcgctgcca    106260
     gtgcgccagg gcctgcgccg cgtcgccgcg ccgcaaggcc gccatgcctg ccaacgccag    106320
     cgccttgggc tggtcgggct gcaaggccag cgcctgggcg atgacgcgct cggacttggc    106380
     gtcgggcgcg ccgccattgg ccgacagcaa ggcgtcggcc aggtcggcca gcagcgccgg    106440
     ctggtccggc accaggcgca cggtttccat ataggcggcg accgcgtcgt catagcgccc    106500
     cagcgtctcg tacgagcgcg ccagcatgta ccagccctcg gcgtcgtcgg gctggcggcg    106560
     caggcgctcg gccagcgcgc cgatggcctg ggtcatgtcc tgcgcggcat cctcggcgtg    106620
     ggcgtcctgc ggcgcggcca gcatcatcga ggcggccgcg cgcgggtcgc ccagatgctg    106680
     gtacagcagc atggccgcga ccggcacggc cacgctcagc gcgcaggccg ccgccaggct    106740
     ggcgcgccgc gccggcgcgg gcgcggtgtc gcggcgcgcg tccagggcct gcagcaattc    106800
     gcgctgcagt tcttcctcgg cgcgcgcatg ggcctgggcg gtcaaggcgc cctcgcgcag    106860
     ttcgcgctgc agctgcgcgc gctgcgcctg gtagaaggcg cgcaccgtgg ccgccgcgtc    106920
     ggccgggccg gccgcgcgct cgcggcgcag catgggcagg atcagcgccg ccagcgtggc    106980
     cagcagcaac agcagcacga tcagccacag cgcggtcatg attcctcgtc cagaaagcgt    107040
     tcggcgcggg cgcgctgcgc gtcggtcagc ggcgccgcgc cggggcggcg cgccagcgcg    107100
     cgccacagga ccacgaagcc ggccagcagc agggcgaacg gccccagcca cagcagccag    107160
     gtcgccggct tgaagggcgg ctcgtagcgc acgaaatcgc cgtagcggtc ctcgaagaac    107220
     tgcatcactt cctcgtcgct gcggccatcg gccagctgct ggcggatcag ggcgcgcata    107280
     tcgtgcgcca gcggcgcgtt ggattcggcc agggtctggt tctggcagac caggcagcgc    107340
     agcgagtgcg ccaggcgcag ctcgcgctgc gcgatatcgg ccgccgccgg ggcgcccagc    107400
     agcagccaca accccagcag cagggccgcg cgcctcatcg caggccctcg atgacgggca    107460
     gcaggcgctc gcgccagatc tgcggcgtca acacgccgag ctggcggtag cggatgcggc    107520
     cggccccgtc gatgacaaag gtttccggca cgccatagac gccgtactcg atgccgacgc    107580
     ggccgtccac gtcgctggcc gaggccacgt acggattgcc gtggcgggcc agccaggcgc    107640
     gcgcgtcctc gggcttgtcc ttgtagttga gcccgtagat gggcaccgcg tcgcgcggtc    107700
     cgacttcctg cagcaagggc agctcttcgc ggcagggcgc gcaccaggaa gcccagacgt    107760
     tgagcaccca gacgcgcccg cgcagctggg cgacttccag ccgccgcccg tcgccttgca    107820
     gcagcggcag gccgatgggc ggggccggct tgtccagcat ggccgagggc agggcgcgcg    107880
     ggtcgcgccc caggcccagc gccaggaacg cggccatggc cagaaaggcc gccagcggca    107940
     acaggtagcg cagcatcagc cggcctcccg cgccaccgcc gtcaccgctt ggcgcgcttc    108000
     ggcggcgcgc cactggcggt agcgccggtc ggttgccgcc atcaggccgc ccagcgccat    108060
     cagcacgcaa cccgaccaga tccaggccat gaagggcttg acctgcagcc gcaccgtcca    108120
     ggcccgctgg ccgaccggct cgcccagcgc cacgaacagg tcacgggtaa agcgggtgtc    108180
     gatggcggca tggctgagcg gcatgccctg caccgtgtag tggcgtttct cgggatgcag    108240
     cgtgaccacc ggccggccgt cgcgcgtgac cacgaagcgg gcgcgttcgg cctggtagtt    108300
     ggggccggcg gccggcgcga taccggcgaa ggtgaactgg tagccgccgg cggcctgcgt    108360
     ggcgccgatg tccatgcgca attcctgctt gtcctcatag ccattggcca gcgtcacgcc    108420
     ggcgatgaac acgcccacgc cggcgtgcgc cagcagcatg ccgtaccagg cgcgcggctg    108480
     gcggcgcagg cgccgcgccc acgagccttc gccgtcggcc aggcgctgcc aggcatgcgc    108540
     ggcggcgctg gcgaccgacc aggccgccag ccacaggccc aatacgatca gcggcgagcc    108600
     tggccaggcg cgcgcgccgg gccaggccag cggcaccgtc agcgcggtgg ccaggctcac    108660
     gccgaaggca atgcgcaggc gctgcgccag gtccggcacg gcgctgtgct tccagcgcgc    108720
     catcggtccc acgcccatca ggaagatcgc cggcgtcatc agcggcacga acaccgcctc    108780
     gaagtagggc gggccgatcg agatcttgcc ccagtccagc acgtccagcg ccaccgggta    108840
     cagcgtgccc agcagcaccg cgccggtagc cgcggccagc accacgttgt tgctgagcag    108900
     cagcgattcg cgcgacagca gggcgaagcc cccgccaagg cctacggtgg gcgcgcgcca    108960
     ggcgtacagg gccagcgagc cgcccacgat cagcgtcatg aagcccagga tgtacagccc    109020
     gcggccggga tcgaccgcga aggcgtgcac cgaggtcagc acgccggagc gcaccaggaa    109080
     agtacccagt atgctcagcg agaacgccgc gatggccagc agcaccgtcc agctgcggaa    109140
     ggcgccgcgc cgctccgtga cgatcaggga atggatcagc gccgtgccgg ccagccacgg    109200
     catgaacgag gcgttctcga ccggatccca gaaccaccag ccgccccagc ccaggacgta    109260
     gtaggcccag gcgctgccca gcaggatgcc gatggtcagg aacatccagg ccagcaaggt    109320
     ccagggccgc acccagcgcg cccagatggc gtccagctcg cccgacagca gcgcggcgat    109380
     ggcgaaggcg aacgccaccg aaaagcccac atagcccatg tacagcatgg gcggatgcac    109440
     gatcatgccc ggatcctgca gcaaggggtt caagtcgcgt ccggcctgcg ccggcggcat    109500
     caggcgctcg aacggattgg acaggaacag caggaacagc aggaagccga tgctgatcca    109560
     ggccatgacg gccagcacgc gcgccgcgaa ggccggcggc agcgcgcggc tgtgcagcgc    109620
     caccgccagc gtccaggcgg tcagcaggta cagccacagc agcagcgatc cctcgtggcc    109680
     gccccatagc gccgcgaagc ggtaggcggc gggcaggtcg gcgtgcgagt tgcccgccac    109740
     atacagcacc gagaaatcgt tgtccaggaa cgaccacgcc aggcagccca tggccacggt    109800
     gaccaggcag aattgggtga cggcggccgg ccgcgccacc cgcaggccgg cctgccagcc    109860
     ggtcgatgcg cccaccagcg gcagcacgcc ctgcacgatg gcaaccagca acgccaggat    109920
     gaggctgaac aggccgattt ccgggatcat cgcgcctccg tctgcaaggt ggcgctcggc    109980
     agggcgcccg cctgcctgag tgcgtcggcg gcctgcggcg gcatgtagtt ctcgttgtgc    110040
     ttggccagca cctcggtggc gcggaacacg ccgtcggcgc ccatggtgcc cgccaccacc    110100
     acgcccttgc cttcgcgaaa cagcgccggc agcagcccgg tataggccac cggcacctcg    110160
     cgcaccgtat cggtgacgac gaaacgcagg gtcaggccgt cggcggcgcg ttcgaccgag    110220
     ccggcgcgca ccaggccgcc gacgcggaag ctgccgctgg acggcgcctc gtgcgcgtgc    110280
     acctgcgtgg gactgaaaaa gaacaccagg ttcgaacgca gcgcattgag caccagcgcg    110340
     gcggccagcg ccagcaggcc cacgccgccg gcgatcagca gcgcgcggcg gcctctacgc    110400
     gtcgtcatcg tcgcctccgg tgggcgggcg ccgcgcggcg cgccacagca cggccagttc    110460
     gaccgcgatc aacagcgcgg cgccgccata ggcggccagg atataggggc tgtgcccctg    110520
     cagggaaaac agcgcgtccc agctcatgag ccctcccgcg acaaggggcc gccggccgcc    110580
     gcggccggtt cgcggccggc gatgacgacg cgcacgcgcg ccagcgccac ggcggcgctg    110640
     taggcccaga acgccgccac catcaacagg gtggccgcca ccatgatgcg cgccatgctg    110700
     ggcgcggcgg tcagcgaaat cgaggcgccc tggtgcaggg tgttccacca ggtcacagag    110760
     aaatagatga tgggtatgtt gatcacgccc accagcagca ggatggcgcc gcctcggtcg    110820
     gcgcgccgcg tgtcgccggc ggccgcctgc agcgccatga agcccaggta gagaaacagc    110880
     aggatcagct cggaggtcag gcgcgcgtcc cagacccacc aggcgcccca ggtcggcttg    110940
     ccccacaagg ccccggtcca caaggttgcg gcggtgaaga gcgcgccggt gggcgccagc    111000
     gcccgcatca tcatgaacga cagccgcgtg ttgtagacca gccccagcgc ggcatagccg    111060
     gccatgacca ggtacaggaa catcgacatc caggccgctg ccacgtgcac gaacaggatg    111120
     cggtagacct cgccttgctg gctgtcgacc ggcgccaccg ccagccccag gtagagtccg    111180
     gcggccgcca gcagcgcggc cagcgcgccc aggcgcggcg cccagcggcc ggccatgggg    111240
     tagaagacgg cgggcgaggc atagcgcagc cagccgcgac cgccggcggg gcggtcgcgc    111300
     acgggcaggg cggccgatga tttcgacatg gcgggcttac tccaacgcca cgcgcagcgc    111360
     cgccgaggcg ctccacgggc acaacaggat cgccaggcac aggcatgcgc ccagcaggga    111420
     caattgcggc caggcgccca ggccggacgc ggtggcggcc acggcgccgc tgccgaagat    111480
     cagcaccggc acgtacagcg gcagcaccac cagcggcagc agggcgccgc cgcgcaggcc    111540
     cagcgtcagg gccgcgccca gcccgcctat caaggccagc gtgggcgtac ccagcagcag    111600
     cgacagcgcc agcacgccga ccgcctgggc cgacaacccg aactgcagcg ccaggaaagg    111660
     gctggccagg atcagcgggg cgcaggtggc cagccagtgc gccgccagct tcaggccgac    111720
     cagcaccggc aggggatggg gcgagaccag caattgctcc agggcgccgc tgccgtggtc    111780
     gtggacgaag ggctgctgca gcgaaagcag gatcgctagc agggccgaca cccacagcac    111840
     gcccgggccg atggcggcca gcagctgcgg atccggaccc agcgccaagg gaaacagcgt    111900
     gcccgccacc acgaaaaaca gcgtggcgcc cagcgtatcg gccggcctgc gccaggccag    111960
     ccggagctca cgccaggcaa tctgcgccaa cgacttcagc atgcgcgtat tcgtccagtt    112020
     ccagggtttg cgtacaaccg gcccaggcgc cgccgccgcg atgcgaagcc agcacggccg    112080
     cgccgccgcc ggccaggtgt gcgtccagca tgccgtgcag ccgctgcagg ctggcggcgt    112140
     ccaggccggc gtcgggctcg tcgagcagcc acagccgttt gcgcgacagc atcacgcgcg    112200
     ccagcgccag ccggcggccc tggccctgcg acaggcgcgc ggccggcgcg tcggcgccgg    112260
     cggccaggcc ccagtcccgc aaggcccgct ccagttccgg ctcggcgcgc ggggcgccgg    112320
     ccacgtgcag cgcgtagcgc aggttctcgc gcgcggtcaa cgcatcgctg cagccattgt    112380
     cgtggcccag gtgcgccatg tgcaggtagt agccgggcag gtcggcatgg atgtcggcgc    112440
     cgttccagcg cacctcgccg cgccgcggcc gcagcagtcc ggccagcgtg cgcagcaggc    112500
     tggtcttgcc gctgccgttg gcgccgcgca catgcaccag ctgccccggg cgcaggttca    112560
     ggtccagcgg ccggcggccg ccgcgccgtc ccaccaggcc gtgcgcggcc agcagggcgg    112620
     gcgcggcctc agcgttctgc atggccggta tccgcgcgcg ccgggcctgc cgcgggcggc    112680
     gccagcgagg tctggtccgg cggcatcctc ggcagcgtgt gggcgatgcc cttgtggcaa    112740
     tcgatgcagg tcttgctctt gtccgccaga taggtcgagt gcatgttctg cgcgcgcatg    112800
     ctctggcgcg tgaagtccat cgattcgtag ttgtggcagt tgcggcactc gagcgagtcg    112860
     ttggccttca ggcgcgccca ttcgtgctgg gccagctcca gccgcttctc gacgaacttc    112920
     tcgcgcgtat tgatggtgcc gaagatcttg ccccagactt ccttggaggc ctgcgtcttg    112980
     cgggcgatct tgtcggtcca gttgtgcggc acgtggcagt ccgagcagat ggcgcgcacg    113040
     cccgagcggt tggtgtagtg gatggtgccc ttgagctcgg catacacgtt gtcgcgcatc    113100
     tcgtggcagc cggtacagaa ctgctcggtg ttggtcagct ccatggcggt gttgaaggcg    113160
     ccccagaaca ggatgccgcc gacgaagccg ccgacggtca gaaagcccag gctgaaatgc    113220
     acgctggggc ggcggatgat gtcccaatag cgcttgatga gttctctcat ggctggcacc    113280
     cgcccgtcat ttctggtccg gtttcggcgc cgtcaggcgc ttgaggatca cgtcgatatc    113340
     ctggaaggta ttggacacca acgggcgcgc ttcggcctgc ggcacgtggc attgcacaca    113400
     gaaatagcgg cgcggcgaca cctcggccag cacgttgctg tcgcggtcca tgtagtgggt    113460
     cacgctcagc ggcggcgcct gcgtctcctc ggtgttcacg cgcgcatggc aggccaggca    113520
     gcggttgaaa ttcttgtcga tctggtagcc gtcgatcttg tgcggaatgg tcggcggctg    113580
     catggagtag gtccgcacgc ggcggatatc cttgttctcg accgggctca tcagcggcgg    113640
     attggtctcg tcggccaccg gcgtgggccc gcgcatgggg tcctgcagcg gcaggggcgg    113700
     cgcggcccag gcggcagcgc ccagcgcgac ggacaggacg atggcggcgg tgcgtaagct    113760
     catggctgtc tccctgtcct ggtcagacct tcacgatctt gaccgcgcat ttcttgaagt    113820
     cggtctggaa cgagatcggg tcggtggcgt ccagcgtgac cttgttgatc agctggccgg    113880
     cgtcgaacca tggcacgaac accaggccgc gcggcggctt gtcgcgtccg cgcgtctcca    113940
     cgcgggtgcg catcttgccg cgccgcgaca ccacctcgac ctcgacgccg cgccgcacgc    114000
     ccagcgcctg ggcgtcgtcg gggtgcatga aacagaccgc ctccggaaag gccttgtaca    114060
     gctcgggcac gcgccgcgtc atcgagcccg agtgccagtg ctccagcacg cggccggtcg    114120
     acagccagaa ggggtactcc ttgtccggcg cctcgggcgg cggctcgtag ggcagggcga    114180
     agatcaccgc cttgccgtcg gggttgccgt agaactggaa acccgtgccc ggcttgacgt    114240
     agggatcgga cccttcgcgg tagcgccaca gggtttcctt gccgtcgacc accggccagc    114300
     gcaggccgcg cgccttgtgg tagacgtcga acggcgccag gtcgtggcca tggccgcggc    114360
     cgaactcggc gtattcctcg aacaggccct tctgcaggta gaagccgaag gcctgcgcct    114420
     cctggttggc gtactccggg tccagctcgg tgttggggaa ctggttgacc ttgccgttgg    114480
     cgaacagcac gtcgtagagc gtcttgccgc gatactcggg cttcttggct agcaggtcgg    114540
     ccggccagac ttcctcgacc ttgaagcgct tggagaattc caccagctgc cacaggtccg    114600
     agcgcgcctg gcccggggcg tcgaccagct ggtgccagaa ctgggtgcgc ctttcggcgt    114660
     tgccgtaggc gccttccttc tccacccaca tggccgccgg caggatcagg tcggccgaca    114720
     gggtggtgac cgtcgggtag gcgtcggaca ccacgatgaa gttctcgggg ttgcggtagc    114780
     cgggcaggcc ctcgttcatc aggttggcgg cggcctgcat attgttgttg accatcaccc    114840
     agtaggcgtt gatcttgccg tccttgagca tgcggttctg cagcacggcg tgcgcgccca    114900
     ccttggacgg aatcgtgccg tcgggcagct tccagatctc ctcggcgtgg cggcggtgct    114960
     cggggttggt gaccaccagg tcggccggca ggcggtgcga gaaggtgccc acctcgcgcg    115020
     cggtgccgca ggccgagggc tggccggtca gcgagaacgg gctgttgccc ggggtggaga    115080
     tcttgccggt cagcaaatgg atgttgtaga ccatgttgtt gcaccacacg ccgcgcgtgt    115140
     gctggttgaa acccatggtc cagaacgagg tgacgcgcac cttcgggtcg gcgtacagct    115200
     cggccagctc ctccaggcgg ttcttgggca cgccgctcag cttggcggtg tattccaggt    115260
     cgtacttgga gacgaagcgc gcgaagtcgt cgaaggtgat cggcttggag ccgcccgcgt    115320
     cgccggcgtt cctggccgcc tgctgcagcg ggtgctcggg gcgcaggcca tagccgatat    115380
     cggcgttgcc ctcgcggaac accgtgtgct tgtcgacgaa gtcgcggttg acgcgcttgg    115440
     tccggatgat gtggttggcg atgtagttga ggatcgccag gtcgctttgc ggctcgaacg    115500
     tcagcgtcag gtcggccagc tcgtacgagc ggtgctcgaa ggtcgacagc accgccacct    115560
     tggtggccgg cgcgctcagg cgccggtcgg tgacgcgcgt ccacaggatg gggtgcatct    115620
     ccgccatgtt cgagccccac agcacgaacg cgtcggcgtt ttcgatatcg tcgtaacagc    115680
     ccatcggctc gtcggcgccg aaggtgcgca tgaaacccac cgcggccgag gccatgcagt    115740
     ggcgcgcgtt ggggtcgagg ttgttggtgc gaaagcccgc cttcatcagc ttgagcgcgg    115800
     cgtagccttc ccacacggtc cactggcccg agccgaacat cccgaccgct tccggcccct    115860
     tgtccttgag cacccgcttg aactgctcgg ccatcacgtc gaaggcctgg tcccaggaca    115920
     cgggcgcgaa ctcgccgtcc ttggcgtact tgccgtcctt aatgcgcaac agcggctgcg    115980
     tcaggcgatc gctgccgtac atgatcttgg acaggaaata acccttgacg cagttcaggc    116040
     ccttgttgac ctcggcgttg aagtcgccgt gcgtggccac tacctggttg tccttgacgg    116100
     ccacgttcac gccgcagccg gtgccgcaga atctacaggg cgccttggac cacttgagct    116160
     tggcggcctc ggactcggtc acgatgttct gggtataccc cgtcaacggc accccggcca    116220
     cggtggcggc ggccgcggcg gcggtctgct tgatgaaatc cctacgagcc attgacatcg    116280
     tcaatctcct cgttcatcga gtccaaagta tcgatatgtt gatagaccat cgccgaagcg    116340
     agcacgccgt cctggccctg cacggcggcg atgcgctcca gcatttcgcc tgtgctgtgg    116400
     gcttcgagcg tgacgaccag cttgccggta tcggacaccg catggatttc cgcgccgtgc    116460
     ccggcggcaa gagccagtac gccgccgatg ccgacgtgcg ccgcctctgc cgcaagatgg    116520
     gcatggtgtt ccagtcgttc aacctgtttc cgcacatgac ggtgctgcag aacgtgatcg    116580
     aggcgccggt cacggtcaag ggcctgcgcc gcgacgccgt gatccccaag gccgaagagc    116640
     tgctgcgcaa ggtcggcctg ctggccaagc gcgacaacta ccccggccgg ctctcgggcg    116700
     gccagaagca gcgcgtggcc atcgcccgcg cgctggccat ggagccggac atcatgctgt    116760
     tcgacgagcc cacctcggcg ctcgaccccg agctcacggg cgaagtgctg cgcaccatgc    116820
     gccagctggc cgacgagcac atgaccatgc tggtcgtcac ccacgagatg ggcttcgccc    116880
     gcaaggccgc gcaccgcgtc gtcttcatgg acgaaggccg catcctcgag gaagccgcgt    116940
     ccgaccgctt cttcgacgcg ccgcagcatc cccgcacgcg cgaattcctc gcccacatgc    117000
     tgtaggcccg gcgcacggcc agcgccggcg ggccttactg cttctgcgcc cagcgcccca    117060
     gcgcgccggc caggtcggtg gggaagggga acaccacggt ggaattgttc tgcgcgccga    117120
     tcacggccag cgtgctcaga tagcgcaact gcatcgcctc gggctgctgc gccagcgtgc    117180
     gcgcggcatc cagcagcttc tgcgcggcct gctcctcgcc ctcggcgttg atgaccttgg    117240
     cgcgccgctc gcgttcggcc tcggcctggc gcgcgatcac gcgcaccatg ctttcgttca    117300
     ggtcgatatg cttgatttcc acattggcga ccttgatgcc ccaggcatcg gtctgcgcgt    117360
     cgaggatctc ctggatgtcg atattcagct tgtcgcgctc ggacagcatt tcgtccaggt    117420
     cgtgcttgcc cagcaccgag cgcagcgtgg tctgggccag ctcgctggtg gcctggcgga    117480
     agttctccac ctggatcacc gagcgctccg gatcgatcac ccggaaatag atcaccgcgt    117540
     tgaccttgac cgacacgttg tcgcgcgaga tcacgtcctg gctgggaacg tcgaagacgg    117600
     acgtgcgctg gtcgacccgc accatctgct gcaccacggg gatgatcagg atcaggccgg    117660
     gccccttgac gcccgtgaag cgccccagcg tgaagatcac gccgcgctcg tactcgcgca    117720
     ggatgcgcac ggccagtgcg atcagggcca gcaacagcac gaggatgggg aggtagaaag    117780
     cgaggttcat gaacatggcg cactccggaa ggaaagggta gtcgggggcc gcccgcgggt    117840
     cacgggcggg agggcgcttg cggcgccggc ggctccggcg ccacatgcag cgtcacgccc    117900
     tgcacggcgt ggatcgtcac ggcgtcgccg gcggccaggc cggccgggcc gcgcgcgcgc    117960
     cagcgttcgc cgtcggccgc gacgtaaccc tgatcgtact cccagctcag gacgcggccg    118020
     cgccggccga ccaggccctg cgcgccgctg acctgcggcg cgcgccgcga gcgcagcgcc    118080
     agccgcgcga tcaggaaagt cagccccagg ctggccaccg ccacgccgcc caccagcggc    118140
     agcgacaccg cgtaggcggg cgtatccgcg tcgaccagca tggtcgcgcc cagcacgaac    118200
     gacagcgcgc cgcccacgcc cagcgcgccc agcgagggtg tgaagatctc cgccaccatc    118260
     aacgccgcgc ccagcgcgac caggcccgcg ccggcgtagc tcagcggcag caccgacaag    118320
     gcatacaggc ccagcaacag gcagatggcg ccgagcacgc ccggaaacag cgcgccgggg    118380
     ctcatgaatt cgaagatcag cccgtacacg cccaccatca gcaggatcag cgccagattg    118440
     ggattggtga tcacgcccag caggcgcgta cgccagtcgg gcccgcgctc gaccagcgcc    118500
     aggccgctgg tgtgcagcac gacattggcc gcgcccacgc gcaccgtgcg gccgtcggcc    118560
     tgggcgagga gggcgggggt gtcctcggcc acgatatcga tcacatttcg cgccagcgcc    118620
     tggctggccg acagagacgc cgcctcgcgc accgcctgct cggctcagtc ggcgttgcgg    118680
     ccgcgcagat cggccagcgc gcggatatag gccaccgcgt cgttgatggc cttgtattcg    118740
     gcggcattgc gcggcgtggc cggcttgccg ccatcggccg gcgccttggc gtccgtcttg    118800
     tcgggctctg tcttgtcgtc cgacggcgtg aagccgccgc ccagcgacac cggggtggcc    118860
     gcgcccaggt tggtggccgg cgccatggcc gccacatggc ttgcgtacag gatgtaggtc    118920
     cccgcgctgg ccgcccgggc gccgcccggc gccacatagg ccagcaccgg cacgggcgag    118980
     gccaggatgg cgcggatgat ctcgcgcatc gacgcatctc cagtccgccc ggggtgtcga    119040
     tgcgcagcac gaccagcgca tgctgcgcgg cggcgccggc cagaccgcgc gacacgtagt    119100
     cggcgctggc cggcccgacg atcccgtcca gcgacagcac cacggccgtg cgcggcgccg    119160
     gggcggcact gtcggccgcg cgcgcgccgt cccaggcggc cggcagcagc agggcggcca    119220
     ggcagcccaa caggcgcaat aggtgcaata aatcggcgac cagcctcggg acgcgggcat    119280
     gcatgctcgt atcccccaaa tcgcggtggg cggacgacgg cgggcggcga gcccgcctcg    119340
     ttgggtccag cgtactcctt ttgcgggcgt agttccgttt cacgcccgcc ggtcagcaag    119400
     gcccgtgccc gcgcgcgccg gccgggagcc ggcgccgccg cctcaatacg cctgttcgag    119460
     gatcgccacg atatcggccg gcgaggcgat agggcgcgga ttgctgcgga ccatcatgtt    119520
     ctgcatgccg ccggcggcga tggcctcgaa atgcgcccgc tcgaccccca cttcgcgcag    119580
     ccgcgtcggc atgcccagct cgcgcgccag cgcctcgatc aggtcggcgg ccggcacgcc    119640
     gggctggccc agcgtggcgg aaatcagcgc ctgccgctcg gcggtatgcg acaggttatg    119700
     gcgcatcacg ttgtgcagca tgacgcacga ggtatgccca tggggcaccg cggccaccgc    119760
     gccaagctgg tggccgatgc cgtggctggc gccccattcg atccggccca ggccggtgga    119820
     ggccagccag acgcccagct ggctctgcag ccgcgcatcc aggtcgtcgg gcgcgcgccg    119880
     ggtctggcgc agtccgtcga acagcatttt cagcccatgc aggcaggtcg tgatgcattc    119940
     cagggcgcca tccgatccat ggcggcacga aagactcgca gggaacgcgc accgattatg    120000
     catgaattca accatcacgt cagcatgcta accgatcgtt caattctctt tcgcaaccgc    120060
     cgtcttcggg ctacagtagc gtatcaatat gtatcgaaaa gggctggata tgcctgacgc    120120
     aagcacgctg ttcaacgaca gcgcggtgta ccgaaccttg ctcgagtcga ccaaggcgat    120180
     tccctggaag atcgactggg ccacgatgaa attcacctat atcggccccc agatcgaggc    120240
     cttgctgggc tggagcgccg acagctgggt aagcgtcgag gactgggcca tgcgcatgca    120300
     tcccgaggac cgcgaatacg tggtgaatta ctgcgtatcc caatcccagg ccggccagga    120360
     ccatgaagcg gactaccggg cgctgaccaa ggacaacggc tatgtgtgga tacgcgacgt    120420
     ggtgcacgtg gtgcgcaacg acaagggcga ggcagaggcg ctgatcggct tcatgttcga    120480
     catcaccgaa cgcaagaaga cggaagaaaa gctgctgctg caaaaggagc tggaagtgct    120540
     gtccttcaag gatggcttga cgaacatcgc caaccggcgc cgcttcgaca gcagtttcga    120600
     cctggagtgg gagcgggcgc gccacgaacg ccagccgctg tccatgctgt tgttcgacgt    120660
     cgattatttc aagcaataca acggacttgt atggccacac ccagggcgac gaatgcctgg    120720
     tggagatcgc ccagacgctg agcctggcgc tggacggtcc gcgcgatctc gtggcgcgct    120780
     acggcggcga ggagtttgtc gtgctgctgc ccgaagccga cgccgaggtg gcccgcaagg    120840
     tcgccgagcg ctgccagcga ttgatcgaga agaagtccat cgtgcacgcg ctgtcgccgc    120900
     acggtcggcg cgtcacggtc agcatcggag ccggcacggt ggtgcccggc gggcagacgg    120960
     cgccggccgg cttcatcaag gccgtggatc agcagctcta tgcggccaag aagaacggac    121020
     ggcaccgcat cgagcatgtg cggctggaaa cctgagcgcg caggccgggt ccagggcgct    121080
     tgcgcgcccg gactagcctt tcgataattc gcataatgta tattatgtaa agtacgagat    121140
     gggcgcgccg gcggatcgac tgttgcccgc atgcatgccg cttcgctgcc cgccctggcc    121200
     agcccatcag gcccggctag accctgtaca gcgcgtaagc caggaaaccc gcgcccagcg    121260
     cgagatggat ggcgaccccg tgccggcctt gcaggatcga cgcgggccgc tggccgcgca    121320
     ccaggcacgc cagcagaccg gaatgcgcca gcagcaggcc caccggccac agcgccagga    121380
     aaagcaagac cccgagcggg tccggcccgt agccgtcgcc gtgacgcggg gccttgtaga    121440
     gcgtgacggc gatcgcccag gccgcgagcg ccagcacgct caggacgaaa ctgatccggt    121500
     aatagagaga caaggcggac tgctcctgtt ggaatgttga atccgaccga caccgcgtcc    121560
     ttcccaggct tggctggccg gcggcatcga cgccatgata aaagacgggg ccgacaagca    121620
     tgggcccaac cgacatgaga gtatccaccc gccagctcca agccttcctg ctggtcgccg    121680
     aggtccgcag cttcacgcgc gcggccgaaa ccctgcacgt cacccaggcg ggcctgagct    121740
     ccatgatcaa cgaactggag acgcaggtcg gaatccggct gttcgagcgt tcgaaccgcg    121800
     cgaccgccct cacccaggcc ggcacgcagt tcctgcccta tgcccgccag gccgtcgaaa    121860
     gcctcaacaa gggcatgctg gagctgtccg cgctgaaccg ccgccagcaa ggcgggatcc    121920
     gcgtcggggt gtcgcccttg atcgccagca cggtgttgcc ggccgtgatg cgcgagttcc    121980
     agcaatgcac gggccgttcg tgcgaggtcg tggacgccga actggaagtg ctgcacgaca    122040
     tggtggagac cggcaggctc gacgcgacct acggcaccta tatgcgccgc gcctcgcggc    122100
     tcaagagcga gtacatcttc ggcatggcgc tgcggctggc cggtcccggc aggctgatcc    122160
     cgccgggcct ggagatcgcg ggggtggaag actgggcgcg ccagcacgat atcgtactgt    122220
     gggcgctgcc ggactccaac gcggtccagc aggtcgtcga ccggtacctg ctggaggtcg    122280
     gcgcgcatgc cctgcgccgc caggaggtct gccacgtggc cacggtggcg tccttgatca    122340
     gcgccggcat ggggatgggt ttcgtgccca ctttcctggc ggatttctac gatcgcgaca    122400
     cgatcggcca gattgcgctg ccgcagggcg cgccggcggt cgatttctat tgcacgagcg    122460
     acgcgtccaa tccggcctcc tcgtccatcc acgtattctc caggctgctg gcggcccact    122520
     gcagcgccgc cgcatagcgc tctagcagcg gttcacgatc ggaatgcagg cgccgttgat    122580
     ctgggcggcc agcggcgagg ccaggaacag gatcagcgcc gccgccgcgt cgagcgacac    122640
     ccagcgggaa aaatcggcat cgggcatggc gcgccgattg cccggggtat ccagggtgcc    122700
     gggcagcacc gcgttggccg cgatgccctg gtcgcgggtt tcggcggcca gggtcctgac    122760
     cagttcggcc acgcccgcct tggacgcggc atacgccccg agcccggcgt gcgcgcgccc    122820
     gatggcgtcc gagccgatgc acacgacatg cccggcgccg cgcgccagca tcagcggcag    122880
     cgcggcctgg caggccacca cggcggtgcg cagattgagc gcgtacatgc ggtcccaggc    122940
     ctcgaccttg ccctcggcca gcgtttcgtg atggaaaccg ccggccacgc tgaccagggc    123000
     gtcgagccgg ccgaaccggc gcgcgatcgt gtcgaaggca tggcgcgtgc tggcgacgtc    123060
     gttgagatcg acgtcgagca aggccaggtc ggcgcccgcc tgcggcaggc cggcggcgcc    123120
     ggtggcctgg tccagcacga cgacctggtc gccgcgctgc ttgaaccgct gcgccagcgc    123180
     cctgcccagc gcgcccattc cgcccgcgat ggccaccacc gccgcgccat cgccggctgt    123240
     tgcttgcgtc ttcatgccgg gccgctcatc agttggtttt catgtcgacc gatttgacga    123300
     tgggtgccca cttgcccagg tcgctgtcga tcttgccggc catgtacgcc accgacaggt    123360
     cgctggccgg ccgcaggccg atgttctgca gcgcgtcgcg cacctgctgc ttgtcgaaca    123420
     ccttgcgcac gctggcgttg agcctggcga tgaccgcgtc gggcgtgccc gcgggcgcca    123480
     ccaggccata ccagggttcg acatcgaagc ctttcatgcc gctttcctgc atggtcggga    123540
     tatcggggat gcggccgtcg cgctgcgacc cggtcacggc cagcgcgcgc agcttgccgg    123600
     cctgcaccat ggggaccgcg ctcaggtcgc tgaacatcag cgtcagccgc ccgcccagca    123660
     ggtccgacct ggccggtccg ccgccgcggt acgggacgtg cgtcatcttg acctgcgccg    123720
     tggtgctgaa cagttcgccc gccaggtgca tggtgctgcc ggtgccggac gagccgaagg    123780
     tggcctggcc aggatgttgc ctggcatagt cggccagatc cgccaccgat tggatcttgc    123840
     tctcggggtt gacgaccagg atgttctgcg tggtgaccag catcgacacc ggcttgaagt    123900
     ccttgaccgg atcgaacggc aagtccgggt acagcgacgg gttgatggtc aggatgctga    123960
     tcgtgcccag cagcagcgta tagccgtcgc ccggcgattt ggccacgata tcggcgccga    124020
     tgttgccgcc ggcgccggtc ttgaactcgg tgtacaccgg cgtgcccagg tcgctggaca    124080
     gttgctcgga caccagctgc gcgagcgggc cgatcgtggc gcccggcgcg aagggcacca    124140
     ccagcttgat gggctggtcg ggaaacgcgg cctgggccgg gccctgccag gaagccgcaa    124200
     gcgcggcgaa cgcaaacgct gcacagatgc ctttcatcat ggtcttctcc tccttgttta    124260
     ttgttcgtgg gccgtcgccg gccgcgctgt gacggcgcga tcaggcggcc gcggactcgg    124320
     ccgccatgcg caccagcctg cccggcagcg cgccggtggc cgcggcgtcg cggtagacca    124380
     ccacgccgga cacgatggtc gccacatagc cgctgggctt ttgcaggtag cggcccttgc    124440
     cggccggcag gtccatgttc atgacgggca cgccgggatc tatcgtcgcg gggtcgatga    124500
     cgttgatgtc cgccttcttg ccgacctcca gcacgccgcg gtcatgcagg cccacggccc    124560
     gcgcggtgtc cgccgtctgg cgcttgacca gccacggcag atcgaaggcc ggccgccctg    124620
     ctcccccgcc ccaatgcttg agcaggaagg tcgggaagct ggcgtcggag atcagcgcca    124680
     cgtgcgcgcc gccgtcgccc aggccgatga ccgtgttcgg gtcggcaagc atttgcgcgc    124740
     aggcgtccag gttctggtcg gcatagttcg cgaatggcga gaacagcagc gccttgccgt    124800
     cttcctcgag caggcagtcg taggccagct cggccggatc ggcgtcggcg cgccgggcca    124860
     gcgccgcgat cgagcgttcc gggcccgggt cgtagcacgg cgggttgccc agcggaaaga    124920
     tgttgtcgaa ctcgttcagg cgcttgccca gcggcgtatc ctggctctcg cgcagtagct    124980
     gcgcgcgcaa ggccgggtcc cgcatgcggc gcacccgctc atccagcgca agctgggcga    125040
     tggccttgta gctggcgcag tcagagaaga cattgcggct gccctgcagc cccagcagca    125100
     cgcctacccc gcgcggcgcg acctgcgcgc ggatgggcag gccgtcggcc gccgcctgcg    125160
     ccgtcagggc cagcagccgg cgccacccgt ccttgttgcc gtgcttctgc atcagcgaga    125220
     acgacagcgg ccggccggat ttctccacca ggcggcgcat catgccgaac tcggcctcca    125280
     gcatgtccgg atcgtcgaag tcgatgatga tctccagcac gccgccgccg gcatcggcca    125340
     gccccatggc gatgccggtc agctcttcct cggccgcgcg cagcaacggc atcgggtcgc    125400
     cggtgaccga gcggtgattg atcgagcgcg aagtcgagaa gccgatcgcg ccatggcgca    125460
     tggcctcggc cgccaggctg cgcatccgcg cgatgtcctc gggcgtggcc atctcgagcc    125520
     gcagcgcgcg ctcgcccatg acgtacacgc gcagcgccgc gtgcggcagt tgcgcgcaga    125580
     aatcgatgtc gtgctcgatc cgttcggtcg cgcgcaggaa gtcgggaaac gtctcccagg    125640
     cccagtccag cccttcgtgc agcgcgatgc cggggatgtc ttccacgcct tccatcagct    125700
     cgatcagatt gccgcgatcg gccgcgcgca ccggcgcgaa cccgaccccg cagttgccca    125760
     tcaccaccgt ggtcacgccg tgccagctgg atggagccag gcgggaattc cagatgatct    125820
     gcccgtcgta gtgcgtatgg atgtcgacga agcctggcgt gacgatcttg ccgcgcgcgt    125880
     cgatctcggc ggccgcgccc ggcgcgatgt cgccgatctc ggcgatcagg gcgccgcgca    125940
     ccccgatgtc ggcgacccgg ggcgcgccgc catgcccgtc catgagcaat ccgccgcgga    126000
     tgacaagatc aagtgcctgt tcgtcgtgca tttcttcctc gattgagctg ccctgtgcgc    126060
     gtctgcgttg gggccggatt cggcaatgcc tgccccgacg aattacaccg gcgaaccccg    126120
     cgagcgacaa gcaaggattt cttatgctgc gacaaggatt cccgatccac ggcgcggccg    126180
     ccaggccgtt cgcccgccca cctgccccgc ccgggccggc aattcggcgc agcccatcat    126240
     gactattcaa tgattcaaga atcattgtat tatttcggca tgaatgcaga acaagccgtt    126300
     tcctccctcg gcgccctggc ccatgcgcaa cgcctgagcg tgtttcgcgc ccttgtcgtc    126360
     gcgggcccgg cggggctcac gcccagcgtc atggccgacg ggctcggcat cgcccgcaat    126420
     gcgctgtcct ttcacctgaa ggagctggcg cacgccggcc tggtcagcgt cgagcaacac    126480
     ggccgcaatc tgatctaccg cgccgatttc ttccggatga atgcattgct cggctatctc    126540
     accgaacact gctgccaggg cgcgacctgc gaggtgtccg attcccgaaa gaacacagcc    126600
     ggttgcgacg ccggcgccag gcgggcctga tccatgccag gcgcaccggt tcgcgtcgtc    126660
     gggatcctgg gaaccgccca gacgctggcc tgggcctcct cgtactatct gccggcgatg    126720
     ctggcggatc cgatggctcg tgacgtgggc gtgtccacgc cgacggtcta tgcggcgttc    126780
     tccgccgccc tggtcgcatc ggcgttgatc gggccatgga cgggactggc gatcgaccgc    126840
     cacggcggcc gtatggtcct ggccggcacc agtctgttgt ttgccctcgg gctgggcatg    126900
     ctcgacgccg cccagggcct gtggacgatg gttgccgcct cgctcgtcat gggcgtggcg    126960
     atgggcgccg gcctctacga ggccgccttc tccagcctgg tacgccttta tggccatcac    127020
     gcccgcgggg ccatcaccgg aatcacgctg atcgccggtt tcgccagcac cgttggctgg    127080
     ccgctttccg cctggatgga gacgctgttc ggctggcgcg gcgcatgcct gggctgggcg    127140
     gccttgcatt tgatgatcgg cctgccgttg aatgcctggc ttcccaaagc cgttgccgcc    127200
     gagacgccaa gcccggatgc cccggccgcg caggagggga ccctccctgc tgcgcggccg    127260
     ggaccgcagg ggctggccac cgccctgctc gccttcgtgt tcgcggcgac gtggttcatc    127320
     agcaccgcga tggccaccca cttgccgcgc atgctgcaag ccacgggcgc cacgctcgcg    127380
     gccgccgtgg ccgtgggcgc gctcatcggt cccgcgcaag tggccggccg cctgctcgag    127440
     ttcggcttgc tgcggcatgt tcatcctttg ctgtcggcgc gcctggcggc cctggcgcat    127500
     ccggccggcg ttgccgtgct gttggccgcc ggcccggcgc tggccccgct gctcgccatc    127560
     ctgcatgggg cgggcaacgg catcctgacc atcgccaaag gcacgttgcc gctggcgctg    127620
     ttcggccccc agggctatgg cgcgtgccaa ggctggctga tgatgccggc gcgggtcgcg    127680
     caggcgctgg cgccgtttct cttcggcctg gcgctggacg cctggcgcgc caacgctttg    127740
     tggctatccg ggggcatagg cctggcggcc tgcgccgcgc tgctcgtgct gcgcgcgcgg    127800
     cccgacccaa tcaagcccta gtcttgcatc aacagaggtg tgtcatgact tccatcacga    127860
     tctatcacaa cccggcctgc gcgacatcgc gcaatgtgct cgggctgatt cgcaacagcg    127920
     gcgaggagcc ggccatcatc gaatatctga agacgccgcc cgacgccgca acgctgcggt    127980
     cgttgatcgt cgccatgggg atgccggtgc gcgacctgct caggcaaaag ggcacgcctt    128040
     acgacgagct cggtttgtcg gatccgaaat ggacagacga gcagctgatc gatctcatgc    128100
     tccagtaccc gatcctgatc aatcgcccca tcgtgacaac cccactggga acgcgtctgt    128160
     gccggccgtc ggaaaccgtt ctggatctcc tgtcccggcc ccagcgcggc gccttcgaca    128220
     aggaggacgg gcagcctgtc atcgatgcgg acggcaaccg tgtctgaggt tctcgccgat    128280
     ctgcccaata tcgatccgtc acggttcaag cagccgaacg cggccgagct gttcccgccc    128340
     gggcgcgcca cgcatgcccc gcgcttcctg ctgctgtatg ggtcgttgcg cgagcgctcc    128400
     tacagccgcc tggtcgcgga ggaagccgcg cggctgctcc gggcgctggg cggcgagacc    128460
     cggctgttca acccgtccgg gctgccgctg gtcgacgacg ccagcgagga ccatcccaag    128520
     gtccgtgagc tgcatgagct ggtccggtgg gccgaaggca tgatctggag ttcgccggag    128580
     cggcacggcg ccatgagcgg cctgatgaag acgcagatcg actggatccc gctgtcgatg    128640
     ggcgcggtgc gcccgaccca gggcaagacg ctggcggtca tgcaggtatc ggggggatcc    128700
     cagtcattca acgccgtgaa ccagatgcgg gtgctgggcc gctggatgcg catgctgacc    128760
     atcccgaacc aatcgtcggt ggccaaggcc taccaggagt tcgacgaggc gggacgcatg    128820
     cagccttcgc cttactatga ccgggtggtc gacgtggccg aggaactgat gaagttcacc    128880
     ttgctcacgc gcgacgcgtc gccgtacctg gtcgatcgct acagcgagcg caaggaagcc    128940
     gccgaggcgc tgtcgcggcg cacggcgcaa gcccgcatct agcgcgcggc cgtggcgccc    129000
     atgtgttcgg ccgccaccga gccgaagcat tgcgcgaagg cgtcgatgcg ctcgccatcc    129060
     ccctgcccgg cccgcatgat gcagtagtaa tcgaccgcca cgcgcggcgc caccggcacc    129120
     aggctgacgc gccagcgccg gcgcgccacc gcggcgaacg acggcaccac ggcctggccc    129180
     agccccgcct cgaccatggc caataccgtt tccaggtgcg tgaccacgcg cgccggcgca    129240
     tcgccctgca cgcccaggtg ccggttgacc aggcgctgga tcggattctc gtcgggcaag    129300
     gcgatcagcc cgtcgcggtc gatctggggc cagcgcaccg accggcgccg ctcgccctcc    129360
     acgcgcggca cggccagcgc cagccgggcc gggaaaacgg tttgccgccg tatgccggtc    129420
     gcgcgcgtgg tgcgctcgaa cagccggctg cccagctgcg tttccaggtc gcgcaccatg    129480
     gcgctcagcc cggcctgcga gatgtgcagc tgttcggccg ccttggtgaa actggcatgg    129540
     cgcgccaccg cgagaaaggc gcgcatctgg cgaaaggaga agttcatggt cggccggccg    129600
     ggggggaaac aggcattcat attaacaagc aatgcttgtc aatttatcca atattgttct    129660
     tttacttatt taatccgatg cggtgaaata agcccatcgg cccatgcgag gcctcattgc    129720
     cacaagagac acaggagacg aaacatgacg agttcgcccg ctttgaccat gacgctgcgc    129780
     gccgtgctgg cgctggccgc caccgccagc ctggccctgg gcccggccgc gccggcggcc    129840
     gccgagacgt tccccgccaa gcccgtgacc ctggtcgtgc ccttcccgcc cggcggcccg    129900
     accgacacca gcgcgcgcct gttcggcgcc gtcatggccg acaagctggg ccagcccgtc    129960
     atcgtcgaga accgcgccgg cgccggcggc agtgtcggca ccaccgtggt cacccgctcc    130020
     aagcccgacg gctacaccct gctgtggggc ggcaccagca gcatcgtggt cgcgccggcc    130080
     ctctacacca acctgcagta cgacccgatc aagtccttca cgcccatcgg catggccgtg    130140
     cgcggcccgc tgatcctggt cagccgcccc gacctcggcc ccaaggacat cggccagctg    130200
     cgcgactacg ccaagaacca tgacctgagc gtggcctcgg ccggcaccgg ctccatcggc    130260
     cacctgaccg ccgagatgtt caagagcgag gccggcgccc gcatgctgca cgtgccctac    130320
     cgcggcggcg cgccggccct gaccgacgtc atgggcggcc aggtcgacct gttcttcgat    130380
     acggtcacgc tgctgacgcc gcagatccgc gccggcaagc tgcgcgccta cgccgtcacc    130440
     ggcagccagc gctacagcgg cctgcccgag gtgcccaccg tcgcggagac gatcggcaag    130500
     cccttcgagg cctactcctg gttcggcctg ctggcgccgg ccggcacccc cgcgccggcg    130560
     gtgcaggccc tgaccgacgc gctggccgcc gccgccaagg atcccgaggt catcaagcag    130620
     ctcagcgcgc tgggcctgga gccggtcggc gacaccccgc aggagttcgc ccaggcgatc    130680
     cgcgccgacc tcgacaaatg gaccggcgtg gtccgcagcg cgggcgtcaa gccccagtaa    130740
     ccgcgcctac gcatacgcga cacagaagga caacccacga tgcccgacac ctcctccccc    130800
     cggatcctga tcgccggcgc cggcctgggc ggcctgaccg ccgcgctggc cctgcaggcg    130860
     cgcggtttcc aggtccgcgt gctggaacag gccgcgcagc tgcgcgaact gggcgcgggc    130920
     atccagctca gcgccaacgc caaccgcgtg ctgtaccagc tgggcctggg cgcggccctg    130980
     gaacaggtgg ccagcccggc gcccggcaag cgcatccgcc tgtggaacac cggccagacc    131040
     tggccgctgt tcgacctggg cgcgcagtcc gtcgaacgct atggctaccc gtacctgacc    131100
     atctaccgcg ccgacctgca ccgcgtgctg gccgaagccg tgctggcgcg cgatccgcag    131160
     gccatcgaac tgggcgcccg ggtcgagagc gtcgcgcagg acgatgccgc ggccagcgtc    131220
     acgctggccg acggcagcac gcgccaggcc gacatcctgg tgggcgccga tggcgtgcac    131280
     tcgcgcgtgc gcgccgccct gcatggccag gaccaggcgc gcttctccgg cgcgctggcc    131340
     tggcgcggcg tcatcccggc gcacaagctg ccgccgcatt tgcgcgagcc gtatgccgtc    131400
     aactgggtcg gccccggcgc ccatgtcatc cactacccgc tgcgccgcgg cgaactggtg    131460
     aacttcgtcg gcatcctgga gcgcgacgac tggcaggtcg agtcctggac acagcagggc    131520
     acgatcgcgg aatgcgcgcg ggatttcgcc ggctggcacg aggacgtgca gacgctgatc    131580
     catgcgctgg atacgccctt caagtgggcg atgatgctgc gcgagcccct ggcgcgctgg    131640
     accagcgggc gcatcaccct gctgggcgac gcctgccacc cgaccctgcc gatgctggcc    131700
     tcgggcgcgg ccatggccat cgaggacggc tacgtgctgg cgcactgcct cgacggcatg    131760
     cgcgccgatg cgcggcaggc gctggtccgc taccaggatc tgcgcgtcga gcgcacggcg    131820
     cgcgtggtgc gcggctcagc cgagaacgcc aagcgcttcc acaacccgga gctggcgcac    131880
     gcggccggcg cggccgccta tgtcgaacag caatggagcg aggcccgggt acgcgaaaga    131940
     tacgagtggc tcttcacgta cgacgtggac gccgaaccgg tctgagggcg ccgcccgcgc    132000
     gtggccaggg tttccccttg gatgcgcgcc cgcgtcttgt cctgccggcg caatcgctgt    132060
     aacttgtgcc ggttccacca acgtgcagtt cgggagagac cgtccagcgg acggcgccga    132120
     cggagcaacc accccggaaa ctctcaggca aaaggaccga cctgctggaa catctggaga    132180
     gtggcgcgcg gtacggcgcc caccgaaggg gatccctggc gcgtttgcag cggcgcacgg    132240
     gtgaagctct caggtaaatg gacagatggg gttgcggccg ggccattccg atggccggca    132300
     gacgccaacc tcctctggga ccacgaccat gtctcgaatc gccgtcatcg gcgccggcat    132360
     caccggcgtc accaccgcct atgcgctcgc cttgcgcgat caccaggtca cggtgttcga    132420
     ccgccaccgc tatagcgcga tggaaacctc gttcgccaac ggcgggcagc tctcggccag    132480
     caacgccgag gtctggaaca gccgctccac gctcttcaag ggcctgcgct ggatgctgcg    132540
     gcgcgacgcc ccgctgctgc tcaatccccg gcccagctgg cacaagtact cgtggctggg    132600
     agagttcctg cgccagatcc cccgctacga agccaacacc atagaaaccg tgcggctggc    132660
     catcgccgcg cgccagcatc tgttcgacat cgcggcccgc gaacggatcg atttcgatca    132720
     tgagcggcgc ggcatcctgc acttctatgc cagcaggcgg gagtacgaca gcgccttgcg    132780
     ggtcaacgcc ctgctgcgcg ccggcgggct ggagcggcgg cccgtatcgc ccgaggaaat    132840
     gcgcgccatc gaaccggccc tgcagggcga cttctacggc ggcttcttta ccgagtcgga    132900
     ctccaccggc gacatccaca agttcaccac tggcctggcc cgggccgccg cgcggcacgg    132960
     cgccctgttc cgctacgaaa cgccagtcag cggcatcgac catcgcggcg gcgccatcgc    133020
     catcacgacc gccgaagccg tcgaacgcta cgacaaggtg gtgatctgcg cgggcgtggg    133080
     cagccgccgc ttcgccagca tggtgggcga ccgcgtcaac atctatccgg tcaagggata    133140
     ttcgatcacg gtgagcctgg acgacgaggc cagccaggcc ggcgcgccct ggaccagcct    133200
     gctggacgac cgcgccaaga tcgtgaccag ccggctcggc gccggccggt tccgggtggc    133260
     cggcaccgcc gaattcaacg gcttcaatcg cgatatccgc gccgaccgcg tcgaaccgct    133320
     ggtcgcatgg gtgcgccggt attttccgca ggtctcgacc agccgcgtcg tgccctgggc    133380
     gggcctgcgg cccatgctgc ccagcatgct gccgcgcgtc gggcccggca agcggccggg    133440
     cgtgttctac aacaccggcc atggccacct cggatggacg ctgtcggccg cgaccgccca    133500
     gctggtggcc gaagcggtga cggccggcgc cggcacgtag acggcaggca ggcggccagc    133560
     ggcgcgcgcc tcaagcgcgc ccggccgccg ccagccggcc caggcaggcc cgcaggccgg    133620
     ctggcagcgc cacggggcgg cggctggcgc gctcgacgta gacatgcacg aagtggccct    133680
     gggccgcgca cagttcgtcg ccggggcgga acacgcccag ctcgtagcgc acgctgctgc    133740
     gccccacgtg ggccacgcgc aggccgatct gcaatgtttc cgggaactcg gccggcgcgt    133800
     ggaaattgca gtgcgtttcc acgaccaggc cgatcacggc gcccgcctgc gggtcgagct    133860
     ggccggccga cgccaggtag cgattcaccg ccgtatcgaa gtaggcgtaa tacacgacgt    133920
     tgttgacatg cccgtacatg tcgcaatcca tccagcgtac cggcatggcc tcgaaatggc    133980
     tgaagccggc ccgctgccac cgttgcggac gcggggcctg ccccgcgcta tcgttcacag    134040
     cgcctcccgg taaaggcgca aggcgtcgtc gtagccgagc tccctggggt tgttgaccag    134100
     caaacgctgt tgctgcatgg cctgttgcgc gagcatgggc agatcgcgtt cggccacccc    134160
     gacttcggcc aggcgccgcg gcagccccag acgcggcccc aggctggcca tttcctgcac    134220
     gaatccttcg gcgcgcgcct gctgcgggcc gtccacctgc ggacaagcga tctgcgcaag    134280
     ctgggcatag gcggcgccgg cctgcggcag gttgaaacgc agcaccgcgc cgaacatcaa    134340
     tgcattggac aggccgtgcg gcacgtggaa aacgccgccc agcggatagg ccagcgcatg    134400
     cacggccgcc accggcgcat tggcgaacgc ctgccccgcc agcatcgcgc ccagcaacat    134460
     gtcatggcgg gccgccatgt cggcgccgtc gcggcatgcg gggccgatgg aacggcacag    134520
     caggcgcaac gcctggcgcg ccaggccatc ggagatcggg ttcttgcgca gccggctggt    134580
     ataggcctcg acggcgtgca cgatggcgtc gatgccggtg gcggcggtca cggccggcgg    134640
     caggccccgg gtcaacgcgg catccagtac ggcgatgtcg cagtacagga cgggggagac    134700
     aatgcccgcc ttggaggcgt cctcgcgggt cacgatggcg atgggcgtgg cttccgagcc    134760
     ggtgccggcc gtggtcggca cctgcaccag cggcaggcgc gccgtggcga cgcggtcgat    134820
     gccgtagctg tcgcgaaagt cggccgcgga gccggcgaac gccgccacca gtttcgcgat    134880
     atccatcgac gagccgccgc cgaagccgat cacgcattgc acgtccgttt cccggccccg    134940
     cgcgatcgcc tggctcacca ccgcttcggg cggatcggcc agcacgccgt cgtagacctg    135000
     gaccgtgtga ccggcgtcgc gcaggctttg cgccagggcc gcgaccagac ccagccgcac    135060
     cagctgctcg tccgtgacga ccaggatgcg gcacggcccc cattgcgccg cgaccgcctc    135120
     gcccaaccgt tgcgaggtcc cctcgcccgc cagcgtgcgg gcatgtgtcc gaaactcgaa    135180
     tccgttcata gcacctcgaa tagtcccgcg gcgcccatgc cgccgcccac gcacatggtc    135240
     accaccacat aacgcacgcc ccgggcgcgc ccttccagca gcgcatgccc caccagcctc    135300
     gcgccggaca tgccataggg atggcccagc gcgatggcgc cgccgttcac gttcaggcgt    135360
     tcatcgggca ggcccaggcg gtcacggcaa tagattacct gcacggcgaa cgcctcgttc    135420
     aactcccaca ggccgatgtc gccgatcgcc aggccggcgc gcgccagcag gcggggcacg    135480
     gcctgcaccg ggccgatgcc catttcatcg ggacggcagc ccgccaccgc gaagccgcgg    135540
     aagcggccca ggggccgcag gccacgcgcc cgcgcggcgg tcgcgcgcat cagcacgcag    135600
     gccgaggcgc cgtccgaaag ctggctggca ttgcccgccg taatgcagcc gccctcgcgc    135660
     acgctcttga gcgcggccag tttttcggaa gtcgtcccgg ggcgcacgcc ttcgtcctcg    135720
     gccaccagca tttcggtttc aacgggcggc gcgccgtgcg ggtcggccgc caggtggctt    135780
     acacgcatgg gcgcgatttc ctcgcgcatg cggccggccg cgcgcgcctg cgcggcgcgc    135840
     tgctggctgc gcgccgcgta ctcgtcctgg cgctggcgcg aaatgccgta gcgccgggcg    135900
     accacttcgg cggtatcgat catgggcagg aaaatctccg gcaggtgccg cgccagccag    135960
     gggtcctgtt ccatgtggtg attcatgtgt tcgttctgca cgcatgaaat cgaatccaac    136020
     ccgcccgcca ccgatatcgg cgccgccgca caggatggac tgggcgccca tggcgatggc    136080
     ctgcagcccg gacgagcaaa gccggttcac cgtgacgccg ggcacctcga ccggcaggcc    136140
     ggcgcgcaag gcagcctggc gcgcgatgtt ctcgcccgcc gttccttccg ggcggccgca    136200
     ccccatgatg aggtcatcga cctcggccgg ctcgatcccg gcgcgccgca ccgcgtgctc    136260
     gacggcgtgc ccgcccaggg tggcgccatg ggtattgttg aaggcgcccc gataggcctt    136320
     gccgatgggc gtgcgtgcgg tcgatacgat gacgatatcg tcgctcatgc gccctcctgg    136380
     ccgtgatcct gcagccggcc gccgtgcgcc gccaggcggg ccagcaggcc gggcggttgc    136440
     cagaattccg gttccgccgt ggcggcgcgc cgccgcaagc cggccaccac cgccggcagg    136500
     cccatggcgt cggcgctgtg gcaagggccg ccgcgccagc gcggaaagcc atagccggcc    136560
     aggaacaccg cgtccacgtc cgtcgcgctg gccgcgatgc cctcctccag caggcgcgcg    136620
     gcctcgacga cgagcgcgtg caggcaacgc tcgacgatct cgtcggccgc aatggcccgg    136680
     cgggatactc cggcctcgcg cgaagcggcc gcaatcatgg cctccacctc ggcatcgcgc    136740
     cggggctgcc ggccgccgtc cggataggca tggatcccgc tgcctccttt caggccgagg    136800
     cggcccgccg cgctgacccg gtccagccag tcgggccagg gcctgtgcgg catctcgctg    136860
     cgctgccgca ggcggatgct gtcgcccacg tccaggcccg ccaggtcggc gacctggaac    136920
     gggcccatgg cgaagcccca gtcgcgcagc gccgcgtcga cctccatggg catggcgccc    136980
     tcgtgcacca tcaaggccgc ctgccgcaga tactgatgcc acatgcggtt accgatgaag    137040
     ccgtcgcaca cgccggccac cacggcggtc ttgcgcaagc gccgcgccag cccttgcgcg    137100
     gcggccacca catcggcgtg ggtggccgcg ccgcgcacga tctcgagcaa gggcatcgcc    137160
     ggcgcggggc tgaagaaatg cagccccacc acgtcctgcg ggcgccgcgt gctgtgcgcg    137220
     atccggtcga catccagcgt cgacgtgttg gtgcccagga tggcgccggg cttgaggacc    137280
     cggtccagct cgcggaaaac cgcgcatttc accgccatgt cctcgaacac cgcctcgatg    137340
     gcgagatcgg cccgcgcgat gccggccatc tcgccggttg tcgcgacggc ggcgacacgc    137400
     tgctcggcct gcctggacgt aagccgcttg cgcgcggcca ggcgctcgaa atgctggcat    137460
     acctgcgcgc gcccctgcgc cagccggtcg gcgtccacgt cgtgccagat caccggcagg    137520
     ccggcgtcgg ccaggcagat gacaatgccg gtgcccatcg tgccggcccc cacgaccgcg    137580
     acctgctcga tgcgccgggc cgacacatcg ccggccggcg ggcgcggccg ctcggcaaaa    137640
     aaggcatagc gcaaggcccg cgcctcggcc ccgtcgcgca ggcgcgcgaa cgactcgcgc    137700
     tccagtgccc gcccggcgtc gaacggcccc tgtgcggcgg caaggcatgc cagcgccgcc    137760
     tcgcgcgccg ccgcgctgcc caccggccgg atggcggccg cgcgcgccgc ctcggcgatc    137820
     gatgccggcg ccaacgcagg caaactggca acgcggcgcc gcgccagccc gcccggcgcg    137880
     ttgcgcatcc acgccagcgc ctgctccagc gtatcgtcgg cagacaacag cgcatcggcc    137940
     agtttgcacc gcagcgcggt ttcgccgccc acgggttcgc cgcccagcac catctcgacg    138000
     gcatggcgcg cgccgaccag gcgcggcaag cgctgcgtgc cgccggcgcc aggcagcaac    138060
     cccagcttga tctccggcaa ccccagcgag gcgcgcggcg acgccagccg atagtggcac    138120
     cccagcgcaa gctccagcgc gccgcccagc gccgcgccat cgagcagcgc caccacgggc    138180
     accggcgcgt tctcgatgcg gtctatcagt tcggccagcc cggcatcctg gtccgaccct    138240
     gcctggtcga actccttgat atccgcgcca gccgagaaaa tgcccggacg ggcgctgacc    138300
     agcagcagcg ccctcacatc cggcctggcg tacgcctgct ccaggcattg cgccaggccg    138360
     tgccgcaacg tccgccccaa tgcattcacc ggcgggctgt ccagggtcac gactcctatg    138420
     tcgccccgca tcgcgatcgc taccgacata tccaggctcc tactgtttct cgatgccggc    138480
     gatctcggcc gcgcggctcc atttggcgat ctcgtcgacc tggtagcgcc gcagttcggc    138540
     gggccctacc gggaaactct cccagttggt gccggccagg aacgcccgcg tctgctcgcg    138600
     ttcgtagatg gcgacgatgg ccttgctcag cgtgtcgacg ataggcgcgg gcgtgcccgc    138660
     cggcgcgaat gcggaggtcc agttcaccat gtcgaacccc ggatagccgg cctgcgccac    138720
     cgtcggcgtc gcgggctcgc tttccagccg ctcggcgctg ctgacggcca gcaggcgcag    138780
     cttgcccgag cgcaggaacg gcaccagcgc cgcatagtcg gcgaacgcga agtcgacctg    138840
     ccggccggcc aggtcggtca atgcctgggc cgcgcccttg tagggaatat ggctggcctt    138900
     ggcctgggcc atcgacagga acagctcggt cgtgatctgg taggccgcgc tgcccgagcc    138960
     atagttcagc gtgcccggct gttgccgcat ggcctggacc aggtcgtcca ccgaacgata    139020
     gggagactgc gcgttcacgg ccaggcccat cgcgcctttc gccaggcgcg ccaccggcgc    139080
     gaaatccttc agggggtcat acggcagcgc cttgaagatg gccgcgttga ccgtcatggc    139140
     cgacgatccg gagatcagca gcgtatagcc gtcgggcgcc gcggcggcca ccatcttggc    139200
     ggcgatgaaa ctgttggcgc cagggtggtt ctcgaccacc accggcgaac cgaactcggc    139260
     ttccatctcg cgcgccagat ggcgcgccgt gttgtccgtg ccgctgccgg gcgcgaacgg    139320
     cacgatgagc cggatcgggt gcgtgggaaa cgcctgttgc gccagggccg cgccgctcgc    139380
     ggccagcgac gccgcgccca gcaggaacga cagaacaaag tgtttttttc tcatggtctc    139440
     ctctcgtgca agaacgggac ggcttcagcg tccgtgaaag acaggcgggc gcttttccag    139500
     caaggccgca atgccctcct ggtggtccgc ggtgcggtgc gacagggttt gatacagcct    139560
     ggagaactcc agcatggcct ccagccgctg gtgcaggcct tcgcggatca gccgcttggc    139620
     gaagcgcacc tgctgcggcg gattgacggc gatccgctcg gccagctggc aggcggcgtc    139680
     catgagctgc gccgccggca cgacgctgga caccaggttc cattgcaacg cggtggccgc    139740
     gtccagcgta tcgccggtaa acgccatctc gtaggtgcgc gccagcccga tgatgcgcgg    139800
     caggaaccac gacccgccat cgccggggat gatgcccagc ttgacgaaac tctcggcgaa    139860
     tcgcgcatcg tcggcggcga tgcggatatc gcacatgcag gccaggtcgc agcccgcgcc    139920
     gatggccgcg ccgttgaccg ccgcgatcag cggcacgtca agctgcgcca gggccatggg    139980
     aatgcgctgg atgcccgtgc tgtacttcgc gggaatgcgc gccgccggtc cgctgtccgg    140040
     gccgtagtcc gccagcatct tcttgacatt gccgcccgcg caaaacgacg ggccgttgcc    140100
     ggtcaggatg gccgcccgca catccaggtc cgcgttgagc tcgcgcacca ggtcctcgaa    140160
     ctcctggaac tgctcggcat cggtcagcgc attgcgcgcc tcgggccgat tcatcctgac    140220
     gatacaaacg cggccacgcc gctccacttc tagaaaccgg gtcattccgt tctttctcct    140280
     cgttgagcaa tcttcatcgt ccgctccagc gcggcgcgcg cttctcgcga aacgccagcg    140340
     cgccttcccg cgcgtcttcc gagcggtata gcggctccag gatatggaaa gccgtccgca    140400
     gggccgcgcc ccgctccatc tcggccgcgg catagaccat ctccttgcag gccgccgcgc    140460
     tcagcggcgc cgtggccacg atggcgcgcg ccagctccat ggccttgtcc atcagctgcg    140520
     cggcgggcac cacatgattg acgaagccga tctcggcggc ccgctgcgcg ctgatgggat    140580
     tgccggtcag cagcagctcc agcaccagct tctgcgggat caccccctgc aaccagaccg    140640
     cccaggccgg cgcccggccg accttggatt ccggcatgcc gaacacggca tggtccgcgg    140700
     ccaccaccag gtcgcacatt tgcgtgaaga accagccgcc gcccagtgcg gcgccattga    140760
     ccgccgcgat gacaggcttg cttgcctgga cgttgtcgcc gagtatgggc aggaacgtct    140820
     tctggctgag gtccgtgttc tcggacaggt cgcgtccggc gctgaagctg cgttcgcccg    140880
     cgccggtgag gatcgcgacc cgcagcgccg catcgttctc gaaccgctcc caggcggcaa    140940
     tcagcgcctg ccgcatctcc aggttgatgg cgttgcgttt gtcgggccgg ttcagcgtga    141000
     tgatcgcgat ctgttcgcgc gtttcgaatc ttacggtcgg ggatgtgttc atttggtttg    141060
     cgggttggat tgaagacggg acgaggccag cgacgacagc accgcttcgg tgtgctcgcc    141120
     cagcacggtt ggcgcccgcc cgtggcgggc cggcgtgcgc gacatgcgca acgcgctgcc    141180
     catcgcgcgg atttcgccga acaccgggtc cggcgctgcg gccacgagcg cccggtggcg    141240
     cacgtgcgga tcggccagca cctccgccac ggtctggatc ggcccgcagg gaatgccttc    141300
     ggccagcagg cgttccagcc agtactggcg tgtctggccg cggaaggcct cgcgcagttg    141360
     cgccatcaat gcattcttgc cctggacgcg cagctcgttg gtcgcatagc gaggatcgcg    141420
     cgccagcgac tcgcggtcca gatggcggca aaggcgctgg aactgccggt cgttgcccac    141480
     catcagcatg agcgggccgt ccaggcactg gacggcgtcg cccggcacga cggtcggatg    141540
     ttcgttgccg ttgcgttgcg gcgcctggcc gcacgccagg aagttggcgg ccagggtgga    141600
     cagcgccgat acctgcacgt ccatcagcga gagatccagg tgctggccct gccctctggc    141660
     ctcgcgctcg cgcaaggcca tcagcacgcc gcagcaggcg tagaccccgg tcatcaggtc    141720
     gatgatggga atcccggttt tctgcggacc gccgccagcg gcgtcatcgg gcaggcccgt    141780
     cacgctcatc attccgccca cggcctggat gatcgagtcg tagcccggcc tggccgcata    141840
     cgggccggtc tgcccatagc ccgtgatcga gcagtacacc aggcgcggat tcagcgccga    141900
     cagcgtggcg taatccagcc catgccgcgc cagcgagccg gccttgaaat tctcgaccag    141960
     gacgtcgctg cgcagcgcca gttcgcgcag cgcctggcgg tccgcctcgg actccaggtc    142020
     caggcacacg gagcgcttgc cccggttggc ggcgcagaag tacgccgaca cccgttcatg    142080
     gccgtcggcc gactcgtaga acggcggccc ccaggcccgg ctgtcgtcgc cctgccctgg    142140
     ccgctcgatc ttgatcacat cggcgccgaa atcggccagc atctgcgtgc accacgggcc    142200
     cgccagcacg cgcgacaaat ccagcacccg gatgccgtcc atcggcatgg gcttgcttgc    142260
     accgccacca ctcatcttcg ctccttcttg ggtcacgcgg ccaagccgga cttgcgcacg    142320
     acgttgcccc atttctcgta ttcatcgcgc acgaactgcg cgcatgccgg cacgtcgctg    142380
     gccacgacgc tgttgccctg cgcctgcagg gcctggcgca agcgcgcatc gcgcatggcg    142440
     ccggccagtc cggcctgcag ggcgtcgatg gtcggcgcgg gcgtgccgcc cggcgcgaac    142500
     agcacctgcc acgtctccga cgcaaagccg ggcagcgccg actccgccag cgtgggcagg    142560
     tcgggcatct ggctggagcg cacctcgccc gcgctggcca gggcaatggc cttgcccgcc    142620
     tggatatgcg ccgccgacgc ggaaatcgtc gtgaacatga cctgcacatt gccggccatc    142680
     aggtccacca gggcgggtcc gtcgcccttg tacggcacgt gcgtcatttc cacgccagcc    142740
     atgctcttga acagctcgcc ggacaggtgg aacgggccgc ccgtgcccga ggatgcatag    142800
     ttgaacttgc ccggctcggc tttcaggagc gcgatcagtt cctccggctt gcgcgccggc    142860
     accgccggat tgaccagcag cacgacgtcg ttcttgacca gcaggctgac gggcgcgaag    142920
     tccttgaacg gatcgtaggg aaccttctcg aggtgcggcg cgatcgtgat cgggcctata    142980
     ccgcccagca gcaggacata gccgtccggg gcggcgcgcg ccaccgccag cgtgccgatc    143040
     cgcccgttgg cgccggcgcg gttgtcgatg atcaccggct ggcccagccg ggcctgcagg    143100
     tgttcggcga tgacccgggc tacgttgtcg gtggctccgc ccggcgaata cggcacgatc    143160
     agcgtcacgg gacgctgcgg gtaaggcttg gcggccgcgg cgcggcccag ccaggtcgtg    143220
     cttgccagcg cggcgagcgc gcccagcgca tcacgtcggt tcatttcctg tctcccgttg    143280
     tcccgccgat tgcgggttct tgttgcgacg gggagaagcg tagccaacgc agtgccatat    143340
     gaacaaatat tgaatttata tccttcccat atgaaaatcg actaccaaca tcgaatcgaa    143400
     gaacaggacc atggatctga agcagatgcg gtatttcgtg gcggtggccg aagagcgcag    143460
     tttcagccgc gccgccgagc gcctgcacat ttcgcagccg ccgctgtcgc aacagatcaa    143520
     ggcgctggaa gaggaactga acgcgccgct ctttcaccgc ctgccgcgcg gcatctcgct    143580
     cacggccgcc ggcgccgccc tgctcaagtc cagcagagcc atcctggcca atgtgcggct    143640
     ggcggcgcag gaaaccaccc agatcgccgc cggcatgctg ggcaccgtgc gcatgggcac    143700
     ggtcagctcg gcgctggcgc atctggtccc gtacatcctg acccaggtga agcgatccat    143760
     gcctggcagc aaggtcgaac tgacggaaat gagttcacgc gaacagaccc tcgccgtcct    143820
     gcgcgatgaa ctggacatcg gactggtcca cacccccatc gatacggccg atctgcggac    143880
     acgccagatc ctgcgcgaac cgttctacgc cgccgtgccc agccagcacc ccttggcaag    143940
     ccgcgaggcc gtgccggtgg cggagctggc cagcgaggaa ttcgtgttct ttccgcgcac    144000
     gctggcctcg gggctgttcg acaaaatggt gtcgctgtgc atgaacgccg gcttcagccc    144060
     caagatccac cataccgccc gccaccagtc gaccatgctg cagatggtgg ccatgggact    144120
     gggcgtcacc atcgtgccgc gctccctgca gcgcatctac aagggcagcg cggtcttcct    144180
     gccgctgacc ggcacgccgc actatctgga gctcagcctg atctggcgcg agagcaccgc    144240
     gaacgggctg gtcgagcgat tgatcggcgg cctggagccg ctacgcgatt tcgacagcct    144300
     gccctaggcc caggcgacgc gcgcgcccgc acgaccggcg gcgcgccgga ctcgcacatg    144360
     tcgacggccg cacgccgcgc cgcgctcgtg cgcggccgtg cttcctcgtc cgatcgaata    144420
     cactaatttc cgctgtgacg aattaatttc tgttaaacgg aaatatgggg aacccctgta    144480
     tttgcagcgc gggcccgcgg gctccatcgg aaaaaggaaa actatgccgt ccaatgttct    144540
     tgaaaacaag atcgccatcg tcgtcggagc cgggcagacg cccggcagca ccatgggcaa    144600
     cggccgcgcc accgcgattg cattcgcgcg cgcaggcgca agcgtcgtgg cggtcgaccg    144660
     cgatatggcc agcgccggcg agacggccgg actgatcctg gccgaaggcg gccaggccat    144720
     ggcggtacaa gccgacatca ccagcgaagc cgccatcgtg gccatggtgc ggcaagtcat    144780
     ggaaacgcac ggtcgcatcg acattcttca caacaatgtc ggcatcgcgg gcgcgggcgg    144840
     cgatgcgccg gtcgaggata tctccgccga agcgttcgac ttgctcgcca atctcaactt    144900
     gaaaggcatg atgctgacat gcaagcacgt gctgccagcc atgcgcgcgc agcgcagcgg    144960
     ctgcgtgctc aacgtcgcat cgacggcggc ctacgcgctg tatcccaacg ttgcctacaa    145020
     ggccacgaag atgggcgtgc tcggcctgac gcagcacatc gcgatgacct acgccgagca    145080
     cggggtgcgc gccaacgcca tcctgccagg gttgatcgat acgccgatgg tcatcgaggc    145140
     tcgcgtcagg ttgaccggca agccgcgcga acagatcgtc gccgaacgca atgcgatggt    145200
     gccgttgcgc gggcgcatgg gcacgagctg ggacgtcgcc cacgccgcgg tgttcctggc    145260
     gtccgaccag gcgggtttca ttaccggcgt gcaattgccc gtggacggcg gagccctggc    145320
     gcgcctcggg ccctaggcac gggaaaaccc tagctatccc tgtcttttgt cgcgcgctta    145380
     gaattttgtt taacggaagt catttccgtt caacggaatt aacaccaact atcgcgcgcc    145440
     agcgcccggc cccgggccga gaaaagacag gagactttcc atgccggacc accaccccga    145500
     agatgttgcc gccccgcgcc gccgcgcact gaaaaccctc gcggcggcgt gctcgctcac    145560
     gttggccccg ctggccgcgc tatcgccggc gcacgccgcg gacgcctttc ccgccaagcc    145620
     catcaccctg gtcgctccct tcgccgcggg cggatccacc gacatgctgg cgcgcgtcgt    145680
     cgccaaggcc ctggcggccg aactggggca atcggtcatc gtcgagaaca aaggcggggc    145740
     cggcggcacg ataggcgcgg cctatgtcgc gcgcgcggcc gccgacggct acaccctgct    145800
     gctctcgaac gtcaccctga cctcggcccc ggccctgtac aagaacatgt cctacgactt    145860
     cagcaaggac atgtcggcga tctccctgct cggccaggtg ccctgcgtcc tggagatcaa    145920
     caaggacctg cccgtcaagg acggcaaggc gttcctggac tatctgcgcg ccaacgacgg    145980
     caagctgtac tacggctctt ccggggtggg cgcggcgctg cacatggcga cggcctcgtt    146040
     cctgagcgcg gcgggactca gcgcgatcca tgtgccctac aaggggaccg ggcccatgat    146100
     ggtggacctg atcgccggaa acgtgcagtt cgccatcgat acgtcgggct cggcatcggc    146160
     ccaggtccgc ggcggcaacg tgcgcggcgt ggcggtgacg tcccgcgagc gcgacccggc    146220
     ctggcccggc gtgccgacgc tgcgcgaact tggcgtgccg ttcgagatga ccatctggta    146280
     cggcatctcc gcgccagccg gcgtacccga gcccgtccgc cggaaactgc acgccgccat    146340
     cgagaaggcc acgcgcacgg acgaagtacg caccgcgtac cagtccatgg gcatgcaggt    146400
     cgacacccgc ggcggcaagg aattcgagca ggtcattgcg gaagataccg cgcgctggat    146460
     cacgctggtc aaggatgccg gcatcaatcc gagctgagcg ccatcggccc gcacggcgac    146520
     accatccgga cggcgagcgc cccgccgccc cagacacagc gacaggagca aggaaaatgc    146580
     aggaaacatc accggcaacc ggcggccagc agtatgccga cgacgccctc cccatcgagg    146640
     acttgaaaga agccccgcta ccgccgttcg aggtcaagga caccgtggtg tacctgcgcg    146700
     gcagccgtag ccggtcctcg ggcagcatgg cgtttcccga acgggaggta tgcctgcaga    146760
     ccggcgcgcg cgacatggag ccgttcctgt tcggccccga cgcaacgctg tattcgtaca    146820
     ccaccgtcca cgtttcgtcc gcgcggcccg tgccctacac gctcggctat gtggattttc    146880
     cgaacggggt gcgcgtgctc gcgcacgtac tggccgaccc cgcccagccc ctgcattgcg    146940
     gccaatccgt ccggctgcgc gccgatggcg agcgctggtt cgtcacgccc gcctgacccg    147000
     gaccaggaga tatcaatgag caaagtctac atcgccggcg cggccatgat ccccatgggc    147060
     aagcaccgcc agtccagcta ctcgggcctc gccgtccccg ccgtgctcaa cgcgctgcgc    147120
     tcggccggca tcgcgccgcg agatgtcgaa gccgtggtct gcggccatgc cttcggcggc    147180
     atgctgaccg gccagcgcat cgtcaaggaa atgggaatcg gcgcggtccc cgtcttcaat    147240
     gtcgataacg cgtgttccgg cggcgcctcg gcgctgcacc tcgcctacaa ggatatccag    147300
     gccggcatac gcgacatcgt gctggtcatc ggcgtggaca aactgaccca gttcggcggc    147360
     gggacgctgc cgctggtcgc cgaggatccc gaagtccggc taggcatcgt gatgccggcc    147420
     gtctacgcca tgcgcgcgca acgctacctg tacgaacgcg acgccaccgt ggcggatctc    147480
     gcgcaggtca gcgtcaaggc ccgccggcat ggcgcccgca atccctatgc gcagtttcgc    147540
     tccgaagtga cggtcgacga agtgctggac tcgcggccga tctgcgaccc gctgacgctg    147600
     ctgcagtgct gcccgaccgg cgacggcgcc gcggcggtga tcatggtctc cgaagcgggc    147660
     cggcgcaaac tcgccgcccc ggccgtgcgc gtggccgcct cggtcgtcca tagcggccag    147720
     gtcaccgcgg gatatcgcga catgctcaac cccgagatca gcaccgactc ggcgcgcgac    147780
     gcctatgaag cggccggttt cggcccgcaa gacctggacg tggtcgaact gcacgacgca    147840
     ttctcgattg ccgaactggt ctattacgag gccctcggcc tgtgcccgcg cggcgaatcc    147900
     gccgcgttcc tgcgctgcgg ccagtccacc tacggcggcc aggtcgtggt caaccccagc    147960
     ggcggcctgc tctccaaggg gcacccggtg ggcgccagcg gcgtggcgca ggccgtcgag    148020
     gtctattggc acctgacggg ccaggccggc gagcgccagg tgcccggcgc caggcgcgcg    148080
     ctcagccacg tgaccggcgg cggcatcgcc ggcctggacc atggcgcatg caccgtgcat    148140
     ctgtacgaag ccgtctgaga cgccgcgaca agaacaagcc tggaacagca gcaacatgca    148200
     tgaagttcaa cagcagtccc ccgcgccggc cgccaagccc ttggccggct atcgcgtgct    148260
     ggacctgacg acctttctgt caggcccctt ctgcacgcag atcctcgccg acctcggcgc    148320
     cgaggtcatc aaggtggagg cgccggacgg cgactccagc cggcacattc cgccgcactt    148380
     cgtggacggc gacagcgcct actacctcgg gatcaaccgg gacaagaaga gcctggccgt    148440
     cgacatgaag cagcccgagg ggctggccct ggtcaagtcg ctgatcgtcc gcagccacgt    148500
     ggtggtcgag aactaccggc caggggtggc ggcgcggatc ggcctggata ttgccgccct    148560
     gatggcgcag cacccgagcc tggtctgggc gtcgatcagc ggtttcggcc aggtcggccc    148620
     gctgcgcgac cgtcccgcct acgacatgat cgtgcaggcc atgtcgggcg tcatgagcct    148680
     gacgggcgaa gccggccgcc ctgccgtgcg cctgggcatt cccgccggcg acctggcggc    148740
     cggcatgtac gccgccatcg ccgtcaatgc cgcgctggcc gacgccgcgc gcggcggacg    148800
     gggacgccac atcgacattt ccatgctcga ttgccaactg gccatgctct cgtaccaaag    148860
     cacctacgcg ctggtggccg gcgtgacgcc gcaacgccag gcggcccggc acgactccat    148920
     ccccacctat cggtcgttcc tcgccggcga cggccgcgaa ctggtggtca ccgccaacac    148980
     cgagcgcatg tggaagggcc tgtgcgaggc attggggttg cgcgagctgg cccaggatgc    149040
     ccggttctgc gacgcggaga tgcgcctgca gaaccgcgag ccattgtggg atttgctcga    149100
     ggcggccttc ctcgcccgtc ccgccgccga atggatcgaa ccgctggcgg ccaacggcgt    149160
     gccggtggcc ttgatcaaga ccgtgcccga ggcgctgagc gaagcgcgcg ccagcggacg    149220
     cggcatggtc atgcccctgc ggcggccagg cggaccggag atcgaagtgg tcggcaaccc    149280
     gatcaagttc ctgggcgaag ccgagccgcc ggcccgctac ccgccgcgcc tgggcgagga    149340
     cgcgccggcg atcctggcgc aatggctcgg ctggagcgaa caggagatcc aggccatgca    149400
     ggccaggaaa gtcgtcatgt agttcccggc cggcgccatc ccgtggctgt ccgcgccatg    149460
     gcgccccgct acaatgtcgg ccatcagggc cggcgcaggc ctttcctgcg cggccaggac    149520
     ggcggcgcgc cggccggcct ggcaggccgg cggccgcgct cgtcgctacc gacatgggaa    149580
     ctatggcaaa gacagacaat acgttgggca ccgtcgcgcg cgtggtcgca ttgctgcgca    149640
     tcctggccga acgcagcaac cgggtcaccc tgagcgacct ggcggcggaa ctggcgctgg    149700
     cgccttccac catccatcgc ctgctggcgc tgctcaagga cgaaggattg gtggccaggg    149760
     atcccgtcac gaagatgtat tactgcgatg tcgaattcgt gcgcatcgcc tcgctggtgg    149820
     tggattcgtc gcagatcaag gacctcgccg cgcccctgct gcaatccctg gtggaacggt    149880
     tcaacgaaac caccctgctg tgcctgtacc tggcccagca gcgccgctac accatcgtca    149940
     gcgtccacca cggaacggaa ctcctgcgct acgacgtcaa ggagaacacg ccgctgcaga    150000
     tggcatgggg cgccacggcg cgcagtattc ttgcctttct gccccaggac gatatcgacc    150060
     gcatcctcgc cgaggccggc ccgtcggtca ccggagccga cgtggccgat aaaacggtgc    150120
     acaaggacct ggcccagatc cgcaagcgcg gctatgccgt gaccaagggg caacgcatcg    150180
     ccggctccat cggcctgggc gcgccgtttt tcggcgtcga cggcaacgtg ctcggatcct    150240
     tgtgcctgac cattccccag ggacgcttca acgccaggcg ggaagccgaa tacacccagg    150300
     cgctgatcga gcatgcggca cggctgagcc acagcctggg ctacgtggcg ccgtcggagg    150360
     caaaaccccg gaaaccggcc gccgcggcgc gccgggcctg agcaggcagc gggctcaggc    150420
     ccggcgcgcc ggcgtccagg catagccggt accggtcgac acgcacactg gacatatcgg    150480
     cggcgccgga cgaaggcgcg cgcgcccagg cttcccgcac cacggcgatg ccgcaatgat    150540
     gcgccaccgc gatgccgcgc cgcccggccg gcaccgccat cgacagcgcc ggatcgtagc    150600
     gttgcagcat gcgcgccacg acctgcgtgg tgcgttcgtc gtcggccacg tccagtgcca    150660
     gggcgccgtg gcagcctacc gtgcgcagcg ggcggtccca gcgccgcgcg atggccgcga    150720
     agccggccag ccgcgccagc aaggcgtctt ccagctcggt gtccggcgcc gccgcgccgc    150780
     gctcgcgcgg gtccagcccg ggcggatagt ccaggctcag gcccacgacg agatcggcgg    150840
     caagcgcccg cacggcgcgg cccagggccg gcgcctggcc gtcggccagg tagacgatgc    150900
     ggcatgccgg cggcagcgcc gccaatgcag cgccggcgtc cgggcagata tgcgcggccc    150960
     attcggcctg ggcgtcgctc acggcgcctc ctggccgccg tccttggcgg ccggcggcgt    151020
     catgtcgtag gacggcgcat aatcgtccgg cgcgccgggc gggatcggcg gataggactt    151080
     gagcgaggcc tggaacgcat tgaccatgcg gcgtatgggt ccgcgcaccc agccttgcat    151140
     ggtgttgacg tcggtttctt ccttggggtc ctgcatcagg ttgaacacat aaggcgtctc    151200
     caggtggttg ggcccggcat tgggctccac ctcccagacg aagtgcattt tccagtcgcg    151260
     ccatttggcc gcgcgcagct cgttcttgat gtagtagaca aagccctcgc gcgccgattt    151320
     ctcctcgcgg cccagcagga acgcggactg gtcgacgccg tcgatgggcc ggtcttgcgg    151380
     cacctgcagg ccggcgatgc cggccagcgt ggggaacagg tccaccacgt gcacgatctc    151440
     gttggtctgc cggccggccg gcaccttgcc aggccagcgc acgatgagcg ggacccgcag    151500
     cgccccttcc atcgccgtgt gataggtgcc ggtccacatg ccggcgctgc cgcgccaggg    151560
     ccggcggtac tccggtccgt tgtcgctggc gaagatgaag acggtatcgt cggcgatgcc    151620
     gtgctggtcg accgcatcca ggatctgccc gatgcgcgcg tccatctcca ccagggagtc    151680
     ggcaaaatcg cccttgccgg tgcggccttc gaattcgcgg tgcggaatgg tggggaaatg    151740
     cagctgcgtc agcggcacgt agaggaagaa cggggccttg cccgcgtggc gaccgatgaa    151800
     ctcgcagctg cgctgcgtga gcacctcgtc gatgcggcgg cgcatttcca ggtcgtagcg    151860
     ttcgcgcctt tcggccggac tgcccttgcg gccctccatg acgtacggca cttccaccac    151920
     gtcggggtcg aagcccaccg cctccatgaa catgctttcg ttggtggtgc gcgggatccc    151980
     gtaccactcg tcgaagccgc ggtccttggg gtaacggccc tccttgtcgc ccaggtgcca    152040
     tttgccgtac atggcggtgg cgtagccttg ctcggagaag gcctgcgcca aggtgcgctc    152100
     ccagggaaca aggccctgcg gcaggccggc cggcaccgac tgcatggcgc cggtgcgcac    152160
     cgggtggcgc ccggtcatga gcgccgaacg cgtgggcacg caatcgcttt ccacgttgaa    152220
     gttgagaaac tgcgtgccct gcgcggccag cgcatcgata cgcggcgtgg gcgccccgcg    152280
     gatggcgccg ccgccatagc accccagctc gccccagcca aggttgtcgg ccaggatcag    152340
     taccacgttg ggatgttgcg tcacttgcga catgaaatac ctccgaatca gtccagcttg    152400
     atgttcagtt ccgtgaccag gcggccccag tcggccacgt ccttgtggat gaaggcgtcg    152460
     aactgcgcgg catccatcga cttgggcgtc aggccgatct cgcgcagctt gtcctgtatc    152520
     gccggctgcg cgccgatggc ggccatggcg tcggacaggc gcttgacgat cgccggcggc    152580
     gtgtcgcgcg gcgccaccac gcccacccat tgcgagcgcg tgatctgcga gtagcccagt    152640
     tcggtcagcg tcggcacctc cggcatggcg gggttgcgtt cggcagtggt gacggcaacg    152700
     atgcgtatcc cgccgctgcg cgcctgcccc agcaggggcg cgaagcccag caccgccgcc    152760
     ggggtggtgc ccgacaccag gtcggtgacc gcctggcccc cgcccttgta gggcacgtgg    152820
     atcatctgca cgccggccag gtgggtcagc cactcgccga cgatatgctg cgacgtgccc    152880
     aggccggagg tgccgaaagc aatggttccc ggttccttgc gggccgcggc cagcagctcg    152940
     tccaggctgg cgtacggcgc gcgcatcgag acggctacgc cgatgggctg gtcgcccacc    153000
     atcgccacgc cagccatgtc atggtcgagc cgccagtcca tcttgcgggt ggcgctgagg    153060
     atggaagccg tgtcggacgc aatggccagg gtgtagccgt cggcgggcga gcgcgacgcc    153120
     agctgcatgc cgatggcgcc ggaggcgccg ggccggttct ccaccaccac ggtctggccc    153180
     agggccttgc ccagctccac gcccatcagg cgcgcaaccg tatcgttggt gccgccggcc    153240
     gcctgcggca cgatgatctt gatgggctgg tccgccggcc actcggcgct ggccgccgcg    153300
     gcgcccagca ggccggcgcc aagcagcagg atacgtaaga ctgttttcat gcgcttcccc    153360
     ttttcgtctg catagcgaaa gacctgagtg tagggattgg gctgcaaagt taatattcaa    153420
     aaaatcctct tatgtgataa ccaatacctt tcactccccc tccgccatgg tccaacgttc    153480
     gcgcgcggcg ctctcgcacc tgaagttccg ccacatcgcc ctcatccagt acctgctgca    153540
     ggaaggcacg ctgcgcaagg cggcgcggcg gctgagcatc agccagccgg ccgccaccgc    153600
     catgctcagc gacatcgaga acctgctcgg cgtgcagctg ttcacgcgca gccgccaggg    153660
     cgtggcgccc acggcgcaaa cgctggcgct ggcgccgcgg ctgtgcatcc tcatgaacga    153720
     cttcgacgaa ctgggcgcca tgctggaccg gctggacacc ggcgagcacg aggtgctgcg    153780
     ggtcggcgtg gtgccgcagg cgttcaccgt cctgctgccg cgcgccatcg agggctttcg    153840
     ccaggccggc ggctgtcatc tgcatacggt ggaaggcagc gcgcaagact tgctggcgca    153900
     gctgctggcc ggcgaacagg actgcgtgct ggggcgcctg ccgccggacg tggccaagct    153960
     gggccgcgac atcgcctcgc tgaccttcgt caacctgtac gaggatgacg tgtgcgtggt    154020
     gtgcgggccc gaccatccgg cggcgcgcct gaagaaaccg ggctacgccc ggctggcgca    154080
     gtgcgactgg gtgctgcagc ggatcagctc gagcgtgcgc caggcgctga ccgaggcctt    154140
     cctgcgccaa gggctgctgc tgccccaccc cgtggtggaa acccccacct acacccaggc    154200
     gctggacatc gtcgccgcca cccgcctgct gaccgcggcg ccccgccaca ccgccatggc    154260
     gcacgcgcgc agcggccgcg tgaaggtact ggacatcgcg ctgggggtgg cgccgatgca    154320
     ggtctgcctg atcctgcgca aaagcgccga gacccatccg cagatcgtgc gctttcgctc    154380
     ggtcttcgag gccatgccca tgcggtttcc ggacgcctga gcggcggcgc cgggcatggg    154440
     cggggctttg cttggcggtc cacgccggct actctgtacg cagtccgccg cggcaacgcg    154500
     gcgataccgc tggcaaacga cacacgacga ggatgacgat gtcccgctgg actttctata    154560
     ccgcccctgg cacctgtgcg ctggcgacgc acatcgcgct gcacgaagcc ggcgccgatt    154620
     tcgatctggt caagctggat ttcggcgcca cgcagcagca aagccccgac tacctgcgcg    154680
     tcaaccccaa gggccgcgtg ccggcgctgg ccaccgaaca tggcgtgctg accgagaatc    154740
     ccgccctgct cgctttcatc gcgcagagct ttccgcaggc gcagctggcg ccgctgggcg    154800
     atccgttcgc gttcgcgcgc atgcaggaac tggccaacta cctggcctcc accgcgcacg    154860
     tcgcgcacgc gcacaaacgg cgcggcgcgc gctgggccga cgacccggcc gcgcacgagg    154920
     ccatgcgcgc caagatcccc gagaacatga cggccatcgc cggctacctg gaatcgcaga    154980
     tcgtcggtcc ctgggcactg ggcgagcgct tcagcgtggt cgacggctat ctgtacaccg    155040
     tcggcagctg gatggaaggc gacagcgtcg acatgacgcg ctttcccaag ctggccgact    155100
     acctggcgcg cgtcggcgcg cggccggccg tgcagcgcgc gctggccgag atgaacggct    155160
     gagcggcgcg tcgccgcagg cagcactggg tcccgttcgg aaccgccagc gcagcaccgc    155220
     gctggcggtg tgctggaggt tgaaatatac gtcaatgacg tatatccttc catgaatgga    155280
     gttcatcgaa accccaattt tcacgcaatt gatcaccgcg ttgctgtcgg atgaggaata    155340
     ttccaggctg caacagctgc tgatcgacaa ccccgaaagg ggcgatctgc tgcgtggggg    155400
     cggcggtata cgaaagatgc gttacggccg gcaaggcacg ggcaagcgag gtggcatccg    155460
     ggtcatttat tactggatca gccaggattg tcagatctac atgcttgcgg cttatgcaaa    155520
     gtcgaagaag atcaacctga ccccggacga aatcgcggcg ctgcgcgaac tggtcaagga    155580
     actgtaacga tgaaaaaaga caacactgtg ttcaacgacc tgcaagccag cctgaagcaa    155640
     gccgtggcca ttcgccaagg caagatgccg ccatcgcgtg tattcaaggt tgagactgtg    155700
     gatgtgaagg caacgcgcga aaaaacgcac atgtctcaaa cggaattcgc caaagccatc    155760
     cacgtcagtg tccgtacgct gcagaactgg gagcaaggtc accgcaatcc gacgggccct    155820
     gccgtggcgc ttctgaaaat cgtggcaagc gccccggaca ttgccgtgcg agcgctgcgg    155880
     accgcgtaag gcaagccgcc attcagaacc gccagcgcag caccgcgttg gcggtgtgct    155940
     ggcggttgcc gccgccgaat tcccccgcgt acgccacgtc caggaaggca ttgcgcgcca    156000
     cctcgatccc ggcgcccacg cccagcaagg ccgcatcgcg cgcgatcggc gcgccggcca    156060
     cctcgaaggc gctgccctgg ccgaaggcca gcgtgctttg cggcgtgcga tcgccgaagg    156120
     catgccgcca gccggccatc gcccgcagcg tggcgccggc gccgagcggc accgccacgc    156180
     gcgccccgag ggtcgtggtg gccatgtcgt cgcggctgct tgcgccgctc aacgcggcgc    156240
     tgccgcccgt ctcggtgaag ccgcgcacgc gcaactggtt ccaggccagt cccgcgaatg    156300
     gctccagttc ggctgtcatg cccagcggca tggcgtagct cagttcggtg aacagctgcg    156360
     tggtgctggc gccgtagtcc gccgtcagtt cctgccgcag gtcgcccacg tcgacgcggc    156420
     gctcgctggc gatgtcgtgc caggtatagg cggcgccagc cagcaggttc aggcgtccgg    156480
     cgcccgtatc ccaggcgcgg ccgccataga gcgcggcggt gtagctggcg acgtcggttt    156540
     gcgaggcgcg tgcgtcgacc tcgatccggc catcggtaaa gcccagcgag ccgcccacgc    156600
     gccagccgtt ggccagcgcg gtgtcggcgc cgacgaacag cccgccgaca tgctggcgca    156660
     cctgcgccgc gttgccgtcg ccgtccaggc gttgccaggc gccgaccacc tcggcccagg    156720
     ccggcgacgg cgcgcccggc agcgccgccg cgccgggcgc gctgccgctg gccgccatcg    156780
     gcgcgccagc ctgccaggcc aggcccaggt ggtcgcgcaa acgccccagg ttgacctgct    156840
     gcgcctggcg cgcgctcgtc agcagcgcgc tgcgcgtgct ggcgtgcacc tcgcccgaca    156900
     aggcatcgaa ggccgccggc ggcgcgcctt cgggcagcgt ctctatcgcg cggtagaccg    156960
     ggtgggcagc cggcagcgtc tcggcggcgc gggcggtggc gcgctggttg gccgtatcgg    157020
     ccaggtcggc gaaagccagt tcgccgctgc ctggcgcgcc gcggcgctgc agggtcagcg    157080
     ccacgctggt cgcgtcatac gacagcgccg gcgcgagata ggcgtagtcc gaaccgacgg    157140
     catcgaactg gccgagccgc cggcccgcgg tgaggatcac gtagcgctgg cgcgcctcga    157200
     acccgccttc cggcccgaca tgcaggaccg tgccgccgcg gatgtcggcc gtgccgctga    157260
     ccgtcacgcg atcgctggcc gtgccggccg ggtcggcttc gacctcgaag cgcgaacccg    157320
     gctcgaacac caggtcgccc gccacgcgca atgtgccgat ggaattgccc ggcgccagcg    157380
     cgccgccggc ccggacggtg gtgtcgccca ccgtgccggt gccgcccagc gtgccgccgg    157440
     cggccaccgt catggccgag cccgccatct cggcatccac ggccaggcgt ccggcgcgta    157500
     cggtccagga cagggccgcc gcgttgccgc cggtcaggcg ccaggagccc gtgccggtct    157560
     tctcgtacgc cgtgaagccg ccataccggg ccacgccgct ccacgcggcc ggcgcgccgg    157620
     ccaccagcgc cgacacgtcg aagacgcccg gctgcgcgcc ccccagggcc agcacgttgg    157680
     cgccgcccgt ggcgacggca ttgccttgca ggacggaccc cgcgcgcagc tcgaaggtgt    157740
     tgcccgcgcc atcgatacgc accgcgtcgg cctgctggcc gtccgcggac aggccgccgg    157800
     cgatgcggcc ggcgttgacc aggcgattgc cgttgccggc gatccgcacg ccggcgccgc    157860
     ccgcgccgcc atcgccgccg tcgagttccc ggctggcctc gccccgggcc ccgttaccgc    157920
     cctggatcag gcctgcggtt tccacctgcc accgcgacgc cgacacgaac aggccggccc    157980
     cgccggcgcc gcccgcgccc gccctgtggg taaccggcca cgtggcgccg ccgtcgtcgc    158040
     ccgcgccgcc gcgactggac tgcagatccg cgccgacgct gagcgcctgg gccacgccgc    158100
     cgccgttgcc gcccgccgcc cccccccccc gccatctcgt agaccaatgc gccgccgcct    158160
     ccgccactgt cactgccgcc gccgcccccg ccatagtgag tcgattcgct gctgccgccc    158220
     gcggcgccgg caccgccgcc ggcgccgccg ttaccgccgg gtacgggcgt cgtcctgtcg    158280
     ccgcccaggc ccggcgcggg tccgctgccc ggctgtcccg ccagccccgg gccgctggcg    158340
     cccgcgccgc cggacggccc gccgccgtcc acgcccagca gctcggcatg cgcggcagcg    158400
     caacaggcca gcgcgccggc cagcagcagt ccgccgcgcg cggcccgcgc gggcaacgat    158460
     ccaaatgggt gttcgattcg aaaaatcggt ttcatgaacg agcatcgagt ccgggttgtc    158520
     gcgaccctgg ggccgcgcta cagtgcagca aaagttacga ttactttcgc tctgtgtctg    158580
     tcccccgaac gggggacagc cggggccgca cggagacgca cgccatgcaa acctgtacgc    158640
     cgacgcggcc ggccggatcg ctgcgtatcg ccatcgtgga ggacgacccg gcgtttcgcc    158700
     acgccgtggt cgcggtgatc gcgcacgagc ccggcatgtc cgtgctggcc caggcgcaga    158760
     cctgcgccca ggcgcgggcc atgctgcaag gcccgccggc cgacgtgctg ctggtcgacc    158820
     tggggctgcc cgacggatcg ggcatcgacg tcatccggca ggcgcggcgg ctctgggacg    158880
     attgcgacat catggtcaac accatgttcg gcgacgaggc gcacgtgatg cgctccatcg    158940
     aggccggcgc ctgcggctac ctgctcaagg acagcgaacc ggccggcatc gtgcgcgaca    159000
     tccgcgccct gcgcgacggc ggcagcccga tcaacccgct gatcgcgcgc cagttgctcg    159060
     accggctgcg ccagggcctg cctgccgccg cgccgcccgc cgcgatggcg ctgtcgccac    159120
     gcgagcatca ggtgctcgaa cggatcacgc tgggctacac ctacgacgaa atcgcccgcg    159180
     acctcgaggt ttcgcgccac acggtgcaga ccttcgtgcg gcgcatctac cgcaaactgc    159240
     aggtccactc caaggtcgac gccatcaatg ccgcgcgcgg cctgtgcccg gatggctgag    159300
     cgccggcgcc tggcgcggcg ggcctgggcg ctgctggcct ggctgtggct ggcgctgccc    159360
     gcggccgtgc tggccgagcc gcggcatttc acggccgcgc agttcctgct gcaggacgag    159420
     gcagcggccg ctgcgccgga tcgcgtgccg gcgttgggcc cgcccggcga ctggcaaagc    159480
     gtggcgctgc cccatgccgg cctgcagcgc cgcgtggtgc ccgatccgca ggccggcgac    159540
     gcggcgctgg cctggtaccg gctggacctc gacgccagcg gtgtcgacga ccccgtgctg    159600
     tatctgccgc gctggcagac cgtcggccgc ctggccgtct acggcgacgg caagttgctg    159660
     tatcgctcgg gcggcagcgc gcaatggagc ggcttcaacc ggccggtgtg gctgcccctg    159720
     gctgccggcg gcccgccgcc cgcgacgctg ctgctgcgca tcagcagcct ggacggcgcg    159780
     ggcgcggggc tgtcgaccgc ctgggtcggc gccgccggcg aactgcgttg gcgctacgag    159840
     ctgcgccgct ggctgcagca ggacctgccg tacctggcca gcgcggtgtt cctggcgatc    159900
     gggctgttcg cgctgggcgt gtgggcggtg cgccgcaagg agtccatcta cggcctgttc    159960
     ttcgcggctt ccgtggtgtt ctacctgcgt tgcctgcatt accacgccgg gccgttccag    160020
     ttgctgctcg acgacgaatg gttcagctgg ctgaccatca cctcggtcgg ctggctggcg    160080
     attgcgtcct atttcttcgc gttccgcctg cacggccgca cctatccgcg cagcgagcgc    160140
     gccatgctgg ccggcatggg cgcgctgacg gccgccatgc tgccggtgtg gcagatccat    160200
     ccgcatctgg tgctgctggc gccgctggcc tacctgggca ttacggcggt cagcctgttc    160260
     gcctgcctgc tggcggtctg gggcgcgtgg cgggccggtt cgcgcgacgg cctggcgctg    160320
     gcctgctgga acctggcggc catcccggtg gcggtgcacg acatgctcct gcagaactac    160380
     aggctcagca tggaacacgt ctacctgctg ccctataccg gcatcggcat gttcgtcatc    160440
     ttcctgtatg tggcctaccg ccgctacctc aacgcgctgg ccggggccgc cggcgcgcag    160500
     gccacgctgc agcgccgcct ggccgagcgc gaacgggagc tggagcacag ccaccgccgc    160560
     ctgcgcgacg tcgagcgcat ccgcatcctg gccggcgagc gcgaacgcct gatgcaggac    160620
     atgcacgacg gcctgggttc ctcgctggtg tcggcgctgc gcatggtcca gcacggcaac    160680
     agttcggagg gcgcggtcgc tcaggtgttg caggaatgcc tggatgatct caggctgacc    160740
     atcgattcgc tcgaacccgc ccagaccgac ctggccctgc tgctggccac gctgcgcttt    160800
     cggctcggac cgcgcctgca ggccgccggg ctggcgatcg actggcgggt cggcccgctg    160860
     ccgccggtct cctggctgac gccgccggcc gccctgcacg tgctgcgcat cctgcaggag    160920
     gtgttcacca atatcctcaa gcatgcgcgc gcgcgccgcc tgaccgtgag cacccggctc    160980
     gagcctgcgc acgcggtcat caccatcatc gacgacggcg cggggttttg cggtccgcgc    161040
     caggcgccgg ccgcatccag gcccgggcgc ggcctgaccg gcatgcaggc gcgcgcgcgc    161100
     catcgaggcg cgccttctct ggcgcgtggt ggcgcgcggc agccattttg aactgcatgt    161160
     gccgcgcggg cccgctcaga agctgactgc caggccgacc gaaaaccccg atacgttgtt    161220
     gccgaacaca tagcggccga ccagccgcgt gcgggtgatg aatacgtcgt aggcgctgga    161280
     atcgagctcc aggcccgcgc ccaccgaggt caggcgatcg aaacccagga tgccgcgctg    161340
     atcgcccagg aattccgaat gcgtcagctc cagcacgtag cgcagcggcc gctgcagcag    161400
     cgtcgcgccg gtgggcgccc gatagcgcgc ccacagattg gccgattgcg ccgtggcctg    161460
     gccgcgcacc gccgccgagc tgtcgaaact gcgcagccgg atctccgagt agcgcaattc    161520
     cacgtccacc tcgtagcccg gccggtaatg ctcatagtcc agcatcagcg acccgcccag    161580
     cccgtaggcg ttgagcgagc cgcggtccag gaagtcgatg tcctgcccgg tctgccgccc    161640
     cacgtaccag ctggccgcgc gcaggtcgct ggtcacgttg cccagcgcca cgttgaagat    161700
     gggccgcagc ttcagctcgt cggtcagcgg gaaatcccag cctatgccgc cggtggccga    161760
     gacgctgttc cacttggcgg ggatgcggcg cgattcgacg ccttgggtgg cgatgaaggt    161820
     ggggtcgtag cggctggccg ccagcacgcc ttccaggtag aggggcaccg atttcgagat    161880
     ggtgtcgccg ccgcccagct gcgtcatgta gaactcggtc gacccgctgg tcgagccccc    161940
     gccgccggcg atgttcaagg cgctggtggt gatgtcggga acgatggaaa acgacatcag    162000
     cgccagcacg ccattggcgc gcttttgcag gtcgtccttg ctcaggcgca agccttgctg    162060
     gccccatgcg gcggatgccg cggcgcaggc cgcaagcgcc atcagccacg agcccagccg    162120
     cctggccgcc ggccgcatgc ctagcgctcc ccggccccgc ccacgaacca gcgcagatac    162180
     ggattgtcgc ggctggcgcg cgccagcgcc ggcgcatggc tggcccatgc ctgccggtcg    162240
     ccctggtagg cggccagggc gctgcggtac aagcacgtcc agctcggcgc gcgcgcgggc    162300
     gatctcggcg gcggcgatga cgccgtcgcc ctgcaggggc ggcgcgccgc gcagcgccat    162360
     cagcgccggc agcgtgcgcg ccacttcgcg cggccgcacc cagccggcat actcgatggc    162420
     gggccggtcg tcggtcaccg cgggcgtctg gccggcaaag cgcgccagcc ccgcgcggtc    162480
     ggtgacccag gtcgccagca gcgccgccgg cgaatccacc cccacttccg acagcgcttc    162540
     gcgcacgccg ggctgggcgt agcgcgcggc gatgcgggcg gcgtccagcg gcaggggcgc    162600
     cagcgagccg accagcagca tttcgtggaa ctccgtggtc cacagcgtgg cgtgcgggaa    162660
     cacctcgatg aagctggcca ccagcgcgcg cgtatcgtcc aggttctgcg tgggcagcgg    162720
     cagccattgc gcggcgatgc cgtacatgtt cagccgccgg gcggccagcg cgtagaagtc    162780
     gcgcgaatac aggttgacca cgccggcggc cgacggcggc ggcggctcca gggtgatgag    162840
     gtcgtagcgt tcggggctgg ccagcagctc gcgccgcccg tcgcgcagcc gcacttgcag    162900
     gccggggtcg ccggccgcgc cgtaggcgcc ctggaacagc ggcgcggcgt gcagcacgtc    162960
     gggcagcagt tcggccacca cgcgctggcg cagccccgga tagcgcgaca gcgcgccggc    163020
     cgtgatgccg gtgccatagc cgatcaccag cgccgagcgc ggttcgccgg catgcacgat    163080
     gagcggcagc aaggcctgca gccgcatgta gcgcagcgaa ggcatggcgt cgcccgagtt    163140
     ggagacgccc tggatgtaga gacgatggaa gcgctgctcg ccctgcccgc tttccaccac    163200
     cgccacggtg ccgccatgat tctcttcgta gaacagcagc ctgccgccct gggcgcccgg    163260
     cagcagccgc gccaggtgcg aggcgggcaa ggcccaggcc aggatcagcg ccgcgccggt    163320
     cagcgccgcc accaacgccc gcgccatcgc ggccggggcc ggcgcgcgcc acgccgccag    163380
     cgcgcccacg cagcatgccg ccagcgccag cagcgccagg gcccgcaccg tgcccaggta    163440
     cggcagcagc acgaaggccg tcagcgcggt gccggcgata ccgcccagcg tattgccggc    163500
     cagcaccgcg ccggcgccct ggccgcgccg cccgggcggc acggcaatgc gcagcacggc    163560
     cggaaacgcc gcgcccagca agagcgtggg caccagcacc accgccgccg cggccacggc    163620
     gaagcgcgcg ctcatgccgg ccaggccgct ggcggtccag tccaccacgg cggcctcggc    163680
     cacgctttgc gcggccacca gccagcggcc cagcaaggcc gcctcgacca gcgcggccac    163740
     cccggcgccg gcgatcagca ggccgaacac ccgccacgga tcgcccagcc ggctctccca    163800
     gcgggcatac caggccgcgc cgccggccag ccccgccagg tacaccgcca gcacgatgga    163860
     aaacgcgaac gcgcgcgtgc tcatgaaggg cacgatcatc tgcgaccaca gcacttcgta    163920
     gcccatggcg atggcgccgg ccacgctgta caggccgatg gccaggcggg ctcccggcga    163980
     ccattcgcca gccgcgggcg tcgccacggg ctgctcggcg agtccggcga ccgcgccgcg    164040
     ccgatggtcc agccagcagg cgcccagcgc ggccagcagg ttcaggcccg cggccgccca    164100
     ggcgctgccc tgcacgccca gcgcgggaat cagcaggaag gccggcaaga gcgcgccggc    164160
     gatggccccg ccggtattgg ccgcgtacag cgtggccccg gagcgcccca cccggcccgc    164220
     gccggccgcg cgcagcagca ccggcaaggt gccgcccatg agaaacggcg ccgcgcccac    164280
     cagcagcagc accgccagcc aggccagcca ggggctgtac tgctcgccct gcacgaagag    164340
     cggcgcggcg cgcgccagcg ccagcgtgac cgccagcgcc aggaccgcca cgccggcctc    164400
     gatggccgcg tacaggcgca gcgggcgcag gctgcggtcg gcccggcgcc ccagccacca    164460
     gccgccggcc gccaggccca ggaagaaggc gctgagcgcc agcgcgatgg cgtgcacttc    164520
     cacgccgacg atcagcgaca actgcttgat ccacaggatc tggaatatca gcgccgcagt    164580
     gccggacagc gccagcaaga gggccggcgc ccacagtccg gccagcggcc gagcttcggc    164640
     gcgcggcggc gccgccgcgc gcccggcccg caagggtgtg ctgctcatgt cgagtgatcc    164700
     gtaaaagaca tgcccatggc gtgcgcgacg caagcgggcg cggggcctgc ccgcgcccgc    164760
     ccgcgcctac ttgccctgct tcttcttctg ctcttcgaag tactgcatga tcttgcgatc    164820
     cacctcttcc tgcacctggt ccacgctgaa gctggcagga cgctggctgg gcggccactc    164880
     gacgaaggtc tccaggaact ccgaggcctt ggccgagccg atgaaagcca ggtaggcgtt    164940
     cttggacagc cagtcgtagt actggtcgga cacgatatcg gcgcgctcgt aggggtccat    165000
     cctcaggttg aacaccttgg gcacccgcag gcacacgaag ggatccttcc acacgtcgaa    165060
     gccgccgggc gcgcgctgtt cgcagaacac gattttccag ttctccatcc gcatggcgac    165120
     cagcaggccg tcgtcgttga agtaatagaa ttcgttgcgc gcgctcttgt cgctcttgcc    165180
     ggtcaggtac tcgagctggt tgtagccgtc caggtgcact ttgtagttct tgccgccgtt    165240
     gcccgcggcc cagcccttga gcagcttttc cttgatgtcg ccctcgcccg ccgcggccag    165300
     cagcgtcggg aaccagtcca gcccggacac catgccgttc ctggtcacgc ccgccgggat    165360
     gtggccgggc cagcgcacca tggcgggcac ccggaacgcg ccttcccagt tcgagtcctt    165420
     ctcgttgcga aacggcgtgg tggcggcgtc cggccagctg aactggttgg gcccgttgtc    165480
     tgtcgtgtag accacgatgg tgttgtcggc gatgcccagg tcgtccagct tcttgagcag    165540
     cttgccgaca tcctggtcgt gctcccacat gccgtcggcg tagtcgttgc cgggcatgcc    165600
     gctcttgccc tggtgctcgg gccggatatg cgtatagata tgcatgcgcg tggtgttcat    165660
     ccacacgaag aacggcttgt cgcccttgcc gtgcttgtcg atgtagtcca gcgcggcgcc    165720
     cacggtttcg tcgtcgatgg tctccatgcg cttggaggtc agcgcgccgg tgtcctcgat    165780
     cttgccgtcg gcgctggcct tgatgacgcc tcgcggcttg tacgccttga ccaccggatc    165840
     cttgggatcc ttgggccagt acggccgctc gggttcttcc tcggcattga ggtgatagag    165900
     gttgccgaag aattcgtcga agccgtgctt ggtgggcaga tattcgtcgc ggtcgcccag    165960
     gtggttcttg ccgaattgcg cggtcacgta gccgtgcgcc ttgagcgcct gcgcgatggt    166020
     gacgtcgcgg tcctgcaggc cgacgtcgac gccgggcacg ccgaccttgg acaggccggt    166080
     gcgccgcggc gactggccgg tgatgaacga ggaccggccc gccgtgcaac tgttctcggc    166140
     gtagtagtcc gtgaagatga tgccctcctt ggcgattcgg tcgatattgg gcgtggtgta    166200
     gccgaccacg ccgcgcgtat acgcgctgat gttggcctgt ccgatatcgt cgccgaagat    166260
     caccaggata ttgggcggct tgccggaggc ttgcggcttg gccgcatcgc cctgggcctg    166320
     cgcatgcgcg ccggccgcca ccgccagccc cccggcggcc accagcgccg ccgtcaacca    166380
     tcgtcttgca ttcatgactg ctctcctcgc ccgacagggc cttgtgccgc caagtcaaca    166440
     aacttcaggg ttgttcgaat gcgtatacgc gcttccactc ggtcttcatg tccaccacgg    166500
     tccagtcctg ccgccgcgct tcgtccagcg cgcgatcgag cctgccgatc cgggaatcgc    166560
     ggtcataggc ccattcgcgc tgcgcatcgg tgtgatgcac caggccggcg aaacgcttgc    166620
     catcgcccgc cgcggtccat tgcagcatct gcaggtcgcc gtccgaatta ccgaacgcca    166680
     ggatcgggcg ccggccgatg tagcgctgga tggccaccgg cttgcccggt ccgtcgtcgt    166740
     tgaattccag cttgccgtgg cgccacagcg tgggctcgcc atcgcgcacg ccgtaggtcg    166800
     tgacgaagct ggagccgatg acctgctccg gcggaatgcc ataggcctgc tgcgtccagg    166860
     gccgcatgaa ctcggtttcg ccgcccgaga cgatataggt cttgaagccg tgggcgcgca    166920
     gatagtccag cagttcgcgc atgggcgcga aagtcagttc cgtatagagc cggtcgaagc    166980
     gcggatggcg ggcggtcgag gcccagtacc tgacgctgcg ggtaaaagtg tcggtgctca    167040
     tgtcggtgtg cgtggcgccg acgattttca tcaacgccgc gtcgccgccc ttggccagcg    167100
     ccgcgtggtc gtcctggagc gcggccttga acggctggcg gcgcgcccag tcgggatggc    167160
     gcggggccat gctcttgacg cggtccagcg cgaacagcat ctggaagtac atgggctgct    167220
     cgctccacag cgtgccatcg ttgtcgaaca cggcgatgcg ttcgtcggcg gcgacgaaat    167280
     ccggcccgcc ggagcgcgtg accgcgcgca cgaactcgac gatggccgtg cgcgacggtc    167340
     cgtcgttcca ggacggcagc tcgtcgacgg acgcggcctg ctggcgcggc gccgcgcagg    167400
     cggccagcag caaggccatg gcggccgcgc ccaggcgcgc cgcccagcgg cgccaactct    167460
     cggtcgtatg tctgttcatc gtcagctcct tgacgcgcgg cgcgcgcggg gttgagaacc    167520
     tcaggcaggc catgcgccgg cgcggcggcg cggcgcgccc gccaattgcc gcgccattgc    167580
     cgtgacgcca tgcccaggcg ggctcgccag ccggcccggg ccggggcgcg gccataggcg    167640
     tcgcgcagcg cggctgccgc cgcgccttgc gccgcctcgt ccagcgtcgc cgtggcgccg    167700
     cgcatatcgg gcgcgccggc ggccagcgcc agccagcggt agaacgcgct cagcgtgccg    167760
     ctgtcgcgcc gcgcctcgcg gcgccaggcg cgccagtgcc agggctcgcc ggcccgccgc    167820
     cgcgcgcgca gccggcacag gccctggcgc caccagggcc aacccagcca gagcgccagc    167880
     aaggccagcg caccgccggc ggcccaggcc agccaggccg ccggcagcac ccagcgcaag    167940
     ccgtggcgca gccgggccag atcgtcggtc agcgagaacg gcggcgcgac ggccggcgcg    168000
     gccgccaccg cgaaggtgcg gccgggcagc gcctgctggc gcggctgccc gccggcgccg    168060
     tcgcgccagg ccagcgtcac tgccggcagg ctcagctcgc cggcctgctc ggccacgtaa    168120
     tcggcgcgat cgatacgttg cccgcccacg aaaccgccac ggccatcggt cagcgtggtc    168180
     acctccggtt cgcgcgcata gcgcttgaaa ccgggcacat cggccaacgg cgccggcggc    168240
     agcagcatgg cctgcacccc ttcggcgcgc tgcgtaatgc tgcgcgtcac ccggccgcct    168300
     gccaccagcg ggtccggcgc cagcgcgaag tcctgcgaca ccgtcagcgc gccgtgcggg    168360
     gccggctgcc cgcccgccgc gccgccgacg gtgaacgaca gcggcgcgct gctggcgctg    168420
     gccggcgtct tgcccggccc cacctcggcg ctgaccgcca gcgccggcac ctgcacctgg    168480
     cccgcggcgg tgggactgag cagataggtg tagcgcagcc cgctgtacgc cacgccattg    168540
     tgttcggcgc gcaccagctc gccttcgccc gacggcggcg tcaccatcac gcccggcagc    168600
     gtcagcgcgg gcagccgcgg cggctgtgtg aaccaggtgg tggtcatcac gtccagctcc    168660
     aggcgcagcg tggcgccagc ctgcgccggc gcgcctgcgg gcaggcgcgc tgtcacgcgc    168720
     agcggtggcg cgtcctgggc gcgcggcgcg ccggccagcc ccaatgccag caaggccgcg    168780
     caggcgagcg gcagccagcg cctcatggcc gcgctccggc cgccgcgtcc tcggcggcga    168840
     acttgctgcg caggaagcgc gccggcgaca gcgtcagatt gcgcagccag gcctcttccg    168900
     agccggcctg cgccaccggc gcctggctca tcttgcccgc ctgcgcggtc cggtcggcaa    168960
     tcgtctggtc gggcggctcg gccggctggt cctgctgcgt ctgcgccatg gcggccagca    169020
     ggcgcgcgac gatgccgcgg ttcaccacgg ccggctgcca gcccggcttc agcgccagcg    169080
     cccggtcgta ggccgccagc gcggcgtcgt accgatgcag gcgagtctgg gtattgccga    169140
     catagaaata gccctcggcg ctgggcaggg tcgagaatgc cgccagcgcg gccttgtaat    169200
     cgccggcttc gtaggccgcc cggcctttcc agtacggatc atggaaatgc cgcgccgctt    169260
     cgtcgtagcg cccgtgctcg aaggcccggc ggccctgctg gtcggcggtc aggaaggcat    169320
     cggccagcgc atcggcgcgc gccggctgcg gcatgccggc catggccacg accagcacgc    169380
     cggcgctcca ggccacgctc cagccgcggc gcaccgccag caaggccaat ggccagcaca    169440
     gccagtatcc cgcgtccttc caatgcaccg gcccggactg cgcatcctgc accgcacgga    169500
     aatgcgcctg cgcatgcagc gcgatccagt cctggtcgtc cggcccgccc gtcaggctgc    169560
     ccagcgccgc gccggcggcg cgcgccagct cctgcagggc ctgcgtatcg atgccgttca    169620
     cgcccaccgc catgaccagc acctgcatgt cgcgcgcggc ctgggcctgc cggcgcacgg    169680
     cgtccatgcg cgcacggtcg gcgccgtcgg tcaggatcag caaggtgccg ccggcgcgct    169740
     cggccgccag ggcctgtgcg gccagcgcaa tcgcgccgtc ggcgtcgcgg cccgggcgct    169800
     cgatcaggcc ggtggccagg gcctgcgcaa acaggtccag caagcccgcg tcgtcggtgg    169860
     gcggcagcac cagatgactg ctgcccgcat aggcgatcaa cccggttcgg gcggccgcgc    169920
     gccgcgccgc caggtcgcgc agcacgcgcc tggccgcttc cagccgcgtg ggcggcacgt    169980
     ccgcgccgtc catggaagcg gacagatcca gcgccacgat gagcggcgcc acgttgtcca    170040
     gataggccgg ctcgtcgcgc tgccaggcgg gccccgccgc ggcgacgccg cctagcgcca    170100
     ggaacagcgc cagcgcatcg atgggacgcg gcccgcggct gcccggcgtg cgcagcacca    170160
     ggtacggcag cagcgccggc gcgatgcgca ggtcgcgccc gggcgcgccg cgctcgccgc    170220
     ggcgcgccca ccacagcagc gcggtcagcg gcacggccag cagccaccat gggcgcagga    170280
     aatggaaggc gctcaggtct atgtccatgc gtcctcccgg cgcgcctgcc ggtccgggcg    170340
     cgccgagcgc caggcggcca gggccccgcc ccgccatgcc acagcgccag caacgccagc    170400
     gccgcgccca gcggcatcca gaaatcctcg cgcttgggct ggtggcgcag cgtgcgcact    170460
     tcgtgcggcg tgatgcggtc cagcgtggcg tacacctcct gcagcgacgc ctggtcgcgg    170520
     gcgcggaaga aacgcccgcc ggcgatgcgc gcgatgtcgc gcaaggcgtc gaaatccacc    170580
     cggtcctcgc cgctggcggc ggggtcgccg atgccgatgg tgtgcaccac gacccgatgc    170640
     tgcgcggcca gctcggccgc gcgcgccggc ggcacggcgc tggccgtgtc attgccgtcg    170700
     gtcagcagga tcagtatctt gtcgcgctcc cgggcgtggt ccagcatgcg gatgcccagg    170760
     ccgatggcgt cgcccagcgc ggtgttgggt ccggccatgc ccaccgccgt gcgctgcagc    170820
     agcaggcgca gcgcggcgtg gtcgcgcgtc agcggcgcct gcgggtaggc gccggcgccg    170880
     aacacgatca gccccagccg gtcgtccggc cgtttgtcga tgaagtcgcc cactaccgcc    170940
     tggaccgcct gccagcgcga cgccggccgg ccctgcacat cgcggaaatc ctcgctgtcc    171000
     atggactgcg agatatccac ggccagcagg atgtcgcgca tgggctctac gtgcgtgagc    171060
     ggcggctcga cccattgcgg acgcgccagc gccagcagca gccacacggc gacgttcacc    171120
     cacaactggg cccggccgcg ctgcacgccc gggcgcgtgg gcgacttgcc ggtcagcgtg    171180
     gccatggcgt cgaaaaaagg caggcgcagc gcctgccggc cctgcacgta ggccggcagc    171240
     cagcgatagg ccgccagcgc cagcggcgcg gcggcgagca gccagggata ctcaagccgc    171300
     cacatgatgg ctctccaccc agcggcggct ggccgcgaac aggcgcgcca gcgccggcgc    171360
     gtccagcgcc cgcacggcgc cgtcgggcgc ataggccagc agcgccagca tgcgcgcgct    171420
     gtcgtccggg aacgcggcgc ctgcggcatc ctgcgcgagg cgcgccagcc acgcctggcc    171480
     gcccagcggc gccacggcgg gctggccggc cgccagcgcg gtccgcttga gcaggcccgg    171540
     caaggcgcgc gcggccagcg gatcggcggc cgcggcgcgc gccagccgct gcagctcggc    171600
     cagcgcctgg cgccggtacc ggttgcggcg ccggcgccgc cagcccgcgt agccggccca    171660
     tgccgcgccg gccagcacaa gcgccgccag caccgcccag ccccaggtct gcggccaata    171720
     cggcaccgcc gccggcagcg gcagctcctg caactggtcc aggccgggca gcgcgtcgct    171780
     catcgccgtg ctcccgtctg caggcgcccc agcgcgcggc gcagctgcac cacttcgtcc    171840
     tcggccgtgt cgatcgacag cagcggcaca cggctgcgcc gcagcaggtc ggccacttcg    171900
     cgcaggcggc cgctgaagaa gtcggccagc ggctggcgct cgcgctgccg gcccacggca    171960
     atctccagct gcaattcgcc ctgcgtcacc accagccggc cgcggcgcgg cagatcctgc    172020
     gccatgggat cgaacaccag catcgccacc acgtcgttgt gccgcgccag caggcgcagc    172080
     gtgcgcaagg tctcggcgtc ggcgccggcg aagtcgctca cgatgcacac caggcaatcg    172140
     tgcggcgcat gcgccagcgc gccgcgcagc gccgcgttca gtccggcgcc cgccggccgc    172200
     tcgggccgcg ccgcggacag cccggcgttg gcgcgcgcca cttccgccag cagcgcctgc    172260
     acccggtcgc ggctgcgcag cggcttgaac gcccgcacgc cgtcgtcgtc gaacaccagg    172320
     ccgccgacgc ggtcgccgcc gcgataggcg gtccaggccg ccagcgccgc cagacgggcc    172380
     gccaccgcgc acttgaaggc gcgcaccgac ccgaaataca tgctcatgcg ctggtccgcc    172440
     acgatcatcg cgggccggtc gcgctcctcg gtataggcgc gcacgtacgg cttgccgtag    172500
     cgcagcgacg cgcgcgggtc gagctggcgc aggtcgtcgc ccggcacata gcgccgcagt    172560
     tcggcgaagt ccagcccgcg gccgcgcagc cgcgagccat gcaggccggc cagcacgctg    172620
     cccagcggct ggccggccac gaacgacagg ccgcccacgg ccgcttccag cgccatcagt    172680
     tcgggcaacg gcgggtggac gggatgggcg gcgcgcggca tcggcgttcc taggcgggca    172740
     cggccacggt gtccagcagc cggtcgatga cctgttcggc cgtgacgccg tcggccaccg    172800
     cgtcgtacga caggtgcagg cgatggcgca gcacgggatg cgccacggcg cgcacatcgt    172860
     cgggcgaact gaagtcggcg ccggccagcc agccatgcgc gcgcgccgcg cggtccagcg    172920
     cgatggcgcc gcgcgggctg gcgccgatct gtatccagcg gcccagctcg gcgtcgtagt    172980
     cggccggccg ccgcgtcgcg ttgaccagat ccacgatgta gcggtcgacc gccggcgcca    173040
     catacagggc ggccgccgcg tcccggcagg caaacaactc ctcctgcgca agccgcgtcg    173100
     cggcggccgc gccgggctgg ggcgcggcgc gcagcaaggc cagcatcgcg ctctcgtcgt    173160
     cggcggccgg atagtccagc cggatcttca tcaggaaacg gtccatctgc gcttccggca    173220
     gcggatacgt gccctcctgc tcgatggggt tctgggtggc cagcaccatg aacagcggcg    173280
     ccatcggccg cgtcaccccg cccaccgtga tctgccgctc ctccatcgcc tccagcaggg    173340
     ccgattgcac cttggccggc gcgcggttga tctcgtcggc cagcggttgc cgaacagcgg    173400
     cccctgctgg aactcgatgc gctggcggcc ttcggcgtcc tgctgcagca cgtcggcgcc    173460
     ggtgatgtcc gaaggcagca ggtcgggcgt gaactggatg cgccgcatgg tcgcgtccag    173520
     gtgcgccgcc agcgccttga ccgtgcgcgt cttggccagg cccggcaggc tttcgagcaa    173580
     cacgtggcca tcggccagca aggcgaccag cacgtggcgg atcaccgccg cctgccccag    173640
     caccgccgcc gacaccgcct gttccaacgc cagaatgcca tcacgattgg ctatgcatgc    173700
     tcctgtgtgt gtccgcgccc acgtgcgcgg gccgccggcg cgcgccggct cagcggctgg    173760
     cgaggcggcc ctggcgggcc tgggccagct tccattgctc cggcgtcatc accgttcgaa    173820
     agcccaggtg cgacatggga ttgagcggat cggtgccccg ccgcgcgctg gcgcggtagc    173880
     tgatgcaata ggtgtcgctg cacaggaagg aaccgccgcg cgtcacgcgc ttgggcgccg    173940
     cggccggcac attgccgtcg tccgggtcga aactgtcggc ggggccggcc ggatcgagcg    174000
     ggggttcgcg gtactgggcc tggatccgga acgcgtcggc ccggtaccag tcggccgtcc    174060
     attgccacac attgccggcc atgtcgtaaa ggccatagcc attgggcgcg aagctgccca    174120
     ccggcgtcgt gccgacctgc actttctcgt ccttgacgac cggaaacggc tgctgctggc    174180
     gggtatccca gatgttggcc atggcctggc cctgcggcag cagctcgtcg ccccaggtgt    174240
     aggtggcctg ctccagcccg ccgcgcgcgg cgaattccca ttcggcctcg gtgggcaggc    174300
     gcttgccggc ccagcgggca taggcttgcg cgtcttcgta cgacacctgc acgaccgggt    174360
     ggtcgtcctt gccgtcgatg ccgctgcccg gcccttgcgg atggcgccag ctggcgcccg    174420
     gcacgaagcg ccaccagcgc gaatagtcgc gcagcgagac ttcgctccgg gtgcccacga    174480
     ataccatggc gccgggcgcc agctggctgt cgtccggacg cggcgtgccg ggcggcagct    174540
     gcggccgcag gtcttcccag cgcggcttgc gttcggcggt cgtcaggtag ccggtggctt    174600
     gcacgaagcg gcggaactgt gcgttggtga cgtcgtgcac gtccatccag aacccgctga    174660
     cccgcacctg gtgcgcgggg cgctcgttgg gctgcgacag cttgtggtca ttgcccatga    174720
     ggaactggtg gccgggaatc caggccatgc cggccggccc cgccttgccg tcgcccagcc    174780
     tgacggcggg cgcctgcggc gcatcggacg tgctcgccac ataggcgccc agcgcgcccg    174840
     cggcgcccac gatggtcgcc atggccaatg cgatcttcag ctgctgcttc acggcccttc    174900
     tccgtcacgc gtctgagaac ggagcgcccc acagaggcgc catcgccaac acggtaccgc    174960
     caaggcttgc cagatccagc tgaatgtccc ccgatccgcg cccagggaga cattcgaccc    175020
     tggcaggata cccagttttg ttttcagttg tcatcaactt tggggcaatc ggtaaccttg    175080
     cgcaccggct tgacgaccct ggggaatcgg cagaaactcg ccgggcaggc agcgagccag    175140
     cgcgcatcca ccgaccagcc ccccatgttc cggatgccat ccgccgcctg gctgctcgtc    175200
     cgtccggctt cctacgcagc gatcgtggag acaatatgcg cagcaggttt gcatggcgct    175260
     tttgcaacgc cggtctggcg ctggccgccc tgcccggcgc ggcacgcgcc accgaaggcg    175320
     cgctgggcag gctggtcacg ggcacgacgg tgcagcccaa tgccggtgtg gtgtcgccgc    175380
     aacccattac ggtgctgagc ctgggccagc tctatctcga cggcaggata ggcggcagcc    175440
     gcgaagtgcc cgtggcgggc aagacctcgc tgggcctgga cgccgaaatg gccctgaccc    175500
     tggctacgct catgaagacc tgggacaccg gccccggacg ctggaacttc gcctccagcc    175560
     tgaccgtccc ctacctgtgg ctcaagatca ccgccacgct ggccggcgag cgcggacgcg    175620
     cggcccgcga aagcgacatc gcgtccaatc tgttcgacct gaacttcacg cccctgatcg    175680
     ccggctacca cttctccgag acccagcacc tggccctgag cctgagcatc tgggcgccca    175740
     ccggcaagta cgacgccgac gcgctggcca accccagcct gaacaactgg accttcattc    175800
     cgcaggtcgc ctataccggc atgttccccg aacacggcct gcagctcgac gccgtggcca    175860
     acgtgcagtt ctatacccgc aatacggcca ccgactaccg caacgcgccg atcttcggcc    175920
     tggagctgat gggccgcaag ctgttcggca acggcgtggg cgccgggctc atcgtcggca    175980
     cccagcagca gctggggccg gacaagggcc cgacggccga ccgcctcaac ggcttcgagg    176040
     gccgcgactg ggcgctcggc cccatcctca cctatgaccg caagctggcg gaccagcgtt    176100
     cgctgtcgtt cagcctgcgc tggaccccca ccatcagcag cacgcgccgg ctcgacagcg    176160
     acagcaccgt gctgggcacc gtcgcgctga tcttctgacc cgccgggatc tcgcggactt    176220
     tccaggccgc gccgcgcggc cgcgcgcatt cataaaatat tctgctgaat ccataaaaag    176280
     atttggtttt gcctgcccgc ccgggtctgc cttaatgtgc gcctggcgcg ggcgagatcg    176340
     tcgcctgcct tcagtcacga caacaagatg gagactcgca tgcgattgat tcgccgattt    176400
     gcccatgcct tggccgtggt gggctcggct ggattcctgg ccgccccggc ggccgccagt    176460
     accggtacct accccgacaa gccgattcac ctgctggtgg cgttctccac cggcggcgtg    176520
     ctggacacgc tggcgcgcac catggccagc gaactgtcca cccgctacgg ccagtcgatc    176580
     gtggtggaaa accgcaccgg cgccagcggc aatatcggca ccgacctgct ggcgcgcgcc    176640
     aagcccgatg gctacaccat cggcatgggc accatcgcca cccacggcat caaccccgcg    176700
     ctctatggcg agcgcctgcc ctacgatccg gtcaagggtt tcaccccgct ggccctgctg    176760
     gccgagcaga ccaatatcgt gctggtcaac aacgacctgc cggtaacctc gattccgaca    176820
     ttgatcgaat acctgcgcgc caaccccggc aaggtcgcct atgggtcggc cggcaacggc    176880
     agctcgcagc acctgtcggg ccagctgttc aagctggccg ccggcgtcga gctgctgcac    176940
     gtgccgtatc gcggcagcgt gccggcgctg accgacctgg tgtcgggcca ggtgcagctg    177000
     atgttcgtcg acgtgcccgc ggcgctgccc ttcatcaaga gcggcaaggt gcgcccgatc    177060
     gcggtcaccg ccgcgcatcg ctcgtcggcc ttccccgatc tgcccacggt ggccgagcaa    177120
     gggctggaag gcttcaacgt gcgcgcctgg ttcggcgtgc tggctccggc gggcacgccc    177180
     gcgccgatcg ccgagaaact gtcggctgat atgatcgccg ccgtgcagca gccggccatc    177240
     cgcgagcgcc tggaagcgct gggcatggac atcaagacgc tcgatggccc ggccttcggc    177300
     cagttcatcc aggacgagat cgcccgctgg gacgagatcg tcaagcgctc gggcacccga    177360
     ctcgaatgaa ccatcgggcc gggccgaagc ggcccggccc tcaccaggac acactatggg    177420
     acgactttcg gggcgcaacg ccctcatcac cggcgcggcc gtcggtatcg gcgcggccat    177480
     ggcgcgccgc ttctgcgccg agggcgcgag cgtgctgctg ggcgatatcg atgccgagcg    177540
     cggccaggcg ctggccgcgg agctggccgc aaccggcgcg cgcgcgcgtt tcgcgcgcct    177600
     ggacgtgacc gacgaagaca gcgtgcggca agcgttggag ctggccgagg ccgagcatgg    177660
     gccgctgcac atcctggtca acaacgccgg cggctccagc ctgaacgacc gctcggtggt    177720
     ggaattcgcg ctggaggaat tctggcgcgc catcaacatc gacctgctgg gcaccgtgct    177780
     gtgctgccgc catgccatcc cgcgcatcgc cgcggccggc ggcggcgcgg tcgtcaacat    177840
     ggggtcgatc gcggccctgc gcggcctgaa agggcgcgac gcctacacgg ccgccaaggg    177900
     cggcgtgcat gcgctcacgc gctcgatggc ggtggagttc gccgagcagc gcgtgcgctg    177960
     caacgccatc gcgcccggcg ccgtgctgtc cgagcgcatg gcgcgcttca tcgatgagga    178020
     tccgcgcgtg gccgcggcgg tgtcgcgcca cctgctgggc ctgcccgaac cggacgaaat    178080
     cgccgcgatg gcggtgttcc tggccagcga ggaatcgcgc cacgtgaccg gctcgatctt    178140
     ccagatcgac ggcgggcgcg ccgcggccgc gtaagaaccg cgcaacggcc gcgcctcgac    178200
     gaccggcgcg cgccgcgccc cggcccagta accctgagcg cgtcaccggt actggccgat    178260
     ccgcccgccg ccctgcctag aatcggcagg agcgtgtctt tcaagggagc ggcctgcggg    178320
     ccgcgtcgat gcggcgctcc atcgtccttt cggcggacta cttatggtcg aggccatcga    178380
     gacgttccat tggggcgcca tattccagat cgttctgatc gacatcctgc tcggcggcga    178440
     taacgccgtc gtgatcgcgc tggcctgtcg caacctgccg cgccggcaac gcatcaaggg    178500
     catcctgtgg ggcacggccg gcgcggtgct gctgcgcgtg ctgctgatcg ccttcgcgct    178560
     ggtcctgctc gacattccgt ttctcaaggc cctgggctgc ctgctgctgg tctggatagg    178620
     cgtcaagctg ctggccccgc atgaggacgc gcacggcaac atcaccggcg gcacctcggt    178680
     gctggccgcg atccgcacca tcatcctggc cgatttcgcc atgagcctgg acaacgtcat    178740
     cgccatcgcc ggcgcggccc agaacgcgca ggccgaccac cagctgtact acgtgatctt    178800
     cgggctgtgc gtgagcgtgc ccatcatcgt ctggggcagc acgctggtgc tcaagctgat    178860
     cgaccgcttc ccgctggtcg tcaccctggg tgccggcctg ctgggctgga tcgccggcgg    178920
     catgctcatc accgacatct acgtggtcga gcgctggggc gagcccgcgc ccatgctgaa    178980
     gctggccgtg gaagccgccg gggcgctggt ggtggtggcg gccggcaagt ggctggcggc    179040
     ccgccgccgc catgcccggc cgacccacga cgaatcggcc tccaccacgc cgggcggcta    179100
     gccgtccgaa accggcgccg gcgccgcccg cacggcgaac accgcgttgg ccttgagcat    179160
     cagcctgtct tcgacctgca gcaggcaagt ggcgtagatg agccggcgcc cctgcttgtc    179220
     gatgcgcacc tgcgcctgca gccagtcgcc cggcttgacc gcgctcaggt attcgaccga    179280
     catctgcacc gtcaccaccg acgcctgtgc ccgccgcgag atacagtagc ccagcgcgct    179340
     gtcggccagc gtggccagca gcccgccgtg cgcgatgccg tgcatgttgg tatgcggcgg    179400
     tcccacgcgc acggccagcg cgtcgtcggc ctcgcgcacg tagaaggtgc ctagatcggc    179460
     cagatgggcc atgaaggggc tgcccggccg ccagggcgcg aaaccgtcgg gaatggaatc    179520
     gttcataaac agggatggtt ggaggaatgc catccagcgt accaccagcc cggcgtgcgt    179580
     gcgcgctcat gggctgcgga aatcacttcc gtgttttatt taatatattt aatatcaaca    179640
     agttaagtat attttttaat cttgattatt taaagtgact tctaaacaaa tggtagcccg    179700
     gacgagccgg gttgcggcgc tttgcgccgc agcccatggg agcgcgcaag gagaattatg    179760
     ctgatgaacg cataattttc agattaactg ctaaaatatg ctaccgatcg cataaattaa    179820
     gacgtgctca tcagatcgct gctcttcgat ttatgcgttt cacagcattt ttttcttggt    179880
     cgggtgtatt ttatgcctct tgccgcatat atttcgatga agaccttgcc ggacgtgggc    179940
     gcgcgcttca gaaccttgcg caaacaggcc cgcaaaaccc agcgcgagct ggccgccgcg    180000
     acgggcatgc gtcaggaagc catctcccgc ttcgaggccg gttcggcgag cgacttttcc    180060
     ctgaacaagc tgctgacgct gctgcaggcc ctggacctgg aattcgactt caagccggcc    180120
     gtgcgccgcc ccgatctcga cgatctgctg gccgagcgac gcggccgcct ggacgacgcc    180180
     aaggacccgt cttgaagctg aacgtcttcg tccacgggac ccgagtcgcc ctcctcgaca    180240
     gccccgatgg cttccagcat cggctggcct acctgcccga aacggacccg gccagattcg    180300
     catcgctgac gatgccggtg cgcgccgagc cctggcgctg gccaacgctg catcccttct    180360
     tccaggtaag cctgcccgag ggatttcttc tcatgctgct caaggagcag ctcggtcccc    180420
     aactgggcgc caggcagctg gatctcctgg cagtcgtcgg cccgaacatg atcggccgcg    180480
     tccaggtcag cgcgggcgcg acgctcgagc ccgcgatggc actcgagagc ctggatccgc    180540
     tgctgcacgg gccggcatcg caacaggtct ttctggaact gatggcccaa tacgccgcct    180600
     ccggcgtctc gggcgtggtc cccaaattcc tcacgccggc aacccaggcg ctctttcgca    180660
     agggcaccat cgccaccgag cggcatattg tcaagggcag ctccgagcat caacccttcg    180720
     tggccctcaa cgagcatctt tgcatgacgg ccgcgcaagg caccggcatc ccggtggcac    180780
     gcaccagagt gtccgacgac ggacaagtgc tggtggtcga gcgattcgac atcgatccgg    180840
     ctaccggccg ccgcctgggc ttcgaggact tctgcagcct gctgggcctg tcggccgacg    180900
     aaaaatacga cagcacctgg gagcgcgtgg cccgcgtggc cagcgattac gtgcggccgg    180960
     aaggacggct gcaagcccgc acccaattgg cgatcacgct gctgctgagt ttcgcattgg    181020
     gcaacgcgga ttgccacgcc aagaatcttg ccctcgtcta tgacacgatc gacgacgtgc    181080
     gcatcgcacc ggtctatgac atgttgacga ttcttgccta cgaccgctat gcggccaatc    181140
     cgcccggcat ggccctcgat ggccgcaagt catggaccat gtccaaggcc ttgtggcgtt    181200
     acctgcagca gcacctcggt ttcgcacccg ctgcgcagcg cgagctggtc gaccgggtgt    181260
     gttcggcgat cgccgacacc gtgccgcaac tcaaggcgca catccgccat acgccgggtt    181320
     tcgagccggt cggcttgcgc atgctgtggg aatggaacga gggtatgaag cggctgagcg    181380
     aacgccggca gatcgccgtt cccgactggg tcgcaacggc gcgcgacgag gggctgccac    181440
     ggcccgctcc cgccgcgcac tttgccgcgc aacgcatcgg cgagtcgccg ctgctggcgc    181500
     cacgcaggcg ccgccagccg gcgcggccgc catcctgagc ggcgttgcgg gttcaatgca    181560
     tggaatgccc gccaggccgc ttcctcaggc ctgctcggcg acttcctgct ggaccaggaa    181620
     aggcagcatg gcgtcgcggg tctgttccat gtgcttgagc agcacgcgca ccgcgccatc    181680
     ggcgtcgccg tccaggatgc gctgcagcag gtcgtcgtgc tcggtctcga gctccgccgc    181740
     cacggccgcc aggggcaaca gcgcgcgctg gtagatggcc gaggcctcgg ccagctggcg    181800
     cacgatctgc agcagccggg ggctgccgca ggcgcgcatc atgacgaggt tgaactcctc    181860
     gtggcgcgcc agccattccg ggttcagctt ctgcgggtcg tcgggcgaga ccacggcggt    181920
     gccgcccaga cgatggtgcg cggccaccac gtccgactgc cagttgaggt cgccgcgcgc    181980
     gatcgactgg cgcagcgcca ggctctcgac cacgccgcgc tgctcgaaca gatccaccag    182040
     atcctcggcc gacagcccgc gcaccgcgaa cccgaattgg ggctgcagct cgaccagttg    182100
     ctcgccggcc aggcgattga gggcctcgcg cacgacattc aggctgacgc cgtgctgctc    182160
     ggatagctgg gaaaccttga gccgctggcg cggcatgaat tgtccggtaa ggatctgcgc    182220
     gcgcaattgc gcgtagacct cggcattgag tgtgcgcccg ttcttcgcgt ttttcatgat    182280
     gtggctgacc aatagtgcgg caatggtagc acacgcggca cccataactg attttcaatg    182340
     caagtatgga ttctactgta cgggtttacg cggtgttgtt ttgatcgatt tgaatacata    182400
     gaatccattt taattcgaaa caaccattgc catgccatgt ccctacccga cggatacacc    182460
     ctctcgcatc tccccttcga aggcacgcaa tgcgcctacc tgcgcggcgg cagcgggccg    182520
     acgctgctgc tggtgcatgg ctccggtccg ggcgcgtcca gcctgggcaa ttggcgcgcg    182580
     gtgctgccgg cgctggtgcg ccgcttcgac gtggtcgcca tggacctggt cggtttcggg    182640
     cagagcggcc gcaagcccgc cgcgccgtat ttcgatttcg acatgtgggt tcgccaggta    182700
     cgcgccatga tgtcccacct gggcgagggg ccgatcgggc tggtcggcca ctcgctggcc    182760
     ggcgccctgg cgctgacggt ggccagcggc aatccggcgg tgcgcggcgt ggtggccacc    182820
     ggcaccatgg gcatcccctt cgcgccgaac gacgcgacgc gccgcacctg gaagtgcccg    182880
     cgcagccgcc cggaactggt gcgggcgctg caggggttga tccacgacca ttcggtcatc    182940
     gacgaggcct atctcgccgt gcgcgagccg gtcatcttcg cgccgggcta tgccgattac    183000
     ttcgacgcca tgttcgacgc cgcgcccgca acctatatcg ccgcggccac gctgtcggaa    183060
     cggacgctgc gcggcatccg ctgtccggtg acgctgctgc acgggcgcga cgacgccgcc    183120
     ttcccgcccg ccgcctcgca acggatcgca gaacagctgg ccgatgccga cctggtgctg    183180
     ctggccggtt gctcccattc ggtggccttc gagcggccgg acgttttcct cgccatggtg    183240
     caccagcggt ttggcgcact tccctacttt ctctgaatat ccccatgaaa acaggctacg    183300
     tactcaaagg cagggtcatc gacggcacgc tcggtccggc gctggagcaa ggcgccgtcg    183360
     tcaccgaggg cgagcgcatc gcctgggtcg gcccgcaatc gggcttgccc gcgcaatacg    183420
     ccggcgaccg ccatacggtg gtggatctgc ccgggcgcac catcatgccc ggcctgatcg    183480
     acgcccatac ccatatctcc ttcggcgagt cccgctcgga ggaagagaat gcgctttata    183540
     cgccggtcga gttccgcacc gccaaggcgc tgtggtatgc ccgcaaggtg ctgcaggccg    183600
     gcgtgaccag cgccttcgac gcggccacca gctacaacat cgcccaggcg gtgcgcgacg    183660
     ccatcgacac cggcatgttc gagggtccgc gcttcacggt ctcgggcaag cagctgacca    183720
     atcaccatgg gctggaggat tcgttcccca acgaaatggc gtttccgccc gggcaaagcg    183780
     cggtgctggt caagacgcgc gaggacctgg tcgaggcgat ccactaccag gtcaaggacg    183840
     aggtcgacgc catcaaggta tcggggtcga acgacaacct gatcacgccc gatgcgctgg    183900
     ggtcgtcggc gttcacctac gaagaattca agatcatcgc cgacgagacc catcgcctgg    183960
     ggcgcctgtg cagcgtgcac gcccgctcgc gcgacgcggc gctgtatgcc gcgcaggccg    184020
     gcttcgacaa tctgttccac gcttcgtaca tcgacgacga aggcatcgag gcatgcctga    184080
     agaacgggtg cgtgatcacg ccgacgctga ccctgctggt caaccttgtc gaagccaagc    184140
     aatcgcacgc gggggcgtcc agcgcccagg ccttccgcca agagatcgag gcggccagcg    184200
     tgaatctgcg gcgcgcctac gacgcgggcg tgcccctgct ggccggcagc gagagcggct    184260
     ggtcgccggt gccgtacggc cactggcacg cgcgcgagat ggagatcttc gtcaagctgc    184320
     tgggcctgac gccgctgcag gccatccacg ccaatacgct ggcctgcaca cgcctgctgg    184380
     cgcgccacgg ccacgaggtc ggcaagctgg aggccagccg cctggccgac gtgctggtgc    184440
     tgccgggcaa tccgctcgag gacatcacct tgttgcagcg gcccagccgc ttcgactaca    184500
     tcttcaaggg cggcacgccg gtggaccgca ccgcgccggc gccgcgcgtg cgcaagtggt    184560
     acgaacgcac caagatcttc ctggccggcg tctatgagta cgaccaggag aacgcctgcg    184620
     ggcgcctggt gcagtgacct tccgattctt cccaaccggg cgccgcgcgg cgccttcccc    184680
     caaggacatg aacatgagtc aagcagccgt gcagtatctc aaccccgaag gcgccgcgcc    184740
     ggcgcagggc ctgtactcgc acgccacgcg cgtgcgcgcg ggcgacctgt acttcgtcgc    184800
     cgggcaactg gcggtgggcc gcgacggcgc cgtggccggc gtcggcgatt tcgaggcgca    184860
     attcgaccag gtgttcggca acctgcgcga tgtgctggcc ggcctgggcg tcgatttcaa    184920
     cgacgtggcc aagttcacga cctacctggt gcactcgcag gacatcccgc gcttcatgcg    184980
     caagcgcgcc gaactgttcc ccacgctgtt cgccggcaag gcctatgcgc ccagcaccct    185040
     gctcatcgtg gaccggctgg tcaaggaaga gtttctcatc gaagtcgagg cggtcgtgcg    185100
     cgcgcgcgac tgatccccac ccgcaacgga atccaacgtg aaatacatca gcttcgaact    185160
     gcccgacggc cgccgccatg ccggcgtcat gaccggcccg gacaccctcg tcgacctcac    185220
     cgacgccatg gacctgcccg acctgctgac cttgctgcaa cggcacgggc aactggccgg    185280
     cgacgtcgcc cggctggccg cgcaggcgcg ccatacggtg gcgctggacg cggtgcgcgt    185340
     gctggcgccg ctgcccaatc cgccgcgcaa tgtgttctgc gtgggcaaga actaccacga    185400
     gcatgcccgc gagttcgccc gcagcggctt cgactccagc gcggcggccg gcgccgttcc    185460
     cgccgcgccc atcatcttca gcaagccgcc ctcgtcggtc agcgggccgg gcgacgccat    185520
     cgacaccgcg ctcgatccgt gcgattcggt cgattacgaa gccgagctgg ccgtggtgat    185580
     cggcaaggcc gggcgcgtcg ccccggacga cgacccgtgg tctttcgtgt tcggctacac    185640
     gctggtcaac gacgtgacct cgcgcggcct gcagaaacgc catagccaat ggctgctggg    185700
     caagggcatc gacgggtact gcccgatggg ccccgccctg gtcagcgccg acgagatcgg    185760
     cgacatcggc gccctggaaa tcacctgcga ggtcaatggc gaactgcgcc agtccgcccg    185820
     cctgtcggac ctgatcttcg acattcccac cctggtgcgc gccatcggcg catccatcac    185880
     gctgcagccc ggcgacgtga tcgccaccgg cacgcccgtg ggcgtgggca tcggcttcac    185940
     cccgcccaag tacctgcgcc gcggcgacgt ggtgcgcgtg cgcgccgaac cgatcggcgt    186000
     gctggaaaac cctgtcatct gaccctgcgc cgcccctgac ggccattcgg gagttgccgc    186060
     catgatgcat tccgaaggcg ccgccagcgc ggcgccctcc ccccagccgc cgccgctgtt    186120
     gcgcttgcgg cagatcagca agcgcttcgg cgccacccag gcgctggacg atgtgtccgt    186180
     atcgttcgag gccggcaagg tgcactgcct gctgggcgag aacggcgcgg gcaaatcgac    186240
     cataggcaag atcgtcgccg ggctgtttgc gccggacagc ggcgcgctgc tgctcgacgg    186300
     ccacgaagtg cgcctggccg acgccagcga ggcgcgccgg cgcggcatcg ccgtcgtgta    186360
     ccaggagctg tcgctggcgc cggacctgtc ggtgcgcgcc aacctgtgcc tgggcgccga    186420
     ggccgggcgc cggccctggt cgcccttgcg gcgcggcgcc gagaccgcgc aagtcggcgc    186480
     cgtgctggcg cggctggggc tggacctgga catggaagcg ccggtgcgcc agctgcccgc    186540
     cggcgtgcag cagctggtgg agatcgccaa atcgctgatg agcagcccgc gcatcgtgat    186600
     cttcgacgag ccgaccgcca tgctgggcgc ggccgagaag cagcgcttct tcgaggtggt    186660
     gcgcggcctg cgcgccgacg gcatcgcctg catcctggtc acccaccaca tggacgacgt    186720
     cgaagcggtg ggcgattgcg tcaccatcat gcgcaatggc cggcgcgtcg actcgttcga    186780
     cctgcacgcc ggcatcacca gcgacgcggt gctggagaaa ctgaccggac gccgcgaagt    186840
     gctggcggcc gccgccgagg cgccgcgccg gctcggcgcc acccggctgc gcatcgcgct    186900
     gccggccggc ggcgggctgg ccggcatcga agcgcgcgcc ggcgaggtgg tgggcttcta    186960
     tggcgtgctg ggctgcggcg cgggcgaact gatgtacggc ctggtgggcc tggacggacc    187020
     gccgcgcgcc gactactacc tggacgacgc cccttatcgg ccgcgcaatc cggccgcggc    187080
     cttgcgccag ggcgtggggc tgctgccggc cggccgccag agccacggcg tgctgaccgg    187140
     ccgctcgatc cgcgagaacc tgatgctgac ccagctcgac cgcgtcagcc gctggcaatg    187200
     catcgatccg gcccgcgagg ccgcctgggc gcgcgaacag ctcgaacgcg ccggcgtcaa    187260
     gcacggcgac cccgccgacc cgatcgaaag cctgagcggc ggcaaccagc aaaaggcctt    187320
     gctggcccgc gccctgggcg cggcgcgccg gctgttgctg ctgcacgaac ccacggccgg    187380
     cgtggacatc ctggccaagc agcacatcca cgaactggtg cgcgcggcgg ccgcgcaagg    187440
     gttgaccgtc gtggtgctgt ccagcgacct gcccgaggtg atcgccctgt gcgacaccgt    187500
     ctacaccttc ttccacggcg cggccgtcgc gcgctacgcg cagcccggcc cggattgcca    187560
     accccacatc ctcgccgatg tcctcggcca acgggagtcc cagcatgctc actaagaccc    187620
     tggccgtatc ccgcgccgcg cgccccgcgc cggccgcgcg cctggccgac gccatcctgc    187680
     cgctgatcat cgcgttgatc gcgctggtcg ccagcctgat cgaaccgcgt ttcgcctcgc    187740
     tggacaacct gaccaacctg gcctgtcagc tggtgccgct gctgatcctg tcggtcgggc    187800
     aggcgttcgc catcctgcgc ggcggcctgg acctgtccat gtcgtccgtg ctgtcgctgg    187860
     cgggcgtggc cggcgtgctg gccatgcccg cctggggcgt cgcggcgggg ctggcggtga    187920
     tgctggccgt ggggctggcc gccggcgtcg tctcgggctt catcatcgcg cgctttcgca    187980
     ccaccccgct ggtggtcacc ctgggcatgc tgtcggtgac ccaggccatc gcgctgatcc    188040
     tgtccggcgg cgttcccatc tacgacgtgc cggcgcccta tgtgaacgcg gtgggcttcg    188100
     gcaggaccct gggcctgccc aacatggtct ggatcgccgc cgccgtgacg ctggccgccg    188160
     ccttcgcgct caagcgcacc gtgttcggcc gctacgtcta cgcgctgggt tcgagcgagt    188220
     cggcagcgtc caaggccggc gtgaacgtgc agcgctacac ggtgatggtg tatgccgcca    188280
     gcggcctgtg cgccgcggtg ggcgccgtgg tgctgaccgc ctggaccagt tcggcccagc    188340
     cggtagccgt gcccggcctg acgctgcaat cgatcgccgc cgtcgtgctg ggcggcgtcg    188400
     cgctgaccgg cggcagcggc agcatcgtgc aggtctttct gggcgtgctg gtgctgtccg    188460
     tgctctccaa tgccatgaac atcaccggcg tatcggcgta cttccagacg ctggtcgtcg    188520
     gcgtggtcat catcatcgcg gtcatcctgg accgctttcg tcgaagctga accgggcccg    188580
     cgcccgtcac accacaaggg gaatacaacc atgacactct tcggcaagac ctcgcgcagg    188640
     ccgggcctgc cgcgccaggc tgccggcctg gccctggcgg cgtgcgccct ggccagcctg    188700
     ccggcgcagg ccaaggaatc cgacggcgac cgcctgcagg gcatcgtcga acccatcgtc    188760
     gccaggcagc ctctcaagct gggcgtgacc gtggtgcacc tgctggacaa tttctacaag    188820
     ggcatcgcct acggcatcgt cgacgaagcg cggcgcagca acgtggaagt ggtgcaggtg    188880
     gcggtggccg gcgcctacgg caacgtgcag cagcagttcg cgcaactgca gtcgttcaag    188940
     accctgggcg tggactacgc cgtgctgtcg ccggcggcct attcgggcta cgacccggtg    189000
     gtcgccgacc tggccaggtc cggcatcaag accatttccg ccggcatccc ggtcaacagc    189060
     gacaagatcg ccttcggcgt gctgcaggac gacaccctga tcggcaaggt gctgggcaag    189120
     gcgctgtgcg acgacggcgc gcagggcaag caggtcatcg tcgtgcccgg agccgccggg    189180
     ctggaatggc cgcggctgcg ctacgaaggc ttcaaggaag tggcctccgc ctgcggcgcc    189240
     aagctgacgc cggcggcctt ccgcggcgaa atgagcctgg ccgacggcat ggcgcagacg    189300
     caggacctgc tgatgcgcac cccggacgcc gaatacgtgt tcaccccggt caccttcctg    189360
     ggcataggcg cggtgcgcgc ggcccgccag gccaaccgcc ccgtcaaggt gctgacctcg    189420
     gccatggtca aggagaacga agccatgatc cgcgagggcc gcctgctcgc ggtcgcctcc    189480
     gagccgggcg tcatcatggg gcgcctcatt gtccagtacg ccatccgcga acacgaagga    189540
     ctgcccatgc cgccgctgga caagccgacc cgcagcgtgc cctacccgca cttcaacgtc    189600
     cccatcaccg tggtggacaa atccaacgtc gacacccacc cgtacgcgtt ctacgactat    189660
     ccgccgcagg gctggagcat cgagaccgcc agatagcgga tgcgcccggc cccccaaatg    189720
     gggggcgcgc gcgcgccggc gcggcctcac aatcgttccc gaaagcgtcg cgccgggcgc    189780
     acatacggga gacgaacatg tggaccttgc tgcgcaacag gctgcctgcg ctactgctcg    189840
     ggttctggct ggccgcgcca gcgcaggcct tcgacgcctt cgaatgcgat tgcgcgcagc    189900
     aggtcggcac ctgcagcgcc acggtcagga tcctgaaaac ggggggcagc gcgccatcct    189960
     actcggccga gctgctggtg caaagctccg cccccgcctg ctcgcgcgtg tcgtacctga    190020
     tcgaccagac gccctacacc acggtgctga cacggcgcaa ccaggacacc gaatcgacct    190080
     ccggcacctc gcccatcaag gcggccaacg tcaaggtgca aggctgcgcc atctgcgccc    190140
     gcaagagcgc cttcgcggcc aacgagtccg ccccggcgcc cgacgatagc ggcgcgtccc    190200
     gggcgttctc cgccggcctg gcacccggcg gcttcgaccc cgcatcgaag caggccggct    190260
     tcgatgcggc agtgtccggt ggcagggcgc gcgacgcctc cttcaacagc atcatctcgg    190320
     gcctgggtgc cgcagcggcg atcacctccg ccgccgcgca ggcgcggcag gctggcgcgc    190380
     aacagccgcc cgccacgccg tcgagatcgg gctactcgcc ccagtacgac ctgcgctcgg    190440
     ccggtcctca gggcggcggg cgctgcccgg acccgtccgc gcccggctgc ccctaccacc    190500
     tcggcaccta cgatccgctg ggagcgccaa agtgaccgcc gatcgcatgc gccgcctgcc    190560
     cggcgccctg atgcggctat gcgctctctc gtgcgccctg ctgctggcag cctgcgccgg    190620
     ggcgccgccc attccgccgc aaaaggacgc cgccgccggc atcttccccg gcgagcgccc    190680
     caagtcgccg ctggccaagg tgccggccgg acccgacgtc aaggcggtgg cggtactgag    190740
     cgaaaacacc ctggccaacg cggcctggaa acggaaaatc cacgataacg cgcgcgccat    190800
     ggcgcagggc aaacgcttcg gcgacgccac gatcgccagc gccggggctg aactgttcga    190860
     ccccgattac ccgctggcct gggtcgcggc atccctgaag cgctatttcg gcagcgtcga    190920
     acaggtaagc ctggcccaac tgccgcaggc cagcggcgac gtgctggcga tcgtcgatgt    190980
     ctatgcgtat ccggcggacg attcggtcgc ccgcatcaag gtcgccttct tcgaccggga    191040
     gctgcggcac attgccgacg ccagcggcga agacgcgcag catttcaaca tgtgggcgcg    191100
     caccggcggc gccaccgcca tcgccgaagg ctatcgccgc gagaacgaag tcctgatgcg    191160
     cgcgctgcgc aagttcgatg cgtcgctggc gcaacaggtc agcggcccgc cggcgcaagc    191220
     ggccggcggc tacgacgcct gcctgcagcg cgccctcgtc gcgcaggatc cgcaactgcg    191280
     ggtggccgcc atggctgcct gcgacgcggc gcgctaagtg caggctagcc cggcgccatg    191340
     cgcgcctggc gtgcggccac cacctcccgc acgcagcgcg cgaagcggtg cgacaggtgc    191400
     ggatgcgcgt cgaactccgg ataggcgacg cagacctcga accccacctc cggccgcagc    191460
     gccaggatgc gcacccggcg caagtcggcg cccagcgcgg tgagcgaatc caccagggcc    191520
     acgcccaggc cggcggtagc cagcttgagg gccacatgga actgctcgat ctcgacgtgg    191580
     ttgtccgcgt ccagcgcctg gccggcgcac agctcggcca gccggcggcc catgggatgg    191640
     cgccgctccg gcacgaacac agcgctgtcg cgcaggtcgg ccagcgtgac gtggtcgcgc    191700
     ccggcgtagc ggtcggccgg cgccacgcag accagcatgc cgcggcccac cgtttcctgg    191760
     cggatcagcg cctgcggcgc gcagcggtag accaggccga tatcggcatc gcgcagcagc    191820
     aaggcggcca ggatgtcgcc cgagtagccg gtcttgaccg tcatgcgcgc attggggctg    191880
     tccgccatga aggcggccag cgcgtccggc accacttcca tcgccagcgc cggcgcggcc    191940
     aggatgcgca ggcgcgccgg cccgtcctgg cgcaggttga cggccatcag cttgaccgca    192000
     tcgagctggc tgttgagctt ttccacttcg gcgtgcagcg cgtgcgcctc gggcgtgggc    192060
     gcaagccggc ccttgacgcg ctggaacagc gcgaagccca gctgcagttc aagactgttc    192120
     atggtctgcg agacggccgg ctgggtcatg ttgagcagcc gggccgccgc gctcagcgac    192180
     ccgccgacca tcacggcgtg gaaaacctcg atatggcgca agcgcatgcg ttcccctggc    192240
     atggtgcggc gcggcgggcg gcgcgcgtat aagcaaaccg cctgcatgcc ccttgaatgc    192300
     ttataaccgg cgcgccgcac accctcctac actcggtgcc acggccggag actgcgcaaa    192360
     gggtactacc ggctgatgat tcgaaccaag gggaaaaccg tcatgctccg tactatgccc    192420
     gccgcccggc gcctgttcgt ccaatccacg ctggccatca ccggcctgct ggccgcggcc    192480
     gcggcctgcg cccagccggc gaccgactgg cccacccgcc cgatcgaact ggtggtgccc    192540
     tacccggccg gcggcagctc ggacgtgctg ggtcgcctgc tggccaagcc gctgggcgag    192600
     atcctcggcc agcccgtggt ggtcctgaac aagtccggcg cggccaccgc gatcggcacc    192660
     acgttcgtgg cccgcgccgc gcccgacggc tatacgctgc tgctggccga cagcccgctg    192720
     gtggtcaacg cggcggtcaa cccggccgtg acctatgacc ccgtcaagga cttcgccccg    192780
     gtcggcatca tcggcacctc gccctcgttc ctctacgcgc cggccgggcg ggtcaaggac    192840
     ctcgacgatt tcatcgccca ggccaaggcg cacccgggca ggctgaaggc cgccagcgcc    192900
     ggcgccggca cctcgaccca cctgctgctc gaactcatgc agcacgaagc gggcatctcg    192960
     ctgaaccaca ttccgtaccg cggctcggcg ccggccttga ccgacaccgt ggccggcatc    193020
     gtggacggtt cgttctcgac ctatgcctcg gcgcagcctt tcgtcgcctc gggcaagctg    193080
     caagtgttgg ccatgaccgc gccgcagcgg ctgccggcct ttcccggcgt gcccaccttc    193140
     gccgaggccg gcatgcccgg actgaccttc ctgacctggt ggggcatcct cggtccggac    193200
     ggactgccgc agcccatcgt ggacaagctg cagcaggcgc tggcccaggt catgaaggac    193260
     ccggccatcg gcgagcagtt cgtgcgcctg agcgtggtcg cgcaggccgg cgaaccccag    193320
     gcgttcgccc agacgctgca gcgcgacctg cagcgctggc gcgacatcgc ccgcgccgcc    193380
     ggcgtcagca tgcaataacg gcgcgccgcc gccgcttccc cgaaccacca cgggcggcgc    193440
     cacgccgcca ggagacctcc gccatgccat cccccagcgc gctgcatgac ctgtgcgaca    193500
     cgccacctac cttcatgggc gtgccccatc gccatgccat cgacggcgcc agggcggcca    193560
     tcctcggcat ccccttcgat tgcggcacgc acgcgtttcg catcggcgcg cgccagggtc    193620
     cgcagtcgat ccgcgaacag tcgcgcctga tgcgcacctt caaccccgaa ctggccgact    193680
     acaacccgct gcagcggctc ggggtgatcg actgcggcaa cgtgcgcgtg gtgcccagcg    193740
     acattctcga tgccttcgag cgcatcgagc aggcggtcgg cgccatcgtc gatggcggtg    193800
     cggtgccggt caccatgggc ggcgacggca gcgtgtcgct gccgcaactg cgcgcggtcg    193860
     gcaaacgcca tccgggcctg gccgtcatcc acctcgactc gcacaccgac accaacacct    193920
     tcgtcaaggg caaggaatac aacgccggca cgcagttcac gcacgccgcc ctggaaggcc    193980
     gcgtggacac ctcgctggcg tttcatatcg gcacgcgcgg caccaccttc acccagcatg    194040
     tgttccgcca tgcgcgccac ttcggctacc agatcatccc gctcaacgag ctgctggcgc    194100
     gcggcatggc cgaagtgctg caggacctgc gcgcgcgcct gggcgaacgg ccggtctacc    194160
     tgtgcctgga catggacgtg ctggatccgt cctgcgcgcc cggggtatgc gcgcccagct    194220
     ggggcggcct gagcgcgcgc gaggcgatcg cgttcctgcg cgggctggcc ggcctgaaca    194280
     tcgtcgccat cgacgtcaat acggtcagcc cgccgcacga cgtcaatggg accacggcat    194340
     cgctggcggc cgcgctgatg gtcgaaggcc tggtgctgct gtgcaagcgc ctggggctgg    194400
     accatcccga cccggcgccc gacttcgccg ccatgtacgc gcgctgagcg cggggccgcc    194460
     cgcgcggccc gtgttttccc tagtgcccgg cggcgccgtt cgccaataag attcggactt    194520
     atcgaataag tacgaactta ttagccaagg gaaaacctat gtccgccgcc gtccgtttcc    194580
     tgcttcgcgc cgcgctgggc gcgtgcgccc tgaccgccgc cgcgaccgcc catgcccagc    194640
     agcgctggga catgtcgctg gcctggccgg cgggcaactt ccacagccgc aacgccgagg    194700
     cgttcgccgc caaggtgcgc gaggccactg gcggccaggt gctgatcacg gtgcacgccg    194760
     gcggcgaact caacgtcaag gggcccgaca cgctgatggc ggtggagtcc ggcatcgtgc    194820
     aggtggccga catgctggtg tcgcaacagg ccggcgtcga gccgctcctg ggcatggacg    194880
     ccctgcccgg gctgatcgcc ggccaggacg acatgaaaac cttcctgcgc cacgcccggc    194940
     cggtctacga ccgcatcgcc gcggcccaca accagcgcat cctgtacgcc gtgccgtggc    195000
     cctcgcccgg gctgttcagc cgcaaggccc tgtccactcc tgaggacatg aaggggcaga    195060
     agctgcgcgc gcacgacaag gccgcctacg aattcatggc ccagctgggc gcggcgccca    195120
     cccagatgcc gtggggcgaa gtggtgccgg cgctggccgc gggcaccatc gatggcgtgg    195180
     gcacctccgc gtcctccggc gtggacggca agttctggga attcaccccg catttcctgc    195240
     ccctgaactg ggccacctcg ctcagcctgg tcaccgtcaa cctggacgcc tgggacaagc    195300
     tgagcgccgc gcagcaacag gccgtgcagg ccgcggccgc cgagctcgag ccgcgcttct    195360
     ggcagatcag cgcggcgcag gacgagaaag acctggccat cctgcgcgag cacaaggtcg    195420
     ccatcgccac gccctcggaa gcgctcggcg cgcgcgtggc cgccgtgggc cgcccgatgt    195480
     gggacgcttt cgcgcgccag gcggggcccg caggcgcgcc agctgctcga cgcctatctg    195540
     caagaccgca agcagccctg agcgagccgc catggaccgc ctgctacgcc tgatcgacgc    195600
     gctgtgcgcc ggcgccgagc accttgccat cgccttgctg tacggcatcg ccgcgctgat    195660
     gctggccgaa gtgggcgcgc gcgccatggg gcgcagcatc ccgttctcgt gggagtactg    195720
     cgcctacggc atggccgccg cgttcttcct cggcatggga gccacgctgc gccatggcgc    195780
     ccacatccgc gtcctgttcc tgcgcgatgc gctgcccgcg cggccggccc ggctgctgga    195840
     tatcgcggcc agttgcgccg gcctggcgct gtcggcggtc atcgtcgtcg cactggcgcg    195900
     cctgaccggc aagtcgatcg cgcgcggcct ggtgtcgaac accgtgatgc agaccccgct    195960
     ggccatcccg caggccgtgg tgctggccgg cgccgcgctg ctggcgctgg ccttcgtcgc    196020
     gcgccagctg accggccgcc cggccgaaac cgacggcggc cgcgccgccg gccattgacc    196080
     cgcgccgccc cgccatcatg atcgccatca ccgtcgtcac cgccgccttg ctgctgctgt    196140
     tcctgggcgc ctcgatatgg gtcagcctga gcctgttcgg cgcggcctac ttcctgttgc    196200
     tgctgttcaa gcccaacctg cccctggacg tgctggccgg ccagatcgtc tggaccgcgt    196260
     cgaccagcca ggaactgctg tcgctgccgc tgttcgtgct gatgggcgag gtcctggcca    196320
     agaccagcgt gggccgctcg ctgttcgccg gactggcgcc ctgggtggga cgcctgcccg    196380
     gcggcctgac gcacgtcaac gtgctgggct gcaccctgtt cgccgccatc tgcggctctt    196440
     cggtggccac cacccagatc gtcggccgcg tcaccctgcc cgagctgcag cagcgcggct    196500
     atgacgcgcg cctgtcgatc ggctcgctgg cgggcgccgg cacgctgggg ttcctgatcc    196560
     cgcccagtct catcatgatc gtctatggcg tgctggccga gcagtccatc gtcgagctgt    196620
     tcatcgccgg cgtgctaccc ggcctgggcc tggcggccgt ctacatggcc tacatcgcgc    196680
     tgcgcgcaca gcgccccgac gacgccgggc cgggctacac gctgcgcgag cgcatcgccg    196740
     cgctggcgca gatcctgccg gtgatcgggc tgatcgccgc catcatgggc gcgctctacc    196800
     tgggcatcgc cggcccgtcc gaggtcgccg ccgtgggcgt gctgggcgcg ctggcgatcg    196860
     ggctgctgca gcgttcgctg acgcgcgcca gcctggtggc cgtcggccgc agcgcggtgc    196920
     gcacctgctc gatgataggg ctgatcctgg ccggcgcggc gctgatctcg gtggccatga    196980
     gctacctcgg cctgcccaag tatgtggccg cgcgcatcgg cgaactgggc ctgtcgccgc    197040
     tgctgctgat cgcgctgctg ctgctgttct acgtggtgct gggcatgttc ctggacggca    197100
     cctccatcat cgtgctgacc ctgcccatcg ccctgccgct ggtggtggcg gcgggctacg    197160
     atgcgatctg gttcggcatc ttcctggtgg tggtggtcga gatggcgcag atcacgccgc    197220
     cggtcggctt caacctgttc gtgatccaat cgatcacggg gcgttcgctc agtttcgtgg    197280
     cgcgcgccac gctgccgttc tttttgctgc tgctggcgtg ggccatggcc ctggccgtgt    197340
     ggcccgagat cgtcctgtgg ctgcccggca cgctgcgcaa ctgagatcct tgcccgccat    197400
     gaccgattcc gacaagaaaa cgccgctgta ccgccgcgtg gcccaggacc tgatgggcga    197460
     catcgccacc atgccggtgg gcagcatcct gcccaccgag gtcgagctgg ccgcgcgcct    197520
     gggcgtgagc cgcgccacga tacgcgatgc gatggagatc ctggtcgagc atcgcatggt    197580
     cgaacgcgtc aagcgcctgg gtacgcgcat cctgcgcaat acccccggcc accgctacgt    197640
     gcagcacatg gacggcctgg cgcacgcgct ggagttcgcc ggccagtcgc tcatgcgcat    197700
     cgacgacacc gccatcgtcg agggctcggg cggcgaaccg ggcctggccg cgctgcccaa    197760
     cgccaccggc caatggctgc gcgtcaccgg cacccggcgc ctggtcgacg acgacgcgcc    197820
     ctcgacctgg acgcgcgtgt tcgtgcccgg ccgctaccag ggcatcgcgc cgctgctgca    197880
     tggcgagttg gattccgtct atgcggtcat cgagcgcgtg tacagtctga aggtggctcg    197940
     gctgcgccac cgcgtcaccg ccgtggccct gcccggctac gccagcggcg cgctgggcct    198000
     gccggccggc gcgccggtgc tgcaggtcag cgcctggctg cacgaggccg acggcgcgct    198060
     ggtcgaatac gtgcgctcgc tgcatcatcc cgagaaagtc agcatcgatt tctcggccgc    198120
     ccaatcttcg tgacgcccgc cgcgcgggcg ttgcctgttc caccgcaacg caaaggacta    198180
     tccgacatga ccatgatcac gctcaagacc cgcgatggcc agaccttcga ggcctatcac    198240
     gccccggcgc ccacggccgg cgcgccgggc ctggtgctga tccaggagat cttcggcatt    198300
     aaccccgcca tgcgcgccgc cgccgaccaa tgggcccggc tgggcttcga cgtgctgtgc    198360
     cccgacctgt tctggcgcca ggagccgggc gtgcagctgg acccgacctc cgaggccgat    198420
     ttcggccagg ccgtgcgcct gatgcaggcc atggacgaga accaggccat cgccgacctg    198480
     gacaccgccc gcgcctggct ggccgaacgc agcggcggca aggtcgccgg cctgggctat    198540
     tgcctgggcg gacgcctggc cgtgcgcctg accatggaca cgccggtgca atgcgcggtc    198600
     agctactacg gcgtgatgct ggaccagctg ctgcccaccg tggacgcgca ggccgcgccc    198660
     acgctgctgc acgtggccga gcaggaccgc ttcgtgccgc ccgaggcgcg cgccgtcatc    198720
     ctggaggcgg ccggcaagct gccgcaatgc gaggcgcacg tctatgaagg ctgcgaccac    198780
     gcgttcgccc gccccggcgg cgagcactgg gacgccgcgg ccgccgcgct ggccgaggaa    198840
     cgctcggtgg cgttcatgca gcgccacctc gcctgacgct gcgcgccatg acggcagtac    198900
     cgtccatcgc gccggtcctc gacctgtccg gccgcagcgc ggtcgtcacg ggcgccggcg    198960
     ccggcatcgg ccgggccgcc gcgctgcggc tggcccaggc cggcgccgcc gtggcggtga    199020
     tcgacatcaa cggcgaagcg gcgcacgaca cctgcgcgcg catcgccgcg ctgggcggcg    199080
     cggccgccgc ctacgcgatc agcgtcaccg accaggacgc cctgctggcc gccgcgcgcg    199140
     acgcgcagga gcggctgggg ccgtgcggcg tgctggtcaa caatgcgggg gtgctgctgc    199200
     gcagcgcctt cgacgacccg cgggcgcgcg acttctgggc cgccacgctg gacgtcaacc    199260
     tgaacggccc gtacctggcc gcgcaggcct tctatccgca gctgcgcgcc acgcgcggct    199320
     gcatcgtcaa catcgcctcc atccattcgt tcgtggcggt gaagaattcg gccgcctaca    199380
     cggcgtccaa gggcggcatc aagcagatga cgcaggcgct ggcgctggaa ctgggcgccg    199440
     acggcatccg cgtcaacgcc gtggcgcccg ggctgaccgt caccgacatg acgcgcgcca    199500
     cggtggccga ccccgagggg cttacccgct tcctggcccg cgtgccgctg gcgcgccccg    199560
     gttcggtcga cgacgtggtc aacgccatct gcttcctggc cagcgactgg gccgcctaca    199620
     tcacgggcgt gacgctgccg gtcgacggcg gctacgtggc caactgaacg cgcccgctca    199680
     ggtgaaggcg cgcaccgcgt tggcgatgcc gcgcgcgcaa tcgcgcaacg gcggcgccag    199740
     ccgcgcgaag gcctcttcct gggtccagcg gctggtgggc gcgacgatgt gcacgcaggc    199800
     caccggcgcg ccgcgcccgc ccacgatggg cgcggccagc gtcatgtcgc ccaggaacag    199860
     ctcttccttg ttgtgcgcca cgccgctcac gcgcgcctgc tcgatcaggg cgcgcaggcg    199920
     cgccggatcg gtctcggtcc agggcgtgtg gcgcttgagc gtggagccgt cgaggatggc    199980
     ctgcacgcgg gcgtcgtcca gcgcgctgag gtaggcgcgg cccgacgccg tgcaatacat    200040
     gggaatgcgg ctgccgatgg gcatgtggat gggaatgaac ttggccgcca ccacgcgcga    200100
     gacgtagacc atctcgcgct ccagcggctc ggtcaggttg accgtctcgc cggtgatgtt    200160
     cgacagctcg gccaggaacg gattggccgc ctccaccagc gcatcggccg tgatgtagtt    200220
     gcagcccagc tccagcacgc gcagcgtcag cgaatacttg cgggtcttgg gcgacttgct    200280
     gatcaggccc aggcgctcca gcgtgaagac ggtgcgctgc accgagctga tgctggcgtc    200340
     gagccgcgcg gccagttcgg acagcgacat ggcgctctgg tggccctgga aggcgaacag    200400
     cgctttcagg cccttggcga acgactggtt gaacatggca ttgctggcca gctcctcgtc    200460
     gtaatcaagc atacgcactc ctcgtttacc cgaatttcgg gtgattatta tcgctatacg    200520
     gtaattctaa accgttttac gggtaaacat tattgtcagc gcatatccgt tcccctatcc    200580
     tgccgacatc gcctacccgc aaacccgagg ctgttcgagc atggaaggtc actccccgca    200640
     gcgcgactcc cggatcctcg agatatccgg cgtcaccaaa acgttcggtc cgaccacggc    200700
     cctggccggc atagacctgg acgtgcgcga aggcgaattc ctcaccttgc tgggccccag    200760
     cggctgcggc aagaccacgc tgatccgcat catcgccggc ttcgagacgc ccaccgccgg    200820
     cgacgtgcgc atcgacggcc gctgggcatg gtgttccaga gcctggcgct gtttccccat    200880
     ctcaacgtgg ccgagaacat cggctatggc ctgaagatcc gccgcgtgcc gccggcccgg    200940
     cgccaggcca aggtggcgca ggcgctggag atggtgggcc tggccggcta cggcgagcgc    201000
     tacatcggcc agatatccgg cggccagaag cagcgcgtgg cgctgacccg cgccatcgtg    201060
     accgagccgc gcgtgctgct gctcgacgag ccgctgggcg cgctggacat gaagatccgg    201120
     cgccagatgc agaccgaact caagcagatc caggagtcgc tgggcacgac cttcatcttc    201180
     gtcacgcacg accaggagga agccctgacc atgtccgacc gcatcgcggt gttccgcaac    201240
     ggcgcgatcg agcaggtcga cacgccggcc gccgtctacg aacgtccggc tacccgcttc    201300
     gtggccgagt tcgtcggcga caccaatttt ctcgaaggca ccgtcgaccg ccaggccggc    201360
     ggcgcgccgc gcgtgcggct ggccgactgg gattgcagcc tgcagccgcc cgccgcgcag    201420
     tgggccgagg gcgcgcgggt cggcgtctcg ctgcgcccgc aacacttgcg catcgccgcg    201480
     ctcgagcaag gccgcctgcg cgccaccgtg ctgcgccgcg tctatgccgg gcagaacaca    201540
     cgcctgtggc tggccgtggg ccagcgcaag ctgctggccg actggcacgg cgccgaggac    201600
     ggcgcgccgc ccgagccggg cgccaccgtc ggcctgacct gggacgaccg gcgcgtctgt    201660
     gtcgtttccc tttgactcgc agcactctcc aggagccaac atgaacatca cgcagcgatt    201720
     tgccaagtgg gcgctggccg cctcgatgct gggggcctcg gccgccgtgc ccgcgcagga    201780
     catcaccatg gcgacctggg gcggcggggt cggcaaggcc tggcgcgagg cgtacgccga    201840
     gcccttcatg aaggccagca agctggaggt gaagatcgtc gaggtgccca cgcccgaggc    201900
     gcaggtgcgg gcccagaaag gcgcgcccaa gttcaacgcg gtgctgtcct cgctgttcga    201960
     ggccgcccag atgtacgagg acggcctgct cgaggatttc gacatggccg atttcccggc    202020
     gctcaagaac atgccggaca agtacctgct caaggcgccc aatggccgcc tgatcggcgt    202080
     cagcacctac ttcgcctact acggcattgc cgtcaacacc gacctggcca agccggccga    202140
     cttcgcctcg tggaagaacc tcgccgatcc caagtgggcc ggcaagctgt cggtcacgcg    202200
     cccggtgtac agctccgcct acgacctgac catcatgtcg gtggccgagg gcggcagcga    202260
     gcgcgacacc gccaagggcc tcgaactgct gaccgcgctg ggcaagaacg cgctgaccat    202320
     gtacagctcg atggcgcaga tgaaccagct gctgcagcgc ggcgaggtgg ccgcggcgcc    202380
     ctattactcc acccgcatct ggcagatgca gcgcgacggg cagcgcaatg tcgaactggt    202440
     ggtgcccaag gaaggcgcgc tcatgctgcc gtacctggtc gtggtgccca agggcgcgca    202500
     aggccgcgag cactacatga agtggctgga atacgtcggc cagcccgagg gccagcaacg    202560
     catcgccgag atcgccggct acatgccgct caacagccag gccaggctgt cgcccgcggc    202620
     cgagaaggaa ctcggccagc cgctggacaa gctgcgcgac cagctgtacc agcccgactg    202680
     gaacctgatc gccaagacgc gcaagacccg catcgaagcg gtcgagcgcg ccatggccgg    202740
     cgcggcgcgc tgaggcgcgg gccatgatgc gggcgatccg gcctcccctg ctgctgctgg    202800
     cgccgccggc cctgctggtg gcgctgttcg tggtcggcgt cggctacctg gtggtcgaat    202860
     cgctgcacac cggcgcgggc tgggggctgg acaacttcgt gcgctttttc gagcgccccg    202920
     actatgtggc ggtgctggtg cgcaccatcg tcatcgccgt ggcggtgacg gcgtgcgcgg    202980
     ccctggtcgg ctatccgatc gcctacgcca tcgcgcgcta ccgcggcaac cgcaatttcc    203040
     tgatgatgct ggtcatcatg ccctggctgg tcagcgtggt ggtgcgcacg tatggctgga    203100
     tggtcatcct cggcccgcgc ggcacgctca actccatgct gctgtcggcc ggcgtcatcg    203160
     atacgccgct gcgcctgatc ttcaacatga ccggcgtggt catcggcctg gtgcacgtgt    203220
     tctgtccgtt cttcatcgtg tcggtgctgg cggtgctgct gtacctggac cgctcgctgg    203280
     acgaggcctc gcagaccttg tcggccggcc ccttcaagac cttctggcac gtcacgctgc    203340
     ccttgagcat gcccggggtc atcaccggcg ccatgctggt ctacctgctg tcgaccggcg    203400
     ccatcgtcac gcccctgctg ctgggcggcg tgcgcgacgg catgctggcc acgcagatct    203460
     accaggatgt gctgcaggtg ttcgattacc ccaaggccgc cagcatggcc gtggtgctgc    203520
     tgctgaccgc gttcacgctg gtcattccgc tgcaatggct ggaacggcgc gtggccgccc    203580
     gcgtatcggg aaggggcgcc tgagatgaag accgcccgcc tgctgctgct gtgcctgctg    203640
     ttcggtttcc tgccgctgtc catcgtcatc gtcgccatct cgtcgttcac ccagagcggc    203700
     tatttctcgg tgccgctgga tgcgctgtcg ctgcgctggt atgtcgagtt cttcaccgac    203760
     tggcaatgga tctcgctgct gctgctggtc agcgccgcgg tggcgctggg ggtggcgctg    203820
     atcagcacca cggcggccct gctggccgcg ctggtgctgg cgcggcgccg cttcgccggc    203880
     agcgggctgc tcgaaaccct gatcatgctg ccgctggtgt ttcccaacgc cgcgctgggc    203940
     gtggcctttc tcggcgtgct gggcctgctg ggcatcggcg gcacctacct gggtatcgtg    204000
     ctggcgcatt gcatcatcac cctgccgttt gcctaccggc ccatcctgaa cgcgctgcgc    204060
     aagctggacc cggcgctgga ggaagccagc atgagcctga gcgccacgcc gctgcaggtg    204120
     ctgcgcaccg tcacgctgcc catgctgcgg cccgggctga tcacggcctt cctgttctgc    204180
     ttcatcgtgt cgttcgacga agccacggtg acgatcttcc tcatcgcccc cgacgtcaac    204240
     accctgccgg tgcgcatcct gacgcagatc caggaaagcg ccagcccggt catcgccgtc    204300
     atcgccacct tcctgatcct gttcacgctt tcgctggtgc tgctgctcga gcgcaccgtg    204360
     gggctggagc tgttcgccgc cccgcagcgc gagcgctgac atcgcccccc taccggagac    204420
     cgtccatgta tgagatccag cccgaggatg ccgaactgct caggcacttc cgcaccacca    204480
     cgaccaagac gcggccgctc aagctgaacc ggctgctcaa ccgcctgcgc atggagccca    204540
     tggcgggcaa gcaggtcatc gtgtgcaccc ggccctacag cgagtacgcc atcggcaccc    204600
     tgggcgagcg gcgcggcgac cccgtggcgc tgcacgccga acgctacgcc acgctggccg    204660
     aggcccagtg ggccattctc aagatccgct gggccatcca ctcgccctat ccctggccgg    204720
     tggtgggcct ggactagtcc cggcccgccg ccgccgctgc gccatcgaat ccaacgcctc    204780
     ttccggaacc cctatgtacg agatacttgg ctaccccagc acctggaccg tcgctcccgg    204840
     ggaaaccatc gaattcaagg ccagctgcgc ccgcgcgctg cgctacgacg ccgacctggt    204900
     tcgcatccgc agcggcgatg tctcgccggg cgcgcccggc ctgaaggaga ccgtcgcact    204960
     ggccggcatc gcgcgcggcg tgcaaggccg cccgcaacac accgagaccg gctcgcgcgc    205020
     ggtcgcgccg ccctttgccg aaccggcgcg cggcgccagg agctgggtgc tggccatcat    205080
     gcccacgctg ccgcaaagcg gccatgagca gatcatcctg gcgcgccacg acggcgccgc    205140
     cggcaccggc tacgccctgg gcctggacaa ggccggctgc ctgttctggg agcaggcgca    205200
     ggcgggcaag gctcgccgcc tgacgctggc gcgcgccgtg gtggcccgcc aatggtatct    205260
     ggtggccgtc ggcatcgacg ccgacagcgg cgaggtgacg ctgcgccaag tgccggccaa    205320
     cccgctgctg gcggccaaca gccacgacca ggccagcgtc cgctgaagcc cgttgcccgc    205380
     tggcgccacc gacgcgctgc ccgtggtgtt cggcgcccgt cccagcggcg gccgcgcgcc    205440
     ggcctacctg caccactaca acggccgcat cgattcgccc accttgctgc cgtgccgcgc    205500
     cggcgacgcc gacctggccc agttgcgggt ggaagcggcg cggcgccgct ggccgcctgg    205560
     gacttcggcc tgcgcatcga cagcgacgtg atcgtcaaca ccgccatctc ctgggccgag    205620
     ggccgcatcg agaacctgcc cgcgcgcgcc gtacccggcc tgcgctggga cgccagcatc    205680
     atgcgctggc aggacggccc cgaccactac ggcgcgctgc acttccatga cgacacgctg    205740
     gaagacgcca actgggacac cgatttcagc ctcgagattc ccgccaacct gcccagcggc    205800
     ctgtatgccg cgcggctgac cggcgcccaa ggcgaacagg agcgcatcac cttcgtggtg    205860
     cgcccgcgcg ccggcgcgcc gcgcaagcgc atcgcctttc tcgcctcgac cgccacctac    205920
     acggcctact cgaactcgca ctaccgcctg gacgaggaag gcatggaaat gaaatcgggc    205980
     aacttcatgg tgctctatcc ctgggagacc tacctgggcg aacaccgcga gcttggcctg    206040
     tccatgtacg acacccactc cgacggctat ggcgtgtact acgccacacg ccgccggccg    206100
     gtgttcagca tgcacctgca gtgccgcacc tggtcgctca acggcgacac ccacttcctg    206160
     gactggctcg acgaaaaggg tttcgagtac gacgtcatca ccgacgacat gctgcacgcc    206220
     gagggcctgg ccgcgctgca gggctaccgc gccgtcatga ccggcgccca ccccgagtac    206280
     tggagcacgc gcatgtggca ggccatggtt gcctaccagg cgcagggcgg gcgcctgatg    206340
     tacatgggcg gcaacggctt ttactggcgc tgcgcctacc accccgaaaa gccctggctg    206400
     atggagctgc gccgcaccga aacgggcgcg cgctacagcg agaccccggc cggcgaaagc    206460
     taccacagct ataacggcga atacggcggc acctggcggc gcatcggcat cgcgccgcag    206520
     acgctggtgg gcatcggcac caccgccacc ggcttcgacg cctcgtcata ttaccgccgc    206580
     cgcccggaaa gccatgaccc gcgggtcgcc ttcatgttcg acggcgtgag cgaggagatc    206640
     atcggcgact tcggcagcag cggcggcggc gccgccggcg acgaaatcga ccgcgccgat    206700
     ttccgcctgg gcacgccgcc gcacgcgctc atcgtggcgc gctcggagaa gcacacgcgc    206760
     tactacaacg tggtgcccga ggagaccacc taccaccacc ccaccatcaa cggcgaggaa    206820
     gccaagtact gctacgccga cctgctgttc tacgaatgcc tgaacggcgg cgcggtgttc    206880
     tccaccggct cgatcacctg gggcgcctcg ctggcctgga acggctacga caacaacgtc    206940
     tcgcgcatca ccgccaatgt gctgagccgc ttcgcgcacg acacgccttt cgacttcccc    207000
     acgacgccac aggcctgatc ccgccatgcc cccgcccctg ccgtacgacg ccatgcgctc    207060
     cgtgtggacg gacactgccg cgcccgcgat ggccacagcg ccgctggccg gccacgccga    207120
     ctgcgacgtg gccatcgtcg gcgcgggcat caccggcctg tcggccgccc tgcacctggc    207180
     cgaacgcggc ctgcgcgcct gcgtgctgga ggcgcgcgac cccggctggg gcgcttccgg    207240
     gcgcaacggc ggccaggtca tcccgggcat caagcacgat ccggacgaga tcctggcgcg    207300
     ccatggccgc gaacgcggcg agccgctgct gcacatggtg ggcactgccg ccgacacggt    207360
     gttcgacctg atcgacagat acggcctgga cctggtgcag gcgcagatcc gcctggccgc    207420
     cggcgagcgg ctggaccgcg tggtgccggc agacctgcag ccctcgggcc acgccatcga    207480
     gctgcgcgtg tacgccgaag acccggtgcg cttcatcccg tcgccgggca cgctggccgt    207540
     gttcgagctg ccgcaagggc ccggggtgcg caccgagacc ggctaccacg ccggcaacgc    207600
     ggtaagcccg cactacgacc ccatgatcgc caagatcatc gtgcacggcg ccgatcgcgc    207660
     ccaggccatc gcgcgcgccg agcaggccct ggccgacacc gagatcgccg gcgtcaagac    207720
     caacctgccc ttcctggcgc gcgcgctggc cttcgaaccc tggcgccagg gccgcctgca    207780
     caccggcatc gtggcccgga ccctggccga gcccgcgccg gccgcgctca ctgcttgata    207840
     accctctcag gaatagacat gaagaaaatc cccgtgaaat ccgaagtcac cggcaacgtc    207900
     tgggaagtcc tcaaggccgg cgataaccgg gtcgaggaag gcgaaacgct catcgtggtg    207960
     gagtccatga agatggaaat ccccgtggac gcgccggccg ccggccgcct ggtggaaatc    208020
     accgtgcaga aaggcgacgc cataggcgaa ggcgacgtgg tggcgatgct cgaagtgcag    208080
     tagcccgcgc gccgcaccgc ccccgatacc tggcaaggag acaccactca tgacccaacc    208140
     cgcagccggc gccggaccgt tggccggcta caccgtgctg gagctcggct ccaccatcgc    208200
     cggcccgttc tgcggccgct tgctggccga tttcggcgcg cgcgtcatca aggtcgaggc    208260
     gaccgagggc gacgcgctgc gctccatggg gcgccacaag ggcggccatt cgctctatgc    208320
     gctgtccctg ctgcgcaaca aggaactggt cagcatcgac ctgcgccagc ccgacggcca    208380
     ggaactggtg cgcgaactgg ccgcccgcgc cgacatcctg atcgagaact tccgccccgg    208440
     cgcgctggag aaatggaatc tcggctacga cgtgctgagc cgcgccaacc ccggcctggt    208500
     gatggtgcgc atcagcggct acggccagga cggcccctac agcgggcggc ccggctatgg    208560
     cgtgatcggc gaggcccaca gcggcctgcg ctcggtcacc ggcgaccccg accggccgcc    208620
     ctcgcgcgtg gcgacctcgc tgtccgacta catcaccggc ctgtatggcg cgttcggcgc    208680
     gctgctggcc ctcgaatcgc gccgccgcac cgggcgcggc caggtggtgg acacggcgct    208740
     ggccgaatgc gccttcagct tcatggagcc gcacgtcatg gcgtacgacc agttgcgcga    208800
     agtggccaac cgcgccggtt cgcgcctgcc cgggtcggcg cccaacaacc tgtaccgctg    208860
     cgccgacggc gcctatgtgc acgtcacgac gctgaccaat gccttgttcc ggcgcctggc    208920
     cgccgccctg gatgcgccgg agctggccga cgatccgcgc tttgccgagc ccggccagcg    208980
     cgccaggcat gacgccgaac tggacgcggc catccaggac tggttcagcc gccacgactg    209040
     ccccacggtg ctggcgcgcc tgacgcaggc cgagattccg cacgccaaga tctacggcgt    209100
     ggacgacgtg ttcgccgatc cgcacttcca ggcgcgcggc gcgctggcgc gcctgccgca    209160
     tccgcagctg ggcgaagtca cggtacccaa cgtggtgccg cgcctgtccg aaacccccgg    209220
     cgccgtgcgc agcctgggca aggacgccgg cgccgacacc ctggcggtgc tgcgcgacga    209280
     actgggcctg gacgccacgc gcctggacgc gctgcgccag cgcggcgcga tccgcgcctg    209340
     aagcgcccgc ccgccccgcg ccgccgcgcc tagctgtgat gtctcaatag gttgttcatc    209400
     caggccggac ctgggatgct gtggttacca cgccatcgca actcagggca ggacactgga    209460
     tgaacaacca taagcatgcg cgattgaccc gcctaggtcg agcccttctt gttaacaggg    209520
     tgatgcaaca gaactggacg atgaggcagg ccagccaggc ggcaggggtg agcctgcgca    209580
     ccggttacaa gtggcttgcc cgcttccgaa gcgaaggtct ggacggcctg cttgaccgca    209640
     gttctcgccc gcaccgcagc ccgaaggcct gtgcgcccga gcaggttgag cacttcgccc    209700
     agcagcgccg ccagcgtctg ccgctgtggc gcatcgcgcg tgaagccggc cgcagcctgg    209760
     ccaccgtggc gcggtatatg gaacgcatcg gcctgagtcg actcgcctcg ctggagccgc    209820
     cggcgccggt gcgccgctat gaacgcgcca gcccaggcga gctgctgcac atcgacacca    209880
     agcggctggg ccgcatccgg ggcgtgggcc atcgcatcac cggcgatcgg gcccagaacc    209940
     gcaaccgcgg cattggctgg gacgctgtgc acctggccat cgatgacttc tcgcgcgtgt    210000
     cctttgctcg catcctcgac gatgagggcg gcgatcagtg cgctgagttc ctgcaccaag    210060
     ccaccgccta ctacgccagt ctgggcgtgc gcatcgaccg cgtgatgacc gacaacggca    210120
     gcggctacgt ctccaggacc tttcgggcgg tgtgcgtgga gctgggaatc cgtcacatcc    210180
     gcacccgccc ctacaccccc aagaccaacg gcaaggccga gcgcctcgtg cagacctgct    210240
     tacgggagtg ggcatacgcc aggccctaca cgagctcagc cgaacgacag gctgccttgc    210300
     agcccttcat tgaccgctac aactggtgtc ggccacactc cgctctcgga catcagccac    210360
     ccatcacgcg tatcccagat gtgaataacc tattgagaat cgacatctag gccgccgcgc    210420
     gcgacggttc cggctgccgc gccatcgtcc ataagcacgc ccccctcgtc catcggaatg    210480
     acgaccagcc cgccagcgcg cgcccgcgcg cgtgcgcggc cggcgcatag cgccgccgtg    210540
     tccgcgcgcc ctgtcgtgcc tgcgcaacta cgcctgcgcc ctatccccgt gcggccgcga    210600
     tgagaatata agtgtgctgc gcggcgcgct cgaccagcaa ggcggtggca cacatggaaa    210660
     gaatcatcgg cagcatcgaa caggcctgcg ccatcgcacg gcggtgggca atccgtaccg    210720
     gcaacaagga agccacgtgc gcggccctcg cggccgcctg gtacgaggcc caggccgcca    210780
     ggccgcctac gtccgccgcc ctgctggcgc atctggccgc gcgcatccag gaaagccggc    210840
     aacgcgtggc cgtgccacgg cccgcgccca tcccgcccgc cgaggactga tccggcgccg    210900
     gcgcggccgg acaggccccc ggggcatgcg cctgcgccgc cacgttgcgc cccctcgccc    210960
     atgccgtcgc catgaggaac ccacgagtca ggcggcgctt tggttacgaa ggttctttcc    211020
     gataccccgg caagcccgta tacacccgcc gcgcgatgcc gataatggcg cctcctgaaa    211080
     accatacgcg gccggatggc gttccggccc gggaggagca cctgatgccg gccagagaaa    211140
     tccagctcac actgatacgt gtctatatcg gactggactt cacccatcac ttcgccgaga    211200
     agttcggctt gcttggcgcg caggcatacg ccgacgtcct gcactatttc tctaccgtca    211260
     ccgccaaccc gcagtccatg ctgctgcttg ccggcctgtg cgagttcgcc gccttcatcg    211320
     gtttcacatt cggcctgttc acccgggtcg cggcggccgg cacggcggcg tacctggtga    211380
     tcgcgctgtt catcggcaac caccagcacc tcggcttcac ctgggccaac cccggcggcg    211440
     gctgggagtt ccccgccatg tgggccttca tctgcctgtc cttcgtgctg tcgggaggcg    211500
     gccgctggtc gctcgaccgc ctgctgctgc cgcgcctgcc tgccgccttg cgctggctgt    211560
     cgcgctgaca cggcgcgacg cgcccgggcc acgcgccctc atctggcccc ttttcggttc    211620
     gcgaagaggg gccgctttgc gttatgctcg ccggctgcct ggaattctcg aagggcgccc    211680
     gggccacaag ccaggcgcgc gcccatgacg caaaggaaac acaatggctc caccgggcca    211740
     cgtcgtcccc agcccggcga acggccaccg ccatgacgcc cggcccgcca cgcgcctgcc    211800
     cgaaccgacg agcctgcgcc gcaccctgtc ggcgcgccac ctgaccatga tcgcggtcgg    211860
     cggctcgatc ggcaccggcc tgttcgtcgc ctcgggcgcc accatcgccc aggccggccc    211920
     gggcggcgcc ctgctggcct acttgctggt cggcatcatg gtgtacttcc tgatgaccag    211980
     cctggacgaa ctggcggcca gcatgccggt ggcgggctcg ttctccacct acggcgccaa    212040
     gtatgtcgac gaaggcttcg gcttcgcgct gggctggaac tattggtaca actgggccgt    212100
     gaccgtcgcg gtggacctgg ttgccgcgca gctggtcatg gcctattggt ttcccgaaat    212160
     gcccggcgtg ctctggagcg ccgccttcct ggcgctgatc gtcgggctga acgccctgtc    212220
     ggcgcgcggc ttcggcgagg ccgagttctg gttcgcgctg atcaaggtga tcgcggtgct    212280
     ggcgttcatt gccatgggcg tgctgatgct gctgggcatc atccgcggcg gcgagcacgg    212340
     cggcctggcc tactggaccc tggacgacgc gccattcgcc ggcggattcg ccgcgctgat    212400
     cggcgtggcc atggtagtgg gcttttcgtt ccagggcacc gagctgatcg gcatcgccgc    212460
     cggcgaatcc aaggacccgg cccgcaacct gccgcgcgcc gtgcgccagg tgttctggcg    212520
     catcctgctc ttctacgtgc tggccatcgc cgtcatcggc ctgctgattc cctataccga    212580
     tccgcaattg ctgcgcaacg aggtgtccga cgtcagcgtc agcccgtttg cgctgatctt    212640
     cgagcgcgcc ggcctgctgg cggccgcctc catcatgaat gcggtggtgc tgacgtcggt    212700
     gctgtcggca ggcaattccg gcatgtacgc cgccacccgc atgctgtaca gcctggcccg    212760
     cgacggcaag gcgccggcgc gcttcggccg cctgtcgcgc agcggcgtgc ccctgtgggc    212820
     gctgctggcc accaccgcgg tcgccgcgct gtgttttctg tcgttcctgt tcagccccaa    212880
     ggcggtgtac atctggctgc tgaacacctc gggcatgacc ggattcatcg cctggctggg    212940
     catcgccatc agccactacc ggtttcgccg cggctatgtc gcccagggca acaacctggc    213000
     cgacctgccg tatgtctcgc ccttcttccc gttcggcccg ctgttcgcgt tcgtcctgtg    213060
     cctggtcatc acgctgggcc agaactacca cgccttcctg caggaccgca tcgactggac    213120
     cggcgcggcc gccacctatg tcggcattcc gctgttcctg gcgatctggg cgggctatcg    213180
     cctggtgcgc ggctcgcgct tcgtgcgcta ccgcgacatg cagttccccg acctgcgcat    213240
     gcgcaaccgc gagttgaacg ccatgctcag cggcgactgc gccgagcccc gccgctaggc    213300
     cgcgcgggcc gcccggcggg cccgcgccgg cctggcgcta gcgcttgccg ccaggcgcca    213360
     tctcctgctc gaccaccatg tccagcacat acaccgtgga cggcgcgtcg gcgggcgggt    213420
     tcttccattc gtagcgcttg gtgcgcagca ccgtgcgcac cccgtcgcgg tgctcgtagc    213480
     cctgcaccga ctggtacagc ggacgccagt cgtcctgcgc gggcagttgc aggcctgccg    213540
     catcgtagcg gcgctcgcgc acctgcaggc agcgatgctg ggggatcatg ggatggctgc    213600
     actgcacgcg ctgcgcggcc acctccagga acacggtctc gcccttgctg ccgtacaggg    213660
     tctcgggcgt gggctcgccg tcgaagctga gcgtatcgcc gttgtccgcc accagcacca    213720
     gccggggctg cccggcctgc tcgcccaggg tcgcgcgcag gctgcccttc aggcgttcgc    213780
     caaccgcggc atcgagcgcc atcaagccgg cttcgcatgc cttcatcgtg gcggccaggt    213840
     tggcgatctc gagccggccc ttgccgtacg tgtagccgcc gaactgcgcg ttgcagccac    213900
     cgctgatgtt gatggcgcgc tcggagaagg ccaggcgcag cggccgctcc aggccgatct    213960
     gcagcggcgc gatgggctgg ccctgccggt cgaccgccgc ggccagccgc caggtgtgcg    214020
     tggtcagcgt ggccggctgg gcggccgccg tggatgagcg ggcaggcatc gtggctggat    214080
     ctccggatgc ggttggggac gacgagcagg cttgcagcag cactgccaac gcggataggg    214140
     caagaatacg cttcatggct tccggatcgt gaacatgggg acagcccgtg gcacacgggc    214200
     tgtggacgcg actgattcta cccgggggcc tgacccgcac ttgtcacacg atctttcatt    214260
     gcgtgtcgcg gtgagcaggc ggcccgccgt cgcgggcccc gtttgcggct atgctaggcg    214320
     catgagccgg ttccgatcga cattctggcg ttgcgccttc gtccttgcct tcctcgcctc    214380
     cgcgctggtg gcgggctggc tgcgccaggc ggccccgtcc tggggccacg ccctgctcta    214440
     cggcgcgatg gtgggcggca tcgtcctgtg cctggcgcta ctgttcgacg acctggcgtg    214500
     gtggggcacg cgcctggtcc aggccctcaa gcgcatgcgc ccctagacgc tgcgcccgcc    214560
     ccattggcta gtccacccgt atctgcgccg cccgcacgat ctcgccatag cgttgcagat    214620
     cggcctggat ttcctgcccg aactcggccg gcgtgttgcc cgaggcggaa atgcccagcg    214680
     cggcgaggcg ctcgcgcgtc tgcggctcgc tgaccaccgc gtgcagttcg cgctgcagct    214740
     tgtcgacgat gggctgcggc gtacccttgg gcgccaggat gccgatccag gaactggact    214800
     gactcggcca cggtcggcac gtcgggcagc gaggccaggc gctgccggct cgataccgtg    214860
     atggcctgga cctggccttt ctggatgaac gggtacgccc cggccacggc cgtgtacagc    214920
     atgggcagcg tgccgccgac caggtcggcc atggcctgcc cgccgccctt gtagggcacg    214980
     tggacgaaat tggcgccggt gcgcatcttc agcagctcgc cggccaggtg cggcgtgctg    215040
     ccgatgccgg cgctgccgta cgacacgccg gccggcagcg acttggaata ggccagcagg    215100
     tcctgcaggt tcttcgccgg caccttgggg ttggtgacga tgatgagcac ggcgtcgccg    215160
     atcttgctga ccggcgcgaa gtcctgcacc gggtcgaacg gcaggtcgcg gtagatgtgc    215220
     ggattgatga ccagcgtgcc gtcgaacccg accaccagcg tatagccgtc gggcgcggcg    215280
     cgcgccgcca tctgcgtgcc gatgttgccc gatgcgcccg gccggttgtc caccaccacc    215340
     tgttgtccca ggcgctggcc cagcttgtcg gccaccacgc gcgcgccggt gtccgtgacc    215400
     ccgccgggcg cgaacggcac gatgagcctg atcggcttgt ccggataggc ttcggcgccg    215460
     gccgcggcgc tccagcccca tgccgcgcac agcattgccg cgccggctac gcgccccaag    215520
     ctccacctgc ctgcagattt ccctagcatc gatgtctccc tttatggttg ttggactcga    215580
     accgcactgc ctgcctggcg ccgcagccac gccatcgagc gcccgcccag cggacgctgc    215640
     aattgcgcct gtgcggcatc gaccgcgcgc agcaggccgt cgagcgaaat ccccgacgca    215700
     aagccgctgc gctcggccat cagcaccaga tcctcggtgg ccaggttgcc cgccgcgccc    215760
     ggcgcgaacg ggcagccgcc gataccgccc acgctggcgt cgaaacggcg tacgcccgcc    215820
     tccagggccg cccacgcatt ggccacgccc atgccgcggg tgtcgtgaaa atgcaccgcc    215880
     agccgctcca gcggcgccac gtcgcgcagg gcgcgcaggc gcgtcttgac ctcgcccggc    215940
     gcagccgacc cgatggtgtc ggcgatcacg atctcgtcgg cgccggccgc gtacatggcg    216000
     gcggccaggc gcagcacatc ggccagcggc gtcgcgccct cgaacgggca gtcgaacgcc    216060
     accgccacat aggcgcgcgt gcgcaagccg gcgccgcgcg ccgcggccag cgtctgctcg    216120
     ctcacgctga cggcctgcgc caggcccatg ttgatgttct tgcgattcat ggtttcggtg    216180
     gccgacagca ccacggcgat ctcgcgcgcc ccggcggcca gcgcacgctc caggcccttg    216240
     agattgggca ccagcaccga ggtgcgcagg tccggcagcg ccgcgtggac ctgtgccacc    216300
     agttcggccg catcggccat ttgcggcacg gcgcgcggcg acacgaaact ggttgcctcg    216360
     acgctgcgca cgcccgcctc ggccagcaga cggatcaggc gcagtttctc ctgcgtgggc    216420
     acctgtgccg gttgattctg cagcccgtcg cgaggcgaga cgtcggtgat gtggatgcgc    216480
     tcctgcatgg ccccacccga tcgcaccggc ggcacgcagg cgctccagtt gcgcaggacc    216540
     atagccggcc agctcggcca gcacggcttc ggtatgctcg cccagcgcga gcgggcaggt    216600
     aaaggcgcgc ggcgcggccg ccgacagctt gaccgggttg cccggcatgc cgagccgctc    216660
     gccgctcttg agcggcacct cgaccaccat gtcgcgcgcg cgcacctgcg cgtcgttgag    216720
     cgcctgcgca aaatcgttga ccgggccgca cggaatgcgc gccgcgccca gccgctccag    216780
     ccagtacgcc gtcggcctgg cctgcagcgc cgcgccgacg atggcgtcga tccgcgcctt    216840
     ggccgcgaag cgcgccggct gctggcggta ggcgggatcg cgcagttcgg gcaggtcgat    216900
     gcactcgacg aagcgctcga agaaggcgtc gccgatgcag gcgatgatga tgtgcccatc    216960
     ggaggtggga taggtgttgt acggcacgtg cacgaagtgg ccgttgccga tgcccgccgg    217020
     cacctgtccc gacatgaggt acatggtcgc catgtagttg agcatcgaga tctgcgcgtc    217080
     cagcatcgag acatccacat gctgtccgcg cccggtgcgc tcgcgctcgg ccagcaccgc    217140
     cagcacgccc atggcgccga acaggccgcc gcccaggtcg ccgatgggga tgccgctgcg    217200
     catcggtccc gtctcgggcg ttccggtaat ggacatgccg ccgcccatgc cctggaccac    217260
     ctggtcgaac gcgggacgct gcgtctgcgg tccggtctgc ccgaagccgg tcaccgaaca    217320
     ggtgatgatg cgcgggttga cccgcgccag cgacgcatga tcgatgccca ggcgctgcgt    217380
     cacgcccacg ccgaagttgt cgaacaccac gtcggcctgg cgcaccaggt ccaggaagac    217440
     cgccttgccg gcctcgctct tgaggtccac gcagacgctt tgcttgttgc ggttcagcgt    217500
     caggtagtag gcgcccatgc cgtcgcgcga ataatcggga tcgtgctcga gcaggcggcg    217560
     ggtgccctcg ccggcgccgg gcggctccac cttgatggtg cgcgcgccca ggtcggcaag    217620
     cagcatcgtg ccgtaggggc cggaaagcat gtgggtcagg tccagcacgg taatgtgttg    217680
     cagcgccaag gtttcagtct ccatcatgtg caatgcgata cctacccata cgcaaatgcc    217740
     gtgccagctt gcgccacgac ggcaagtcat tgattcctat gcgcttactg ccatgccgca    217800
     cgcatcgaga cgtttcatgc aacactcgtg aaacctttat ctgttccggt gaaacacgcc    217860
     atgcccgcgc tttccgccgc gcagcccctg ccgcgcctgt gcttcgtcag ctaccgccag    217920
     atccgcgaat tcgccgcccc ggtgatcgcc gaataccgca accgggccgc catcgacgta    217980
     gtggacggca ccttcgccga tgccctggcg gtcgcgcgcg accgcatcga gcgcaatgcg    218040
     gtcgacgcct tcatcagcgc gggcgccaac gccagcatcc tgcgcgccaa cctgcaggcc    218100
     ccggtggcca ccatccagct gggcggcttc gatctgctgc aggccctcat ccgggcgcgg    218160
     cgcatcgcca gccgggtcgg ggtggtcatg tacggccaga cgctgcccga gctcgatgcc    218220
     gtcaaggagc tgctcaatat cgagatcacc cagtacgcct accagacgcc gtatcacgcc    218280
     cgccagggct tcgaacagct gcggcgcgac ggcttccagg tgatcgtggg ctccagcctg    218340
     gtggtcgagc tggccgagga agcgggcctg cgcggcatcc tcgcctattc gctggcgagc    218400
     atacgccagg ggttcgagga cgccatcgag ctggcgcgcg tggcgcgcct ggaggccggc    218460
     cgctacgagc agctcaatgg cgtgctgcac aacctgcagg aggcggtgct ggcggtcgac    218520
     cgcgaccacc gcatcatcgc cgtcaatccg cccatgcgcg agctgctgga catgcccaac    218580
     cgcacgctgc tggggcagcg cctggatgcc gtcgaacccg agctgtcgct gcagcccacg    218640
     ctggactcgg gccgggccga gcgcgccgcc gtgcagcgct acgccaggcg cgactggatc    218700
     gccaatcgca cgcccattct cgagtacggc aagctggtcg gcgccgccct gaccctgtat    218760
     gacgcgcacc gcatccagga ggccgacagc agcttgcgca tgcagcaacg ccgtcgccag    218820
     agcgcggccc gccaccgctt cgacaccctg ctcgggcaaa gccccgcgtt catgcgcgcc    218880
     gtcgacaccg cgcgccgcta cgccggcacc gacctgcgcg tgctgatcca gggcgaaagc    218940
     ggcgtcggca aggagctgtt cgcccagtcg atccacaacg ccagcgcgcg cgcccaccgc    219000
     cccttcgtcg ccatcaattg cgcgtcgctg cccgaaaccc tgctcgagag cgaactgttc    219060
     ggctacgagg acggcgcctt caccgggtcg cgccgcgacg gcaagcgcgg cctgatcgag    219120
     gccgcgcata cgggcacgct gtttctcgat gagatcggcg acatgccgct gtcgctgcag    219180
     acgcgcctgc tgcgcgtgct gcaggaaggc gaaatcacgc gcctgggcgc caccacgccg    219240
     gtgccggtgg acgtgcgcgt gctggccgcc acccatcagc cgctgcagga gctggtggcc    219300
     cagcgacgct tccgccagga tctgtactac cgcatcaacg ccctgcggct gccgctgccg    219360
     cccttgcgcg agcgcggcgc cgacatcgcc ttgctggcga cccgcctggt tgcgcgctgc    219420
     ctggaccggc tgggctcgcc cctggacgcc gaggccgcgc tcgccgccct gctgccgcgg    219480
     ctggccgcct atccctggcc gggcaacgtg cgcgagctgg agaacctgtg cgagcggatc    219540
     gcggtgttcc tgctgcagtt cgacgacgcc gaggcgatcc gccatgacgc cttgcgccac    219600
     gaatgccccg agctgttcga gcaccccgcc gccatggacg cgccgcgtcc ggagcgcatc    219660
     gcgcaggccc tgcgccaggc cgatggcaat cgcgcacagg ccgccgcgca gctgggcgtg    219720
     agccgctcga cgctgtggcg ctggctcagg cagatcgacg ccgccgacga tggcgcgcgc    219780
     gcgacttgag ccgcccccct gcctgtacac tgccagggtc ggacccgggc cggtacggcg    219840
     catcgccgcc ggccggcctt ccaacccggc gggccatggc ggcgcgccac cgcatcggca    219900
     ggagacacgc gcgtgatcat cgaatacctg caactggtcg gcctcggcct ggtcaccatg    219960
     ctgcccgtgg ccaacccgct gaccagcacc acgctgctgc tggcgctggg cagcggcttc    220020
     acgcgcgacg agcgcaaccg ccagatcggc cgcgccaccg tatatgtggc cgccatcatc    220080
     ctggcctcgt tctatgccgg caacgccatc atcagcagct tcggcatttc cattcccggc    220140
     ctgcgcatcg ccggcggact gatcgtcgcc tacatcggct tcaccatgct gttcccggcc    220200
     acctcgcaga acgaggcgca ggcgcaagtc gagatggcgc cggacgaccc gcacatccag    220260
     gtcccgggcg ccgcgcacac cggcccgcgc ccgcgcgaca tctcgttcgt gccgctggcg    220320
     ctgccgggca ccgccggccc cggcacgatc gccctgatca tcagctccgc ctcgaccctg    220380
     cacagccatg gcggcatcac cctcatccac catttcgccg tcatcaccgt cacgctcctg    220440
     ctggcgctgc tgttctgggc ctgcctgcgc agcgccgagc gggtcatgcg catgctgggc    220500
     cagtccggca tcgacgccat ctcgcgcgtc atgggctttc tgctcatctg catgggcgtg    220560
     caattcatca tcgacggcgt gttcgagctg atccgccatc cgcccggcgc ctgagccggc    220620
     gcccgcctgg cccgccgtgc tatcgtggcc cgatgaactc gggcgcatgg ctggcaatcg    220680
     gcgtggcgat cggtgtggcc atcggcgtgg cgatgggcaa cattgccgcc ggcataggca    220740
     tcggcatcgc gatcggcatt gccctcaaac tggcgagccg gtgacgcggc gcaggcccgc    220800
     cctcaggccg ccggcagcgc gcaggccggc ccggggcgtc cgaacagcca gccctggccg    220860
     acggcgtgcg gcgcccgctt gaagatgtag tcggcctggc tgcgcacttc tatcccttcg    220920
     atgaccaggt gcaggtcgag ctggcgggcc atttctatga cctggtccag caccggcgcc    220980
     gcgctgtcga aatcgccgag ggattgcatg aagatccggt ccagcttgat gccatcgacc    221040
     tcccagcgga tgatgttccc caggttcgaa tagcccacgc cgaaatcgtc caggaagatc    221100
     cgaaagcccg cggcccggaa acggcgaaac agcaccgacg gcgaggcggt cgaaaacacc    221160
     gcggattcgg tgacctccag cacgacactg cccgggctca gctcgcgctc gcgcacgctt    221220
     tgcgtaagga aatccaggaa cgactcgtcc tcgagatctt ccggaaagac gttgatgctc    221280
     aggtagaacg gcgcgtcgcc cgccatccgc gtcttcatgc cgtccagcgc ggcctggacg    221340
     atgtagcgcg tgaaaggctg gcgcaggccc atcgcctcca cccacccgag gaacgtgacc    221400
     ggggagatcg gcccgacctc gtcatacgtc cagcgcgcca gcgcctccac gcccgccatg    221460
     cgccccgaat ccagcacgcg cagcggttga taagccacct gtatcttgcc cttgcgcagc    221520
     gcgtcgacca ggctggcgcg cagcccgaac gacctgcgcc accagaggaa tacgataagc    221580
     ccgaccccgg cgcccagcgc catgccgccc agaccggcaa cggccaccgc gccgcgcgcg    221640
     tccacgcgcg ccgtggtttc gacacagata tccggccccc ccactggcgc gcaggccgcg    221700
     gccgtgcgca cgagctgaaa cccagcgccc catccctgcc agtcctcggc cgcggacgcg    221760
     ccgaacacct tgtacacatg gccttgcttg cgcgaataca gcgtggtctt ctgcccgccc    221820
     gcgcggcgca cgatgtcgtc gaagatgccc ggaatcgtga aaaccgccag ccgctcgctg    221880
     gccagcacgt cgcccgacag ctccggctgg atggggttct ccatgttctg ccacaggaag    221940
     accccgtcac gcaccgtcct gcccccgcgc ggcagcacgt gcggatggcg ccatacgccc    222000
     catacggcgg agcagcgcaa ggcgccattg tcaatgcgcg cgatgtcggc gacgtacttc    222060
     gaacgaaaga cccgttgccg caaggcggcg agatccccct ccgaacaggc cgcgggggcc    222120
     acgcgcgcct cgagcacgat atcgagctgc tcgcgcgcga tatccagcga gcgcgccagg    222180
     aaatgggcgt tgtcgtgctc gaccatgctg gtcgcgtgca tgcctttcca ggcatagccg    222240
     atcgctgccg ccaccagccc gcaggccaga acaggcacaa cgaagaaaag cagtctgtgc    222300
     cggaccggaa gatatctgat cgtcatgttg ttggcttccc gcccggacat gacgtggccc    222360
     tgcgtcatgc ccatttcgcc tgccggcggg gcgtcagaca accggccggg atcgccggcc    222420
     actcactacc aggcccatcc tgcgcgcaat gcggatctgg caacatcgca ctcgaatcaa    222480
     cggcgtccta cgccgctgga tcggatgcta gcagtttgtt tgacaaaacg catccaagaa    222540
     ttgcgccaaa tgtcaaaatt ttgcagcatt cgaccttttg ccgatattcg ccagcccggc    222600
     ggcgcgacgg cggttttccg gctcatggca ggcgcgccag cctccctgct tcgaccaaac    222660
     gcatgacaca cccgttcgcg cgaaaggcct actgacaccg gccgatacaa ccgcgcccgc    222720
     gctttctcta tggttgcctt ggaaccgtac gcacctggag agaatcgtga aaagaagaag    222780
     aaaggaggac gccgacgaac gcgtcagctg gagctcttac ctgcatgtcg ccggcatcgc    222840
     gctggtgatc atggtctgca ccgtcgagct ggtggagtgg ctgcttgccc gcggctcgtg    222900
     acgccgcggg caagccccgc gggcccattt cccggcgctg aagggccacg ccacttggaa    222960
     cgcccctgcg ggcttgttat aaacggggct gtgttgtctt tgccgggctg gaagagatgt    223020
     acgttcaaat atggagtcgc tgggccgctt cgctgtccct cgtggcgctg gtttccgggt    223080
     gttcctgggt cgggctgggg gattcggatc gcaaatccac agccagccgc gtcagcgacg    223140
     agtgcaggtg gaaccgcagc ggctgtatct acgagggctc gtacgaggcg gacgaacgcg    223200
     actatgccga ggccaggcgc ctgaaccagg ccgaaatggc gcggctgcgg cgcagcgccg    223260
     gcaactgaac cgccgcgaac gtacaggcgt acgggctggc gcccgcgccg agcctcaata    223320
     ggacttgggc agcccgagca ccttctcggc gatgaagctg aggatcatct gcggactcac    223380
     gggcgccagg cgcggtatcc acgcctcgcg cagatagcgc tccacgtggt actccttcgc    223440
     gtaccccatc ccgccgtggg tgaagatggc gttctcgcac gccgcatagc aggcttcggc    223500
     ccccaggaac ttggcgctgt tggcttccgc gccgcacggc tgctgctggt cgtagagcca    223560
     ggccgccttc tgcaccatca ggtgcgcggc ctccagttcc atccaggaac gcgccagcgg    223620
     atgctggacg ccctggttct tgccgatagg ccgatcaaag acctcgcgct ccctggcgta    223680
     gccggcggcc ttgcgcagcg cggcccgccc caggccgaca gcctccgcgg cgatcaggat    223740
     ccgctccgga ttgagaccat gctggatata gctgaacccc ttgccctcct ccccgatccg    223800
     gtcttcgacc gggatgcgca ggttatcgat gaacagctgg ttcgagtcca cgcacttgcg    223860
     gcccatcttc tcgatttcgt gcacttcgat ggcggcgcgg tccaggtccg tatagaacag    223920
     gctgaggcct tcgctgcccg tgcacgcttc gatcggggtg gtgcgcgcca gcagcaggat    223980
     cttgttggcc acctgcgcgg tggaaatcca cactttctgg ccggtcacca cgtagtggtc    224040
     gccctggcgc acggcgcggg ttttcagttt cagcgtattc agcccggtgt tgggctcggt    224100
     cacgccgaag caggccttgt cctgcccggc gatcagcggc ggcagccagc gctgcttctg    224160
     ctgcgccgtg ccgaacacga cgaccggatg caggccgaag atgttcatgt gcacggccga    224220
     ggcgcccgac agtcccgcgc cggtcgccgc gatcgtgtgc atcatcagcg ccgcgtcgct    224280
     gattcccagc cccgcgccgc cgtaggcttg cggcatggcg atgcccagcc agccggcctg    224340
     cgccagcgcc tggtggaatt cgtgcgggaa gcccccttcc cggtcccggt tgaaccagta    224400
     ctcgtcgtcg aacggctcgc acaagcgttc gatcgccgat ttgatttgct cttgttcgtc    224460
     gctcagacgg aagtccatgt cttgtcctgc caggttgaag gtcgaaaacg cggttcagcg    224520
     gcccgaggcg gcggggaagt cgagctcgag ctggtgctgg ccgaagcgcg gcggcggcat    224580
     gcggtagcgc gccggcgtgc ggcccagctt gacgggcgaa gccacgccgg catagccgtc    224640
     gcgttgcacg accatttccc gatgcacggc ctgcggatgc cgcaacgcct ggggaatgtc    224700
     caggacgctg gagcaaggca cgcctgcgcg gatgaggcgc tcggccagtc cctgcgccgc    224760
     gtgccggctc agcagcgcgg ccaatgaccg ggtcagcgcc tgccggttgg cgcaacgctg    224820
     gccgttggag gcgtagcgcg gatcgtcggc cagcgccgcc gcgcccagcg cctcgcacag    224880
     gatccggaat tgccggtcat tgccgaccgc caggaacagc ggatcggtcg ccgtggggaa    224940
     aatgtcgtaa ggggtgatgt tgggatgggc attgccggtg cggccgggcg tgacgccggc    225000
     ggcaaaatgg ctggccgtat gcggatgcag gatggatagc gcgcaatcga acagcgcgat    225060
     atcgacgaac tgcccgcggc cgctgcgctg gcgctcctgc aacgccagca gcaccccgat    225120
     ggccgcgttc atgccggtca ccatgtccac gatgggcacc cccacgcggg taggctcgcc    225180
     gccgggatcg ccgttgacgc tcatgatgcc ggacatggcc tggatcgccg cgtcgtagcc    225240
     gggcatgccc cccatggggc cgtcggcgcc gaagcccgat acccggcaat ggatcaggcg    225300
     cggaaaccgc ccgctcaaca cctcgaagcc caacccccag cgctccatgg tgccgcactt    225360
     gaagttctcc accagcacat cggcgccgtc gagctgcgcc agcagcgcgg cgcgcccggc    225420
     ctcggacgac agatccagcc aggcgccgcg cttgttgcga ttgatgccct ggtaataggc    225480
     ggcaacctcg ccggcgaacg gcggccccca ggcgcgcgtc tcgtcgccgc ccggcggttc    225540
     gatcttgacc acgtccgcgc cgtggtcggc cagtatctgg gtgcaataag gcccgctcag    225600
     cacccgcgac aggtccacga cgcgtatgcc gtccaatgcg ctgcccgccg ccatggccgc    225660
     gagcgtgtct gcggcgtttc tcatgggcgg atgtacgagg tcttgaggct ggtgaagaac    225720
     tcgcgcgcat aatggccctg ctcgctgctg ccgtagctgg acgccccgcg cccgccgaac    225780
     ggaacgtgga aatcgacgcc cgaggtcggc atgttcacca tggccaggcc gctttggacg    225840
     tggcgccgga aatgcgtggc atgcttgagc gactgcgtgc agatgccggc cgacaagccg    225900
     tactccgtgt cgttggcgat ggccagcgcg tgctcgtagt cctgcgcgcg cagcacgcag    225960
     gccagcgggc cgaaaacctc ctcgcgggcg atccgcgcgt ccaggctcac atccagggcc    226020
     aggcagggct gcaggtaata gccgcgctgc gcccgctgca aggctgcgcc gccgataacg    226080
     cgctgcgcct cgtcgcgcgc cagcgcgatg taagacagat ccttgtcgaa ctgggcgccg    226140
     ttggacaccg gaccgatctg gctccgctcg tccagcgcat ggcccacgtt cagggccatg    226200
     acccgttgcg ccagctcctg cacgaaacgg tcatggatgc ccggcgtgac gatgagccgg    226260
     ctggaggcgg tgcagcgctg gcccgtggca tggaaggcgc cgtcgagcgc gcaggccagc    226320
     gcgatctcga ggtccgcatc gtccaacacc accagcgggt tcttcccccc catttccatc    226380
     tgcagtttct tgtgcccggc aaccgccgat gcggcgatct tgcgcccggt ggcgctcgac    226440
     ccggtgaaac tgacgcccgc gaccgccgga tggccggtca atacctgccc gacgtccgcc    226500
     cccgtaccca ggaccaggtt gaacacgccg tccggcacgc cggcggcccg gatgatctcg    226560
     gccaacatga ccgccgtggc gggcgtgaac tccgacggct tgagcacgac cgcattgccg    226620
     caggccaagg ccggcgccgt cttccaggcg ggaatggcga tggggaagtt ccacggcgtg    226680
     atcagggcca cgacgcccag cggctcacgc gagatctcca cctcgacgcc ggcgcgtatc    226740
     gacgggaaca tctcgccgcc cagccggaac acctcgccgg cgtagtagtc gaagatgtcc    226800
     gcggcgcgct gcacctcgcc gcgcgcctcg ggcagggtct tgccctgctc gctggccagg    226860
     atatgcgcaa gctgctggct gttggccacg atgccgcggc cgatgtcctt gaggatctgc    226920
     gcccgcgccg ccaggcccgt ggcggcccag cccggctggg cccgccgcgc cgcctcgacg    226980
     gcctgcgccg cctgctgcgc gctggcctgg gccaccaggc ataccggcgc cgacaggtcg    227040
     gacggattga tgttctcgct gtcgccggcg ccgcccgccc attggccgtc gatcaggctg    227100
     gtgatggttc gcatctcgtc tccttcaacg cgcgccggcc tgctcgcgcg cggcgctgat    227160
     catggccgaa taggggtagt acggcgggaa cggcccgatg gcgttcatgt ccacctcgac    227220
     cagcgtcggg ccccgcgtgg ccagggcctg ggccaccgtc gcgccgaaat cggcggcgcg    227280
     ctcgacccgc catgcaggaa tgcccgccag ctcggccagc ttcagcaagt ccggcgccag    227340
     caggctgctg tgcgcatagc gtccttcgca catcgcgtcc tgcatgtgct tgatgacgcc    227400
     atagccgccg tcgttcatga cgatcatcac gatatccgcg gcttcctgca cggccgtcca    227460
     catctcggtc atgttgaaga agaagccacc gtcgcccgtc agcagcacca ccttgcggtc    227520
     cttgctgcct atcgccgcgc cgatccccag ttgcagcccc tgccctatcc ccgcgcccac    227580
     cggatagatg ttctggcttt gcgcgtgcag cgggaacagg cgatggcccc aggggctgtt    227640
     gctcagggtg atgtcgcgcg cgaacacggc gctggcgggc atcaccgcgc gcagctgcga    227700
     cgcgaaatcc ttgtaggggc ccagcgtttg ccggaagtgc tcggcggcct tgggcttggc    227760
     ctcgcgcacc gcctgcttga aggccgcgtc gatgtccggc ccctgctcgc gcaagcgctc    227820
     cagcagccct tgcaacgtga cggccgcgtc gccgcagacc agcagcgtgc tggcatagcc    227880
     gcgcgcctgc gcggcgggat cgacatcgat cctcaccagg ttctgcggca acgccagctt    227940
     gtggtccagc gtctcgtgtc cgcgcaggcg cgaaccgacc accagcaaca gatccgcctg    228000
     ttcgtacagg gcctggaccg ccggactgcc cggcccgttg agcgccccca gattggcagg    228060
     atgatcgtcg ctgaccaccc cgtgcccgtt ccagctggtc accatgccga agcccagctc    228120
     caccagggcg gcaagttcct tgccggcggc ccgcgcgccg ccgcccgccc agacgagcgg    228180
     ccgcctggcg gcccgcacct tttgcgccag ctggtccagc gccgccggcg acggcgccag    228240
     cgcccgcggc gcggccaccc gatacgcctg gctgtcggcc ggccgggcca ccggcgtgcg    228300
     ttggatgtcg atggggatct cgacgctgac cgggccggcc ggcgcgctca tggcctgcgt    228360
     ccaggcctgc ttcaggacat ccagcgtctc ctcggccgac cgcacccggt acgcctgctt    228420
     gctgacggcg ctgagcatgc cgagctggtc cggcacgtca tgcaccgccc cggtatcgcg    228480
     gccgagatgg gccgtggcgc tctgtccggt gatgtgcagc aagggcgtgc cggcaaagcg    228540
     cgcctcgacc aggcccggca cggtattgga ggcgcccggc ccggtgctgc tgatcaccac    228600
     gcccatcgcg ccggtggcgc gcgccagccc gtcggccatg tgcgcggccc cggtctcgcc    228660
     acgcgtcatc accatgcgga tacgcttgtt cagcgtgatg ccgtccatca tggggatgtt    228720
     gtggacggaa ataatgccga aaacggtctc caccccgtta tgggcaagag tccgcgacca    228780
     gatgccctgt caggtatttc gacatcaaac tgctccctca gaattggcga agattggcgc    228840
     gctcggccag gtcctggaac tgcttgccct cgcgcgccac gattgcgccc agttcctgcg    228900
     gtgagctggc cgtgatcgtg tagcccgacg cctgcatccg ctcgctgaac gccttgtcgg    228960
     ccagtatctt ccgggtcgcg tcggccagcg tcttgacgac ggcctcgggc gtacccgccg    229020
     gcgccaggat gcccagccat ccgtcgaaaa tgaagttcgg atagccggcc tcggccatcg    229080
     tcggcacgtc cttgaacatc gggttgcgct ggccggaggt caccgccagc gccttgaccc    229140
     gcccgctttc gaccagcgac ttggccgtgg tgttcaggtc gaacagcatg gtgatccggt    229200
     cggcgatcag gtcgctctgg gccggcgcat tgcccttgta cggaacatgg ctgagcttga    229260
     tgttcgcgtt gtcctcgaac agcttgccgg acaggtggtt cgacgcgccc acgcccgccg    229320
     atccgtaggt cagcttgccg gggtcggcct tggccgctgc caccagggcc tggatgtcct    229380
     gatacggcgc ctgcgcgttg accagcagca cattggtgta gctcaccacg gaggccaccg    229440
     gctggaagtc cttcaccggg tcgaacggcg tcttctgcag ggccggggta atggtgacgg    229500
     tcgggctggc cgtgaagaac agcgtgtacc catcggccgg cgccctggcc acggcctgcg    229560
     ccgcgatcgt gccgctggcg cccccgcggt tttccaccac cacggactgg tcgagcaggc    229620
     gtcccaggtg ctgcgcgtac tcgcgcgcca caatatccac cgaaccgccg ggcgaataac    229680
     ccaccatcaa ccgtatcggc tggttgggat agccgccctg cgccaccgcc gtgccgaacg    229740
     cgagcgcgcc cagccaacct gccgccacca gcgtcttgaa ccggatcttc atgttgtctc    229800
     ctgaatgtgt cgtgcgccgt accgcagccc gcgcggccgc tctatggcgc ctgggcgcgg    229860
     ggtcgaaaaa ctataccatg aataattcct gccattgaat atttattcct tcacaagaat    229920
     ttttaggaag gcagacgcac gacaatcccg gcgcatcggt gcttgccgga acgtatcgaa    229980
     aaggtggatg gggccgcgcg ggatgggatg ccggggcggc aaggcgccgc aataggcgcg    230040
     cccggctctc ggccgggcgt cgggatgcgc gtgcgaagcg gtatcgccct gctacgcctg    230100
     cgcgggcgga cggatcagcc gcccgccggg aaaggaaagc cgcgccgggc ggctagtcga    230160
     ccttggcttt cgcctgcctg acgatgggca cccatttgtc gatatccgcg ttgacccgct    230220
     ttgccatatc gccgggcgtg ccctgttcga agacctcgaa tccatagttc ttcagggtct    230280
     cttgcagctt cggctgcgcc atggcggcgt tggcggcccg gttcagcttg agaacgacgt    230340
     catccggcgt gcccgctggc gccagcaggc cgaaatccac cgacatcaca tagccggcca    230400
     cccccgcctc catcatggtc gggacctccg gcagcatcgg cgtgcgtatc gttccggtcg    230460
     ccgccagcgc gcgcagcttg cgctccttga ccaggctgga cacgctgggc gtgttgtaga    230520
     acccgaagtc ggtttcgccc gccatgaccg cgctgacccc ctggggcgcg ccgccatacg    230580
     ggatgtgcat ggcctgcgta ttcgtcaggg acttcagcaa ttccgaggac aggtgatggg    230640
     tggtgccgtt gccgcccgag gaatacgtca gtttcccggg cgccgccttc atcgcggcaa    230700
     tcagcgcggc gaccgaggtg tacgggctgc tcggcttgac gatcaggatg ttcgagccgc    230760
     ccgccagata cgcgaccggg gcgaaatcct cgaccggccg ataaggcagc ttctcgtaca    230820
     ggcccaggtt gatcgcccat gtgccattgg accccatgac gatggtatag ccatcggcgg    230880
     cctgcttggc gacatagctc atggcgagct ggccgcccgc gcccggacgg ttttccacca    230940
     ccacggtctg gcccagcgcc ttgctcaggc ccggctgtat ggcccgcgcc aggatatcgg    231000
     ccgtactgcc cgccgccagc ggcacgacca gcgtcaccgg gtgggtggga aactccgcgg    231060
     ccagcgcgcc ttcagacagg acgctggcca gcagcgccat ccataacacg ttcttcatgc    231120
     acttcccctt gtttgtcgtc gggcgccatc gccgtgtcgg gtggcacgcc tgcaaggcag    231180
     gttatccgaa ggtctgtgcg tgaaataggc gtgaagcgct atagcgtcat gtcgtcatgt    231240
     aatggcccgg ctgcgtcaaa accggcgcag cacgtcacgc gcgatcgcgg caaaggcctg    231300
     cgccgccggg gaaagcggat ggttcgacag ccgcaccagc gaaatcggcc aactcaggaa    231360
     cggattgcgg atcggcactg cccgcacgcc gcgcggcgcc tgcgccgccg ccgcatgcgg    231420
     caacatggcc acgcccatgc ccgcctggat catgcccacc gcggtcgaca ccagcacgac    231480
     gcgctggtcc acgcgcgggt ggatgccgtt ggccaccagc aggcggctga tcaccagcca    231540
     gggcggcgcg ttggggttga gctggatgca gggcagctcg gccagtatcg ccgcgtcgat    231600
     cgcttcgcgg tcagccagat aatggtcgtc gcgcatgaac agcgacaccc cgccgtccca    231660
     cagcagctcg gtcgacaggc gcgaatcgtc gctgccgacc acggcgccca ggccgacgtc    231720
     ggcctcgtgg gacagcagct tgttgcggat ctgttcgacc acgcaatcga ccacgatcaa    231780
     ttcgatattg gggtgccgct gattgaaggc caccaggatg cgcggcagca gggtggcggc    231840
     gctgacgtgg ccgacggcga cgctgaccga gccggacttg agcgccgact ggtcgcgcga    231900
     ttcgcgcacc gcgccgtcga tggagaggat cgcccggcgc gcgatgtcgg ccaatgcctg    231960
     gccctggcgc gtcagcgtca cctcgcggcc gcgcaccacc agcgtttgcc ccacctcggc    232020
     ctcgaggcgc cggatgagat ggctgacgga cggctgcgac atgccgagct gctcggccgc    232080
     gccggtgaag ctggccgtat ccccgatgga gaccagggcg cgcaactgac gcagggaaac    232140
     cgattcgata gcatccatca taacgtcgca tcatgcagga atagctcgaa tactatagca    232200
     atatgggcgt ggcctccata gcatggcaaa aacccctcct gcacaccgag accgccatgc    232260
     cgcactccga ctacgcccgc cacctcatgg actccgccac catagatccc accggcgcct    232320
     tcgaggcggg cagcttcgcc agcttcaccc tcacctacac cgccggctac ttcggcatcg    232380
     acgacaccgg ctcgatcaag atcgtgcacc gcttcgccag cgacatgggc aagccgcagt    232440
     tcaccgatcc gcagggctgg aactacacca ccgtcgaagc cggcaatggc gcggtgctgc    232500
     acgtcgagta cgacggcaag cgcaatatcc gcccgtggga caagaccctg ttcatccgcg    232560
     tcgtgcgcgg ctatctcgag gaaggcgaac agatcatcgt gcgcttcggc gacacccgcc    232620
     aaggctcgcc cggcatgcgc gtgcagacct tccacgagcc gaccttcgaa ttcaaggtgc    232680
     tggtggacgc tttcgccacg tacaactatg tcgagatcga ggcctcgccg acgatctccg    232740
     tggtggccgg cccccctgtc cggtacaagg ccgtgctgcc cagcctgtcg ctggccggcc    232800
     agccgctgcg cctgggcttc aagggcgagg acaaatgggg caacccttcc gaccaggcgc    232860
     agggccgcta caccctgcgc agcaacctgc gcatggcgcg gatgcccgag tccttcgaga    232920
     tggccgccgg cgcctatgcc cacgcgatcg aaggcatcgt cgccgccgag accggcgacc    232980
     tgcgcctgga agtcctgcac ggcgaccggg tcgtggcgcg cagcaacccg tgccgcgtcg    233040
     ccgcgcaggc ggcgcgcaac cactactggg ccgacctgca cggccagtcg gaagagacca    233100
     tcggcaccaa ctccgccgag gagctcatcc tgttcgcgcg cgaccgcgcc ttcctggacg    233160
     cgatgagcca ccagggcaac gatttccaga tcacccagga attctgggag cacctgaaca    233220
     ccctgaccgc ccgctacgac gagcccagcc gcttcgtgat cttccccggc tacgaatggt    233280
     cgggcaatac cggcctgggc ggtgaccgca acgtgctgta cctgcacgaa ggccgtccgc    233340
     tgcaccgttc gtcccacgcc ctggtggacg acctgtccga cctggactcc gacgccaaca    233400
     gcgccgatgc gctgttccag gccatcaagg acgaggacgc cgtcgtcttc gcgcacatcg    233460
     gcggccgcta cgccgacatc acgctgtcgc acgacccgcg catcgaacgt tccatcgaaa    233520
     tccactccga ctggggcacg ttcgaatggc tgctcgagga cgccttcaag cagggctacc    233580
     gtgtcggcat cctcgccaac agcgacggcc acaagggacg ccacggcgcc agccatcccg    233640
     gcgcctcgct gttcggcgcc tacggcggac tgagctgcct gatcgccgac acgctgagcc    233700
     gccaatcgct ggccgagtgc ctgcgccagc gccgccacta cgccaccacc ggctgccgcg    233760
     cctacctgga cgtggcggcg cacttcgatg cgccggcgcg ccgctacgcc gaagatccca    233820
     ggctcgcccc cgatgccgcg agcacgcagg tgcgcagcgc ggacatgggc gccatcctcg    233880
     cctgcgacac cgacatggtc gagttcgaat tcgacctcgc caccgaggcg ccgatcgaat    233940
     cggtggaagt gcgcaaccgc atggacgtgg tccagaccct gcgtcccttc aagccagccg    234000
     acctgggccg ccgcatccgc atcgtctggg aaggctcgga gtaccgcggc cgcggccggc    234060
     agaccgtatg ggacggcagc gccacgctgc aagacaacgc ctttgtcgac cccaagccca    234120
     tcaatttctg gaacctcgac aagacgctgc aacagccgca gcccaaccac ctgtgctggc    234180
     agtcgctgac cacgggcggc ttcagcggcg tggacgtgat gctcgaagac gccgggcgcg    234240
     gcacgctgtg catcgacacc gacctgatcc aggcgcgcat cccggtggcc gacatcggcc    234300
     tggagccgct ggtcttcgag aacggcggca tacgccggcg cctgcaagtg ttccgcctgc    234360
     cggacgagaa ccccgcctgc cacctgaagg cgcgcgtgca ggtccccttg catacggaac    234420
     aggacaacgc cctgtacctg cgcgccacga cggaggacgg gttcttcatc tactccagcc    234480
     cgatctatat agaacgaaag gcgtaacgcc gccccgcccg gccgccgccc cggcggccgc    234540
     ggcattgccg cgcatccgcg ccgaccggcg cggcgccacg gcatcgtttc cgcgcctggc    234600
     cggcacggga tttccaggcg gccatcggcg cgcccgccgg ccgccgcacg cgccggatcc    234660
     gggcccgaca cccctcattc aaatttcttt cttcccgatt ccgtttcctg tattattaat    234720
     tgaccggtca ttctgactat tatttaaata gatgtgctgc caggccgccc tcgcgcccgg    234780
     ctgcgccgac gcaggagaca atcgcgtgtc caacattctg gctatcgggg tccatctccc    234840
     gcggctgcgc ctgtcccgca gggccatggc aaacgcgctg ggctggctga gcggcggcgc    234900
     cggcgccggc aagggcagcc gcaccctggc ctactgggac gaagacagcg tcaccatggc    234960
     cgtggccgcg gcgcgccatg ccctggcccg ccaggccgcc cccgccatcg acgccttgca    235020
     gttcgccagc accacgccgc cgttcgccga accgcagaac gcggccttcg tgcgcgccgc    235080
     cttgcgcctg ccggcgacca ccctgaccca ggatgtccac ggcacgccgc gcgccggcct    235140
     gcttgccttg cacatggccc tggagagcgg cacgcggacc ctggtcgcgg cggcggacct    235200
     gcccacggcg ctgccgggca gcacggccga ggcgcgcgcc ggcgatggcg gcgccgcggt    235260
     gctgaccggc gacgaaccgg ggctgttgcg ctacctgggc ggcgccagcc tgagcgcgcc    235320
     gttcaccgac cgctaccgcg ccgccggcca cgactacccg caggaatggg aggagcgctg    235380
     gctgcgcgaa gccggctacc tggagctggt ccatgacgcc atcggccgtg cgctgcaggc    235440
     ggcgtcgctg cggcccgaac aggtcgacca tttcgtactg ccgtgcccgg tgcccggcgt    235500
     ggcggcggcc gtcgccgcca aggccggcct gggccaggcg cgcctggcca gcgccctggc    235560
     cgagaactgc ggcgacaccg gcgcggcgca tgccttcgtc atgctgggcc gcgcgctcga    235620
     agatgccgcc cccggccaga aggtgctggt cgcccagttc ggccagggcg cgaccgcgct    235680
     gctgttcgag gccgacgagg ccgtggccgg cctggccgcg ccggtctcgc ccgccctgca    235740
     gggcgggctg gccgaggaca actacatgaa gctgctggcc tttcgcggcc gcatcgcctg    235800
     ggaccgcggc ctgcgcggcc gtttcctggt caacgaagcc ttgagcacgg cctggcgcaa    235860
     cgccgatgcc ttgctcggct tcgtagcggg acgctgccgc gaaacgggcc aggtccagtt    235920
     cccgcccacg cgcctggccg ccacgggcgg cttccatctc gatacccagg aaccctggcc    235980
     gctggcggac cggggcggac gcatcgccac cttcaccgcc gacctgctgg cattttcgcc    236040
     atgcccgccg aattgctacg ggctggtcga catcgatggc ggcgggcggg tgctgatgga    236100
     gttcaccgac ccgcaagcca gccagctcga ggccggcgcg gccgtggcgt tcgccttgcg    236160
     catcaaggat ctcgacccgc aaaccggcta ccgccgctat ttctggaaag cgctggccgc    236220
     gccgacggcc gattgaggac agactgatgg ctacaggaat caaggatcgc gtcgccattc    236280
     tggcgatggg ctgttcccgt ttcggcgaac gctgggacgt gggccaggaa gaattgatgg    236340
     tcgaggccta cgccgaggcg ctcgccagcg tcggcatcga gccgcgcgcc atcgaggcgg    236400
     cctggtactc gtcgcattat gacgacatcg gcgcgggcaa ggccggcacg cccatggcca    236460
     tggccctgcg cctgcccgac atcggcgtga cgcgcgtgga gaacttctgc gccggcggca    236520
     ccgaggcatt tcgcggcgcc gtctacgcgg tcgcctccgg cgccgcggac atcgcgctgg    236580
     cgctcggggt ggaaaagctg aaagacaccg gcttcgccgg cctgccgctg gcctcgcgcg    236640
     gcacgctggc gcccatgtac ctgcccacgc acagcaaccc gggcaacttc gcgcagctgg    236700
     cgcgcgccta ccaggcccgc cacggcgtct cccgcgaaga cctcaaggcg gccatggccc    236760
     atacctcggt gaaaagccat gccaacgcct tgcacaatcc caaggcgcac ctgcgcaagg    236820
     ccatcagccg cgaacaggcc gccggcgcgc cgctggtggc cgaccccatc ggactgttcg    236880
     attgctgtcc ggtgtcggac ggcgccgcct gcgccatcgt caccaccccc gagatcgccc    236940
     gcagcctgaa ccgcggcccg ctggtcctgg tcaaggccat ccagctggcc acgtccaacg    237000
     gctgggagct gcagcaatcg gactgggacg gctcgtacgt gcacaccacc cgcgtggcgg    237060
     cgcgcaaggc gtacgccgaa gcgggcatcg acgatccgcg cgcgcagctc agcctgaccg    237120
     aattgcacga ctgcttctcg atcaccgaac tggtgacgct ggaagacatt ggcctggccg    237180
     agcccggcac ggcctggcgc ggcatgctcg acggccgctt cgacgccgac ggggcgctgc    237240
     cctgccagat agacggcggc ctgaaatgct tcggccatcc cgtgggggcc tcggggctgc    237300
     gcatgctcta cgaggcctgg ctgcaactga gcggccgcgc cggcgcgcgc cagctgcccg    237360
     cgccctcgct ggccctgacc cacaatctgg gcggcgcgcc cgcgcagaac gtgtgttcga    237420
     tcacaatact cggcgcggcc tgacaccggg ccgcgccggc ccgcgggggc cgcgcacaat    237480
     tatcaacacc atcctgccca caggaggaga ctgagatgct tcaccctgag atagaactgc    237540
     tggaccgaga cggcatcctc aagatccagc gcgagcggct ggcgcgattg ggccagcgcc    237600
     tgcagcacag cccgcaatgg cgcgagcatt tcgccagcgt cggcatgacg cccggcgacc    237660
     ttgcctcgcc ggacgccttc gaacacctgc ccttcctgca gaaggccgac ctgcgccagc    237720
     agtatcccta cccgttcctg accgttcccc tcgaagacgt ggagcggttc gtcgccacct    237780
     cgggcaccac cggcctgccg gtgatgttcg gcctgacgcg gcgcgacctg cacgagctac    237840
     tgcccagcca gaccgcgcgc ctgctggccg cggcgggcgt gcgccgcggc gcgcgcgcct    237900
     accagggcta cggctacggc ctgtggatcg gcggtctggc gctggaccag ggcttcaagg    237960
     aaatggactg cgtcaacttc ccgctgggcc cgggccgcgg cgacctggcg gcgcgctgga    238020
     tgcgcgacca tgcctacgaa gtggcctcga tgtcgccgct gtggctgatg agcctggcgc    238080
     aggccgcgcg cgcccagggc atcaacccca agaccgactg ggcgctgcgc acagccatcc    238140
     tgggcggcca gtcggtctcg gccgaattcc gcgcccagct ggaagcggaa atgcccgaag    238200
     gattcgtgtc gcacaacatc tacggcacca ccgaggcggg cggcccgatc ctggccatct    238260
     cgacgccgta cacgcacgcc gacgacgaac tgcatctcat caatgaagac acggtgctga    238320
     ccgagatcct ggatccggtc acgctcaagc cggtctcaga aggggaagtg ggcgagatcg    238380
     tcatcaccac cctgaccaag gaagcctcgc ccgtgatccg ctggcgcacg catgacctgg    238440
     tcaggctgtc gtcgcacccc tacgactgcc cgtcgggacg gcgcggcatg cgcaagatcg    238500
     gacgcatcat cgggcgctcc gacgacatga tcaagttcaa gggcgtgatc gttttcccgt    238560
     cgcagatcga ggacgtcatc accggcgtcg ccggcgtggt caaggaagcc tggcagatct    238620
     atatcgacaa ggaatgcatg accatcggca ccatgaccgt ggcgatcgag gcgtccgccc    238680
     aggccggccg tccggccgaa cagctcagcc atgaagtggg ccgggaaatc cacgcgcgcc    238740
     tgggcatgaa ggtctgcgtc gaatgccatc ccgaaggcac gctgccgcgc tacgaagcca    238800
     aggccgtgcg cgtactgcat cgtcccgaag catgaccgcg cgcgatccgc tggccgccat    238860
     ccgcgcccgc ctggccgagg tggggccgcg cggcgcggcg atggcccgcc cccggcccca    238920
     acccctggcg ccggcgctgg ccggcgcctg gatcggccag ggtgcgcggc gcgcgctgta    238980
     ctgccatggc ggcggtttcc agattggcgg catcgcctcg cacgccagcc tgatcgcccg    239040
     gctgaccgag gccggccagg cccgcatcct ggccgtcgag taccggctcg cgcccgaaca    239100
     tcgctatccg gcggcgatcg acgacgcctt cgcggcctac cagtggctgc tggccaacgg    239160
     cggcgcgcca gcggccatca tcggcgactc cgcgggcggc gccctggcgt tgcagaccgc    239220
     gcagcgcgcg cgatgccggc ctgccgctgc cgcgctccct cgtgctgctc tccccctggc    239280
     tcgatctgtc catgcaaggc cgcagctacg tggagctggc cgaacaggac attttctcca    239340
     agccggcaca gctgcgcgcg atggcgcgca gctatctggg acgcctcggc ccgccgccgg    239400
     atgcgccgcc ggcctcgccg ctctgggacg atctgtcagg cttgccgccc atcgtcgtgc    239460
     acgccggcgc gcacgacatc acgctggacg actcgcatac gctggccgca cgcgtgcgcg    239520
     ccgccggcgg gcaggtgcaa ctgcaggtct ttcccggcat gtgccatcac ttccagatct    239580
     acgaagcgct ggccgaagcg cgggagtcga tcgacgcgct gggccgccat ctgcggcaag    239640
     actagcgcca ggcggcgcgc aaggcgcgcc gcccctcatg cctggacgat cagcccgctg    239700
     tccagcgcgc tggccacgcg ctcgggcgcc aggccccatt cgtgcagcac ctcgaccgaa    239760
     tgcgcgccca ctgcgggcgc ggcggcgggc tggcgcgccg gcgtggcgct caggcgcggc    239820
     gccggcgccg gctgcgtcac cccctcgacg tcgatatagc ccgcgcgggc cgccgcatgc    239880
     ggatgatggg cggcttcgcg ccaatccagg acgggcgtca cgcaggcgtc gctgtcctcg    239940
     aacagcgccg cccaatggtc gcgcggccgg gtggcgaaca gcgccgccag ccgcgcgcgc    240000
     aaggccggcc attgggcagg gtcgcgatcg tgggtataca cggccgggtc caggcccagc    240060
     cgttcgacca gcagatcatg aaagcgccgt tcgacgcagg ccacggccag aaagcgcccg    240120
     tcggcgcagg cataggtggc gtagaaatag gcgccgccgt ccagcaggtt gccctcgcgc    240180
     cggtcggacc agccgccgcc ggcgcgaaag ccccagaaca tcgaagccag caggcccgcc    240240
     ccatccacca tggcggcgtc gacgacctgg cccggcgccc cgccacgcac cgccagcaag    240300
     gcggccagca tgccgaacgc cagcagcatg ccgccgccgc cgaaatccgc cacgtagttc    240360
     agcggcaccg gcggcggacg gtcggacggc ccgatggcgt gcagcgcccc ggtcaggccc    240420
     aggtagttca gatcatgtcc ggcctggcgg gccagcggtc cctgctggcc ccagcccgtc    240480
     atgcgcccgt acaccagccg cggctggcgc cgcaggcatg cctcgggcgc caggcccatg    240540
     cgctccatca cgccgggccg gaaaccttcg atcagcccat cggcggcgcc gaccagttcc    240600
     agcagcagat cgctggcgcc gggcgcgcgc agatccagcg ccagcgagcg gcggccgcgc    240660
     gccagcacgt cgaagcggct gtccagcaag gggaagtccc ccttcctgtg cgccgcatgg    240720
     acgcgcacca cgtcggcccc gtgatcggcc agcatcatgg ccgcgaacgg cgccggcccc    240780
     agtcccacca tttcgatgat gcgcaaaccc tgcaaggcag gcgccatgcc ctctccttgc    240840
     gccatcactg cggcgcgacc ctgacggtca gcccttccag cgccggcgcg accgtaatct    240900
     ggcaggaaag acgcgactcg gcgcggacat cgttggcgaa gtccagcatg tcgcgctcca    240960
     tgtcgccggg ttcgcccacg gcctgcatcc actcctgtcc cacatgcaca tggcaggtgg    241020
     cgcaggtgca cgcgccgccg cactcggccg cgatgcccgg cacattggcg cgccgggcgc    241080
     actccatcag gctcaatccg tcgtccgcct ggacgacgtg gcgagcctca ttggaggcga    241140
     tgaaaataat cgttgtcata cgaggcgttc ccgtcgtgta tcaagcgccg cagcccatcc    241200
     cgccggagac gcccagcgcc tcgccggtga tgaagccggc ggcttcggag cataaaaacg    241260
     caatcgccgc ggcgacttcc tcgggccggc ccaggcggcg cagcagcgtc aacgcctcca    241320
     ggtcgacgcg catctgcgcg cccgcgacgt cgacggcgcg cgccagcatc ggcgtgtcga    241380
     ccggcccggg cagcacggca ttggcggtta cgccgtagcg cgcgttctcg cgcgcaatcg    241440
     agcgggtgaa tccgagcagg cccgccttgg cggcggcgta gaccgccccg ccgcgcgaac    241500
     ccaggcggcc cgcctcggac gacacattga cgatgcggcc gaagcgcgcc gcctgcatgc    241560
     cgggcaacac gcccagcgtg aaggcgaacg cgctctccag gttgacggcc agcagcgcgc    241620
     gccagtcctg cggggtcgtc cgggaaaaga acgcgtgctg gtcggcgccg acgttgttga    241680
     ccaggatgtc gaacggcgcg gcgccggcgc agaatccggc caccgcctcg gcgtccgtgg    241740
     cgtcgagcgc gacaaagcgg gcgccggtgg cctgggccac gctggcgccc gcctgcgcgt    241800
     cgcggtcgca gaacgtgacg cgcaggccgt cgcggcatag ctgcgcgacg gtggccgcgc    241860
     cgatgccgtt ggcgccgccg gtaacgagcg cgtgccgcgg catcagtgcc tccggaaaac    241920
     cggctggcgc ttcccgatca ccgccgccag cccttcccgg ctgtcggccg tggccgacag    241980
     ggtcgatacg gtacgggcct cctcgggcag cgcccgttcg acctgcagcg tgttccacaa    242040
     caggcgcttg gtcgccgcct gcgccagcgg cgctccggcg gcgtaggtcg cggccaggcg    242100
     ggccgcgctc tcgtccagct cggcgtcggc gaccacctgg ttgaccaggc ccatctcgag    242160
     cgcctcgtcg gcgcccaccg tgcggttcga cagcatcatt tccatggcgc ggcgaaaacc    242220
     gatcagatgc ggcaggatga ccgagctgcc cgcgtccggc gccatgccca cgcgcgtggc    242280
     gccggccagg aacctggcgc cctgcgcggc gacgacgatg tcggccgcgc ataccaggcc    242340
     caggccgccg ccggccgcgt agccctgcac ctgcgccacc acgacggcgt ccagcctgat    242400
     cagcgcgccg atggccattt gcagccaggc ggtcacttcg cgcaggaagt cgcccaggcc    242460
     ctcgcccttg ctggcgaact cgcgcacatc gccgccggcg cagaaatgct tgcccgcgcc    242520
     gcgcaacagc accacgcgca catcgggctc gcggtggcag cgcatcaccg cttcgtgcaa    242580
     cgccttcatg aattcgatat tcatgccgtt ggccgcatcg ggccggttca acgtgatgcg    242640
     ggccacatgg tccgcatagt ccagcagcac aggaccctcg ccaatccagg tctcggggtt    242700
     tgcagtcgtc atcgtcatct cctcatacca ggaaggacag ggtgaaaatc ggtttggcgc    242760
     cattgaccag ggcaatcttc ttgcgcacca ggcggaaggc gccatcgacc agccggagcc    242820
     ggtactcgtt gcgggcggcc caatgcgttt cgccgcgcag gttgtcctcg tagatcagca    242880
     cattggccag cgccgtcact tcctgccccg cgacatcgac gatctcgatg ttggaaatca    242940
     ggcgcgccag cgccgagcgc ggcgtctgcg tatggcggcg gccggtcagc aactgttcga    243000
     tgcggacacg gatgcgcgac cggttgtcgt agatcaccga catcttctgc tcgggatcga    243060
     tatcgtcgcc attggccgga atccagtaga tggcgtcatc ctcccagagc gactcccagc    243120
     cctggtagtc gtgcgtgtcc tgcagccggg cctcgtgata gagaaactgc gacacccgat    243180
     ggtgcagcgt cagttcgtcc agcgcctgca gatcgtcagc ggccggacgg gtttcggggc    243240
     gtgcggtcat ccggattact cctgcatcag cttgaaatag tggcgccaga tcccgcgctg    243300
     cgggacctcg tcggtcgaat gcccgacggt gtagccgttc tcgtccttgc gctcgcgatg    243360
     caggccgcgg gtcagcatca gccattcggg gtcgcggatc ttcgcgccgc ggtggttgcg    243420
     ctcgtacatc tccgtatcgt cggccagcag caggccggcc ggcccgaccg aacccatggt    243480
     ctgctggcgc agccggcggt tgatgtcggg cgcgtccttg aactgcaccg ccgtcacgtg    243540
     ctggatggtt tcctccaccg ataccggctg cagcacgaag atctggatct ccgcgatgaa    243600
     cagattgggg aagatcatcg tgtgcggcga gccgtcgatc atgatctggc gcgcccgctc    243660
     ggcgccgtag gcctggtcca tcgcgacggc gtagtccgcc atccgctcga ccgacgagcc    243720
     gaaccagtac agcggcttgt cgatgcgccg ccactccggc cgcagatcga actcggtatg    243780
     gccgttgccg tagtcgcgcg tcagcgcggt cgaatccttg ccgtagagat tggcgatcgg    243840
     actgttggtg acctggaaga tggaaccatg cacgaagccg gggtggtagc cgtcggtctc    243900
     gttctccagc atgaacttcc agttggcctt ggcccggtgc tgcaggaacc cggcgcgcag    243960
     gtccagctcg ccgttgggcg agttgtcgca caactggtcg atggcggcct tggccccgcc    244020
     caggtgctcg tccaggctcg gaccggtttc ggcgaacgat ccgaacacga agccgcgata    244080
     gatgcctatc ctcgccacct tgccgagccc gacgccagcc ttggaggcgc cctcgtagcc    244140
     gtcggccagc gcgtacccca tcaggtcgcc ggtgttcgag aaggtccacg agtggtacgg    244200
     gcacgtgaag gtgctgcggt tgccttcctt gtaggcgcac agctggttgc cccggtgcgg    244260
     acacttgttc agcaacaggc ggatctcgcc gtcgcggtcc cgcagcaaca gcaccggcgt    244320
     cgtgccgatg ctcttggtca cgtagtcgtt cttgttgggc acttcgctga cgtgacccac    244380
     gtatacccag gtcctgtgcc agatcttgtc cagctcctcc tggaagatct ccggatcgac    244440
     gtacaggcgg ctattgatcc gcgtgggctc gatcagcgcc cggtagtcga tctcgttcct    244500
     gatggaagac atcgccctca cctccgatgg tttgtgaatt atttaataat ccgaatggtc    244560
     gttcgattta taaatgagga ggcgatggca tgtcaagtac agatttttat aaccaatcga    244620
     ccattcggtt tttacaacaa cttccgggaa tcgaatcagg ggaaaccatt agggagattt    244680
     cttaaaaaca ccttaaaaga aaacatatat atttgattta taagtgtttt tacaaaacac    244740
     cagactaccc gcaacatgtc ggaaaagcgc ggaaccgact atagccaagc ctctcaagcc    244800
     ctgataaatt acacgaacgg ttgttcaata ataggctcac accacatatc gagccgccat    244860
     acaggaggag tcatgaacac aagcaaggca atcgtcgcgg gcttgctcgc actgggctgc    244920
     gccctgcccg ccgcggccga gatccggctc ggcgcctcgg tctcggccac cggcccggcc    244980
     ggcatcctgg gcgaccccga agcccgcacc ctggaactgc tcgtgcagga actgaacgcg    245040
     cgcggcggca tcaagggcga gcagatcaag ctggtgctgt acgacgacgg cggcgacgcc    245100
     aacaaggcgc gcaccttcgc cacccggctg gtcgaggacg acgaagtgca ggccatcatc    245160
     ggcggcacca ccaccggcac ctcgatgtcc atcctgtcgg tcgccgaaga cgccaaggtg    245220
     ccgttcatct cgctggccgg cgccatcgac atcatcgacc cggtcaagcc ctataccttc    245280
     aagacgccgc ataccgaccg catggcatgc cagaaggtgt ttgccgacat gcgcaagaac    245340
     ggctggacca aggtggcgct gatcggctcc acggacggct tcggcgcttc catgcaggcg    245400
     cagtgcaagg ccgtggccgg ccagtacggc atcgaactgg tggacagcga aacctacgag    245460
     cccaaggacg ccgacatgac ggcgcagctg accaagatcc ggggcatccc cggcgtgcag    245520
     gcagtcctga acccggggtt cggccaaagc gcggcggtgc tggcgcgcaa ctaccgccag    245580
     ctcggcatga gcctgccgtt ctacgcctcg cacggcgtcg catcgcaggg ctatatcgac    245640
     ctggccggcg ccgacgtcgt cgaaggcttc cgcctgccgg gaaccgcgct gctggtggcg    245700
     gacctgctgc ccgccagcga tccccaggcc gcgccgtcca tcgcctacaa gaaggccttc    245760
     gaagccaaga ccggcgcccc cgtgggcacg ttcggcggct atgcgcacga cgccttcctg    245820
     atcctggtcg atgcgctgaa ccgcgccgac tcgaccaagc ccaccgcgat ccgcgacgcg    245880
     atcgagaaaa ccagcaagct ggccggcacc accggcgtct acaccttctc gccgaccgat    245940
     cacctgggcc tggacctctc ggccttccgc gtgctcgaga tccgcggcgg caagtggaaa    246000
     gtcgtcgact gagcgcctga acggcggccc gtcgccggcg caccgagcac gggcccgcca    246060
     tcccagtcca gacaaacgcc ggagtgccca tgtcggaatt catgcagttc attttctcgg    246120
     gagtgacagt gggcgcggtc tacgcgctcg tcgccctcgg gttcgcgatc atcttcaacg    246180
     cgaccggcgt ggtgaacttt gcccagggcg agttcgtcat gctgggcggc atgatcactg    246240
     tcttcgcgca cggcgcgggc ctggcgctgc cgctggccgc gctgctcgcc atcgccgtga    246300
     ccgccgcgac aggcgtggcg ctgaaccgcc tggcgatcga gccggcgcgc ggcgcccccg    246360
     tcgtctcgct catcatcatc accatcggcg cctcgatctt catccggggc gcggtgcaaa    246420
     gcctgttcgg caagcagatc cacagcctgc ccgcgttctc gggcgacgac ccgatacacg    246480
     tgctgggcgc caccatcctg tcgcaaagcc tgtggatgat cggcggcgcg gtggcggtat    246540
     tcatcgtcct gtggctgttc ttcaccagga cactgatagg ccgcgcggtg ctggccacct    246600
     cgaacaaccg cctggcggcc cgcctggtcg ggatcaacac ccgattcatc atgaccctgt    246660
     cgttcgcgct gtcggcggcc atcggcgccc tggccggcgt gctgatcacg ccgatcacgc    246720
     tgacttcgta cgacgtgggc ctgaccctgg cgctcaaggg ctttgccgcc gccatgctgg    246780
     gcggcatggg cagccccaag ggcgcgctgg ccggcggcat tctgctcggc ctgctggaat    246840
     ccctgaccgc cggctacctg tcgtcgcagt acaaggacgc ggcggccttc ctcaccattc    246900
     tcgcggtgct gttcttcatg ccgcagggac tgttcggaca caagtccacg gatcgcgtat    246960
     aagccatgcg gatatcatcg aaacactgga cgctgatcgt cctggccgcg ctgatcgcca    247020
     tcgccccgct gttcttcccc tccggctatt acttccgcgt gggctcgaca attttcgtca    247080
     acgcgctggc ggtcaccggc atcgtcatcc tgaccggcta cgccggccag atcagcctgg    247140
     gacacgcggg attcgccggc atcggcggct atgcctgcgc gctggcgccc gtgcacctcg    247200
     ggctgccctc ggcgctgtcg gtcgtgctgg gcgcggccgt ctcgggcgcg ctggcgtggc    247260
     tggtcggccg ccccatcctg cgcctgaagg gctactacct gggcgtggcc tcgctgggct    247320
     tcggcatcct ggtggccatg gtgctgaaca atgaacgcca gctcaccaaa gggccggacg    247380
     gcatcgccgt gcccgacccc ggtctgcgca gcctgttgaa gggctggagc ctggacctgt    247440
     ccaatggcca gttctggtac gccatgacgg gcatcgcgct ggtgatcggc gcctggctcg    247500
     cgctcaacct ctaccacagc ccgacagggc gggcgctgcg cgcgctgcac ggttcggaga    247560
     tcgccgccgg caccgtcggc atcgacgtgg cgggcgccaa gctcaaggcg tttgtcgtct    247620
     cggccgtgta cgcctcggtc tcgggctcgc tgctagcgct gcagaaccgc ttcatcacgc    247680
     cggacatcgc gggcttcatg cactcgatcg aaatggtgac catggcggtg ctgggcggcg    247740
     tcggctcggt cgccggcgca atcttcggcg cgagcctgct gaccctgctt ccgcaggtgc    247800
     tgacggtgtt cgccgactac gaacccctca tcctgggcct gaccatgatg ctggtcatga    247860
     tcttcctgcc cgaaggcctg gttccgtcca tcatgcgcac gatacgagga aggaaaaaat    247920
     gagcctgctg gaaatccacg gcctgggcat tacctttggc ggcctgcgcg ccgtgcacga    247980
     cgtcgcgttc agcgtcgagc cgggcgagat cgtgtccgtc atcgggccca acggcgcggg    248040
     caagaccacc ctgttcaaca tgatctcggg catctaccgg cccggcgccg gccgcgtcgt    248100
     gctggaccgc gacgacgtca ccggcatggc gccgttccgc ctggcgcggc gcggcatgtc    248160
     gcgcaccttc cagaacctgc agatcttcca gaacatgacc gtgctggaga acgccatcgc    248220
     gggctttcac ctgcaggagc aaggcgcgct gctgtccgac ctcttcaacc tgcgcgcctc    248280
     gcaggcccgc gcccggcgcg ccgaagaagg cgcccgcgcg ctcctgcagc gcgtgggcct    248340
     ggaacgcgcg gccgaacgcg aggccgccag cctctcctac ggctcgctca agcggctgga    248400
     gatcgcccgc gcgctggccc tgcagcccaa ggtgctgctg ctggacgaac cggccgccgg    248460
     ctgcaatgcg gtcgaaaccg aggaaatcga ccacctgatc gccgaggtcg ccgccacggg    248520
     cgtcgccatc ctgctggtcg aacacgatat gaaaatggtc atgcgcattt ccagccacat    248580
     cgtcgtgctc gatcacggcg agaaaatcgc cgaaggcccg ccggacgcca tcagccgcga    248640
     cccggcggtc atcgccgcct acctgggcac cgacagccag ccgggagacc gcccatgctg    248700
     accgtgcaag gactacgctc gtgctacggg cgcatcgaag tgctgcacgg catcgacctg    248760
     caggtcgaca gcggcgagat cgtcaccgtc gtcggcgcca atggcgcggg caagaccacc    248820
     ttgctgcgct gcctgtccgg cgtgcagccc gtctcggccg gcgccattac ctttcgcggc    248880
     gaggccctgg ccgccgtgcc cgcccatcgc cgcctggcgc gcgggctggc gcactcgccc    248940
     gaaggccggc agatcttcac caacctcagc gtcgaggaaa acctgcggct gggcgcctac    249000
     ctgtacgccg acgaccgggt cgaacgcgac atggacgacg ccttccagat gttccccatc    249060
     ctgcgcgaaa aacgccatct ggccgcaggc ggcctgtcga gcgggcagca gcagatgctg    249120
     gcgatggcgc gcgccctgat gggcaggccg tcctgcctgc tgctggacga gccctcgatg    249180
     ggcctggcgc cgatcatcgt gcagcagatc ttcgacgtca tccgcggact gaaggcgctc    249240
     ggcgtcaccg tgctgctgat cgaacagaat gcctacggcg cgctgcagat cgccgaccga    249300
     ggctacgtca tggaaaccgg caacatcacc atgcaaggcg cggccagcgc cttgatcgcc    249360
     gacccgcgca tacgcgccgc ctacctgggg atatgaacca tgcggtgaac cctgcggcgc    249420
     gggccggccc gcgcattgcc cccgaggcca tgtggcccta caattagagg ttgcctcagt    249480
     catgagttca cgcgctgtcg ttgcttggca tcgggcagcg tcttaagcgg gcgcgtcctg    249540
     cctatgccag gcaccgccca ctgcaggcgg cgagtgtacg acgaacagcg gcacgacgaa    249600
     cagccatcgc ggcactcgcg tcatcggagg tgttttggcc cgtacgagat ctgcggatta    249660
     cgagaatatc cgcgacacca tcatcgagcg cgcggcggca atgtttgcgc gccaaggcta    249720
     ctcggaaaca tccattggcg atatcgcccg ggcctgcgag tgctcgaaat cgcgcctgta    249780
     ccattacttc gacagcaagg aagcggtatt gcgcgacatg ctcaccacgc acgtcgactc    249840
     cctgctggaa cgctgccgcc aggtcctgta cggctcgaac gaaccgaaga cgcgctttct    249900
     ccagatcgta aagctgtttc tcgagatcta cgccacctcg cgcgaccggc acgtcgtgat    249960
     gctgacctgc ctggacgccc tgcccgaaga ccagcgcaag gcgctgatcg ccaagcagcg    250020
     cgaactgatc gcctatgtgc gcgacgcgct tctgcaactg cgccccgaca tggccgccaa    250080
     ccgcaccctg gcccacgtcg acaccatgct gttcttcggc atgatcaact ggacctacac    250140
     ctggtacaag gccgatggca gcgtctcgcc cgatgcgctc gccgagcgca ccgtgcaact    250200
     gttcctggac ggctacctca acctgctctc ggcctgatcg cgcagcaact gcatcggctc    250260
     gaagccgggc cgctcgacct cgccacggcc gaccgcgcgc ccggcttcca gcagcttctt    250320
     gccgaccata tacgcccgcc cgtcattgag cgcatcgacc gaaatcaagc ggtcggcgcg    250380
     gaagtaccaa tgcgactcgc ccttggccga cgcatggctg accaccgcgt cgtagccgcg    250440
     gttcagcccg acgatctgca gcttcatgtc gtattgatcc gaccagaacc acgggacggg    250500
     ctgatacggc cgcccctgcc ccagcatatc gtcggccacc gcctcggcct ggtcgatggc    250560
     gttctgcacg ctctcgagcc gcgccggctc gccgcccagc acgaaccgcg cgcaatcccc    250620
     cgccgcccag acatccggcg ccgaggtacg tccgtacgca tcgaccagga tcccgtcgtc    250680
     gcaatcgatc ccggccgcct cggccagcgc cgtttgcggc gccaccccca ccccggccac    250740
     caccaggtcg caggcaatac gcagcccatt gtccagctcc acgccggtta gagcctcgtc    250800
     gccttcggta cccgccaccg tgcgcccctc atggatgagc accccgtggc gctggtgcag    250860
     ggcgcggatg gccgcggccg tggccgggca cgccacccgc tccagaaccc gggacgcgcg    250920
     ctccaccacc tgcaccgaca accccgcctg cgcggcgacc gcggccgttt ccagcccgat    250980
     atagccgccc cccagcacca gcagcctgcg cccggccagg aacgccggct gcaagcgctg    251040
     cacgtcggcc agattgcgca gctcgaacac attgctgcgg cccgcgaacg ccgccggcaa    251100
     agggcgcggc gcggcgcccg tggtcaacgc cagcttgcgc cagccatggc gccggccgcc    251160
     gcagcgcagc gtgcgcgacg ccaggtccag cgcctcgacc gtgccgccca ggtgcagcgc    251220
     aatgccctgc tcgcgccaga actgcgccgg acgcagccac aaacgctcct gctcccagtc    251280
     gcccgccagg tatttcttgg acaggggcgg ccgctggtaa ggcggcgcgc tctcggcgcc    251340
     aaaaacgtcg attccgccct ggaaaccggc ctggcgcagg cgggccgcca acgccgcgcc    251400
     cgcctgtccg gcgccaatga ttgcgatact gtccatggcc atagcgtttc ccgtaattaa    251460
     ttaatcgacc aatctgatta ttataagaac gccatgccgg attgcaatat ccgcgttgcg    251520
     tcgcccgccc ggccgctacg ccgggacgca atagaatgcc ctcacatccc taggcacaga    251580
     caggagccgg catgcccaga accgccctca accccgacac cgtcttcgac tccctgcaat    251640
     acggcttcag ccaggggctg atcgtcacag ggcagcgccg catcatgctg tccggccagg    251700
     tcggcgtcga cgcccaggaa cgcaccgtgg gccccggcct gaacgagcag accgacgccg    251760
     cgctggacaa catcgaacgc gtgctggcgg ccgccggcgc cgcgatgcgg cacatcatca    251820
     tgctgcgcat ctacatctgc gaagacgcgc gcggcgatca ggaagtcgtc gccgacgcgc    251880
     tgcgccgccg ctttccggac aacccgccgc cctcctcctg gatcatcgtc agcggcctgt    251940
     cgctacccga atgactgatc gagatcgagg ccgaagccat gctggactga gctacttctt    252000
     tgcattcaac ctgtcctgct cggccttgcg ctcggcgcgc atcgcttcgc aatcgagcag    252060
     cttcacttcc ttgcccgtgg cggtttccac gatcttggtc gcgctgttat cgccccccga    252120
     cctgccaggc agcacgcact cgcgaaacgc attgatttcg gcttgagaca ggacgagcga    252180
     agtaaagccc gtccgcggtg ccacccatga tccgttggcg cttttcttcg tccagacgcc    252240
     atactgagcc atcgcgtggc tggcgaccag caggcccgcc aggccgactg cataccggaa    252300
     tgttttcatt gccaccctcc ttggtcgtgc gaaggagcag actagcaaga acggcacaaa    252360
     cggtaactcc gccgaaagca gtatccagac cgacccgcta caagagtcct tgcaaatccg    252420
     ccgccacatg gcggctaccc cgataccacg gacggaacaa atggcaattg accgggcacg    252480
     gtccaggccg cggcgtgcgc cagcgccgat cagatacggc gcgaccaacc tgaacaacgc    252540
     gctcacgctt tcccgcgcca accgcgcggc agctggaaat gcggcccatc cttgagcgtc    252600
     gtccagtcgc cgccccatcc cagcggtatc tccagcctgg ccgcgctctc cttcatcacc    252660
     tccgctaacc gcttgaacga cgcccagtcc tcccaggaaa tcgttccctc caccagcggc    252720
     gccagatcca cggcatgggc ccaaccgtcc ggctggggta tgtacagact gcgcagcgtc    252780
     tggctgacgc cttgagcaag cagcctggac tgacgctgcg ccgagcgcgc gccctccagg    252840
     acggtgaacc gcccgttgta tgcaccggcc gccgcctcca ccacggccgc caggtccggg    252900
     tacaccccgg ccaggcgctg gcgatcgcgc gcggaaagct gaaaccccat ggtcaacgcc    252960
     ctccttgcgg cacgcctggg ccatgccgta gggcacagcc atgcaaaaac atcaacgctg    253020
     gcatcgatat gccctcgaac cgttctggat accggcggga tgccgggcta cccggacggc    253080
     ggcgcgtgcc cgatggcccg tgccgtcatc cgcgcccgat tagtggaaca ggcaacgctc    253140
     gcgttccatc agaaccgcgg gcggcaatca gcaagaatca agactctcgg gccgcgcagg    253200
     cgccggaaaa gaaaacagcc gccattgctg gcggctgcgg aaggacttgc acctgcggca    253260
     gaatccaggg caccacgcga gcctgactag gcgtgcgccg gcggccggat caaactttca    253320
     gccgggatgc ccagttcggt gtgcaagcgc cagatcatgg gcagggtaag accgcgcttg    253380
     cggttcaaga cctcgtagac ccggttgcgc ttcccgatca tgggctccag gtccttggga    253440
     gtcaggccac cttgctccat gcggaacttg atcgcctcga ccggatccgg caggtcgatc    253500
     gggtaatgcc gcgcctcata ggcctgcacc agcgtggcca gcacgtccag ccgatcgcca    253560
     tcgggcgtac ccagctcagg gtccgactcc atgagccgag aaatttcctt caaagccgac    253620
     ttgtaatcgg cctcggtgcg tacggggcgg atttccatgt tcactccatt tcgactgtct    253680
     cggcatcgac cctgtcgtac tccacatggg tgccgacgaa tttcacgtag acgatgccca    253740
     gcttgaaggc gacagcgaca atcagacggt agtcattgcc cttgatcttg aataccacgc    253800
     gccggttctt gagaacgctg gcgctccggt attgggcctt gaggtccgcg ggcggggccc    253860
     atcgggccct gctcgcctcg tccacccaag ccttgagggg ctgctcagcc gccgggtgct    253920
     tttcccagaa ctggcggagg gtgctaaggg ctatgactcg catgaattga attcatagtc    253980
     ccaatttggg actatcgcaa gccacttccg gtttccggcg tccagggacc gagccggacg    254040
     gacgcgaaaa agaaaacagc cgccattgct ggcggctgta ggtacctgat ttctcaggat    254100
     ttctttggta ggccccccga gagtcgaact cggcaccaac ggattatgag tccgctgctc    254160
     taaccaggca tgagctagag gcccaggaaa tgtttactgc ccttcgagga agctcttcag    254220
     cttgtcggcg cggctggggt ggcgcagctt gcgcagcgct ttggcctcta tttgacggat    254280
     gcgctcgcgc gtgacgtcaa actgcttgcc cacctcttcc agcgtctggt cggtgctcat    254340
     ttcgatgccg aaacgcatgc gcagcacctt ggcctcgcgc ggggtgagcg agtctaacac    254400
     ttctttgacc acatcgcgca tcgagccgtg cagcgccgcg tcggaaggcg ccagggtggc    254460
     ggtgtcttcg atgaaatcgc ccaggtgcga gtcgtcgtcg tcaccgatgg gcgtttccat    254520
     ggagatcggc tccttggcga tcttcaggat cttgcggatc ttgtcctcgg gcatgtccat    254580
     cttctgcgcc agggtcgcgg gatccggctc ggcgccggtt tcctgcagga tctgacggct    254640
     gatccggttc atcttgttga tcgtttcgat catgtggacc ggaatccgga tggtgcgcgc    254700
     ctggtcggcg atggagcgcg taatggcctg gcggatccac cacgtggcgt aggtcgagaa    254760
     cttgtagccg cgccggtatt cgaacttgtc caccgccttc atcaggccga tgttgccttc    254820
     ctggatcagg tccaggaact gcaggccacg gttggtgtac ttcttggcga tggagatcac    254880
     caggcgcagg ttggcctcgg tcatttcgcg cttggccttg cgggccttgg cttcgccggt    254940
     ggccatgcgc ttgttgacgt ccttgaggtc cttcagcggc agcacgacgc gcgtctgcag    255000
     gtcgatcagc ttttgctgca gttcctgtac agccgggatc tggcgttcga gggtttcgct    255060
     gtaggcatgg gcggcggcga cttcgtccag cacccactgc aggttggtct cgttgccggg    255120
     aaaggccttg aggaagtgcg agcggggcat gccggcgcgg tcgacgcagg tatgcagcac    255180
     cgcgcgttcg agctggcgta cttcctcgac ctgggcgcgc agggtatcgg ccagcttctc    255240
     gaccatcttg gccgtgaagc ggatgcccat gagttcggtc tggatgatgt cctgggcctt    255300
     gagataggcg tccgacttat agccttcctt ctcataggac tggcgcatct tctcgaactg    255360
     cttgctcacc tcgtcgaact tggccagggc cttgacgcgc aggtcttcca gctgcttgct    255420
     ggacatgccg ccggccgggc cgtcatcggc ttcgtcctcg tcggcggtca cgccggcgcc    255480
     ggcgtattcc tcgccgtctt cggggtcgac caggccatcg accacttcgt cgatctgggc    255540
     ctggccttca cgcacgcgcg tgatgtgggc gaggatttcg ttgatggtgg taggacaagc    255600
     cgagatggcc atcaccatgt gcttgaggcc gtcctcgatc cgcttggcga tttcgatttc    255660
     gccttcgcgc gtgagcagct cgaccgagcc catttcgcgc atgtacatgc gcacggggtc    255720
     ggtggtccgg ccgaagtcgg agtccacggt ggtgagggcg gcctcggcct cgtcctcgac    255780
     atcgtcgtcg ttggaggcaa ccggcgcgtt ctcgctcatc agcagggttt cggcgtcggg    255840
     ggcctggtca tagaccgcga tccccatgtc gctgaaggtg ctgatgatgc cgtcgatcgc    255900
     ttcggcgtcg accaggtcgt cgggcaggtg gtcgttgatt tcgccgtagg tcaggtagcc    255960
     gcggtccttg cccagcttga tcagctgctt gaggcgattg cggcgcgctt cgtattcttc    256020
     gggcgagacg gggccacgga cgatcagatc cttgggatcg gccttgccgc gcttgccgcc    256080
     gcgcttgggc ggcttcaggt cgggcagcac ttcgccttcg ccgtccatgg agtcgtcgaa    256140
     agcatcgcta tcgttgttgg cgttcttcgc ggggcggccg ggacggcggc cgctgggcgc    256200
     cggacgcgcg gcgccgacca ggtcggccag cttgtcttcg gccttcttgg cgcgcgcctt    256260
     ggtggtcttg gccggcttgt cggcggcagc cgtcttggcc gcgaccgtct tggtggccgt    256320
     cttcttggcg gccgtcttgg cagcgggctt ggcgaccttc accgcagtct tggcaggggc    256380
     cttttccgcc gccatgcttg cagcacgctt ggccgtcgtg gattgggcag ttgccgcatc    256440
     gattgcagag ggggatttgc ctgtggattt ggtcatagtc gcttccgtgg tcgtcgcaac    256500
     ccattggggt cattgcaccg catgaacgcg ttttcgagca tcgcacgaaa cacgttgaca    256560
     tcgagtaaaa caaggccggt tcgccggcac gacgcgctgc gctggtgtcg cagcccggcc    256620
     cgcctgcggg ccgtggcgcg tcctttctgg cccttgggcc caaagacgcg ccggtacgcc    256680
     atgccacctg gcgggcatgc cgggcaacgc gcggggttgt ctcgcctgtt acaggcctgg    256740
     tcagctcaat gggcactgcc cttcgctgct ctccaaacac aacacccgac tgcaatgccg    256800
     cgggacaatg tccacgccag actgctgaac ctgcctcctg ctaatacgtt tgtaacatat    256860
     cagggacgga cctcagggct gccgcgccgc aaaccgcaaa aggccatgcg ccggcccggc    256920
     acatgaatgc cgccacccgc catgaccctg cgcaccgcgc gtcagccggt actcgtccat    256980
     ccctgcacac ccgcggcaaa cgccaagcgc ccgctcgcca gtgccatatt caattcgatg    257040
     ccgccacttc cgtccgcatt ccgcgggtca gaaaaacacc cggcgcggca cccgaagggc    257100
     aacactcaaa accgcaattt cgcctttaag cgaaaaccct cgatcttacc gcaattaatg    257160
     tgccccggca ttctttaaga ccatgattct gctcgacagt tccaggtagc gccggcgcgc    257220
     ctcgtcggtc gccaggccgc tttcggccag tttcgccatt tcggcgcgag ccgcgtcgaa    257280
     ctccatgcgc cgcagcgcgt cgtcccattc ggtctgcggg tgcggcaggt cttcctgggc    257340
     caggacatcg gcgcgcaggc ccttgagcac cacgtagaga tcggaatccg ggtcggcagc    257400
     ctccatcagc gcgcccacat ggcgcgcgcc actggtctgc gccagcagga tcaggtccct    257460
     taccagtcct aaatgggggc catggtcgat aacttcaagc tgctggtcac ccatggtatc    257520
     gaccagctcg gggtgggcca gcagcaggca cagcagccgc ctggccagcg acggcatggt    257580
     acggcggcct tcgtaaccac ccgtatcatt gtcgcggcgc cccttccagt cgcccttctt    257640
     gcctttccag tcgcccttct tgcctttcca gtcgcccttc ttgcccttcc agtcgccgcc    257700
     ctgcctgccc ttgcgctcct gccagccgcc cgcggccggc atgcccggct ccccgtcgac    257760
     ggcgccaacg gaataggcat cgggttcgaa gtcgtgcacc ggctcgaacg cccagtccgg    257820
     cggcgcctcg tcggcatgcc ccggcccgcc ctcgcggcca gcagccggcg cggacgcctg    257880
     ggccggcgcg gcggccgaag cgagcggccg ggcgggttgc tgggccagca cctgggccat    257940
     ttcctcgggc gtgagctgca ccaggcgcgc cagctcgcgt tcgatctgca cgcgcagcgc    258000
     gcactcgggg atggcggcca gcagcggctt ggcctcgtgc aggcaactgg cccgcccctc    258060
     ggcctcgccc atggtatggc gcgaggccag ctcgtcgagc agaaagcgcg acagcgccac    258120
     ggcttcgccc aggcgggtac gaaacgcttc ggcgcccagc tctcgcacat acgagtccgg    258180
     atcgtgctcg gcaggcagga acaggaagcg gatggcgata tcgtcgcgca gcaccggcag    258240
     gcaggcctgc agggcccgcc aggcggcacg ccggccggcg gcgtcgccgt cgaagctgaa    258300
     aatcaccttg tcgctggcgc gcagcagctt cttcacatgg tcgggcgtgg tcgacgtgcc    258360
     cagcgtggcc accgcgttgg cgatgccctg ctgcgccagc cccacgacgt ccatgtagcc    258420
     ctcgaccacc acgacctggc cctcctggcg tatggccagg cgagcctccc acaggccata    258480
     gagttcatgg cccttggaaa acagcggggt ctcgggcgag ttgaggtatt tgggctcgcc    258540
     cttgccgatg atgcgcccgc caaagccgat caggctgccg cgcgcattgc ggatgggaaa    258600
     catcacgcgt tcgcggaagc ggtcgtagcg ccgcccgtcc tccgactcga tcaccaggcc    258660
     ggcttccacc agcacgggat cctcgtagtt gtcgaacaca tgggacaggc catggcggtc    258720
     ggtgcccgac cagcccagcc cgaaatgggc ggcgatctcg ccggtcagcc cgcgctgctt    258780
     gaggtaggca atggcttgcg gcgagccgcg caactggcgc aggtagtgcg cctgcgcggc    258840
     gtcgagcacc tgcgtatggc gcgacacctc ggccttgcgg cgggccgatt cggcctgctg    258900
     acgaggactg cggttttctt cgggaaccgt gagccccacg gcggccgcca acgtgcgtac    258960
     ggcctcgggg aaactcgcgc ccgtatgctc catcaggaag gtgatggcac tgccgtgggc    259020
     gccgcaaccg aaacagtgat agaactgctt ggtcggactg acagtaaacg acgggctttt    259080
     ttcgttgtga aacgggcaaa ggccaagcag gttggcccca cccttgcgca gctgcacata    259140
     tcgcccgacg acgtcaacga cgtcgacccg ggcgagcaaa tcctggatga atgattctgg    259200
     aatcaataga ttcgggaatc aggcatcaat acaggcgcgg gggcagttgc tggctacgaa    259260
     tccgcttgta gtggcgcttc accgcggcgg cgtgcttgcg cttgcgctcg gccgtgggct    259320
     tctcgtagaa ctcgcgcgaa cgcagttcgg tgagcaagcc ggttttctcg atggtgcgct    259380
     tgaagcgacg cagcgcggct tcaaacggtt cgttttcctt cagtcgaacg ataggcataa    259440
     agtggttggc ctttatggat agcaataagt gggtaacggg ttgaccacta acctggcttg    259500
     gctgccgcgg ctatgcgccc atggcgacaa gctaagacaa cttgccgcat cagtagcaca    259560
     gcccaaccag cgttttccgc cacccctggt gtattaccag gaaacaagac gccaggttcg    259620
     gtttagcgat aaccagtgat tctagcacga ttgacgccat tctgcccagg ggcagcccct    259680
     gaggggccct ggctgggcgc cccggccggg ccgccttcta tttgtagcct ttccggatcc    259740
     aggcttcaag ctggtgcgga cgcaggctgt cgtagtcctc gaatggctgg tagatccacg    259800
     ggttggtggg caatttgtcg acaaagtagt cgggcgtggc ctgcgaatgc cccttccacc    259860
     acagcacggc gctgcgcaac tcggaaatgg cggggaactg ctcgctcaga tgggtatgca    259920
     ctttgttgaa ggtatggccg gtatcgacca tgtcgtccac cagcaacacc cgcccggaca    259980
     aggtgccgcg cgtgatggtg atgaactggg cgatatccag gtcgccctgc ttggtgccgg    260040
     ccgcctcgcg atagctgctg gtggccagaa tgcccagcgg cacgtcgaaa atccgggaca    260100
     tcacatcgcc gacccgcacg ccgccgcgcg ccaggcacag gatctggtcg aattgccagc    260160
     cggactggta cacctgcagc gccagacgct cgatcaggcg gtggtaatca tcccaggtca    260220
     cccacaaatg gctatcgtca ctgctcggcg agctcatagg cggatatctc cctgcaaaag    260280
     aaaatgacaa ggccgcctgc ggaacgaccc gcggcggcct ggcgaataat aaccgaggcc    260340
     gcgccacaac ggggcgcggc ccgcggcgcc ctaccccttg aaggggtggc gcagcacgat    260400
     ggtttcgttg cggtcgggcc cggtcgacac caggtcgatc ggcacgccac acacttcggc    260460
     cacgcgctcg agatagcggc gcgcgttgac cggcagcttg ctgtactcgg tgatgccgac    260520
     ggtggactcg gtccagcccg gcagttcttc gagcaccgcc tgcgcctgcg ccacggcgtg    260580
     cgcgccgtac ggcagcacgt cgcggaattc gccgttgacg cgataaccca cgcccagctg    260640
     gatggtttcc aggccgtcga gcacgtccag cttggtgatg cacaggccgg aaatgccgtt    260700
     caggcgcacc gagcgcttca gcgcggcgcc gtcgaaccag ccgcaacggc gcggacggcc    260760
     ggtgaccgaa ccgaactcct tgccgatggt ggccaggcgc gtgccgatct cgtcgaccag    260820
     ctccgtgggg aacggccccg atccgacgcg ggtcgtgtag gccttggtga tgcccagcac    260880
     gtactgcaac gcttgcggac cgacgccggc gccggccgac gccgcgcccg ccacacagtt    260940
     gctgctggtg acgaacgggt aggtgccgtg gtcgacgtcg agcagcgcgc cctgcgcgcc    261000
     ttcgaacagc aggttcttgc cttcctgctg gagcacgaac aggttgctcg agacatcgcg    261060
     caccatgggc gcgagggccg gcgccagggc catggcctga tcgcgcactt cgttggccga    261120
     cacgggctcg gcgcccaggt actgggtcag cacgaagttg tggtaatcga gcacctcggc    261180
     cagcttctcg tcgaacagcg ccgggttaaa gaggtcctgc acccgcaggg cgcggcgcgc    261240
     gaccttgtct tcgtaggccg ggccgatgcc gcggccggtg gtgccgatct tgccctcgcc    261300
     cttgcgcgcc tcgcgcgcct tgtcgacggc cacgtggtac ggcaggatca gcgtgcagat    261360
     ctcggagacc tgcaggcgcg aacggacgtc caggccggcc gcctcgagct cttcgatttc    261420
     cctgagcagc gcttcgggcg acagcaccac gccattgccg atgaagcacg tgacgccgtc    261480
     atgcatgatg cccgacggga tcaggcgaag aatggtcttc ttgccgttga tccacagcgt    261540
     gtggccggca ttgtggccgc cctggaagcg caccacgccc tgcacggact cggccagcca    261600
     gtcgacgatc ttgcctttgc cctcgtcacc ccactgggtg ccgatcacaa ctacgttctt    261660
     gctcatttta cgaatcaata tcgagtttct cgggaaatcc ggaaatctcc ccgcggccct    261720
     cccgttgccg ggagggagtt agtcacagcg ttctgaccgt ccaggcgcca tcctgcagcg    261780
     ccagctcgcg atcgcaaacg aattcgtcca ggccctgctc gtgaccgggc agtacctgaa    261840
     cgacgatttc gcccgaccgg cgcaaacgac gcaccgcgtc ggtcagggcg gggtcttgtc    261900
     cccaaggggc gcgcacggcg cgcgccggct cggcaggcgt caggcccgcc gccagcttgc    261960
     gcaggtcgag actgaaaccg gtggccggac gggcccggcc gaaagcgcgg ctgacatcgt    262020
     cgtagcggcc gccgcgcacc agcgcgtcgt gccagtcttc gccgtacacc gcgaaggtca    262080
     cgccggagtg atagccatat ccgccgacgt cggccaggtc cacgctgagc gtgacgccag    262140
     gcatggcatc gaccagggcc tgcagggcgt ccagcgcctg cgccatgccg ggcaccgccg    262200
     gcagctcgcg ccgcgcccgg gcgatgatct cgggcccgcc atacagcgtg gccagcgcct    262260
     gcagcgcgcg cacggtatcc tcgcccagcc cgtcgacacg gctcgccagt tcggccagcc    262320
     ccggcacgtc cttctcgcgc agcagcgtgc acaggtcgcc ggcatggcgc gaggcctgcg    262380
     ggtcggcgtc gaaaatggcg cgcatcacgc ccgaatggca caggtccagg cgggcattgc    262440
     gcacgccggc ggtggccagc gtgtccatga ccagctggat gatttccagg tcggcctcga    262500
     agccggcatg gccgtagatt tcggcgccga tctgcagcaa ttcgcggctc gacagcaggt    262560
     cggccggacg cgcgtgcagg acgctgccgc agtagcacag gcgcgtcacg ccggcacggt    262620
     tgagcagatg ggcgtcgatg cgcgtgacct gcgaggtcat atccgcgcgt acgcccaggg    262680
     tgcgaccgga cagctggtcg accagcttgc aggtgcgcag attcagatcg ctgccggtac    262740
     tcgacagcag cgaatcgatg tattcgacca gcggcggcgc gaccagctcg aaaccgtagg    262800
     tacggtagag atcgagcaat tcgcgacgca gttcctcgat gcgccgggcc tcggccggta    262860
     gaacatcggc aaggccttcg ggcagcaacc agttacccat ggatttctat acctgaatca    262920
     cgcccggaac atgcgcgggc gttgcccaaa cgaaaaacgg ctgagagggc gtaagcccgc    262980
     tcagccgtat gcggaatgtt ttctagctta cgcggtattg tacatggatc ggcaccctgt    263040
     tcctagaggt tgtcccgaac cgccctactt taccgcgccg gcgtcaattc gccggtgccg    263100
     gggcgcccgc cgcgcccttg ccagggttct tgaagaactg gaagaactcc gacgtcggat    263160
     cgaccaccaa tacgtcaccg gttttgccga acgcggcgcg ataggcttcc aggctcttgt    263220
     aataggtgta gaactcggta ttgcggccga acgcctgggc gtagatgctg ccggcctggg    263280
     cgtcgccctc gcccatgatg ccctgggcgc gcgcataggc ctgggccacg atgacctcgc    263340
     gctggcggtc ggcctcggcg cggatcttct cgctttcggc cgcgccgatc gaacgcagct    263400
     cgttggccac gcgggtgcgc tcggcttcca tgcggcgata gaccgactcg gaaatctcgg    263460
     gcgcgaactc gatgcggcgc aggcgcacgt cgaccacctg cacgcccagc ggctcggcgc    263520
     gcttggcgac gttggtgagg atttcggcca tgaccttgtc acgctcggcc gacaccacgt    263580
     ccttgaccgt gcgcacgttg accgccgcgt tcagcgcgtc gcggatctgc gcctgcaggc    263640
     gctcctgggc ggcgcgctcg ttgccgccga aggtcacgta gtacaggcgc ggatcggcga    263700
     tgcgccactt gacgtacgag tcgatcagca ggttcttctt ctcggaggtc tggatgcgct    263760
     cggcatcgct ggactcgatg gtgaggatgc gcttgtccag cgtgacgacg ttctggaacg    263820
     gcggcggcgc cttgaaatac aggcccggct cgctgatgac ctggcgcacc tcgcccaacg    263880
     agaacaccag ggcgtagtcg cgctcgcgga ccacgaagac gcatgaagac aggacggcca    263940
     ggacgacgag cagtccgacc aggatgggca tgagacgttg catgttgggg actcctccgg    264000
     gttagcgcga catgcggtcg cgaggcagcg tgttgctggt gctgctgccg gatgaagact    264060
     ggccgctggc cgaaccgcgc gccggcgcct gcggaatcgc cggctggttc gcgccgggca    264120
     ggcccaggct ggaggaggtc ggcttgccgg cgtcttgcgc ggcctgctgc atgatcttgt    264180
     ccagcggcag gtacaacatg ttgttgccgc ccttggtatc gaccatgacc ttgctggcgc    264240
     gcgtgaagac ttcctgcatg gtttccaggt acaggcgttc acgcatgacc tggggcgcct    264300
     tctcgtactc gttgaggatg gacgagaagc gcgaggcatt accctgcgca tcgccgatca    264360
     ccttggcctt gtagccctcg gcctgctcga tcatgcgcga ggcctggccg ctggccagcg    264420
     gcacgacctg gttggcgtac gcctggcctt cgttgatctg gcgctcgcgg tcctggcccg    264480
     ccttgacggc gtcgtcgaac gcggcctgca cctgttcggg cggctggacg ttctggatgg    264540
     cgaccgtgct gatctggatg ccggcgctgt agcggtccag gatctgctgc atgagattct    264600
     gcacttcggc ggcgacttcg gtacggcctt catagagcac gaagtccatc ggcttcttgc    264660
     cgacgatttc gcgcatggcg gtctccgccg cctggcgcac ggattcgtcc gggtcgcgca    264720
     tcttgaacag gtagtcgggc gcgccgtcgg cgcgcaggcg gtactgcacc acgaattgca    264780
     tgtcgacgat gttctcgtcg gtggtcagca tcaaggcctc gggcagcacc ttgttgcgcg    264840
     aaccgccgcg aaagcccacc tcgaacgtgc gcagctgcga cacgttgacc atttcgtggt    264900
     tctggatcgg gtaaggcatg cgccactgga agcccgccgg cgcggtgctc ttgtacttgc    264960
     cgaactgggt gacgaccgcg acctggcctt cctggacgat gaagaatccg ctggccagcc    265020
     acagcagcac cagcaccagg gcgatgatgc ccaggccgat gcgggcgccg cgcggcgaag    265080
     gcggcgtcat gccgccgcgg ttgttggggc gattgttgcc ccctccgccc ttgcggccga    265140
     acaatgcgcc tatgcgattg ttgaagtcgc gccagacctc gtcgagatcg ggcggaccgt    265200
     cgccgccgcc ctgtggacgt cgcggcggct cggagccgtt gccgttattg ttgccacggc    265260
     cccagccggg gtcattcaga ttgaagagtt tggtgattcg agacattgtt tcccacaatc    265320
     tggccgatct ctgcaattgc cccgcgcaac gcatccagac cggcgcgctc ggtagcgctt    265380
     acgaatactc gcgcaatcgt accatgggcg tcgcggtcga cccgtggctc caggcccgcg    265440
     cggtcgatct tgttgtatac cagaatggtc ggaatctgcg ccgcgccgat ctcggccagc    265500
     actttgtcga cctcggcgat ctgctcgtcg cgctgcgcgc tggccgcgtc gaccacgtgc    265560
     agcaacaggt cggcatgcac ggtttcctcg agcgtggcac ggaatgccgc gatcaggttg    265620
     tgaggcaggt cgcggatgaa cccgaccgtg tccgacagca ccaccgaccc ggcgccgtcg    265680
     atccagatgc gccgcgtggt ggtatcgagg gtggcgaaca gctggtctgc ggcataggcg    265740
     ccggcgcgcg tcatggcgtt gaacagcgtg gacttgccgg cgttggtata gcccaccagc    265800
     gagaccgaca gcgcgccgcc gcgcgcccgc gcccggcgct gcgtgacccg ctggcgctcg    265860
     acccgatcca ggcgctcgcg cagcaccttg accttggcgc cgatcatgcg gcggtccatt    265920
     tcgagctgcg cctcgcccgg gccgcgcatg ccgataccgc cgcgctgccg ctccaggtgg    265980
     ctccacatgc gcgtcaggcg cgtggccagg tgctgcagct gggccagctc gacctgcagc    266040
     ttgccttcgt ggctcttggc gcgcagcgcg aagatatcca ggatcaatgc cacgcgatcg    266100
     accacgcgca ggttgaattc gcgctcgagg ttgcgctgct gcgccggcga cagcggctgg    266160
     tcgaacagga tgatgtcggc cagcagcgcg ccggccatcg ccacgccctc ctcgaccttg    266220
     cctgaaccga tgaagaactt ggcgtcgggc cggtcgcgcc gcgccgtcag cgtgccgacg    266280
     atctcggcgc cggcgccctt ggccagcatg gcgaactcct cggcgtgggc cgggtagtca    266340
     ggattgccga gatcgacgct gatgatcagt gcgcgcatac atgcaccatt ttggagccaa    266400
     agcgaaaatg cccgccggcg ctggccgcgc ggcgggcaat caagggtaat gctggagcga    266460
     ggcgattatt cagcgggaac ttccacctgg aaattgacgg cgcgcgccgg caccacggtg    266520
     gagatggcat gcttgtacac catctgggtc acggtattgc gcagcagcac gacatactgg    266580
     tcgaacgatt cgatctgccc ctgaagcttg atgccgttta ccaggtagat ggacacgggc    266640
     acgtgttcct tgcgcagcgt gttcagaaac ggatcttgca aagtttgccc tttattgctc    266700
     attggccagg ctccatttgt ttgttttaag tgacggcaca gtgcgccgaa atcagtactt    266760
     acagggtttt cccgggcggt gccacttgcg atatacgcaa atatgacacc agagttttca    266820
     ggaaattccc cagtgcgcgt cacgacgaaa aaattttctt cagcgcgccg atcaatgcct    266880
     cgcattgggc gtccgtaccc accgtgatac gcaggaattg atcgatacgg gcctgccgga    266940
     agtggcgcac caggatgctg cgctcgcgca gccgggcggc cagctgcgcc gcatcatgct    267000
     ccgggtgccg cgcgaacacg aaattggccg ccgaaggcag cacgtcgaaa cccagcgccc    267060
     gcagatcggc gctcatgcgc tcgcgcgtgg ccatcacggc ctggcgcgtc cggtcgaaat    267120
     acgcctggtc ctgcatggcg gcctgcgcgc ccgccgacgc cagccggtct atggggtagg    267180
     aattgaagct gttcttgacc cgctccaggc cgtcgataag cgcccggctg cccagcgcga    267240
     aaccgactcg caggccggca agcgagcgcg acttggacaa ggtctggacc accagcaggt    267300
     tgtcgtggcg atcgaccagc ggcgcgaccg actcggcgcc gaagtcgaca taggcctcgt    267360
     ccaccaccac gacggtatcg gggttggcgg tcacgatgcg ctcgacctcg tcgcgcgcca    267420
     gggcgcggcc ggtcggggca ttgggattgg gaaagatgat cccgcccgcg gcctggccac    267480
     cgggctggta gtcggccgga tcgatgcgga agtcatcggt cagcggcacg acctgatagg    267540
     gaatctcgta caggccgcag tagacgggat aaaagctgta gctgatatcc gggaaacgca    267600
     ccggccggcc gtgcctgaac agcgccatga agacgtgcgc cagcacctcg tccgaaccat    267660
     tgcccacgaa tacctggtcg gcctgcaccc cgacggccgc ggcaatcgcg ccgcgcaggt    267720
     cgtccgaggc cggatccgga tacagcctga gcgtgtcgcc ggccgccgcg gcaatggcct    267780
     gcagcgcctt gggcgacggc ccgtacgggt tctcgttggt attcagcttg atcaggtccg    267840
     gcagcttggg ctgctcgcct ggaacatagg gactgagcgt cccgaccacg ggactccagt    267900
     agcggctcat ggatcagttt tcctggacgt aggggttgcg cgacgacttg aactcgatgc    267960
     gcagcggcgt accggccagg tcgaaggcat tgcgaaagcg cgtctccaga tagcggcggt    268020
     acgaatcggg caccgcgtcc agcgcgttgc catggatcac gatcaggggc gggttctgtc    268080
     cgccctggtg cgcgtagcgc atcttgggcc ggaaaatacc cttgcgcggc ggcggctgct    268140
     gctcgacggc ggcctgcaat tcgcgcgtca gccgcggcgt ggacagtttg gcgaaagccg    268200
     ccgcgtgcgc ggcgttgacg gacttcagca agggcttgac gccctgcccc ttgagcgccg    268260
     aaatggtgtg catgcgcgca aagccgagga agcgcagctt gcgctggaac tcccgctcga    268320
     tgcgctcgcg ctggtcactg tccaggccgt cccatttgtt gatggccacc accacggcgc    268380
     ggccggtctc cagcacgaag ccggcgatgt gggcgtcctg ctcggacact tcggcctgcg    268440
     cgtcgatcat cagcagcacc acgttgctgg cctcgatggc ctgcagcgtc ttgatgaccg    268500
     agaacttctc gatcgcctcg aacaccttgc cgcgcttgcg caggccggcg gtgtcgatca    268560
     gggtgtactt cctgccgtcg cgctcgaagt cgatctcgat cgcgtcgcgc gtggtgccgg    268620
     gcatgtcgaa ggcgatcacg cgctcttcgc ccagcagcgt attgatcagg gtggacttgc    268680
     ccacgttggg ccggccgacg atggccagct tgatgcggtg gtcgacgaca tcctgctcga    268740
     gctgctcgcc ggtgtcggcc ggcggcgcga ccaggccgct caaggcgatc tcgatcaggt    268800
     cgacgatgcc gtcgccgtgc gcggccgaaa tcggatgcgg ctcgcccagg cccagctcgt    268860
     ggaaatcgcc ggtggcattg cccacgccca tgccttcggc cttgttgacc gccagcagca    268920
     cgcgctgctg gccggatttg cgcagcaggc gcgcgatctc gtggtcgtgc gcattgacgc    268980
     ccgcccgcgc atcgaccagg aacaccacca catcggcttc ggcgatggcc tggcgcgtct    269040
     ggcgcgccat ctcggccagg atgccgtcct tggcgaccgg ttcgaagccg cccgtgtcga    269100
     tcaccaggaa gggcgtgtcg cccaccctgc cctcgccgta gtggcggtcg cgggtcaggc    269160
     cggagaaatc ggccaccagc gccgcgcgag agcgcgtcag gcggttgaag agggtcgact    269220
     tgcccacatt gggacggccg accagggcaa cgacaggctt gaaagacacg gtatgaggct    269280
     tgctatagga aaagttcagt tggcgcgaac catcaccagg ctgccattgc cggtttgcac    269340
     cagcacgccc tgggaggtgg tctgcggcgg cgagacgatg gcgcccccac ccaccgacag    269400
     ccgcgccagc aggcggccgt cgctacgcga caggaaatgg acatagcctt cgaaatcgcc    269460
     caccgccacg gcctcgccga gcaaggccgg cgcggtcagc aggcgattct tcaactcggc    269520
     ctgtttccag acattgttgc cgctgtccag cgcgaaggcg ctgaccacgc tgccctggtc    269580
     gggcgcgtag gcgaagcggt cgtcgatgac catgccgctg gcgctggaga aatccttggc    269640
     ccagatgggg cgtccgcccg ccgatacgtc gaagcacacg atacggccct ggtaggcgac    269700
     cgcgcacatc aggcggccgg cgatgcgcgg cgcgcccacc acgtcggtca ggcgctccag    269760
     gtcgctggcg ccgcgcggcg tggccaccgt gccttcccat tggacgttgc cggtggcgct    269820
     gttgatggcc agcagcttgc cgcccggcag gccgctgatg accaggcctt cggccagcac    269880
     catctgcgcg gcgctgcgca gcgccagcgc cggacccggc cgctgcatgc tccacatgcg    269940
     ctcgccgttc tcggcgttga aggcctggat gcggtaatcg ccgctgcgca ccacgaccac    270000
     tccatagccg accaccggcg ggatggcgac gtcgctggtg gcgcgggcgc gccatttgat    270060
     cttgcccgta tcgtcgaagg caatgacctc gccgtcgggc gtggccaccg cggtggtctg    270120
     gccgtcgctg ccggcgcccg ccgacagctt ggcgtcggcc gaggacttcc agatggcccg    270180
     gccgctgagc aggtcgaact tgccgaccga cccgtcgggc gtggcggcgt agatcgactc    270240
     gcccagcacc gtgggcgcga agcccaggcc cgagccgctg ccgaccgagg ccgtccaggc    270300
     ggtgcgcacc gacatgccgg gcgcatattg cgtgagctcg gccggtttgt agcgatcgtc    270360
     gtcgctggag aacatcgagc agccgctcag ggccagcagg cccgtcagca cgacggcgcc    270420
     gcgccatgcg cggccggggc gggaattacg catcaagatc aggctccgct caaggcatcg    270480
     agtttcagtt gcacgacctg cgtcaacggg ttgctggttc ccagcccgtc gatcgcgctc    270540
     tgccacgccg cgcgcgcgtc atcgcgcttg ccttgcgcgg ccagcacgtc gccgcgccgg    270600
     tcggcgaaca aggccgcgaa ggaagccggc gggttgttca gctgcgcaag cgcagcgtcg    270660
     tattgcttct ggtccagcag gatgccggcc aggcgcaagc gggccaccgg ctgcagggcc    270720
     ggctgcttgg cctgcgcggc cagccattcg agctgctcgc gcgcgccgtc gacgtcctgc    270780
     tggctctgca gcgcctgggc cgcgatcaac gcgccgcggc cggcgtagcc ggtggccgga    270840
     tagtcggtgc gcagcgtggc ggccgcggcc ttgatgcgcg tggcggcatc ggcgccgccc    270900
     aggcgggcgg cgtcctcgag cgcctcgaaa tagcccatgg cctggttggc gcggtagttc    270960
     tggtaggcct tccagcccga ccagccgccc catgccagca ccaccagcgt ggccagcgtc    271020
     aggatcagcg tgccgtaacg cgcccaccag gcccggattg cgtcgagttt ttcctgttct    271080
     tcgagatcgt atgccatgct aacccttgga tttcaaaaca tcggccaact gcgccagcgg    271140
     cacctgctgc tgcgccgcgt cggcgccgac cggcccgcgc aagtgcttga tgctggcggt    271200
     gcggctggcc acttcgtcgc cgccaagaat aaccgcaata cgcgcgccgc tggcgtcggc    271260
     gcgcttgaat tgcgccttga agccggccgc gcccgcgtgc acgatgacat ccaggccggc    271320
     gtcgcgcagc tgttcgccca cccgggccgc cagccgctgg ccttcctcgc cctggtgcac    271380
     gatgtagacc tcgcactcgg ccggctgttc gatctcgacg ctttgctccc agaggtcgag    271440
     caggcgctcc atgccgatgg cgaagcccac cgccggcgcc ggcttgccgc ccagcagctc    271500
     gaccaggccg tcatagcgcc cgcccccgca gaccgtgcct tgcgcgccca ggcgatcggt    271560
     cacccactcg aacacggtca ggttgtagta atccagcccg cgcaccaggc gcggattgag    271620
     gcggtattcg atacccgcgt cggccaggcg ctggcacagg ccgtcgaaat ggctgcgcga    271680
     ttcctctccg aggaaatcga acaagcgcgg ggcgctatca gccatttcct gcatggcagg    271740
     gttcttggtg tccagcaccc gcaaggggtt gctgtacatg cggcgccggc cgtcctcgtc    271800
     gaggatgtcc tggtggcgct ccagatgctc gatcagtgcg gcgcggtggg cggcgcgctc    271860
     ggccggctgg cccagcgagt tcagctccag gcgcacgtcc tgcaggccca gcagcttcca    271920
     gagccgggcc agcatgacga tcatttcggc atcgacatcg gggccggcaa agcccagcgc    271980
     ctcgacgtcg atctggtgga actggcggta gcgcccccgc tgcggacgct cgtggcggaa    272040
     cacggggccg atcgcgtaga cccggtgcgg ccggtcgtac agcatgttgt gttcgatgct    272100
     ggcgcgcacg atgccggcgg tcatctcggg acgcatcgtc agcgagtcgc cgttgagcgc    272160
     gtccgtgaag gtgtacatct ctttttcgac gatgtccgtg acttcgccga tgccccgggc    272220
     aaacagcctg gtgtgctcga gcaccggcgt gcgcacattg cgataaccgt agctgcgcag    272280
     ccagccacgc acgatttctt cgaatttttc ccagcgggcg ctgggcccgg gcagcacgtc    272340
     gttcatgccc cggatggcgg agactttctg gaaaacttgc gtcatcttcg tcatgcccac    272400
     cacacccgca tcgaagaggg cctggcggct tggtccctta ttcctgatga gtgatgccgg    272460
     cgccgtagcg gcgcgcgacg tagtcttcga cgatggcctg gaattcttcg gcgatatggt    272520
     cgcccttgag cgtgaccgtg cgctcgccgt cgatgaaaac cggcgcggcg ggcacctcgc    272580
     ccgtgccggg caggctgatg ccgatgtcgg cgtgccggct ttcgcccggc ccgttgacca    272640
     cacagcccat caccgcgaca ttcatgctct cgacgccggg gtagcgcgtg cgccacaagg    272700
     gcatctgccg gcgcaggaac gactggatgc tgtcggccag ttcctggaag aaggtgctgc    272760
     tggtgcgccc gcagcccgga cacgccacca ccatgggcgt gaacgcgcgc aagcccatgg    272820
     tctgcaggat ttcctgcgcc acgatgactt cgcgggtccg gtctccgccc ggttcgggcg    272880
     tgagcgagat gcggatggta tcgccgatgc cctcttgcag cagcaccgcc agcgccgccg    272940
     tggaagcgac gatgcccttg ctgcccatgc cggcttcggt caggcccagg tgcagcggat    273000
     agtcgcagcg cgcggacagg tcgcggtaga cggcgatcag gtcctgcaca tggctgacct    273060
     tgcacgacag cacgatggcg tcggagcgca ggccgagctc ctcggcgcgg cgcgcattgc    273120
     tgatggccga caccaccagg gcgtcgcgca tgacggcctg ggcttcccag ggctgcgcgc    273180
     gccggctgtt ctcgtccatc ttgcgcgcca tcagctcgtg atcgaggctg ccccagttca    273240
     cgccgatgcg cacgggcttg tcgtggcggc acgccacttc gatcatctgg gcgaaattgt    273300
     cgtcgcgccg cttgccgccg cccatgttgc ccgggttgat gcggtacttg gacagcgcct    273360
     gcgcgcactc gggaaactgc gtcagcagct tgtggccgtt gtagtggaaa tcgcccacca    273420
     gcggcacctc gacgcccatg cgatcgagct gttcgcggat ggcggcgact tcgcgcgcgg    273480
     cctcgggggt gttgacggta atgcgcacga tctcggagcc ggcctgggcc agttccttga    273540
     cctggatggc ggtggccacc gcatcggcgg tgtcggtatt ggtcatggac tgcacgacca    273600
     cgctggcatt gccgcccacg gtgaccgtgc gcccgcccca ctgcacccgc acggcgcgcg    273660
     tggcgcggcg cggcgccgcg ccgacgtccg gcggcgacgc gtcctggcag ggcatagagc    273720
     tatcttgcat gtatcgcacc cgttgttact gggtcaccgg agaaaaccat tgcgccggca    273780
     gccactcctg cggcagccag ccttgccaaa aagcataggc cactgcggcg gcgaccacca    273840
     cgaggatggc gagcagccat ccctaggagc cggaggagcg ctcgtcatcg acggagatat    273900
     tgacgccagc cggacgcagg ccctgtccgc cgcgcggcgc cggccgggcc ggcgcgggcg    273960
     tgcgtgccgc ctcgagatcg agcgaatcga ccacggcctg ggcgtcggcg cccagcatgc    274020
     gggcgtagtt gcgcaccagg ccgcgcagcg acacgccctt gggcagggat tcccagcgct    274080
     cttcttcgag cgcctggatc atgcgcgtcg agaacttgat gcggcttgag acctcttcga    274140
     gcgaccaccc cttggcctgg cgcagcgccc gcagcgccga acccaccgta ggcgccgcag    274200
     caccgggagc gattgcggcg ggcgaagcgg ccgaagcggg atcctgcgtc atgcgtgcac    274260
     ctgttgaatg ggaatggttc gggtggcgtt gcgttcagtg atgcgcgtgc gatcgcgcac    274320
     ttcgccggcc agctggccac aggccgcgtc gatatcgtcg ccgcgcgtct tgcgcaccgt    274380
     ggtgacgatg ccggcatcca tgaggcgctg ggcgaatacc ctgacgcgcg ccgacggcga    274440
     gcgcttcagg ccggaggccg ggaaaggatt gaagggaatc aggttcagct tgcagcgcac    274500
     ctggcgcgcc agctggatca gttcccgggc gtgctggtcg gtatcgttga tgccgtccag    274560
     catgcagtat tcgaaggtga tgaagtcgcg cggcgcatgg gcgagatagc gctcgcaagc    274620
     agccagcagc gcgttcaagg gatatttcct gttgagcggg accagctcgt cgcgcagcgc    274680
     atcgttgggc gcgtgcaggg acacggccag cgccagcggg caatcctggg acaggcggtc    274740
     catcatgggc accacgcccg aggtcgagac agtgacgcgc cgccgcgaca ggccataggc    274800
     gttgtcgtcg agcatcaggc gcaacgcggg caggacctgg tcgtagttga gcaggggttc    274860
     gcccatgccc atcatgacca cgttgctgat gacgcgcgtg tcctcgccgg ccttgccgcc    274920
     gggcagccgg gcggtatccg ccgccgcctc gagcacgcgc ttggcccacc acagctggcc    274980
     gatgatctcg ctggcgcgca ggttgcggtt gaagccctgg tggcccgtgg agcaaaagcg    275040
     gcagttcacc acacagccgg cctggctgga aatgcacagg gtgccgcggt cgtcttcggg    275100
     gatgaaaacg gtttcgatgg cattgccctg gccgacatcg aacagccact tgcgcgtgcc    275160
     gtcggacgaa cgctgctcgg tattgaccgg cagcgcctcg atcacgcagt cccgcgccag    275220
     ttgcgcgcgg aaatcgcgcg ccaggtcggt catggcgtcg aacgaatcgg cgccgcgctg    275280
     gtgcacccag cgctgcaatt gccgggcgcg aaacggcttg ccgccccact gccccaccag    275340
     ctcggacaat gcggcgccat ccaggcccag caaattgacg cgttcgacgg attccatgat    275400
     cggttcaggc gttatatccg ggaatcaacg gctgtggatg ttgatttcgg gaaagaagaa    275460
     agccacttcg acggcggccg tctcgggcgc gtccgagccg tgcacggcat tggcatcgat    275520
     gctgtcggcg aagtcggcgc ggatggtgcc cggcgcggcc ttcttgggat cggtggcgcc    275580
     catcaggtcg cggttcttct gaatggcgct ttcgccttcg agcacttgca cgaagaccgg    275640
     gcccgagacc atgaagtcga ccaggtcctt gaagaagggg cgctctttgt gcacggcgta    275700
     gaaacgctcg gcgtcggtgc gcgacagttg ctgcatgcgg gcggcaatca ctttcaggcc    275760
     ggcctgctcg aagcgggcga cgatctggcc gacgacgttc ttggcgacgg catcgggctt    275820
     gatgatcgaa agggtgcgtt cgatggacat gaaaactcca ggatctgact aaagaatata    275880
     tttccgaggg gctatgacgc tcaaatccgc gcagcctgct gcccgggcac ccgggggcgc    275940
     cgccgcgggc ggcctgcgcc atgggcgcgc gaaacgcccg aaaggctcgg gccgaacgtc    276000
     aaagcaagga ttcgcgactg cataccgatc agattttccc aataaaaaca ggcacttcta    276060
     aaaggtttac agtaaccggg tattctaaca cgccggcaag aacgtattac atcttaaaat    276120
     cgatcgtttg cttgccccct attcttccca ggctgaccgc cggaacccgc aatgactgac    276180
     gccgcaccca atcaacccgt gaacgaatcc cagaaactgt ccaagagctt tgaacccgcc    276240
     gaaatcgaaa cccgctggta cgacgagtgg gccaagcgcg gctacttcga cgccggccgg    276300
     cacgtagaaa cggggaccga cccccagccc tacgtcatcc agttcccgcc ccccaacgtc    276360
     acgggcaccc tgcacatggg ccatgccttc aaccagacca tcatggatgg cctggtgcgc    276420
     taccaccgca tgctgggcga cgacaccgta ttcgtgcccg gcaccgacca cgccggcatc    276480
     gccacccaga tcgtggtcga gcgccagctc gatgcccaga aggtttcgcg ccatgacctc    276540
     ggccgcgaga agttcgtgga aaaggtctgg gagtggaaag aacagtccgg cagcacgatt    276600
     accggccagg tgcgccgcct cggcgcgtcg gccgactggc cgcgtgagta cttcacgatg    276660
     gacgcgcgca tgtcgcgcgg cgtggccgag acgttcgtgc gcctgtatca gcaagggctg    276720
     atctaccgcg gcaagcgcct ggtcaactgg gatcccaagc tgctgacggc cgtgtcggac    276780
     cttgaagtac agtccgagga ggtggatggc cacatgtggc acatcctcta ccccttcgtc    276840
     gacggcccgc agaccatcac cgaccaggac ggcaacaccg tcacactgcg cggcatgacc    276900
     atcgccacca cgcgcccgga aaccatgctg gccgacggcg cgctgtgcgt gcaccccgac    276960
     gatccgcgct acaagcacct gctcggcaag ctggtcgagc tgcccctgtg cgaccgcaac    277020
     attcccatca tcgcggacga tttcgtcgac cccgatttcg gaaccggctg tgtcaagatc    277080
     accggcgcgc acgacttcaa cgactacgcc tgcgcgctgc gccacgacat tccgctcatc    277140
     gtcatcttca cgctcgacgc ccacatcaac gagaacggcc ccaagcagtt ccagggactg    277200
     gagcgctacg aagcgcgcca ggccgtggtg gccgagctgc aggcgcagca gtacctggtg    277260
     aaggtcgagc cgcacaagat gatgcagccc aagggcgatc gcacgggcgt cgtgctcgaa    277320
     cccatgctga ccgaccagtg gttcgtcgcc atgagcaagc ccgccccggc cagcacgctc    277380
     aaccccggca agagcatcac cgaagtggcg ctggaggcgg tggccgacgg ccgcatcgcc    277440
     ttctaccccg agaactgggc cacgatctac aaccagtggc tcaacaacat ccaggactgg    277500
     tgcatctcgc gccagctgtg gtggggccac cagatcccgg cctggtacag cgaggacggc    277560
     caggtgttcg tggctcgctc cgagcaggag gcgcaggagc aggcgcgcgc cgccggcgtg    277620
     gccggcccgc tgacgcgcga cccggacgtc ctcgatacgt ggttctcgtc ggccctggtg    277680
     cccttcacca ccttcggctg gcccgaggac acgcccgacc tgcgccgcta cctgccctcc    277740
     agcgtgctgg tcaccggctt cgacatcatc ttcttctggg tcgcgcgcat ggtcatgctg    277800
     accatgcaca tgaccggcag cgtgccgttc aagcatgtgt acgtgcacgg gctgatccgc    277860
     gacgccgacg gccagaagat gagcaagtcc aagggcaata cgctcgaccc ggtcgatctc    277920
     atcgacggca tcgacctgga aggcctggtg cgcaagcgca ccttcggcct catgaacccc    277980
     aagcaggccg gcgccatcga gaaggccacg cgccgccagt acccggacgg cattcccgcg    278040
     ttcggcaccg acgcgctgcg cttcaccatg gcggcctatg ccaccctggg acgcaacatc    278100
     aacttcgacc tgaagcgctg tgaaggctac cgcaacttct gcaacaagct gtggaacgcc    278160
     acccgcttcg tgctgatgaa caccgaagga cacgcgctgg acggcgacgg cggcgaactc    278220
     tcgtttgccg accgctggat cgtcagccag ctgcaggcgc tggaagccga ggtcgagcgc    278280
     ggcttcgccg actaccggtt cgacaacgtg gccaacgcgc tgtaccgcta cgtgtgggac    278340
     gaatactgcg actggtacct ggagctggcc aaggtgcaga tccagcaggg cacaccggcc    278400
     cagcagctgg gcacccgccg tacgctgatc cgcgtactgg aggcggtgct gcgcctggcc    278460
     catccggtca tcccgttcat cacggaagaa ctgtggcaga aggtcgcgct ggtcgccggc    278520
     aagcggaccg ccggcgccgt ggccagcgtc agcgtgcagc cctacccgcg cgccaatccg    278580
     caggccgtcg acgccgaggc ggaagccgcg gtggccgaac tgaaatccca ggtcgaggcc    278640
     gtgcgcgcgc tgcgcggcga aatgaacctg tcgccagccc agcgtgtccc gctggtcgcc    278700
     gaaggcccca ccgacgtcct gtcgcgcaat gccccttacc tggcggcgct ggccaagctg    278760
     agcgaggtcg aggtggtggc cgccctgccc gacgccggcg cgccggtgca ggtggtgggc    278820
     gacgcgcgcc tgatgctgca tgtcgaaatc gacgtggcgg ccgaatgcgc gcgcctggac    278880
     aaggagatcg cgcgcctgga gggcgaaatc gccaaggcga acggcaagct gggcaacgcc    278940
     agcttcgtcg agcgcgcgcc ggcggccgtg gtcgaacagg agaaggcgcg cctggcgcag    279000
     ttcagcgaaa cgttaaagaa agtacgcggc cagcgcgtca agctgggcgc ctgaacgcaa    279060
     ggaacccccg gcgcggccgg gggttcctgc ccatggcaag cgcaatggac acagcggcgc    279120
     gagcgcacag gcggcgccgg cacggttcag aacgcgtagg tcaggcccac gccgccgaag    279180
     tagttggtcg agcgctcgct cacggggctg tcgcgcgcat cgccgaacag ggtattgacc    279240
     cccgccgtgg cgttgacggc ccagcgctgg tccaggcggt gcgtccagga cgcgaagatc    279300
     ccgccggact tgaatcccga cgaggccgag tagcggcgca acccggcctc gctgcgggcg    279360
     gcctgggagg cgctgatgcc gtaccaggtg cgcatgtagt cgtcgctggc ccactcggtg    279420
     cgcgcgccca ccgagacgct gtcgcgcccg gtctgccaga cgcggtaggt ggcgcgcagc    279480
     tcccccactc cgccgtagcc gctgcgcgcg gcctggcggt atgcggcgcc caggcccagc    279540
     gcgccatact gccattcgat gtaggcgccg taggtcgcgt gcatatcgat gtcgtccagg    279600
     ccatggagaa tgtccgaatc gtcggcgtca cgccccaggt gcgcgccgac gaacacgccg    279660
     gcatgcacat gctcgccgag ctgccacttc aggccggcgc tgggcagccc ggcgcgcggc    279720
     gaaatgaaga aaggcccgtt ctcgtaatgg atgagcggca ccggcaggaa gcggtagtcc    279780
     ttggcgccct cgtagcgcgg cgccaccgcc gccgatatgc cgatgtagtt ctgggcctgc    279840
     gccgccgtgc ccagcgtgcc ggccaggcac acgacggtcg cgcgccacca tgcgtgcttc    279900
     attgtcattc cttgggaaac cggggcgccg cgcaggcggc ctgccccaac ggcgcgattg    279960
     tgcgcgccgc gttttaaatt ctttttaatc ggcggctgcg acactggacg cggatagccc    280020
     ggcgacacga catgactcat ttgctattgg tggaagacga cccgatgctg ggcgacgcgc    280080
     tgcagaccgc gctgcagcgc gaactcggcg cccgggtcga ttgggtgcgc gacggcgcgc    280140
     aggcgcagct tgcgctggtc gaccacgcct accagctgat cctgctggac ataggcctgc    280200
     ccggccagtc cggcttggcg ctgctgcgcg cgctgcgcga gggctacgac accaccccgg    280260
     tgctgctggt gaccgcgcgc gaccagctca gcgaccgcat ccgcggcctg gacggcggcg    280320
     ccgacgacta catcgtcaag ccgttcgaac tggacgaact gctggcgcgc ctgcgcgccg    280380
     tgctgcgccg cagccacaac caggtggcgc cgctcatgcg gcatggcgag ctgctggtgg    280440
     acccggcggc gcgccaggtg tcgcgcgcgg gccggcccgt cgcgctcagc cagagcgaat    280500
     accgcacgct actggcgctg atgcagcggc gcggccgcac ggtctcgcgc gagcagctgg    280560
     agcacgatgt ctacggcgcc agcgtggcgc tggaaagcaa cacggtcgcc gtgtacgtgc    280620
     accagttgcg gcgcaagctg ggcgacgacc tgatcgagac ggtgcacggc tacggctatc    280680
     gcatcggcca ggaaggcgca tgaaatcgct caagcgacgc attctgaccg cggtactggc    280740
     cgcgctgctg ctgaactggg gagtctggct gggctggcag accttcgaaa tgggccggcg    280800
     cgaaaccggc acctgggacg cccggctgcg cgatgtcgcc agccaggccg tgctgtccat    280860
     gccgctggac atcatggagc gttcggagcc gaccggcttt cgcctgcccg agccggtgca    280920
     gaccagcgag ctgcgcatga gcttccagat ctggagcatg gcgtcgcgcc gccagatcgt    280980
     gcacagcgtg aacgcgccgc ccggcccgct caacccggcc ttcgccgacg gctatgccga    281040
     cgtcgagctg gatggagagc cgtggcgcgt ctacagcgtg accgacgccg agggccggat    281100
     acaggcgcag gccggccatt cgctggccgc gcgccgcggc gacatcctgc aatggctggg    281160
     cgccagcctg aaggcctcgg ccctgctgtt cctgttcctg gccctgagca tcctgctggc    281220
     gatcgaccgc gccatgcggc gcctggaccg tgtcggccgc gccgtccagc aacgcgatcc    281280
     gctggatctc gcccccctgc ccgacggcga cgtgccggcg gaactgcggc cgctgatcac    281340
     ggcgatcaac cggcagttcg ggcgtgtgca cacggcgctg gcgcgcgaac ggcgcctgat    281400
     cgccgacgcg gcccacgaac tgcgcacgcc cctggccgcg ctgaagatgc aggcggaagt    281460
     cgcgcttggc gcgcgccacg ccgacgaacg gcacagcgcg ctgtgcaaac tgctggacgc    281520
     ggcgcggcgc gccgcccgcc tgtccgagca gttgctcgac caggcgcgcc tggacgccat    281580
     ggaagccagc gtgcctggcg gcgaagtgga tctggccacg ctgaccgcca tgatcatcgc    281640
     cgaccaccag gcacgcgcgc aggcgcgcca tcaacgcatc cagctcgacg tccggcccgc    281700
     cttcgtgagc ggcgacctgg attcgctcgg catcctggtg agcaacctgg tcgacaatgc    281760
     actgcgctat acgcccgagg gcggccgggt cgtcgtgtac tgcggcccgc tggagaacgg    281820
     cgcggtcggc ctgcgcgtgc tggacaacgg gccgggcgtg cccgccgacc ggcacgagcg    281880
     catcttcgag cgtttctatc gccagccggg ccaggcgcag cgcggcggcg gcatcggcct    281940
     gtcgctggtg gcccagatcg cccgcctgca tcgtgcccgg atcgactgcg gcgccggcct    282000
     ggacggccgc ggcttcggca tcgccgtggg cttcgcgccg cgcagctagc gcatgaggaa    282060
     ttggccagca tgcgccgcaa ccgctaggat gtggggctcc actctctgaa caggtgtacg    282120
     acaatgactg cttcgatctc cgcccgcgtc gccgaactcg gcctgactct cgagccggcc    282180
     aacgccccgg cggccaatta cgtgccgttc gtgcgcgacg gcaacctcct gtacatctcg    282240
     gggcaggtgc cgcgcgtgga cggcaagccc gtccacctgg gccgccttgg cgacagcgtg    282300
     agcgacgaag aaggcgtgca ggccgcgcgc caggccgcgc tgggcgtgct ggcgcaactg    282360
     gccgccgcca ccggcgaccg cctgcagggc gtggcgcgcg tcgtgcgcct gggcgtattc    282420
     gtggccgccg cgccggactt caatcgccac agcgccatcg cgaacggcgc atcggacctg    282480
     atggtcaatg tgttcggcga agcgggccgc catgcgcgca gcgcggtggg cgtggcctcg    282540
     ctgcccaacg gcgtcgccgt cgaagtcgag gccgtggtcg cgctggcgca ggcctgagcc    282600
     gccccgacgc caggatcgca ccatgcccgc cacgctgacc gatgagctcg tcgccgtcct    282660
     gcgtgcccgc acaccgggcg cgcaaggcgc attcatccac ttcaaccacg cgggcgcttc    282720
     gctgccctcg gccggcacct tgcaggccat cgaggcgcat ctgcgcctcg aggccacgca    282780
     ggggcccatg gaggccggcg tacgggcgcg cgaacaggcc gagcgcgcac gcctgctggc    282840
     cgcgcgcctg ctcaacgccc agccagccga ggttgcgctg accacgggca attcggcggg    282900
     ctggggcgcg gccttcgccg cgctcggacc ctggcgggcc ggcgaccgca tcctggtcgc    282960
     ccgccacgaa tggagcggca acctggcggc catgcgcctg gccgcgcagc gcgccggcgc    283020
     gacgatagaa accattgcct cggacgagag cggcgcggtg gaccccggcg ccttgcaggc    283080
     catgctggac gagcgggtgc gcctgattgc gctgacatgg ctgccggcca atggcggatt    283140
     ggtcaatccg gctgccgccg tcgggcgcat tgcgcggcgc cacggtatcg cctatttcgt    283200
     cgatgccgcg caggccgtcg ggcaattgcc catcgatgtc gccgaggtag gatgcgacgt    283260
     cctgagcggc acgggccgca aggccttgcg cgggccgcgc ggcaccgggc tgctgtatgt    283320
     gcgccaggcc ttcctggagc ggctggcgcc ggcctgggtc gatacctggt cggcgccgct    283380
     gggcgaggat ggctgcccca tcgtgcgcgg cgacgccgcc cgtttcgagt cggccgaaaa    283440
     cagcgtggcg ctgcgctgcg ggctggccca cgcgctgcac gaagcgctgg agctggacat    283500
     cgcgtcgatc cgcgcgcgca tcgacgccgt ggccacgcgt ctgcgcacgc gcctggccgc    283560
     gctcgacggc atcacgctgc tggaccaggg acgggtgcga tccgggctga ttgccttcga    283620
     tgtggcaggc tggcaggccg acgcggtgca acgcgagctg gcgcgccagg gaatcgcgct    283680
     gggctgcaac ggggtggcct atacgcccct ggacatgcag gcgcgcgggc tgcggcagat    283740
     cgcccgcgct tcggtcagct acctgaccac cgaggccgag atcgatgcgc tgctcgacgc    283800
     gctggccgcg ctggcgcgcc gcacgcccta gcttttgcgc tcgcccgcca ggccggccag    283860
     gaagcgttcg tcggccttgc tgagccggcc ctcgccgcgc gcgcgctcga tcagctcggg    283920
     gcggcggctg gcggtcagcc gcagggactg ctcgcggcgc cagcgcgcga tgttggcatg    283980
     atgaccgctg agcaacggct gcggcaccgg cacgccttcg tagacttccg gacgggtgta    284040
     atgcgggctg tcgagcaggc cgtcgagcgc cgcgttgaag gagtcctgca gcgcggagtc    284100
     gccatcgttg agcacgccgg gcagcaagcg caccgcggcg tccatcatgg ccagggcggc    284160
     cagttcgccg cccgacagca cgaaatcgcc caatgacagc tcatgcgtga cacagcgctc    284220
     gatgaagcgc tggtccacgc cttcgtagcg tccgcagatg aaaatcgcgc ccgtgcccgc    284280
     cgccagcgtg gtggcttcgg cctggtcgta gcgccggccc gccggagaca gcaggatcac    284340
     cggcgcggcc tgcaggccct gcgcggcgcg ggcggcctgc gcggccgcca ccgcggcttc    284400
     cagcggcgcg gccatcatca ccatgcctgg gccgccgccg taggggcggt cgtcaaccgt    284460
     gcgatgcacg tcctgggtga aatcgcgcgg gttccaggcg tgcagcgccc acaggccctg    284520
     cgcatgggcg cgccccgtca cgccctggtc gcgcaccagg ccgaacatgt cgggaaacag    284580
     cgtgacgacg tcgaagcgca tcagtagtcc agaggccagt cgctgtcgat gcggcgcgcg    284640
     gccaggtcga catgccggat atgggcgcgc acgaacggca ccagctcttc gagcggccgg    284700
     cccttggggt cgaccagcgg caccggcccg ggctggccgg gctggagctg ctggcgcaag    284760
     accttgagga ccgcgtgcgc gccgttgtcg aacacctcgt cgaccacgcc cagcaagcgg    284820
     gactcgccgt ccgcatcgct gtagagcgcg cagccgatca ggtcgaccca atagtattcg    284880
     tcgtcggcgg gcgccggaaa ggcgctgcgc gccgcctgga cgaggcaacc gcgcaaggcc    284940
     tcggcctgat cgcggtcgtc gatgcctgcc agctgggcca ccaccgcgcc gccatggacg    285000
     cgcgcctgca gcacctgata ggcgcgcggc acggacgcga caacgccccg ggccgcttgc    285060
     ggcgcggggc gagtcagcca ccagtgagag acagtgcgca acacttcggc ctgcgccgag    285120
     tggggctgca cctttaccca gcctttgaca ccgtaggccg atgcaatgcg gcccagctcg    285180
     accagatccg cgggcgccgc gccggaatgt gcggcttcag acatgtgtcg tgtgtagcaa    285240
     agttgcggac aaagaaagcg ctggcatagg cagcgctttc aagaaatgca ggcgctggcg    285300
     ggcatggcaa agccccggcc agacgcgcac gggggcacgg ccgggggtac gcttacgcgc    285360
     gcccgcaccc gccgcacccg gcagcgggct caggcagcag ccgaaacctt ggccgagtat    285420
     tccttgacca ggcgctcgac ggcgggcgac agcagcgcgc cgttgccggt ccagtattgc    285480
     acgcggccca gggcgatgcg cagattctcg gtgccctcag cggcaaccgg gttgtaaaag    285540
     ccaacgcgct cgacgaaacg gccatcgcga cgattgcgcg aatcggtagc taccaggttg    285600
     taaaacggac gcttcttcga gccaccgcgg gccagacgaa tcaccagcat aggtaatccc    285660
     ttgaattggt tgtgaaaaac gggaaattct agcacttaaa gttgcctggt ggcaactgaa    285720
     gttgcgtttt tcccctatgg acagacaaaa aaatgggacg aatgcccaac tacgctgaac    285780
     gccgcccgcg ccacaggcgt atgcttgcgt gacgcaaccg gggggcggcc acgcgggcgg    285840
     cccgaaggcc cctcgcaagc ggcgcgccgg cctgcctgca aaggcagccg gcccggcagg    285900
     tatgcaagca tacaccgccc gctgtttcat cgcatcgaca ggagctttcc atcatgaagc    285960
     attgttcgat tcttgccccg cttacccgcc tggccgcctg cggcgccctg gccgccgtcc    286020
     tggcggcgcc cctgccggcg gccgcccggg tcggcgacgc cgccctggtt tcggtcacag    286080
     gccagatcac cgcggtggac cccgccacgc gcacggtaac ggtgcgcggc ccgcaaggca    286140
     acgaagttcc cctgtaggcc ggccccgacg tgcgcaattt cgaccgcatc aaggtgggcg    286200
     acaccatgcg tgtggactac tacgagtccg tgtcgatcgc cacgcgcgcc aagggcagcg    286260
     gtgtaccgga agtccgcagc gagaccgtcg ccacccgcgc caaggaaggc gccctgccgc    286320
     aaggcgcggt gggccgcagc acgaccatca cggccgaaat ctggcacatc gccaaggacg    286380
     gccgcacggt catcctgcaa ggcccgcagg gcggccgcga gaccttccat ttgcgcagcg    286440
     ccgcggcgca ggaaaaactg cgtaccctca aggaaggcga cctggtcgac ttcacggtga    286500
     cgcgggcgct ggccgccgcc gtgcgcagcc gctagccccc cgcacgctcg cgcgccaaga    286560
     caaacggccc gcttgcgcgg gccgtttgct tgccggcagg cgctcagcgc cgctgcagga    286620
     agtgctcgcc gcggccctcg gcctcgcgtt gcgccagcaa ggtgttgccg gtctggcgcg    286680
     cgaaggcctg gaaatcgcgg atggcgttgg gatcggtggt gaccacccgc agcacctggc    286740
     cgctttccat ttgcgccagc gccttcttgg cgcgcaggat gggcagcgga caggtcagcc    286800
     cgctggcatc gacttcgtgc tggtaggacg gcaggccgcc ggtatcagag gcgctcatcg    286860
     acccacttct gtacgctggc cacggcagcc ggcagagccg ccagatcggt gccgccgccc    286920
     atcgccatgt cgggacggcc cccgcccttg ccgcccacct ggccggccac gaagccaacc    286980
     agatcgccgg ccttgatgcg gccggtgaga tcggccgtca cgccgcccac caggctgatc    287040
     ttgccatcgg ccgagccggc ggccagcagg accacggcgg gcttgaggcg gtctttcagg    287100
     ttgtcgacca tgccgcgcaa ggccttggga tccacatcgc cgatgctggc ggccagcacc    287160
     ttgatgccct tgacctcgac cgtggccgtg gcggccaggt cgttgccggc gctggcggcc    287220
     agcttggtgc gcgcctgctc gagctctttc tcgagcgcct tgagctgttc ctgcacctgg    287280
     gcgatgcgct cgggaagctc gtgcgccggg gcgcgcagca cgccggcggc gcgctgcagc    287340
     agcacgttct ggtcctgcac ccaggccagc gcgttgtcgc cggtaatcgc ttcgatgcga    287400
     cgcacgcccg ccgccacgcc gccttcggac accaccttga acaggccgat gtcgccggtg    287460
     cgccgcacgt gcgtgccgcc gcacagttcg cgcgaaaaac cgatgtcgag cacgcgcacg    287520
     gtatcgccgt acttctcgcc gaacagcgcc atcgcgccgc ccttgacggc gtcgtcgtag    287580
     gccatgacct tggcctctgt ggcctggttg gccagtacct cggcattgac gatggcttcc    287640
     acgcgggcga tctgctcggc cgtcatgggc gcgtcgtgcg cgaagtcgaa gcgggtcttg    287700
     tcgggatcga ccagcgagcc gcgctgctgc acgtgggcgc ccagcacttc acgcaaggcc    287760
     ttgtgcatca ggtgcgtggc cgagtggttg cgcaccgtgc gggcgcgacg caccgcatcc    287820
     acgcgcgcca gcaaggtatc gccgaccttc agcgcgccgg cctcgagcgt gccgtgatgg    287880
     ccgaacacgc cgggctggat cttgagggtg tcggccaccg cgaaccgcac gccgccagcc    287940
     tccagcaggc cggtgtcgcc cacctggccg ccggactcgg catagaacgg ggtggcatcg    288000
     agcaccacga ccgcgtcctg gcccgccgac acctgctcga cctgggtacc ctcgacatac    288060
     agcgccgtca ccttgacgcc gctcaattcg aggctctcgt agccttcgaa gcgcgtctcg    288120
     gcgccttcgt agctcaggcc ctcggccatc ttgaacttgc ccgcggcgcg cgcctgctcg    288180
     cgctggcgct gcatcgccgc ctcgaagccg gccatgtcca cctcgacccc gcgctcgcga    288240
     cagatgtcgg cggtgagatc gaccggaaag ccgtaggtgt cgtacagcgt gaacaatgtg    288300
     gtgccgtcga gcgggtcgcc cttggcgacc ttggccagcg cgccgtccag gatcttcatg    288360
     ccgtgttcga gcgtttcgcc gaagcgtttt tcttcctggc gcagcacctg cgccacgcgc    288420
     tcggccacct gggccagctc gggataggct tcgcccatct cggccaccag gtccggcacc    288480
     aggcgatgga agaacggctt ggtctggccc agcttgtagc catggcgcag ggcgcggcgc    288540
     acaatgcggc gcagcacgta gccgcggcct tcgttgctgg gaatgatgcc gtcgacgatg    288600
     agaaaggcgc aggcgcggat gtgatcggcg atgaccttca gggagttatc ggccagatcc    288660
     ttcacgccgg tctcgcgcgc ggcggcggcg atcagcttct ggaacaggtc gatctcgtag    288720
     ttggaatgca cgtgctgcag caccgccgcg atgcgctcca ggcccatgcc ggtgtccacg    288780
     cagggcttgg gcaggcgttc catgttgccg gcggcgtcgc gctcgaactg catgaacacc    288840
     aggttccaga tctcgatgta gcgatcgccg tcttcctcga gcgagcccgg agggccgccc    288900
     cagatttccg gaccatggtc gtagaagatt tccgaacacg ggccgcaagg gccggtgtcc    288960
     gccatttgcc agaagttgtc ggacgcatag cgggcgccct tgttgtcgcc gatccggatg    289020
     atgcgctcgg cgggcacgcc gacttccttg gcccagatgt cgtaggcctc gtcgtcttcc    289080
     tggtagaccg tgacccacag cttctcggcc ggcagcctgt agacctgggt cagcagctcc    289140
     caggcgtact ggatggcctc gcgcttgaag tagtcgccga agctgaagtt gcccagcatc    289200
     tcgaagaacg tatggtggcg ggcggtgtag cccacgttct cgaggtcgtt gtgcttgccg    289260
     ccggcgcgca cgctgcgctg cgacgacgtg gcgcgcttgt aggcgcgcgc ttccttgccg    289320
     gtgaatacgt ccttgaactg caccataccc gagttggtaa agagcagcgt ggggtcgttg    289380
     gccggcacca gggacgacga cggaacgatc gtgtggccct tggactggaa gaattgcagg    289440
     aacttctggc gaatctcaga ggatttcatc gtggatgaat cgggattttg gcgaattttt    289500
     gattatagag ggtcggcagg ccgatgccag cgccgccgcc ctactccttg cccggacgca    289560
     cgcagacgaa gctggtgaac cccggcgcgc cgtccacgcg gtcggtggcc tgcgccatga    289620
     tgaccgacgc gtagcccggt gggcacgaac actgtccggt aagcgggttg cggctggtat    289680
     gaccgctgta cgagcggcag cccacgtggg aattcaccga ataggcgccg ccgaacgccg    289740
     gcgatgcctt gcccgccgcc aggccggccc aggccagcgg cgtgccggcg ggcagccgcg    289800
     ccacgtccgg ccagggcgga ttggcgaagc gaaacgccgc gccgcgcacc ccgccggcca    289860
     cggcgaagcc gccacggccg gcggtggcgg ccaccagggg cgccatgcgc atcaggtcga    289920
     cctggccgtg gccatccagc aaggggcggt ccagccaggc cagcgcgtcc agccggcagc    289980
     ccgcccgcgg gcaatgcgga tcgcgccgga ccagcatgat cacccccgtg cccaggggcg    290040
     agcgcctcgg cagggaacgc gccagcaggc cggcggcctg cagctcgggc agcgtcggac    290100
     gccaggcatc gcgaaacagc gcgcgcccgc gctcatcgcg cggcgccagc ccatcggcca    290160
     gcgtgtcgaa ataccgctgc agcagttggt cgaggccgcg ctggatttcg cccagccaga    290220
     cgccggcacc gcgtgcggcc gcgtcctgcg catcctgcac cagccggttg gcggcccaca    290280
     ccgccgccat ggccgcgagc gcggcggcca cggccagttc cagcaaggcc aggccgccct    290340
     gggtgtgcgc ggatctcatc gcgccgtgaa cgcgaaggtg ttgcgatcgc ccgccacgca    290400
     ctgcgcctgg gcggcctgcg cgcggtacgg caacgccggg acggccagcg cattcttgac    290460
     caccaccggc cccgccttgc cctgcacggc gatgatgtcg gatacgcgct gcatgacaga    290520
     ggccaacgcc gggcaggccg cgccgttgac attggtcagc gtcagcgtga acgccgaacc    290580
     gggcggcgcg ccgcccggcg cggccggcgc cacgctgatg acgccatggg cgccagcccc    290640
     ctgcccgccc aggccgtgcg cgaccgtcgc cgacgcgccc tcgccgcgca ccgacaccac    290700
     gctggaatcg cgcagcgcat gcgccagcga cgccgtgccg atgcccgtgt agggcgccgc    290760
     gccatcgcct tgcgcattgg ccttggtccg cgccacgaaa cgctgcagtt cctctccgac    290820
     ccggggcact ttgctttcga tgacatacga gccgatggcg ggaatgccga tgatggccac    290880
     cagcaagacg atggccgtga cgatggacac ctcgaccagg gagaagccgg cttggcggcc    290940
     ggacagaatc gtgtgtgaca tgaagaatcc tcctgcgtga agaaacgcct gccgaggctt    291000
     attggctggc gtagaaactg accaatgcgc gccgtagatc gtcgatggcg gcgtaatgcc    291060
     aaaacgccag ggccagcacc gccccgaccg cgcccagcag cagtacccag cgcaggccct    291120
     gcgcctggcg ccgcaggcgc ggcagcatgt gcgcctcgac ccgcgtgcgc gcccgcgcca    291180
     agccgtcggc caggccatgc gcggcgacca tgtcggccat gaaccaggcg tgcgcgggtt    291240
     cgaacagccc ggtatcgaac acgctggcat cgaccacccc ggcgtcgacc cgcagcagca    291300
     tgcgctcgag gtgccaggcc agccacggcg gcgcgtcggc cccctggacg agcagcgcgg    291360
     tgcgcaggcg cgtgtcgatg ttgccccgct ggcgcaacag cacggtggcc agcgccagga    291420
     agcggatcgc ctgcatatcg cggtacaggc gccatggctg ccagcggtcc aggaacacgc    291480
     gcgcgcgccc ggcgtagcgg ggcagcgacc agcacaccag cgccaccgcc gccgtcaatg    291540
     ccgccaccgc cgctggccag gccgcttcga cgtacctggc cagcgcgaac aggccggccg    291600
     accaggcgcc gtggtaatcc ggcggcacgg cctggaatac caggcgcagg cgcggcgcgc    291660
     tgaaggccgg cacggccgcc agcaaggcgc aggccaccgt catggcaacc aagccggcgg    291720
     cgatcgtcac gcagaactcg cgccgcattc cctgcgtcag gcgggtcagg tgcgccaggt    291780
     cgcgcaacac gatgcccagc gcgccgccgc ccgccgactg cgccagcgcc agcagcgtgc    291840
     aatcgccttc gggcaggcaa cgggcccagg tggcgcgcag gtcgccgccg caatcctggt    291900
     agcgctgcag ccagcggcgc gccaggcggc cgcgcacgct cgcctcgcca tggcgcgccg    291960
     cgtcggtctc gaagatgtcg cgcagggtct ggcgcccctg caggccttcc agcatgtcgg    292020
     ccaggtattc gtagtagtcg ccccgctcgg cgccgaagcg ccatgcgtcg agccgctggc    292080
     ccagcgcgcc ggccgcgcgc cacgccaacg ccagcgccgc gtgctcagcc atggccgtcc    292140
     tcggcgccca ccggcgtgcg caaggcgggt gacagcgcga aacagcgttc gaccaggcgc    292200
     ggatccacca cgcctgcttc gaccttgcgc caggcgcaat cgactgcccg cagcggcgcg    292260
     tcgggcggct gccggcgtgc gcgccgcccc agcaagcggc gcagcgccgg attgtcgcgc    292320
     cgacggatga gatcgagcag gacggcgtcg gtttccggct cgagcagttc ggcgaccacg    292380
     gtgcgccccg cgtagccgcg cagggccggc agaccggcgc ctgcgcaggc cgcgcaaccg    292440
     gcgggattgc gcacgcgcgc ctgcgccagc gccacgccgg cgcggcgcag gcgcgcggcc    292500
     cagcaacgcc acgccaggcg ctgcgcgtgg gaccggccgg cgccgcggtg ccacagcatg    292560
     gccaggggca aggcgcatgc cggacacagg cgcggcagca aggtctggta gaccagcagc    292620
     ttgagcacgc cgggcgtggc caggaagtcg cgcgacacac cgatgaagtc ggatgccagg    292680
     cgttccggaa tcagcaaggc ggagccggcg tgcgtcgtgg tgtagaggct gaccccggag    292740
     ccggccaggt cggtgaagac gcgtccggtc tggcgatccc ggacctcgcc caggtacagg    292800
     tcgtgcatgg ccgagcgctt gatggtcagc agcttggcat cgaacggcgc gccggcctct    292860
     ccttccagcg agcggctcac gctgttctgc agggcgttgg cgatggcgta ctcggccgag    292920
     tcttccaggg tgaccagctt gcgctcggcc ggcaggccgc gcagcatggt ggcgatggtg    292980
     gtggacttgc cggcccccac cgtgcccgcc aacaccaccg ccccgccagc gcgctggcag    293040
     gcgcgctcga gcgtggcggc ctgcgccggc agatagccca gttccgccag gctggccccg    293100
     ccttgcggcg ggtcctggcg caggatgcgc aggcatacgg acggaccgtg atccgtggcc    293160
     agggaggccc agcgcagcac gaccggcacc tcgtcgacct gcagcgcgat gcgtccctgc    293220
     tgttcggcac gcggatcgaa caccgcgccg ttgcccgcgc gcacgtccat ccaggccacc    293280
     gcgaggattt cgagcaggca ggcatgcgac aggccattga agcatggcgc ggccacatag    293340
     gcgccaccca cggtatagcg aacctgcgcg gtggcggcgc gtcggtcggc gtgcaggtgc    293400
     agatcgctgg cgccgtggcg cacgccccag cgcaccatgt cgaagaacag cgcctgcagc    293460
     gccgtgcgcc gttgcgcggg atggtcggcc gcatgcaggc ccggggcgcc agccgcctcg    293520
     cgcgccacgg ccagcagcaa gggcgacggc aacacatagc gcgccggcgc cgccagccgg    293580
     tagccgcgct tgcgcatgag gcgctcgagt tcgtcggcct ggtcgccatg tacgtagtcg    293640
     gccagcgcga acagggcggc gtagctgcct tcgagcagca ccgggcacag gcgtcccgcc    293700
     agggcgccga ggtcgaactc ccgcgccagc gcacgcacga acgcgggacg caggcggccc    293760
     agcgcctcgt ggtcggccac gaagggagca agcgtggtgc acgggctgtg caagaccggc    293820
     ctgtgggatc ggattctcat ggcgcggccc ctgcggcaga cgccgcgccg ttgtccaggc    293880
     tcgcggccgc agccaggcag gcggtacggc ggaccgcgcc gctgcgcaag tgcacgcatg    293940
     gcacggctat ggcttcgagc tggtagcggg cctcgggcgc ctggccggac ggcctgcgct    294000
     ggcccgccag gtagcgccaa tggcgccggt tgatggagac ctccgcgcgc agcgcagcgc    294060
     cgacgccgta gatggccagc aatacgatgc ggtcggcgcg cgggcccggc gccgccggcg    294120
     ctgccttgcg cgcggctggc gcgtcgctcc acggcgccgg ggctgccggt cgcggcggct    294180
     gtgcggccgc cagggtttcg cgccgcagca gctcgcgcac ggtatcggcg tgcggccagg    294240
     gtgcgggcgg cgcggccggc tgggcctgcg cggcatgaac cgtcagggcc gataccagcg    294300
     ccggcaggaa ggccccgcta ggaacgtgaa gtcgtctgct catagaggga tccttgaaga    294360
     tgcagcgaca gcacgctggc gcgcagcgtc gcgatcgcgt ccgggaccac gcgcagggac    294420
     accgtggccc atccgatggg cgccggcagc ggccacacca gcgccagcga acgcagaggc    294480
     ccgtcgagca cgacctcgcg ccggcggagc tcgggcgcgg caggcggcgc gagctcgggc    294540
     gggccatccc aggccgggcc ggccagcgcc tgcgcggcgc ccaccgagac atgcgtgaag    294600
     gcggcgctgg cacgctgcag cgtggcggcc agcgccagcg tgtcggccgg cgaggccggc    294660
     gcggtgcgat ccagcccgtg ctggtcgccg gccagcgtcc aggccacgcg cgtatgctcc    294720
     agcgtatgca gccgcatctg ccagccgggc ggaaccgcgg cggcaaacgc caggctggtg    294780
     gccgccgcat cgacgcggtg gtagtcggcg tcgcagtgcc acgccgggcc cggcacgcat    294840
     tgcgcctgcc gcagcgccca gccggcgacc cgcagcggca aggcctgcaa ggtatcgagc    294900
     acccgcgcca gctcgctgct ggtatgcacc ggccagccgc gcaggaactc cgcttgggcg    294960
     gcgcgccaga cggcccgcgg atcgggcgcg gcgggcggcg gcccctggcg caggccgcgc    295020
     cacaacgagg cgccgccggc cacggccagc gccagcacga ccgctcgcgc cgctaccggc    295080
     gcacgcgacc agcgcgaggc cagcggcgcc aggcgcgcgg agggatccgg cctggccagc    295140
     aaggtatcca gcgcggcctg cgccggcacc tcgcgcaggt cgggacgctg cgccaacagc    295200
     gtgcgcaggc aggcctgcgc ctgcgcgaca tccgcaaaga gccggtcggc gctggcaagc    295260
     acggcgccgt cctgcacggc gatcagccag ccctgcccgt ccggcaggct ggccacgccg    295320
     gcctgcgcgc catccgggtg cagactggcg tacgcctgcg ccgcgctgtg gagcgccagc    295380
     gcgccatagc ggcgaggcag gcgcgcgcaa cccgcggcaa ccgcgtgccg gccgcccacc    295440
     aggtaatgtg tggcgcgcaa ggcgcgggcg cgggcccgcc cctgcagcgc ggcgtgactg    295500
     cccagcacgg cgaaccatgt cagcccgaag gccagcatgg gcccgccctg cgtctgctgc    295560
     agcaccagcg gcggatgcgt ggcggcgcgc atggctcaac cctcgtcgat ctgcgcggtg    295620
     accatgacca cggtcgtgac ccgctcgcgc gccgtgcggt cgtgcccgcc ggccgcgagc    295680
     ggcgcatcgg gaaacaggcg gtggcgttcg tattggtctt cgctgtggtc gaagcccgac    295740
     aggatgacgg gctggccggg cagcagctcg acctgctgca cgatgccgct gccgtcgatg    295800
     gcgatctgct gcagcgacac ttgctggccg ccctcgccga aggtcagggt gcgcagcggc    295860
     tgggcgatgg tgttgtcata ggaaatggag agcaggatgc ggccgtcatc gcgcgccttg    295920
     ggcaacagcg tgaggaacgt gcccaccgtc tcgcgcttct gctgcaccgc caagccgggc    295980
     acggcatcgc gcccaccggg cgccgccgcg gtcgggctca ggcgctgcac ctggtccacg    296040
     taggaaaatg tggtgcgcac ggcgtgggtg acggcgcgcc ggttcagcgt cagcatgggt    296100
     atgctgcgat ggcgcagtac cgctcccatg gtgctcaacg cggcgatcag ggcgcgcgcg    296160
     tcgcgccagg gcccggccag cacgcgggcc ccgagcgcgc ctgccgcgcc tgccccgccg    296220
     ggcatgacgt acgacgccgc ggcgcgcgcg ctggcgtaga ccgcctgcca atcgatgccg    296280
     ccttcggcgg cggccgtggt gcgcaccgtg agttcttcga acaccaggcg tacccggcgc    296340
     gtcagggcgc ggttctcgcc ttgcaggtat ttctcgatgc gcgcgagcgc ctccggcgta    296400
     tccgtgaccg cgagcgtgct tccgcccgcc tcgatctcgg cgatgacgcc ggcgcgcgtc    296460
     aggaaagcgg cgacgcggtc tcgcacggcc tgcagcgcct tgccggcgtc ggcgctgagc    296520
     accgtgctcg aggcatggcc gaaactgccc gtctcgccgc tgccggcgcg gcccagccga    296580
     gcctgcgcgc tggctgccag cgccagcgtg cgcacatcga agacccgcgt ttcggtgcgg    296640
     tagaactcga tggcgccgcg atggtagcgc cagtgcacgt acagctgcgc ggccagcgcg    296700
     tcgagcgtgt cggccagcgg acgcggcccg gcgcgcagtt cggcctgggc gggaggctcg    296760
     gccgccagct cggccggccc cgccaggcgc ggcaggaagg cggcgcgcgg cagcagcgcg    296820
     tcgggatgca cgcgcacggc gatgccggtg gcgcgatgca ggcgctcggc cagcacgagc    296880
     agcgtggcct tgcccgcgaa cagcagggtc gtatcgacat cggcgcgcag cgccggcggc    296940
     agcagcacct cgcgtgccag tggctgggcg cgaccggcca gccagggccg cgcgacgtcc    297000
     tgggcggctt cgcgcgccgg ccgctcgccg gcccggccca cggcctgctg cccttcgagc    297060
     aggcgtgcgc gcagggacgt cgcggcgtcg cgcatggcct gcatctgctg cgacagcgag    297120
     catccgccga gcgccagcga caggcccgcc atggccaggc gccgcgcctt catgtcagcc    297180
     ccggcgcggc ggcgcgcgtg cggtcgcagg cttgcgccag cggcacgacg cgcagtacgc    297240
     gattggcgta gaagcacggc tgcgccggcg gctcggacaa ttcggtggcc gccagcagcg    297300
     cgcgcacggc ggtcttgaaa tcacccggaa gttcggcctt gcccgccagc ggaatatcga    297360
     cgtcgagggc ccagtgttcg gcctcgaacg tccagcccgc ggcgcgcgcc cagcgcgcca    297420
     gcacggcccg caaggtcagg tcgggcggcg cggcccgaaa gcgcggcgcc ggcggcgcgg    297480
     cctcggcggc ctcggcgggc gcgacggcgg atggcgtggc cgggaccggg gccggcccct    297540
     cggcgcggac aaccggcgcg cccgccggaa tcggcgcgcc gctgcgctgt atgcgcgcga    297600
     catagcggcc gccgcgcagg ctgagcgcgg gccaggcgcc gtccacgacg atgtaggggt    297660
     cgcggcgcag gtacggcacc ggacgttcgc cgccggcgcc gtgcgcgaag atggccggta    297720
     tcggctggcc cggcgcgaac tgcagccaaa tgcgccgcgc atcgtcgaac acctgcagcg    297780
     gcgccaccgc cgggtcgccc gacagttgcc agtcgaagcg gtactggccg gccggcgcct    297840
     cgtcccaggc ggccgcgacg gcggccgggc gcgggcccgc gcaggcctgc aagacggcca    297900
     gcaggcacac tatggacagc gatcgaacca tgcgactttc ctggcaaggc ggcgcgacgg    297960
     ccgcgggatg ccaggcatgg tgacgcagcc ggcggggcgc gcctagaccg acatgtacgc    298020
     atggatcaat cgggcaccat gccttgccag gcgatctgca tggccataaa aaaggccggc    298080
     cagcggccgg cccgcagcgc gtcgcgccct acgcatattc ctggtaggcg cgccccagcg    298140
     acatcaccag ccggtccgat tcgggcaggc cgacgatctg cagggaggtc ggcaagccgt    298200
     gcgcccccga gccgttgggc accgccagcg cgcagcagcc gagccacgcc ggcatgcgcg    298260
     tgtacaccgc cgggttgtac ggcgactgct ccagccccgc aagcggctgc gccacgcacg    298320
     gcgtcgtagg catcagcaag gccttgacgc cggccatcgc ctgcgtgaac gtatcgatca    298380
     tcgcgctgcg gcgccccagc aattcggcat aggcggcggc atcgtaccgg tcgcccacca    298440
     ggaagcgcgc gcgcacgtcc tcgtccatgc cggacagtgg gtcgtggacg tacttcccgg    298500
     cgaattgcag gccttcgcag gcgatcagcg tggaggtcaa ctgggcgaac gcttcccggt    298560
     cgaacggcag cgccagctcg accagcgtcg cacccatcgc ctcgaaggcc cgcaggcttt    298620
     gcgcataggc gtgcgccacc tcgggctcga tggcgcccag ccattgcgcg ccgagcacgc    298680
     cgatacgcgc gtcgcgcacg cgcgccacgg cctgcgaacc cggctgcgcg gtgtccgtgg    298740
     cggtcttgcc ggtcaacagg tcgtcgagca tctgcacgtc ttcgacggtg cgcgccaacg    298800
     gtccgatggt gtccagggtg tggctgagcg acatgacgcc cgcgccgctg tggcgcccca    298860
     tgctgggccg catgccggtc agcccgcaga acgccgaagg aatgcggatc gagccgccgg    298920
     tgtccgtgcc taccgcgaag ggcaccatct gcgcgccgac ggcggccccc gatccgctgc    298980
     tcgatccgcc cgtcgcgcag ggcacgtccg cgcgcagcgg attgcgcggc gttcccatgc    299040
     gctggttggt gccccagccg ccgaacgcga attccacggt gtgcgtcttg cccagcagga    299100
     tcatcccggc atcgagcagc gcacgcacgt actcggcggt ggcgccggcc tgccgccccg    299160
     cgccggtgcg cgagccatag gtcgtgaatc tgccggccac gtcgacgata tccttcacgg    299220
     cgaacggaat gccatgcaag gggctcaggc gctgcccttg cgccagcgcc tgcgtggcct    299280
     ggcgggccgc gtgccgggcc tcgtcctcgt agacggccac gaacgccccg atcgcgggat    299340
     tcaggtcctg gatgcggcgc aggaagacgt cggtcacctc ggcgggcgtg aacgcgcccc    299400
     gggcgatccc cctggcgagc tcggcgacgc cggcccgggc aatatgctgg tcagtactgg    299460
     tcatgcctgt agctccatgg cgggttccgc cgcctggccc acgcggccgg gcagcgaatc    299520
     gaacaagtgg cgggtatagg ggtgctgggg cgcatggatg acttgccgca ccgggcccag    299580
     ctcgagcagg cgccctttct gcatcacgcc gatgcggtcg cagacctgcg cggccacgcg    299640
     caagtcgtgg gtaatgaaga tcatggcgaa tcccagccgc ttctggagat cttcgaacag    299700
     ctccagcacc tgcgcctgca ccgacacgtc cagcgccgac acggcctcgt ccgcgacgat    299760
     caggtcgggc tccatcgcca gggcgcgcgc aatgcagatg cgttgccgct gcccgcccga    299820
     gaactggtgc ggataacgct gcaggccgtc ggccggcaag cccaccaggg ccatcaattc    299880
     ggccgcgcgc gcgcaggccg ccttgcggtc caccccgctt tcgatcgggc cttcgatcaa    299940
     ggcatgcaga atcctgcggc gcgggttcag cgaccggtag ggatcctgga acaccatctg    300000
     cacgcggcgg cgcaccgccc gcagcgcctt gcccgacagc cccgcgatgt ccacgccgtc    300060
     gaagacgatc cggcccgacg tgggggcgtg cgcccgcgtg atgcagcgcc ccagggtcga    300120
     cttgcccgag cccgactcgc cgacaacgcc cagggtctcg ccctttttca gcgtgaagcc    300180
     gacatcggcg acggcatgcg tgcgccgcgc cgggcccagc aggccgcgcg actcataaac    300240
     caggttcagg ccgctaaccg acagaagttc atcggacgac gcgttctgct gcgtcttggg    300300
     cacgccgctc ggcaccgcgg ccagcagctt gcgggtgtag tcgtggcgag gcgcgtccag    300360
     cacctgcccg gccggcccct gttcgacgat gcggcccagc tgcatcacgg ccacgtggtc    300420
     ggcgatatcg cgcaccacat cgaagtcatg cgtgatgaac agcaccgcgc tcgaatgctt    300480
     ggccagcaac tggcgaaaca gcttgagcac ctgcgcctgg gtcgtgacgt cgagcgccgt    300540
     ggtgggttcg tcggcgatga tcagcgcggg ctccagcgcc agcgccatcg cgatcatgat    300600
     gcgctggcgc tgcccgcccg acaattgatg cgggaaggcg tccatgagcg cctcgggggt    300660
     gggcaggcgc acatcgccca tcagctccag cacccgcgcc cgcacttgcc cggcgcccag    300720
     gtccggccgg tgcacctgca acacctccgc gatctggcgt cccacgcgca tcagcggatt    300780
     gagcgaggtc atgggttcct gaaacaccat ggccatgcgg tcgccgcgca gcgcctgcat    300840
     gcgcgccggc gacgccgcgg tcaggtcttc gccatcgagc cggatgctgc cggcgctcac    300900
     gcccaggttg cccggcagca gccccatgac ggccgacgcc gtcagcgact tgcccgaccc    300960
     cgattcgccc accaggcaca ggatttctcc ctgggccagg ctcagcgtga cgtcctgcac    301020
     cagtgtccgc gcgccggcgc ggatggccag gccggacacc tccagcaccc gttgcttcgg    301080
     tgtgttctca atcatttgcg cgcctcgcga gtttcgggtc caggctgtcg cgcagtccat    301140
     cgcccagcag gttcaccgcc agcacggtga cggccagcag caggccgggc gccacggtgg    301200
     cccacggcgc gcgctggaag accggccgcg cctcggccag gatgttgccg aaggtgggga    301260
     tctcgggcgg gaaccccacg cccagaaagc ccagcacggc ctcgagcagg atcgccgcgg    301320
     cgaacacgta gctggcctgc acgatcagcg gcgcgaagca attgggcagg atgtgccgcc    301380
     agacgacctt gggatacggc accccgagcc cgaccgcggc ctcgacgtag ggctcttcgc    301440
     gcaccgagag caccacgctg cgcaccaggc gcaccacgcg cggaatctcg ggcacggcga    301500
     tcgcgatcac gaccgaggcc aggctggcgc cgaacagcga taccagagcc accgccagca    301560
     ggatgccggg aatggccatg acgccgtcca tgatccgcat gaggacgcgg tccatgatgc    301620
     gcgaggcccc ggccaccagg ccgatgaggg tgccgatcgc aatcgtgatg acgaccacca    301680
     gcgcgccgat ggccagggac atgcggctgc catgcacgac gcgggagtac acgtcgcgcc    301740
     cgagcgcatc ggtgcccagc aggaaggcct ctcccggcgg cgtcaggcgc atgcgcggct    301800
     gcatcatcgc ggggtccatg ctggcgatcc aggaagccgc gacgctgatg gcgaccatca    301860
     gcagcagcac gccgcctccc agcagcgcca gtctgttgtg gcgaagaatg gatgtcatgt    301920
     ctcgtctccg gatcgtcagt agcggatccg tggatcgatg accacgtaca gcatgtcgat    301980
     caacaggttc accaggatgt agacgcaggc gaaaaagagg atgacgccct ggaccacggg    302040
     gtagtcccgc gacagcacgg cgtcgatggt caggcggccc aggccgggca ggttgaacac    302100
     gctctcggtg atcaccaccc cgctgatcag gaaggccagc ccgatgccga tgacggtgac    302160
     gatgggaatc gcggcgttgc gcagcacgtg ctgcgacagg atgcgcagcg acggcacccc    302220
     cttggccttg gcggtgcgca cgaaatcctc gttcagggct tccagcacgc tggcgcgcgt    302280
     cacccgcgaa atcagcgaca tgtagaagat cgccagcgcc agggtgggca ataccaggtg    302340
     ttgcgcggcc agccagatat cgtcggtgat gctgacgtat ccctgcaccg gcagccagcc    302400
     cagccagacc gagaacatga gtatcaacag gtaccccacc acgaagctgg gcagcgagaa    302460
     gccgatgacc gcgtagatca tcacgacccg gtcgaccagc gtgttgtggc gccaggccgc    302520
     cagcacgccc agcggcaccg ccagcagcac cgtgaccacc agcgcgctga gcgacagcac    302580
     cagggtcgat tcgaggcgct cgccgatcag cgtcgccacg ggctgcttgg tgacgatgga    302640
     tgtgccgagg ttgccctgca acagatccca cagccattgg gcatactggc ccagcaaggg    302700
     gcggtccagc cccaggtcgg cgcgcacgct ggcgaccacc tcggggctgg ccatgtcgcc    302760
     ggcgagaatc gtggcgggat cgccggtcag cctgaccagc aggaacacca ccgtcaccac    302820
     cacgagcacc acgggaatgg cgctggccag gcgcaggaac agcaacctca gaatttgcac    302880
     gaaaacgatc tcctacgtgc tgcgcggcgc catggcggcg ccgcgcggcg actcagttct    302940
     tggatattcc ccagaatacc gtcacgggcg cgtccagcag cggcgtcacg ttgctgcggc    303000
     gggcggcgta attgctgtag gtacccagcg gaatatagaa gacctggtca taggccagct    303060
     gctgtatctt cgcggcgatc tgctgccggc tggcgggctc ggtggcctgc gcgtactgcg    303120
     tgcgcagcga ctccatctcg gcgctctcgg tccagcccgc gtatccctcc ttgccgcggc    303180
     catcgaggtt gaggttggcg atgggcgaca tcaggtccag ggtgttccag ctgccgtagg    303240
     ccacgctcca gccgcccttc tccaccgggt cctgcttgcc gcgccgggta aggaaggtcg    303300
     cccaatccat ggactggact tccgccttca tgccgatgga gcgcaggatc tgcgccgtga    303360
     aaggcgcgat ggccgaggtg ggcggatagt cggtggcgtg cagcacgacc gccttctcgt    303420
     tcttgtagcc gctttccttg agcaaggcct tggcggcgtt gagatcggcc tcgtcgtcct    303480
     gggacaccac gcccgccgtg ctggccagcg gcgagtcgca gccgaacatg gcccagcaca    303540
     cgcgataggc cttggggtcg ccgacctgcg catccatgta gtcgcgctgg ctcaccgcat    303600
     gcagcagcgc ctgcctcacc ttctggttgt tgaacggcgg ctgcagccag ttcaggcgca    303660
     gggtcggcgt ggtcgtgctg gccagtttct ggatgacgac gtccttgctg gcctgaagcg    303720
     tctgcaccac gtcgggatac acggtctgca catagtccac ctcgcccttg gccagcgcat    303780
     tggcctcggt ctggatgtcg ggcagcgaca gccagacgac gcggtccacg ttcacgacct    303840
     tgccgccggc caggccgctg gggggctcgc tgcgcggaac atagtcggtg ttgcgctcat    303900
     agacgacctg caggccgggg cggtactccg acgccacgaa gcgaaacggc ccggacccga    303960
     tcacctcggt gatcgcctgg ctggccggcg catcggcgat gcgcttgggc atgatgaagg    304020
     ccggcagcga actggccttg ctcaggcctt cgatgacggc gccgaagggt tgctccagca    304080
     cgatctcgaa cgtcttgtcg tccttggcgg tgatttcctt ggcggcggcc atcatgcgca    304140
     agccggtcag gtcgcgttgc gcccagcgct tgatcgacgc gacgcagtcg gccgcggtaa    304200
     ccgggctgcc gtcatggaac ttcagcccgt cgcgcaaggt gaagcggtag accagcttgt    304260
     cggggctcac gctccaggtg cttaccatct gtggctgcgg cttgagctgc gcatccagcg    304320
     caaacagcgt gtcatagacc atgtaggcgt ggttgcgcgt gatatacgca gtcgtgccca    304380
     ccgggtccag cagcctcaat ggcgcctcgg ccgcaacctt gacttcctgt gccagggtgg    304440
     tcgcgtgcgg cacggccgtg ccgatagcca gcaggacggc tgcataggta cttttcaggt    304500
     atcgcatcag ggggcccctt atcagttgag ttgttataag cggactgacc gtcctcagcc    304560
     gggcgaaccg gccaggcggc agaccaggtc ggacggaacg gcgatttccg tcttcaggat    304620
     caaataggac agcgccttgc catgcgcgtc gaggttaagc gcgccattga cgccgccgtc    304680
     gagcacggcg tccagcacga agttcatggc gcccagcttg ggcagcaggt agcgctgcgc    304740
     cccggccggc cgtcgatgcg cgaattgcgc cagcaccacc tcgggcgtca gctgttcgac    304800
     cagcaaggga tacaaggcgc gatcccaggc gatcacgctg atgttcgagc ggtcgccttt    304860
     gtcgccggtg cgcgcgtgcg cgacgcgaaa caggggaaca agcacatcag acatcggcat    304920
     ccaccatttc gaatccggcg cgcaccaggt cgcgcggcag caggcatgaa accatgtcca    304980
     gccgcggcgt cagcgtggtg cgcacaccgc cgccgccggc cgggccgcaa cagtaaagcg    305040
     cggtcacttc gcgcgtcagg cgcatggcgt cctggcgcgt gacggcgtgc gccgccaggc    305100
     gcaagcgcac gtcctagcca tcgcccgccg gcgcgccggc cagcaggcgt ccggcgtcgt    305160
     cgccgaaaat gctcacgtgg ccgatcaggt cggtgcggat gcgcaggtcg gccagccgct    305220
     tgcacacgac ctcggcggcc aggcgcgcgc gcgcctcggc gcgcgggccc gcgtatgaaa    305280
     tctcgccctc ggccagccag ccgccttcca ggcacacgtt gaccttgtac gccgccggcc    305340
     gggggtggcc gcgcacgccg gtgagccgga cctggttgtc cgccacgcgc cggacctcgg    305400
     cctgcgaaat gtcggcaacc acgtcgggcg tcagatagcc ggcaggatca tggacctcgt    305460
     agagcaactg ctcgatgacg gtggcctcgt cgaccaggcc gcccgtgcca tcggatttgc    305520
     cgatgatgca atggccgtcc tcgtcgatct cggcgaccgg aaagccgacc tgctccagcc    305580
     cgggcacgtc cttgtagccg gggtcggcgt aatagccgcc gcaaacctgc gcgccgcatt    305640
     cgagcagatg cccggccatg gtggcgcgtc cgatgcggtc ccagtcgtcg gcttgccagc    305700
     cgaaatagga catcgcgggg cccaccgtca gcgacgggtc cgccacgcgg ccgcacacca    305760
     cgatttccgc gccatggtcc agcgcgtcgc gaatctgttc gcttcccaga taggcattgg    305820
     cgctgacgat gctggaggga tcgtattgct cgcccaggta ctcggccagc atgccggcat    305880
     gctgcgcgcc ggaaacatcg tcgcccttga ccaccgcgat gcgcggcttg cgcaagccca    305940
     gccgcgcggc catgcgcagg atatggcgcg ccgcgccttc cggattggcg gccccgaagt    306000
     tgctgacgat gcgtatgccg tgcgccaggc agcgcgccag caccggtccg agcatgtcct    306060
     cgagcagcgg ctcgtacccg gcctgggcat cggcgcgctt gcgcagctgc gcaagcgcca    306120
     gggtgcgttc ggccagggtc tcgaaaatca ggaaggctcg gccgttggcg ggaacgccgc    306180
     ccaggcgggc gatcagcgta tccaccaccg ggccggcggc gtcgacacgg tcgcccgaga    306240
     agcctgcggc gcagccgatc aacagggaag ggagtgaacg cattgcggaa tcacgaagtg    306300
     acaatggcag ccagtttaga atcggcagta cgataagaaa aatcgatttt ttggattgat    306360
     taatagatac ttcaaatcaa tgagaccaca ggccgatctg tccacccgcc aattgcgcgc    306420
     cttcgtcatg cttgccgacc tgcgccactt caccaaggcc gcgcaggcat gccatttgtc    306480
     ccagcccgcg ttcagcgcac tgatccagtc cctggaggcg acgctggcca tgcagctgtt    306540
     cgatcgcagt acgcggcggg tggtgctgac gcaggaaggc gagctgttcg agcccctggc    306600
     gcgccggctg ctggccgacc ttggccacgc catgacgcac atcgccagct tcgtcgagtt    306660
     gcggcgcggg cgcgtccatg tcgccgccct tccctccctg gcggcgggat ggctgccgaa    306720
     agtcctgcat gagttccacg ccgagcaccc cgacatcgaa ctcatgctct cggatgtcct    306780
     gtccgacgag tgcatcgaac tggtgcgcag cggccaggcc gatttcgcgc ttgcctcgcg    306840
     cggcatccgc gcctcggacc ccgcggtcct gcatgcgcgt gagctgtgca gcgacacgtt    306900
     ccacctgatc tgccgcaagg accatccgct ggcgcgcgag ccgcgcctta ccctcaagca    306960
     cctggcgccg tggcctttca tccatctcac gcgcaacagc agcgtgcgcc agacggtgga    307020
     agcggcgctg cgcccgcagg tcgcgaaaac gatactggaa gtcgcgcagc tcgcgaccgt    307080
     ggcgggcatg atcgaagccg ggctgggcat cagcgtcgtg ccgaccttca cgctgtacca    307140
     gttcgaacga cccggcctgc tcatccgccc catctcgctg ccgggcctga cgcgccagat    307200
     ctacatcgtc cgccggcagg aggaaaggct gtcgatcgcc gcgcaggcgc tgtacgacct    307260
     ggtggtcgcg aaactgggca cgcctgcggc cgccaagccg cggcgacgcc ggacggaaaa    307320
     aggccgctga tcgccgcgcg ccggtccgcg taggggcaga tgccgccccc ccggcaggcg    307380
     ggcgtcgatg gcatacggca agtgtgcctg tcccggcggg gacaggcacc cagccgcaga    307440
     tgtcagtccc catgccgctg gcgcatgacg gcgtgcctgt cccggcgggg acaggcaccc    307500
     tggccgcagg tgtcgctccc cctgcgggca caggcaccgc gtcgcacgcc caaaaaaagg    307560
     ttcatcgcgc attgccgggg aaggcggcac ggattttgag gaagaagtat tcctggtcgc    307620
     ggtagccgta agcgcgccgc ttgatgacct tgatagtgtt gttgatgccc tcgacaatgc    307680
     tggtgttcag gggatgtcgg catctggcca ggatgccgtg cagatagcct ttcaagcgct    307740
     gagcgaaggt gttcaaggcg gctattccgc tttgctcggc ctgctcgtac cagtggttcc    307800
     aggcttgtct tgcccaggca ggtctttggt agaaccagag ccgtttgagt tcgtcacgca    307860
     ggacatagac cgtcagcagc ggctggttgg cttgcagcaa ttcgtcgagc cggacggcct    307920
     gctgccgatc caggttgtca cggttgcgca gcagcagcca gcgactcgat ttgatgatcc    307980
     tgcgtgcggg acgatcctgg cgtagttgat tggcctgatc cacgcgcacc cgatcaatga    308040
     cctctcgtcc atacttggcc acgacatgga acaagtcata gacgatctcc gcctgtgggc    308100
     tgtgggcctg gatctccaac tcgtaggcgg tggtcatgtc gatggcaacg gccttgatgc    308160
     gttgggcggc cccaggcggc aattgttcga agaacgcccg ggccgtctcg cgtgagcgtc    308220
     ctgggccaat ccacagcacc tgcctgctga tcggatcgac caccactgtc gcgtagcgat    308280
     gccctttgtg cagggcaaac tcgtccatcg ccaaatactc gatcttggac caatccggtt    308340
     cgcgcaccga cgcacgcagc cgagccttgt ccagcgtctt gacggtatgc caacccagct    308400
     cgaagaacct cgccaccgcc tgcacgttgc tcgattgcag caattggctg caggcctgcg    308460
     ccagccgatc cgtcacccgt tgatatcgcc ccagccaggc aagccgctcc aggcgcgggc    308520
     cgccgcattg ctcacaccac aagcgtcggc gcggcacgtg cagaacgacc cgatactcga    308580
     ataacggcag atctcgcacc cgtcgaaccg tggtctcatg cacctggcga caccgcgcgc    308640
     cgcactgctc gcacagcatc accttggccg ttggcttcaa atagatcgac agcgtgcgcc    308700
     ctgggtcttc gggccattcc acgcgttcga cgccatagcc ctgccagcct cccagcgact    308760
     ccagcaactt gcgatccagc atctccctgc actcctgatg gcaaatacct gccgtcaaga    308820
     atacgaaaac ttgccaaacc cctccacgct attgcgcgat gaaccaaaaa atacggcgac    308880
     gttgtaactc ctggctccgc cgcgcgctgc cgtaacgccg cgccccgaga ggagcgcagg    308940
     ctggcaccga tcttgcgtac tcctctggta tgttcccgcg cccaggcgcg tccctgtcgg    309000
     aggaaaactt gagccacgtc ctgcaggatc tgcggctgcg ccagcaaacc acgctggcgc    309060
     cacgcctgca gcagtccatt catctgctgc aaatgtcggc gctggagttc accacgacgg    309120
     tgcagcaggc cctggcgacc aatccgttcc tggaggacgc cgacgagacc gaagcgcagg    309180
     acgacgcgcc ggcgccgccc gcggcgtccg agccgcccgc gacatccgag ccgccgcccg    309240
     agccgccctc ctatgccggc gactatccca cgcgcagcgc cgccgcccag cctggcgtgg    309300
     ccagcgacgc ggcggcctgg gtgccggcca ccctgagcct gcacgaacgc ctgtcgcagg    309360
     cgctgggcgc ctatgtgctg agcgaacgcg accgtgcgct ggccgagttc atcgtggatg    309420
     gactggatga cgacggctac ctgcggcagg aattggccca attggccggc gtcgccgatt    309480
     tcgacccgcc gcccgacgcc agcgaatggc aggcggcgct gcacctggtc cagcaactcg    309540
     atgcgccggg cctggccgcg cgcgacctgc ccgaatgcct ggccctgcag atccgcgcct    309600
     gtagccggct cgatccggcc gtgcgcgacg ccgccctggc catcgtcgcc gcccacctgc    309660
     cgcgcctggc gcgcagcgat taccccggca tgcggcgcgc gctgcgctgc agcgaaccgg    309720
     tgttgcgcca ggcgtgcggg gtgatccgcg gcctcgaccc caagcccggc cgccgctatg    309780
     cgcacgaacc gcccagctac gtcgtgccgg atgtggtggt cagcaaacag cgccagcaat    309840
     ggctggtggt gccgaatcgg ggcgccatgc cgcatgcccg gctgcaccag gcctatgccg    309900
     acctgttccg gcgcgcccgc atggacgagc gcagcccgat ggcgcaggag ctgcaggaag    309960
     cccgttggct ggtgcgcaat gtcgagcaac gctacgccac catccggcgc gtggccgagg    310020
     ccatcgtgca gcgccagcag atgttcttcg agttcggcca gatcgcgctg cggccgctga    310080
     tgctgcgcga ggtggccgac gagctggaga tgcacgagtc cacggtctcg cgcgccaccg    310140
     ccaacaagta catgtcgacg ccgcgcgggg tgttcgagtt ccgccatttt ttctcgcgcg    310200
     aactgagcac cgaatcgggc ggcacgtgtt cggccgcggc cgtgcgcgcg ctgatccgcg    310260
     aatacatcga cgcggaagac ccgcgcatgc ccttgtcgga tgtgaccctg gccaaacggc    310320
     tggccggcga cggcatcgtg gtggcgcgcc gcacggtgtc caagtaccgg ctgcagctgc    310380
     gcctgcccgc cgccgacacg cgccgccagt actactgacg cgcgccggcg cggaccggtc    310440
     ccgccgctac ttcgatccgc ccgtgttggg gtatcccggc ggcggcgaag cgccctgcgc    310500
     cggcgtggcc ggcgggttgt cgttgatgtc gggctggcgc cgcggcatgt cgccgcgcgt    310560
     gtcgttgccg cgatgctcgt tcatgtgctg ctgcggcgtc ttgggcatcc cgtcgtgggt    310620
     ggtggtgccg ggcgcgggcg gcacctggcc cggcggcacc ggccggttcg gcggcacggc    310680
     cgtcgaatcg ttgggcgtgg tcgaaggcgt ggtcggcgcg gtgccgcttt gcgccagggc    310740
     gccgccatgc gccagcagcg cggccatggc gccggcaacc aggtaaatca ggcttcgttg    310800
     cttcatatcg atgtcctcca ggtaaggccc ctccatttcg caagcggcgt gcctgtcggc    310860
     cacgcggccc gtcgcctgcg ttgcagcgca tcactgctgg cggcggcaaa tattgcgcgc    310920
     cgaccgacga ggcggaatta ccggcgcatg caacaacggc gcagcgccgg cagcgcgcgc    310980
     cccgccgata cgcgggctcg caacggccgc cgacgaccgg atacggctgg cgaacaaccc    311040
     gggcacggcg cttgcggaac cagcgcatcg gcccgatcac gtccctgttt gcggcgcggg    311100
     catcctctca gggagcttgc atgacgacca tacgtacctt ggtggtggcc gcggaggcgt    311160
     ttccgctggc caagacgggc ggcctgggcg acgccgtgtc gggcatggtg caggcgctgg    311220
     gccaccggcc gggcggtgtg gacgtgcagt gcgagttgct gatgcctgcc tatcgcggca    311280
     cgctggatat ggtgtatcgg ccgcgcacgg tcgcgcggct gggcggactg cccggcggcc    311340
     cggccagcct ggtgcgcggc cattgcccgg gctcgggatt gtcggtgctg ctgctgcgca    311400
     acgacgcgct gtacgaccgg cccggcattt acgtggacga cagcggccag ggctacccgg    311460
     acaatgcccg ccgctatgcg gccctggccc acgcggccgc ccggctggcg cagggcctgc    311520
     ccgggctgcg gccgccgcac gtggtgcacg cgcacgactg gcatgccgcg ctcgcgccgc    311580
     tgctcatcca cgcggccgga ctgcactacg tcaagacgct gctcaccatt cacaacctgg    311640
     cgttccaggg tacgtttccg gccgagctgg ctagcgcgct gggcatcccg ctggcgtgcc    311700
     ggcacgacga cggcgcgctg tccgatgaca gcgtgaattt cctcaaggcc ggcatccgtt    311760
     atgcgacccg cgtcaccacc gtcagccgcg cctatgcgcg cgagattctc acgccggcgt    311820
     tcggctgcgg attgcacggt ttgctgcgcg cgcgcggcgc cgacctgagc ccggtgccca    311880
     atggcatcga caccgcgctg tggaatccgg ccgccgaccc gcatctgggc ggcctgcgct    311940
     tcgacgcgct ggatatgcgc aacaaggcct gttgcaaggc cgcgctgcag gccgagctgg    312000
     gcctgcagcc gcgcgcggac gcgaccgtgc tggccatggg cagccgcctg accggccaga    312060
     agatggccga cgtggccatc gccgccctgc ccgccctgct ggaggcgcac gaacacttgc    312120
     agttcgcgct gatcggccgc ggcgagccgg ccctggagac ggcactgcgc gccctggcgg    312180
     cgcgctaccc gggccgttgc gcggtccaca tcggctacga cgagccgctc gcccaccgtt    312240
     tgcacgcggg tgccgacctg ctgctgcacg gcagccgctt cgagcctttc ggcctgaccc    312300
     cgttgtacgc catgcgctac ggcaccctgc cggtggcctc gcgggtgggc ggcatggtcg    312360
     ataccatccg cgatcccggc ccggcggtcg aggaatcctg cgccggccag ggtacgggct    312420
     tcctgttcga tggcagcgag cccgccgata tgcagctggc cgtggcgcgc gcgctgcgcg    312480
     cgctggccaa gccggcggtg tgcgacgcca tgcgccgcaa cgccatgcag gccgatttca    312540
     gctggcgcgc ttcggcgcag gcctatgcgg gcctgtacgc cagcctggcc agcgcgccgc    312600
     agcgcggccg ggtgcccgcg cccacgctgc cgctgctggc caacgcggcc tgaggcacgg    312660
     cgccatggtt cgccgcgccg ccgcccgact cgatcgcgac gcccacctgc tggcctttca    312720
     cgccgccgcg atcgccctgg cgcgcgatac gcccgccggt tcgttcgcgg cgtggcagac    312780
     cttgtgcgta cggctgcgcc gctgcggttt caacgcggtg tgcctgacgc cgccatggca    312840
     gtgccccgat gacatccagg gcgcgccggc cgacgtggac catgccgacg cgcgctgggg    312900
     cggcggcgcc atggacgcca ccctggcgcg cctggcgcgc gaggccgccg cgcaaggcct    312960
     gacactgctg ctggacctgg agcccgaccg ggtggcgcgc gacgccgcgc cgcgcaccgc    313020
     gcaggcgcaa tggctggaga gcccggccga cgagccggcc ggcgacccgc gccagcccgc    313080
     tgcgcggcac ggcgtgcgct atgtgcgcgg ccgcccggcg ccggccgcct tcctgcaggc    313140
     ctggcagtcc cgcctggccg gatggctgga cgccggcgtg gccggctttc gctgcaccgc    313200
     gccgcagcgt ctcgatcctt ccgactggcg cgccctgttc gaacccttgc gggccagccg    313260
     gccggcgctg cggctgctgg cctggaccgc gggcctgacg ccggcgcaat cggccgccct    313320
     ggccggcgtg gggttcgacg gcgtattcgg ctcgatcccc tggtggtcgc ccgacgccac    313380
     gtggctggac gccgaatcgc agcgcctgcg cgagatagcg ccgctgctcg ccgccccgct    313440
     cgccccggcc ggcggcgcgc cgctggcgcc cgccagcgcg gccgcgcacg ccgcgctgcg    313500
     cgccctctgg gtggccgcgc tgtggggcga cgggctgctg gtgggcagcg aactgcagcg    313560
     catgatgccc gccgtggcgc gcgcgctgcg ctggcgccgc caggccgcgc cgcgcggccg    313620
     gccggtcttg ctgtgcgggc gcgacggctg ggccacgctg atcatccgcc cgggcccgcc    313680
     cggcacgagc catgtgctgg cgctggatcc gcaggccgcg catgagccgc gggtcgactg    313740
     gagcgccggc gccgcgttgc tgccggccgg cgtgcctagg cacctggccg acccggtcga    313800
     acactgcgcg ctgtaccgcg ttgccgccga gcgtccggtg cgcgccacgg cgggcgcgct    313860
     gttgcccggc ccgccctcgg cgtgcgaccg cgacgcccgc gtcgtcttcg agcacgtcgc    313920
     gccttcggtg gcgcacggca gcctggccgc caaggccctg gcccatgtgc cggtcgaagt    313980
     cggcgtcgac ctgatctcgg acggacacga acagctggcc ggcgagctgc aatggcgggc    314040
     cgtcgaccag gccggctggc acggcgtgcc gctggcgccg ggcgacaacg accgctggca    314100
     cgcgcgcttc gcgccgcgcc ggatcggcct gcatgagttc cgcgtgtgcg cctggcgcga    314160
     cacctggctg actttctgcc gcgagctgcg cctcaagcac gaggccgacc aggacatcgc    314220
     gctggacctc gccgagggcg ccgcgcacct gcggacagcc ctggcgcggc gccaggcgcg    314280
     cggcgacgcg cgccgcgcgc ccatcgaagc ggccctgtcc atgctgaatg gcgggccggc    314340
     gccggccgac gccgtggccg ccctgctgcg cgacggactg gcccaggcca tgcgcgcgct    314400
     ggccgcgcgg cccttcatgc acaccagcgc aagccgaccg ctctgggtcg accgcgcggc    314460
     cgccggccac ggcagctggt acgaactgtt cccgcggtcg caggccgtgc ccgccggcgc    314520
     gcacggcacc ttcgacgacg tgatcgcgcg cctgcccgcg ctgcgcgcca tgggtttcga    314580
     cgtcctgtac ctgccgccca ttcaccccat cggccagtcg cagcgcaagg gccgcaacaa    314640
     cgcgctgcag gccgccgccg acgaccccgg cagcccctac gcgattggtt cgcccgacgg    314700
     cggccacgac gccatccacc cgcagctggg cacccgggcc gacttcgcgc ggctggtgca    314760
     agccgccgcg gcgcatggca tggaagtcgc gctggacttc gcgatccagt gttcgccgga    314820
     ccatccctgg ctgcaacgcc accccgactg gttcgagcac cgcgccgatg gctcgatccg    314880
     gcacgccgag aacccgccca agcgctatga agacatcgtc aatgtcagct tctacgacca    314940
     ggccagcggc cgcccgcgcc gggcgctgtg gcgcgcgctg cgcgatgtgc tgctgtactg    315000
     aatcgacgcc ggcgtgcgca ttttccgcgt cgacaatccg cataccaagc cgctgccgtt    315060
     ctggcagtgg ctgatcgccg acgtccacgc ccgccacccc gacgtggtgt ttctttccga    315120
     agccttcacg cgcccgcgca tgatgtaccg cctggccaag ctgggcttca cccagtcgta    315180
     tacctatttc acctggcgca atacccgcca tgagctggac agctatctgc gcgaactgtc    315240
     gcgcccgccg gtctgcgagt ggttccggcc caacttcttc gtcaacacgc ccgacatcaa    315300
     tccgtatttc ctgcaggcct cgggccgggc cggctttctc atccgcgccg cgctggccac    315360
     cgccggcagc ggactgtggg gcatgtacag cggcttcgaa ctgtgcgagg cccagccggt    315420
     gcccggcaag gaggaatacc tggactccga gaagtaccag ttgcgccagc gcgactggca    315480
     tgcccccggc aacgtgaccg ccgagatcgc ggcgctcaat cgcatccgcc gcgccaaccc    315540
     ggcgctgcac agccacctgg gctacgtgcc gctgcagtgc gccaacgagc aggtgctgac    315600
     gttctgcaag gccactccga accgggccag cgtggtgctg gcggcagtca gcctggaccc    315660
     ctgggcgccg caatcggtcc gggtggccct gccgcgctgg ctgttcggcc tggacgacag    315720
     cgccgacctg cacggcgagg acctgctcga cggcgcgcgc gcaagctggc gcgaggtcgc    315780
     gctggacctg gaattgacgc cgcaacgtcc ataccggctg tggcgcctgt ggtcccgacc    315840
     cctgtcatcc tgagcgtacc gatcatgcct gccacccatc ccgctcccga cccgctctgg    315900
     tacaaggacg ccgtcatcta ccagttgcac gtcaagtcct tcttcgacgc caacgacgac    315960
     ggcgtgggcg acttcgccgg cctgctggcc aagctggact acatcgtcga gctgggcgtc    316020
     aattccatct ggctgctgcc gttctatccg tcgccgcgcc gcgacgacgg ctacgacatc    316080
     gccgactatc gcggggtgca ccccgactat ggctcgctgg ccgacgcccg gcggctggtg    316140
     cgggcggccc acgcgcgcgg cctgcgcgtc atcaccgagc tggtcatcaa ccacacctcc    316200
     gaccagcacc cttggttcca gcgcgcccgc gccgcgcggc cgggttcggc gcaccgcgcc    316260
     tattacgtct ggtcggacga cgacaaggcc tatgccggca cgcgcatcat cttctgcgac    316320
     acggaaaagt ccaactggac ctgggacccg gtggccggcg cctatttctg gcaccgcttc    316380
     tattcgcacc agcccgacct gaactacgac aatccgcagg tgctgcgcga agtgctgggc    316440
     gcgatgcgct actggctgga catgggcgtg gacggcctgc gcctggacgc ggtgccctac    316500
     ctggtcgagc gggaaggcac caacaacgag aacctgccgg aaacccacgc catcctgcgg    316560
     cgcatccgcc gcgtcatcga cagcgagtat cccggcagga tgctgctggc cgaggccaac    316620
     cagtggcccg aggacgcgca agagtacttc ggcgccggcg acgaatgcca catggcgttc    316680
     cactttcccc tgatgccgcg catgtacatg gccatcgcgc aggaggaccg cctgcccgtc    316740
     accgacatca tccgccagac gccgtccatc gcgccgcaat gccaatgggc cattttcctg    316800
     cgcaaccacg acgagctgac cctggagatg gtgaccagcc gcgaacgcga ctacctgtgg    316860
     aacgtctacg cggccgagcc gcgcgcgcgc atcaacctgg gcatccggcg ccgcctggcg    316920
     ccgctgctcg agcgcgaccg gcgccgcatc gaactgatga acagcctgct gctgtccatg    316980
     ccgggcacgc ccgtgctgta ctacggcgac gagctgggca tgggcgacaa catccacctg    317040
     ggcgaccgcg acggcgtgcg cacgcccatg caatggtcgc ccgaccgcaa cggcggcttc    317100
     tcgcgcgccg accccgagcg cctgccgctg ccgctgctga tggggccgct gtacggctac    317160
     gaggcggtca acgtggaggc gcagcagcgc gacccgcatt cgctgctgaa ctggacccgc    317220
     cgcatgctgg ccaagcgccg ccagagccat gtgttcggcc gtggcgaact gtcgttcctg    317280
     tatccgggca accgcaagat cctggcctat ctgcgcacct gggaagacac ggtggtgctg    317340
     tgcgtggcca acctttcgca ggcggcccag ccggtcgaac tgcacctgtc cgagtacgcc    317400
     ggccgcgtac cggtggaaat gctgggcggc accgcctttc cgcagatcgg cgagctgccc    317460
     tatctgctga cgctgccgcc tttcggcttc tactggctgg acctgagcgc cggcgccgcg    317520
     ccgcccgcgt ggcacagcga gctgccgccg caaatgccgg aatcgatcac cctggtgtcg    317580
     cgcggcgcgg gcgcggcgct gcgcctgacc gaggcatcgc gccgccagct ggaagcggac    317640
     gtgctgccgg cctacctgca gcggcagcgc tggtaggccg cgcgccgcaa acccggcgtc    317700
     atgcggctgg cctacagcgt gccgctgaac gacgacgtgg aaagctatta cgaagccgag    317760
     atcgaagtca gcgacgacgg accgccgcgc cgcttccata cgccggtggc gctggcctgg    317820
     caggacgata ccgccgccca gtatccgctg gcgcgcgtgc ggcgcggcgc gcagctgggc    317880
     acgctcaccg acgcctcgct gcagcccggc tatgcgcgcg tgctgctggc ggccctgacg    317940
     gccggccgcg atatccaggc cggcggcgag cccgccgtgc ggctgcgctt cctgcccgag    318000
     ccgggcctgg ccgacctggc gctgcgcgat gacagcaagg tgcgcgcgct cagcgccgac    318060
     cagtccaaca gttcgctgct ggtcggcgag cgcgtcgtgt tcaagctgct gcgcgagctg    318120
     catgccggcc cgcaccccga agccgagatg acgcgctacc tcacccaggc cggctacgcg    318180
     catacgccgg cgctgctggg cgaggtcgtg cgcgtgcagg gcgaccaggc gccccatacg    318240
     ctggcgctgg cccacgccta cgtcgtcaac gaaggcgatg cgtggaactg gaccgtggcc    318300
     tacctgaagc gcacggtcga cgccgccatg ctgaccggcg ccagcgccga cgactaccag    318360
     caggaactgg ccggctacga agtgctggcc ggcaccatcg ggcaacgcct ggctcagatg    318420
     cactcggtgc tggcgcgtgc cggcgaactg ccgggcttcg cgccgcggcc ggccagcgag    318480
     cgcgacgccg ccctggcggg cgagcacgcg gtggcgcagc tagaccgcgc gctgcaggcc    318540
     ttgcgggcgt gcgagagcgg gctcgcccct gcatcgcacg cctgcgcgca atggctgttc    318600
     gagcatcgcg accggctggc ggcccacatc atgacactgg cgcaggccga aaccggcgcg    318660
     ctgcgcatcc gcgtgcacgg cgacttccat ctcggccaga tcctggtcgc gcagaccgac    318720
     gcctacctga tcgatttcga gggcgagccg gcccggccca tggccgagcg ccggcaactg    318780
     agcagcccgt tcaaggacgt tgccggcatc ctgcgctcgt tcgactatgc ggtggccgaa    318840
     ctcagccgcg acgatccgct gggcggcgcg ccgcgcgact tcaacaccgg cgtggccgag    318900
     ccggccgacc cggccagcgc gccccgggaa acgcgcgagg cgctgctggc gcgcttccgg    318960
     cagcgcgccg gcgcggccct gctggccagc tatggtaatg ccatcgaccc cgtgctggcc    319020
     ttgccgcccg agcgtgccca ggcgcttacc tgcctgtacc tgctggagaa ggccgcctac    319080
     gaaatctgct acgagtcggc ctaccggccc gagcgcctgc cggtgcccat ccatggcctg    319140
     gccgaaaccg cccgcgccgc gctgctggcg gccgccgtcg accacgatga aggaccggcg    319200
     ccatgatgcg agattcgcct tccatccagg gcacgctgga cgcggccacc cagcacgcgc    319260
     tgctggccgg ccgccatgcc gatccgtttt ccgtgctggg gccgcaccag gccggcgcgc    319320
     ataccgtggt gcgcgtgctg gcgcccggcg cgcgcaccgt gatggccgtg ctgcccggcg    319380
     gccagcgcac acccttgctg cccatgcagc ccggcctgtt cgaaaacacc gtgccgggcc    319440
     tgcagccggg cgcgccggca gcctaccgac tgtgcatcga atgggaggga ggcatccagc    319500
     acaccgccga cccctacgca ttcgggccgg tgctcgacac cgcccagctc gaccattgcg    319560
     cggccggcgg ctggcgctac ctggccggcc tgctgggcgc gcacgccgcc agcgtggacg    319620
     gctgcgcggg cacccgcttc gcgctatggg cgcccaatgc tcggcgcgtg gcggtggtgg    319680
     gcgatttcaa cggctgggat ggccggcgcc acgccatgcg cctgcgctat ccggcgggcg    319740
     tctgggagct gttcctgccc gacgtggggc cgggcgcgcg ctacaaattc caggtgctgg    319800
     gcgccgacgg ccataccgtg ctcaaggccg acccgctggc gcgccaggcc gaggcgccgc    319860
     ctgccaccgc gtccatcgtc cccgacgaac gccccttcgc gtggaccgac gaggcctgga    319920
     tggaacaacg cgcggcgcgc cagcgttgcg acgcgccgat ctccatctac gaagtgcatg    319980
     ccggctcctg gttcgacgac gccggcgcgc cgcgctggca aagcctggcc gcccgcctgc    320040
     ccgaatacgc gcgctcgctg ggcttcaccc atatcgagct gctgcccgtg atggcgcatc    320100
     ccttcggcgg ttcgtggggc taccagccgc tcggactgtt cgcgccggcg gccgcgcacg    320160
     gcgcgccggc cgacttcgcg catttcgtcg accgttgcca cgaggccggg ctgggcgtca    320220
     tcctggactg ggttccggcc cacttccccg acgacgcgca cgggctggcg cgcctggacg    320280
     gcacgccgct ctacgagcac gccgacccgc acgaaggccg ccatcccgac tggaacacgc    320340
     tgatctacaa ctacggccgc cgcgaggtgc gggcctttct catcgccagc gccatccact    320400
     ggctgcgcca ttaccatgta gacgggctgc gcgtggacgc ggtcgcgtcc atgctgtatc    320460
     gcgactacag ccgcccggcc ggccagtgga tccccaaccg ccacggcggg cgcgagaatc    320520
     tcgaagccat cgacttcctg cgcgaactca acgccgccgt gggcgtccag tgccccggcg    320580
     ccatcaccgt ggccgaggag tccaccgcct ggcccggcgt gaccgcgcca gtggccaacg    320640
     gcggtctggg cttcgactac aagtggaaca tgggctggat gcacgacacg ctgcgctaca    320700
     tgcggcgcga tccgatccat cgccgccatc accaccacga tctcagcttc ggcatggtct    320760
     atgcctatgc cgaacgcttc gtgctgccgc tctcgcatga cgaagtggtg cacggcaagg    320820
     gctcgctgct gggcaagatg ccgggcgagc gggccgccca gctggcccag ttgcggctgt    320880
     actacgcctt catgtgggcc catcccggca agaagctgct gttcatgggc ggcgagttcg    320940
     gccagcaagg cgagtggaac cacgacgcca tgctgcagtg gtcgttgctg gacgatccgg    321000
     cccatcgcgg gctgcagcgc ctggtcgcgg atctcaacca cgtctacgcc accctgcccg    321060
     aactgcattg ccgcgacgcc gacccgagcg gcttcgcctg gatcgtcggc gacgacgcgg    321120
     acaacagcgt gctcgccttc gcccgcgtgg acgccagcca ttgcctggtg gccgtgtgca    321180
     acttcacgcc ggtgccgcga ccgggctatc gcttcggcgt accccacgcg ggcgactggc    321240
     gcgtacgcgt ggacaccggg gcgacgcgct acggcggcgc cggcggcggt ccgcccatct    321300
     gcctgcgcag cgaacccatc ccggcccatg ggcacccgca atcgctggtc ctggacctgc    321360
     ccggcttcac cgcgctgtac ctgcgccact cggagtaaag ccatgtatcc gtcgctgccc    321420
     gaccgactgc tgcccggcct gcccgccccg ctgggcgcca ccagcgacgg cctgggcgtg    321480
     aatttcgccg tgttctcggc caacgccgcg cgcatcgagc tttgcctgtt cgacgcgcgc    321540
     ggccgcaagg agctggcgcg cctgcccatg cccgaatgca ccgacgaggt gtggcacggc    321600
     tacctgcccg acgcgcagcc gggcctggtc tacggctatc gcgcccacgg accgtacaac    321660
     ccgcgcgccg gccatcgctt caatccgcac aagctgctgc tcgacccgta cgccaccgcc    321720
     ctgaccggcg cgctgcgctg gtcggacgcg ctgttcggct accgcatgca gcacccgcgc    321780
     gccgacctca gcatggaccg gcgcgacagc gccgccggcg tgcccaaagc cgtggtgacc    321840
     gagccggcgt tccactgggg cgcaacgcgg cgccccgccg cggcgtgggc gcacacggtc    321900
     atctacgaag cgcacgtgcg cggcgtgtcc atgctgcgca gcgacctgcg cgaacccatc    321960
     cgcggcacct gcgccgccct ggccgacccc cgcttcatcg accatctcca ccggctgggc    322020
     gtcaccgcgc tggaactgat gccggtgcat gccttcctgc aggaccgcac cctggtcgaa    322080
     cgcgggctgc gcaactactg gggctacaac accctggcgt acttcgcgcc cgagccggcc    322140
     tatctggccg acggccagcc ccacgacctg cggcgcgcca tccgccgcct gcacgcggcc    322200
     ggcatcgaag tcatcctgga cgtggtctac aaccacacct gcgaaggcaa cgaactcggt    322260
     cccacgctat cgtggcgcgg gctcgacaac gccagctatt accggctggt gcccggcgac    322320
     gagcgccgct acatcgacga cacgggcacc ggcaacaccc tcaacctgtc gcatccgcgc    322380
     gtgctgcaga tggtcatgga ctcgctgcgc tattgggccg tccactaccg cgtcgacggc    322440
     tttcgcttcg acctgggcgt gaccctgggc cgcgagggta ccggcttcga tgccggcagc    322500
     ggctttttcg acgccttgct gcaggatccg gtgctggcgc gcgtcaagct gatttccgaa    322560
     ccctgggacg tcggccccga cggctaccag ctgggccgcc acccgcccgg catggccgag    322620
     tggaacgacc agttccgcga caccgcgcgg cgcttctggc gcggcgaccc gggcatggcc    322680
     ggcgcgctgg cgacgcgcct gaccgcctcg cgcgacgtgt tcgaccaccg ccaccggcgg    322740
     ccctggagca gcatcaattt cgccgccgcc catgacggct tcacgctgca ggacgtggtc    322800
     agcttcgccg agcgccacaa cgaggccaac ggcgaggacg gcgccgacgg ccacggcgag    322860
     aactacagca gcaactgggg cgtcgaggga gccgccagca gcgcgagtcg atggccgcgc    322920
     cccacggcgt gtcggcgcgc gcgtcaaaga agtcggcggc gtagcgatgg aggtaattgc    322980
     cgtcgggccc gaagtggttg tagaccacgt ccagcatgac gcccatctgc aggccgtgcg    323040
     ccgcgtcgat gagggccttc agttcatcgg gcgtgccgta ggcggtgtcc ggcgcgtacg    323100
     gcagcacgcc gtcgtagccc cagttgcgcg ggccgggaaa atccgcgatg ggcatgagtt    323160
     cgagcagcgt gacgcccagg cgcgccacct cgggcaggcg gcggcgcagg ccggcgtagc    323220
     cgccgcacag gccggcatgc gcttcgtaga tgacgctgtc ctgccaggga cggccgcgcc    323280
     acccggtgtg gcgccacgga tagcggtcgg gtccgaccac cacgctgtgg ccgtgcacgt    323340
     cgccgtcctg cagccgcgag gcggggtccg gtacggcgca atccacggcg agccgatagc    323400
     gatagcgcag gccgggcgcg ccgtccacga tggcctgggc gtagccgtcg gggccgggcc    323460
     gcagggcgat gggcgcgcgg ccttcgatct ccagggcgag cgcgggcggc gcgctggggg    323520
     cccagagccg gaagcggatc ttgccgggcg cgcagaccgt tgcgcccatg gcggccggcc    323580
     ggttcatggc gtgtgcgcgc cgtcgaccga cgccgtcaac agcagcacgg cgcgcgcgcc    323640
     cacgatcgct tcgggcccgc cgcaaggcgc ggccggcgcc tcgggcgagg cgctgtcgag    323700
     cgccagggtc caggccagcg tcggcgccgg caggacgcag ggccgcggct cggccgcggc    323760
     gttgcacagc agcagggtga cgtcgacgcg gccaggctgg gccgggtccg gcagggcgcg    323820
     gcgcaggacc agcagacggc cttcgggcgc gtcccagtcc gcggacgtca tgggcgcgcc    323880
     gcgcgcattg aaccagtcga tggcgcccag gccttcctgc cattggtgcg cggggtcgcc    323940
     gtagcgcgtc gcgcgcaggc tcgggtgggc gcggcgcagc gctgccagcc gcacggcgta    324000
     ggcggtcagg gcgcggcccg gcgtgctctg ggcgacggcc cagtccagcc agcccatcgg    324060
     gccgtcctgg cagtaggcgt tgttgttgcc gccctggctg ttgccgaact cgtcgccggc    324120
     cagcagcatg ggcgtgccgt cggccagcat gacggtggcc agcagggcgc gctgcacccg    324180
     ggcgcgggtt tcgcgcacgg ccgcggcagc aggccgtgca gcgctacttc atcgacaacg    324240
     cgctgtactg gctgcgggaa tatcgtttcg acggcctgcg gctcgacgcc gtgcacgcca    324300
     tgggccgcac cgactggctg gctgggctgg cccgcgaggc gcgcgcggcc tgtccggacc    324360
     gccgcgtcca cctcgtggtg gaaaacgacg ccaaccaggc cagcctgctg gaacaggggt    324420
     tcgatgccca atggaacgac gacgcccacc atgtcctgca ccatctgctg accggtgagc    324480
     ggcagggcta ttacgccgac tacgcgcagg cgcccgccgc gctgctggcg cgcgcgctcg    324540
     gcgaaggcta cgtgtaccag ggccaggccg cgcccacgcg cggcgggcgc gcgcgcggcg    324600
     agcccagcgc gcacctgccg ccgtgggcct tcgtgctgtt cctgcacaat catgaccagg    324660
     tcggcaaccg cgccgacggc ctgcggctga cctcgctgct cgctcccggc tcgccggccc    324720
     tgcgcgcggc catcgcgttg cagttgctgg cgccgcacat tcccctgctc ttcatgggcg    324780
     aagagtacgg ctcgaccgcg cccttcttct acttcaccag ccacggtccc gagctggccg    324840
     ccgcggtgcg cgcgggccgg gcgcgcgagt tcgcggcgtc gatgcatgat tgcgatcccc    324900
     cgcccgatcc gaacgatccg gacacttacc gccgctcgtg cccctggccg ccgcccggcg    324960
     ccgaacgcca ggcctggttc gagtactacc gcgaactgct gcgcctgcgc gcgcgcctgc    325020
     tgggcgggcg cctgactggc gcgcgcgcag acggcgccgc ggcgttgggc ccggcggcgg    325080
     tgcgcgccgc gtggcggctg ggcgatggcg cccggctcac gctgtacgcc aacctgctgc    325140
     ccggcagcgt catcgtgccc gcgccgccgg cgggccagct ggcctatgcc agactggccg    325200
     gcgcgggcca ggacctggcc gccggcgtgc tgcgcggcgg ctgcgcgctg gcgctgtggg    325260
     agcccgcgcc atgagcgaga accaggccct cgcccggctg tgcgcgctgg cgggcgtctc    325320
     gccgcgctgg accgatgtat ggggccgcac gcgtgccgtc gccccgccgg tcttgcgcgc    325380
     ggtactggcc gcgctcgacc tgcccgcggc tacgccggcc caggccgccg acaccctggc    325440
     gcgctggcgc gcccggcgtc cggccatgct gaccgcgcgc gccggcggga tgctgcgcgt    325500
     gcccggcgac gcggccgcgc cctacgccat cgaactggac aacggccagg tggcgcacgg    325560
     cctggccgag cccgatggcg ccggcggcct ggcgctgcgc gcacccaggc aacccggcta    325620
     ccacacgttg cggctgggca gcgcgtccat cgccttggcg gtcgcgccgc cgcgcgcgcc    325680
     cacgctggcg cgcctgctcg ccagtccacg gccgcgccgc tggggcgtgg ccgcgcagat    325740
     ctacagcttg cgcggcacgg ccgaccccga tggcggccat ggcgatttcg gcgcgctggc    325800
     cgaactggcg gtcgccgcgg cgggccacgg cgccgacgcg gtggcgctca gccccgcaca    325860
     cgcgctgttt gccgccgctc cgcggcgctg cagcccgtac tcgccctcca cgcggctgtt    325920
     cctcaacatc ctgtacgcgg acccgctcga caccttcagc gacgccgaat gcgccgccgc    325980
     gcgccggccc tcgtccggcg ccgacgcccc cctgatcgac tggccgcagg ccgcgggcgc    326040
     gcggctggcc atgttgcggc gcctgcaccg cggcctggcc gccgacgacc cgcgcgccgc    326100
     cgaactggcg cgctttcgcg ccgaaggcgg ccaggcgctg cgcgaccacg ccctgttcga    326160
     ggccttgcac gcggccaatg gcgccaccga ctggcgcggc tggccggcgg cgtggcgccg    326220
     ccccgccgcg gcgctggccg ccggctgcgc gcgcgaacat gcgcgcgaga tggatttcca    326280
     cgtctttgcc cagtggctgg cgcggcgcag cctggcgcac gcccaggccg ccgcgcgcgc    326340
     ggcgggcatg ggcgtggggc tgatcgcgga cctcgccgtc ggggtggacc cggccggcag    326400
     ccagacctgg gcccagcccg acgccatgct cggcgggctg aacgtgggcg cggcgcccga    326460
     cctgcgccac cccggcgggc aggactggcg cctgaccgcc tgctcgcccg ccacgctcgc    326520
     cacgcaaggc tacgcggcct acatcgacat gctgcgtcgc gcgctggcca gcgccggcgg    326580
     cgtgcgcatc gaccacgtac tcggcctggc gcgcctttgg gtcatccccg agggcgcgcc    326640
     gcccgaccag ggcgcgtacc tggcctttcc ggtcgaagac ctgctgcgcc tggcggccct    326700
     ggaagcgtgg cgccaccgcg ccgtgctcat cggcgagaac ctcggcacgg tgccgcggga    326760
     cttcaacgcg cgcctgcgcg cgcacggcgt gctcgggatg gacgtactgt ggctgcagcg    326820
     cgagaccggg ccaggcggcg cgggacgctt tcgcccgccg ggccgctggc ccgccagcgc    326880
     cgtcgccatg accagcacgc acgacttgcc taccctgcga ggctggtggc aggcgcgcga    326940
     tctggactgg tgcgtgcctg cgcacgaggc cgacgcgcag cgccggcagc gcgaccagga    327000
     ccggcgcgcc ctgtggcgcc aggcggcccc gcccggcctg gccgctacgg cgccgcccgc    327060
     cgagccgccc tgcgccgccc tgctgtccca tgtggcgcgc agccgtgcgc cgctgatgct    327120
     ggtgccgctc gaggatctgg cggggctggc cgaacagccc aacgtgccgg gctgcccgga    327180
     ccatcccaat tggcgccggc gcatgcccgc aaccgccgcg gcgatgctgg tgcagccggc    327240
     cgcgcgcctg gcgctggcgg cgatcgccgc gcaccgggga cggccatgat ccgcgccacc    327300
     gtccgcctgc agttgcatgc cggcttcacg ctcgacgccg ccggcgccca gctggactac    327360
     tacgacgcgc tgggcatcag ccatctgtac ctgtcgccgg tcgcccgcgc gcggcgcggc    327420
     tccacccatg gctacgacgt gatcgaccac gcccaggtca accccgaact gggcgggctg    327480
     gcggcgctgc ggcgcctggc cggcgcggcg cgtgcgcgcg gcatgggcct gatcctcgac    327540
     atcgtgccca accacatggc cgcccatccg gacaatcgct ggtggcgcga ggtgctgcgc    327600
     gacggtccgg ccagcgccta tgccgactgg ttcgacatcg actggcgccc ccccggccgg    327660
     accttgcgcg gccgggtgct gctgcccgtg ctcacctgcg gcgcgcgcgc cgcgctggcc    327720
     agcggcgaga tcgggctgcg cgccggctcc gacggcacgc cggcgctgca tgccaacggg    327780
     ctggacctgc cgttggcgcc ggcgagcctg cccatggccg cgctgctgct gcaccatggc    327840
     ggaacgcccg cccaatggca tgccttgctg cgggcgcagg cctaccgcct ggcatggtgg    327900
     cgcagcgcgg cgcaggccat caactggcgg cgcttcttcg agatcggcga tctggtgggc    327960
     gtgcgggtcg aacggcccga ggtattcgac gccgtgcatg cactgccctt ggcactgtac    328020
     cgcgcgggcc tgatcgatgg gctgcgcatc gatcatgtcg atggcctggc cgagcccggc    328080
     gcctattgcc gccgcctgcg cgccgagctc gcgcaggccg gccaggcgcg cgccgcgcgc    328140
     ggcctgagcg ccgaacccta tgtggtggtg gagaagatcc tcggcgacaa ggagacgctg    328200
     cgcgccgact ggccggtcca gggcaccacc ggctacgact tcatgaacga agcctcggcc    328260
     tggctgcacg acgcgcgcgg cgccacgccg ctggccgcgt tctggcgcga caatgccggc    328320
     acctggccac actggcgcga acaattgcgg cggatacgtc tatggttgtt gcggcgccac    328380
     ttcggcgccg agcggcgcgc gctggcgcgc agcctggccg acttgcccga actgcgcgcc    328440
     tcggcggccg ccatcgaccc tgtgctcacg caatggctgg cctgctttcc cgtctaccgc    328500
     acctatgccg aaggcggcgc cggccaggcc gccgaccagg cctggcgcca gacggcgcag    328560
     acccgcgcca acgcccacct cgaccctgcc cagcaggcgc tgctggccgc gctctgcctg    328620
     gctctcgacg gacgcatggc ggacgcgccg caccgtctgg cgctgcggcg cctgcagcaa    328680
     ctcaccccgc ccctggcggc caaggccctc gaagatacct ggttctaccg cgacggcacc    328740
     ctgctctcgc gcaacgaagt cggcgccgcg ccggcccagt tcgcgctggg cggcggcgcg    328800
     ctgcgccgca gtgtggccgc gcgcgcgccg ccatccgcaa gccttgctgg ccaccgccag    328860
     ccacgaccac aagcgcggcg aggacgtgcg cgcgcgcctg gcggtgctga gcgaaatgcc    328920
     gcaacaatgg tgcgactggg cccggcaatg gctagccgac gccggcggca gcgccgcccc    328980
     gcccgcctgg gccgaccgct acatgctgct gcagaccctg gtgggcgcct ggcccgccga    329040
     cctcgcgccc gacgaccagg ccggcatggc cgcgctgttg cggcgcgtgg ccgcctggca    329100
     ggccaaggcc ctgcgcgaag ccaggcagcg cagcagctgg acctgtcccg acctggccca    329160
     cgaaaccttg tgcgcgcgct atctgcgcgc cctggccgac gatggcgcgg cgctgcccgc    329220
     cgtcgccgcc ctggcgcgcc ggctggcgcc ggccggactg gtcaacagcc tggcccagac    329280
     cgcgctgcgg ctgggcctgc ccggcgtgcc ggatctatac caaggctgtg aaacgtggga    329340
     cctcagcctg gtggacccgg acaaccgccg cgccgtggac tacgccgcgc ggcgcggcgc    329400
     gctggccagt ctcggcaacg gcgcgctggc gctgcccgag ctgtggcgcg acggccgcgc    329460
     caagcaggcc ctggtggccc gcgccctgca atggcgccgc gagcaacccg cgctgttcga    329520
     acacggcgct tgccgctggc tgcgcgtcag cggcgcgcgc gcccggcatg tgctggcctg    329580
     cctgcgcacc cgcgggccgc aacaggccct gatcgtcgtg ccgcgcgcca gcgccctggc    329640
     gctggccggg cagaccggac cggaccggga cgccgccgcg cattggcgcg acacctgcgt    329700
     acacctgccg gccgacgccc cgccctggcg cgacatcctt acccacgccg gccaccaggg    329760
     ccgcgccctg gcgctgagcg aactgctcgc gcgctggccg gtggcgctgt gccgcgttca    329820
     gtcctgactg gcagccagca agcggcacac gcgggcggtc agctccccgg gcgagaacgg    329880
     cttgcgtatc aggctgacgt cgcgctcctg ccgggcccag ccattctcgc gttcatcggc    329940
     gtagcccgtc atcagaatga tgcgcagggc cggccgcagc gcccgcgcgg cctgcgccag    330000
     cgcgtggccg ttcatgccgg gcagccctac atcgctcaac aacaggtcta tcctggcgtc    330060
     gctttgcagc aggcgatggc cggcgtcgcc gtcggccgcc gtcagcacgg tcaggttcag    330120
     ctcctccagc gccgcgcgca ccatgtcgcg tacatgctca tcgtcctcca ccagcgccac    330180
     caccgccgca tgcgcgggcg cggcgggcgg ctcggacgac tcgggcgccg gcagggccac    330240
     gggctcgccc acatggcgcg gcaggaacag ccgcaccgcg gtgccttcgg cctgcacgct    330300
     ggctatcgtc accatgccgc ccgcctgctg ggcgaaacca taaatcatcg acaaccccag    330360
     gccggttccc tgccccatcg gcttggtggt gaagaacggc tcgaacacgc gcgccagcac    330420
     gtccggcgcc atgccgcatc ccatgtccga gacacagacc tcgacgaact cgcccgcctc    330480
     ggcgcaggga ttggtctgca ccgccgccgc gtccagttcg cggtgggcga cctcgatctc    330540
     cagatcgccg ccggccggca tggcgtcgca ggcgttgatc accaggttca gcaccgcgtt    330600
     ctcgaactgg ttcatgtcgc agcgcacccg ccacgactgc gccggcagct tcagcgtcag    330660
     gcgcacctgc tcgcccgtat agcggcgaaa cagctcatcc atggaacgca ggatatcgcc    330720
     cggatcgaac acctgcggat cgatggcctg ctggcgcgag aaagtcagca gccgttgggt    330780
     cagccgcgcg gcgcggtcgg tcgattcctg ggcggtgcgc acatacttgc cgacctcctc    330840
     cggcttgctg cggcgcagct tgcggtctat caggtacagc gcgccggaga tgccctgcag    330900
     catattgttg aagtcgtgcg cgatcccacc cgtcagccgg cccaccgcct ccagcttctg    330960
     cgactgccgc agggcgtcct ccgtctggcg cagcacttcg gcctgcgcct tcaggtcggt    331020
     gtcgtcgcgc ccggccaggt acacattacc ctcggcgcgc gacaggctcc aggtaatcca    331080
     gtgatagcta ccgtccttgt gcagcaggcg gctttccagg tgccgcaccg gctgcatgcc    331140
     ctcggcgggc tcggcctcca gcgtggcctg catcgacgcc aggtcctcgg gatgcacgcc    331200
     ctcgtccagc cccatcgcca ggaactgttc gggcgaccag cccaatatgg cgcgcactgc    331260
     cgggttcacc gataccagcc gtccgccatg gtcggccacc gccagcagtt cgggcgacag    331320
     gcgccagatg cggtcgcgct cggcgatggc gtgctcgacg cgttgttcca gcacgcgcgc    331380
     gtactgcgaa cgttcgatcg cttcgcacat acgctcggcc gcttcttcga taaaagcgat    331440
     gtccgtgccc ttgagcggat gggtcggatc gggccgcacc agcaaggtgc cgtcggcgcg    331500
     gccccagcgg cgcagcggga ccacgatggc cgaaggctgc tggttgcccg ccgggccggc    331560
     cagatacggc gacagatagg ccgtgcgccc cttgcgcacc gcctcgtagt aatcgggcgt    331620
     gagcggcgcg gactccagca tcgaccgtcc atcgtagggc ggccgcggcc cccagcttgc    331680
     ggcgatgcgg tcgccacgct gcggcacgga ttccattacc gccaccgcgc ccagttccag    331740
     gtgccggccc aactcctcgc acaccatctg ctcgatctgg tcctgctggt ggatttcgcg    331800
     catgcgatcg cccagggtca gcaggaaatt cttgcggtac tgccgctccc acagctcgct    331860
     ctcggccagc ttgcgcgccg tcacattgag aaacaaggcc gccacccgat catgcccttc    331920
     cttgccggcg cggcattcgt agcaggcctg cggcggcccg ggcgcttcca cttcgaactg    331980
     cgccggctcg ccgctctcga tcacgcccac gaagatccgc atgatgctgt cggccgcggc    332040
     cggactcatg acgcgcagca tggggcccag cgtctggccg acggccagcc cgctctgcgt    332100
     ctcgaatgcc gggttgatct ccagcagcgt gaaatcgtcc acgctgcccg tgctgtcgcg    332160
     ctgcgcctcg gccaggaaga aaccctcctg catgcgctcg aacatgccgc gccagcgcac    332220
     gctgctgttg cgcagcgcct gttcggtcag gtggcgctcg atggccagcg ccgcggtgcg    332280
     cgtcaccagc gcgatcgcct cgatgtcctc gcgcgtgggc aggcgcggct ggcgatagta    332340
     gttggagaac acgcccaggg tgcgcccgtc ggtcgccttg atcggcgtgg accagcaggc    332400
     gcgcaagccg tgctgcgtcg ccgcctcgcg ccagggcggc caattgggat gcacggtcag    332460
     gtcctcgaca tagaccggcg tgcccaggaa cgccgccgcg ccccacgacg ccacgcccgg    332520
     gccgatcgcc gcgccatcgg tggcctgcac ataggccgcc ggcaggctgg gcgtcgccac    332580
     atggcgcagg cgcatgcccg agtcatccac gaacgcgatc gaggtgagca gctccacgct    332640
     ggactgcgcc tcgaccgcct gcatcacgtg cagcagcacg tcggtcaagg gcacgcctgc    332700
     ggcgatgcgc tgcagcatca cccgctcgtc ctccagacgc gccagcgtat tcgtccacgg    332760
     gctggaaacc cggtctccct tgcgcagcat cgcggtcctc gtgtggcggc catggccggc    332820
     tgccgccggc ccaatgaacc actgtattgc aggccgcgcc ggtcatacca ctacgcgagg    332880
     taacacgacg ctacctgagc ggccccgcca gcagcagctc cccgcagccc gcctcgcgcg    332940
     tgcgttccag cgcctcgatg acctgcaggg cggcgcggcg cgcggcctcg gccaccggct    333000
     ggccggccag caggtggccg gtaagcgcag caccgaacat atcgccggtt cccttgggcg    333060
     ccgtgtcgac atgggcatgc tccagcacct gcgcgtcgtc gtgcgtgacc accgccacgc    333120
     gcacccggcc cggcggccag gtggccggcg ccgcgctggt cacgatcacc cagcgggcgc    333180
     gcccgcccag cagggtgcgg gctgcggcga tggtctgctc catggtgccg gtgggcagcc    333240
     cggtcaggca ttccagttcg aagccgttgg gcgtcaagcc ctgcgccagc ggcagcagat    333300
     gatcgcggta cgccgcgacc atgccgggcg ccacgtacac gccgctgtcg tggtcgccga    333360
     tcaccggatc gatgtgcacg cgcaggtcgg gacgcaccgc caccaggccc gcgatccagc    333420
     ggcccagcgc ctcggcctgc gcgggcccgc ccaggtagcc cagctgcacc acccgcaccc    333480
     ccgccagcgc gccgcgcgcg cccaggtcag ccagataacc ctcgaaccaa tccagcggca    333540
     cggcgccgcc atgcatgctc ggatagtgcg gcgtattgct cagcaccacc gtgggcaccg    333600
     ccgccacccg caggccgaag ccattgaaca ccggcacggc cacgctgttg ccgacctggc    333660
     cgtacaccac ttgcgactgg atcgacacca cgtcgatggg cagcggcgca agcgcctgcg    333720
     gattgggggc cgccagcttc atcattcgtc ctccgcccgg tccgccgcgc cgctgtcggg    333780
     ccagtaataa tcgttgggca aggcgcgcgc gccatagatc gcctggccga cccgcaccac    333840
     ggtggcgcct tcctcgatgg cgatctcgta gtcgcccgac atgcccatgg acagctcgtc    333900
     caggctcacg ccggccggcg cttcctgccg caggcggtcg cgcaaggtac gcagctgccg    333960
     tacgcgcgcg gcgtcggccg acagcaccgc cagcgtcatc agcccgcgca cacgcagcgc    334020
     gccgtagctc ggcagttggc ggatgaaggc cgccgcctcg tccggatgca ggccgtactt    334080
     gctggcctcg cccgaagtat tgacctgcac gtacacatcc agcgcgcgcc cctcggcctg    334140
     caggcggcgc tccagcgcct cggccaggcg cacgctgtcg agcgcctgga actcggccgc    334200
     gaagcgcgcc accagcttgg ccttgttggt ctgcagatgg ccgatcaccg accagcgcaa    334260
     gtcggccagg tcggccatgg cctcccattt ccggtaggcc tcctggacct tgttctcgcc    334320
     cagctcgcgg cagccggcgg catacgacat gcggatgcgg gcctcgtcca ccgtcttgct    334380
     gaccggcaac agccgcacgc cggccgggtc gcgcccggcc cgctggcagg ccgccgccat    334440
     gcgggcccgc accgccgcca ggttgtgctc gaaatcggcc acgctgtcgg cgcgggggta    334500
     acgcgccgcc gcgtcgggcg catcctgggc agtatcggcg tgcatggctg tttcgaatcc    334560
     tatagaattt gtcctatgac aaagtatata acgacccagg ccagatgagc atcaccggcg    334620
     ccagcgcggc cgagatcttc gacagcgtgc gccagctggc gcaggcgcgc cgcctgctgc    334680
     ccggccaggc gctgcccccg gtgcgcgagc tagcgcagac gctgggggtc aatcgcaata    334740
     ccgtggccgc cgcctacaag cggctggtcg gcgccggcct ggcgctcagc cagggccggc    334800
     gcggcaccat catccgcggc ccgtccgagc cgggcgagca ggacggcgcg catcccggtt    334860
     cgcccctgat cgacctggcc agcggcaacc ccgaccccgc ccgcctgccc gatccgctgg    334920
     ccatcatggc cggacgcgcc agcccgccgc gcctgtacgg cgaagccacg gtcgacccgc    334980
     gcctgcaggc ctatgcaagc cagtggtatg ccggcgactg cccggccgcc ttcgaggtcg    335040
     atctcaccca cggcgccatc gacgccatcg agcgcctgct gggcgccaac ctcgccgcgg    335100
     gcgacacggt ggcggtcgag gctccgggtt ttctcggcag catcaatgcg ctccgcgcgc    335160
     tgggcctgca cgccgagggc gtggcgctgg acgccgccgg catgctgccc gacgccctcg    335220
     agcgcgcgct ggccgacggc gcgcaggccg tgctgctgac accccgcgca cagaacccga    335280
     ccggcgccag cctcacccgc gcccgcgcgc gggcgctgcg ccaggtgctg caacgctacc    335340
     cgcatgtcat ggtcatcgcc gacgaccact tcgcccacct gtcggcctcg ccctatcaca    335400
     gccccattcc cgccgccgcc ctgcgctggg ccctggtgcg ctcggtttcc aaggcgctcg    335460
     ggcccgacct gcggctggcc ttcgtcgcca gcgatcccga cacctcgcgg cgcctgcgcc    335520
     tgcggctggc cagcggcacg acctgggtca gccacctgct gcaggacgtc gtggcgggct    335580
     gcctggcatc cgcgccggtg caagcgcgga tggcccaggc gcgcagggcc tacgcccaac    335640
     ggcgcacctg gctggccgac gcgctgcgcg ccgaagggat cgccgcgcag tggccggccg    335700
     acggcctgaa cctgtgggtg ccgctggccc aggacagccc cgcgctgctg ctggagctcg    335760
     cgcatcgcgg ctggcgcttg cgcaacggca ggtccttcgg cgtacgcgag gacgtccatg    335820
     gcctgcgcat caccatcgcc acgctggagc acgccacggc gcgccgcctg gcgcgcgacc    335880
     tgcggctgtg cctggacgcg ctggacggac ttaagaaata tcctacgctt ctgtaaataa    335940
     agtcctgacc acatcaacca ggcgacttcc cataatgggg cggttatttt ccgaacgccc    336000
     tcagatgtcg cgcaccagcc tctcttctct cgccccccgc ccgcaccggc tcctgtccct    336060
     ggcctgggcg gccacggtcc tgtcgctgcg agtgggcatg ggcataagcg gactgttctg    336120
     cgcctggcgc tacctggtcg acttgcggcc ggttcgcccg ctgttcgatg gcgtggccgc    336180
     cggcgccacg ccgctggcgc tctacgccgc attcgaagcg ggctgcgcgg tgctgctgat    336240
     ggccggcgcc tccacccgca tcgccgccgc cggcatgacc gccgcccata tcgccggcgt    336300
     cgcactggcc ttgccggccc atggcctctg gatacccctg ccctcggccc tgtggctggc    336360
     ctgcctggcg ctgctgtggt gccacggccc gggcccgtgc tcggtggatg cctgcctgca    336420
     cccggcggcc atcgccccct tgtcgccgcc ccccgatgac ccggcgcaac ggccgattta    336480
     gcctgctgtt ccagcgattc gcgatcgggc cctcataata tagtgcgcgc catgtcgaag    336540
     ttctcccgca tcggcctggc cggcgtggtg ggcgccgcgc tccatgccat cctggccaac    336600
     caccttgcgc cggccgtgca gcagcggctg cccatcggcc gggtgagcct cacattcttt    336660
     ctcgccctgc tcagcgccct ggccgccggc gccgtgctgg cgcgcctggc cccgcgcgcg    336720
     cgggtggcgg ccctggccgt ggccgcactg gcattcctgc tgctggccgc cgccacgacc    336780
     tggctgcagc aatgcacgcc ggcccagctc gccgccatcg atgccgccac gccgctgggc    336840
     tgcaacctcg gcctgtacaa ccgcgcccgc gcccacctgc cgcccgatgg ccggccggcc    336900
     gagctcgcgc cgggagtctg gttcgaccgc cacggactgt cctacgcctg tctgcccccc    336960
     gaagcgcaag ccacccacct gcgcgtcgcg ctggccgatt acgccctggc gctggtgggc    337020
     atgagcctgg gcgccttgct gggcgccagg caacgcaggc gccgcgacca ggattgattc    337080
     ctgtcaatgc gctgaaaaag gcgataacct atgctgaacc atggacaact ctcaacacag    337140
     aggctgatat gctgaaaatc ctggttcccg tggacggttc cgaatgcgcc gtgcgcgccg    337200
     tgcgtgaagc catcaaggtc gccaacgaca gcaagggcgc ccagctgcat ctgctcaacg    337260
     tgcagctgcc gctcatctcc ggccacgcca agatgttcct gcgccacaac gagctgcaaa    337320
     gctactacca ggccgaaggc gaagccgccc tggccaccgt cctgcccgtc gtcgccgagt    337380
     ccggcatccc gttcgaatcc gaaatgcgca ccgggcagta cggcgagacc atcgccaact    337440
     acgccaagga gaaacagtgc gaccgtatcg tcatgggcac ccggggcctg ggcgcggtcg    337500
     gcggcctgct gctgggatcg gtggcgcgca aggtgatcca cctggccgac gtgccgatca    337560
     cgctggtgaa gtaggtcccg cgccccgccc ggccgagtac ctgcccatga gccgggcgcg    337620
     cttcctgcgc ctggccggcg cggctgccct cggcctggcc gccccgcgcg tcccggccgc    337680
     gcccagtctg ctgacgcggc cggtcccggc cgacggctcc ccgctgcccg tgatcggctg    337740
     cggaacctac atcggtttcg acgtcgcccg gccctcggcc gagtacgacg ccctcggcga    337800
     ggtcgtgcgg accttgttcg ccgccggcgg cacggtattg gacagctccc cgatgtacgg    337860
     acgcgccgag gccgtcaccg gccggctgct ggccgaagcc ggcctgcgcc agcgcgcctt    337920
     tgtcgccacc aaggtgtgga ccagcggccg cgccgccggc ctggcgcaaa tgcaggcgtc    337980
     gctgcgccag ctgggcggcg agcgcatcga cctcatgcag atccacaacc tgctcgactg    338040
     gcgcacccac ctgccggtgc tgcgcgaatg gcaggccgcc ggccgcatcc gctacgtcgg    338100
     catcagccat tacacggcga gcgcgtatga cgaagtcgag gcggtgctgc gcgccgagcg    338160
     gctggacttc ctgcagatca actatgcgct ggacgaccgc caggccgcgc agcgcctgtt    338220
     gccgctggcc gccgaccgtg gcgtggcggt gctggtcaac cggccgtttg gcggcggcgg    338280
     cctgctgcgc cgcctggccg gccggcccct gccgtcctgg gcggccgaca tcggcgcaac    338340
     cagctgggcg caagtgttgc tgaagttcgt gctcagccat cccgcggtca cctgcgcgat    338400
     acccggcacc ggccgggccg cccacatgcg cgacaacctg gccgccggca tggcggcgcc    338460
     accgccgctg tcattctgga acgacaaagc ctaggctcag cgcgccggcg cgctgcgcca    338520
     cagccatacc aggtcgtgcg gcgccagctc ttcgggcacg tcgaaacgca agggttcggc    338580
     gcgcgacccg gcgccaaaat gcacctcgac gcgaaaatag cgctggtctc cttgcccgca    338640
     tgcatcgcgc gcctgtccgg ccgcgctgta cagggcggca tcgatctgcg cgcgcagggt    338700
     tgccgagcac gcccccagct cgaagcgccg ggtgcggacc agggccggca cgaacgccac    338760
     gccgccttgg cgcgacacgc gcacttccgc ggcctgctcc agcgatggca gcgcaatcat    338820
     gtcagtaccc ctacatcggt ccaggcctgc cgcaccgccg cctgggccgc gccatggcgg    338880
     ccggcctgtt ccaccgacag gcgcgcgaac agggcgaaat cggcctgcgg cgtcagcgcc    338940
     ggcaggcgca aggtgtcgta ccagatccgg ccggccacct cccaggcatg gccgcccagc    339000
     gcggtggcgg ccagatggaa tgcacggttg ggaatgccgg aattgatatg cacgccgcca    339060
     ttgtcctcgc cggtctgcac gaagtcccgc atgtgtcccg gctgcgggtc gcggcccagc    339120
     aggggatcgt cgtaggcgct gccgggctgc gccatcgagc gcagcgcgcg cgcccgcacc    339180
     ttggcggtga acagccccgc cccgatcagc cagtccgcct ggtcggcgcg ctggcccgcc    339240
     acatgctgct tggccagcga accgaacaca tcgcacaggg attcgttcaa cgcgcccgac    339300
     tggccttcgt agcgcaggcc gccttcgtgg tcgatcaccc cgtgcgtcag ttcgtgggcg    339360
     acgatatcga ccgcgatggt gaagcggttg aacacgtcgc cgtcgccgtc gccgaacacc    339420
     atctgcgcgc cgttccagaa cgcgttgtcg tattcctcgc catagtgcac gctggccacc    339480
     agcgcccgcc ccgcgccatc gagcgaatgg cggccgtagg cctgccagaa cagcgcatag    339540
     gtcgcgccca gatgatcgta agcctcgttg accgccacgt cggcatgcgc gggctgccct    339600
     tcggaccgca ccagcgcgcc cggcaattgc aggccgccgc cggcatcgtg cacctgcctg    339660
     tcgacctgcc cgggcgggcg cgcggacgcg ggcgccggcg gcgcggcaag ccgcacggcg    339720
     cgctggctgg tgtcgatgcg caaggtgttg acggcgcgcg cgctcagccg cgcgtcggcc    339780
     gcctgcgcca gccggtccag caagtaaggc ggcaccacgc tcgggcgcgc ggctttcgag    339840
     gtaggtcgct tcatcgcatt cctcctgcca ggctgcgggg cgcccgattc tcgccacggg    339900
     cgcgcgtccc attccagcaa ctttatccta cctattcact cttgtattct gcgcggaatt    339960
     tgcaataatt agcgcgcttg taaggaagtt ttcctaactc tttttcttgc cccttacgct    340020
     cctgtacgcc gatcaacttc tggaacatag agatccccat gattaaatct gacgacgccg    340080
     gcaagctgat tcttcgcctt gcgctgggca ttctggtcat catgcacggt ctggccaaac    340140
     tgagcagcgg cgtgggcggc atcgccggca tgctgtcttc gcatggcttg cccggtttcc    340200
     tcgcctactt cgcctacgtc ggcgaaatcg tcggccccct gctgatcatc ctgggcatct    340260
     attgccgcct gggcgccctg ctggtcgtgc tcaacatggt ggtggccatt ctgctggccc    340320
     acatgggcca actgttctcc atcagcaaca ccggcggctg ggccctggag ctgcaaggca    340380
     tgttcctgtt cggcgcgctc gccctggcct tcatgggcgc gggccgcttc agcctggccg    340440
     ggtcgggcgg tcgctggaac tgagcgccgc gccgcgatcg cagggccgcc tcgggcggcc    340500
     ctgttttttt ggacgcttgg taatcaactg tcacgcttgt tgtgtttcca acccgttacg    340560
     ctggcgaacc ccaaggccga aacgacggcc taatcctgac atcgggattt atggacgccg    340620
     ctcgcggcgg attgccatgc atactgccaa agcccctctc gccgccctgg ccctggccct    340680
     ggccctggcc ctgggcgtga gtacgccacc tgccctggca caggtcggct acgaccctga    340740
     accggcctac gacgagcccg ccggcgccga ccccgccgcc gccaacctgg cccccgtcga    340800
     agtggcccgc gaggccccgc cgcccctgcc ggtctaccag caaccgcccg tgccgggcga    340860
     cggctacatc tgggtgccgg gctattgggc gctcaacgcc ctggggttct actgggtgcc    340920
     cggcgtctgg atgctggcgc cctacccggg cgcgttgtgg acgccgggct actgggccta    340980
     cgatgccggc tactaccggt ggcggcgcgg ctattggggt ccgcacatcg gcttttacgg    341040
     cggcatcaac tacggctatg gctacatcgg cttcggctac gtaggcggct actggaaccg    341100
     cgaccgcttc tattacaacc gcgccgtcac caatgtgaac atcacgcgcg tcacccacgt    341160
     ctacgaacgc agggtggtcg tccagcacat cgacaggagc cgcgtcggct accacggcgg    341220
     accgcgcggc atccagcggc gcgccgaccc gcgcgagatg gccgccgcgc gcgagcgcca    341280
     cacgccgccc accgacatgc aacgcgacca cgcccgccag gccggccgtg accgcgccca    341340
     attcgacggc ggcgcgcgcc gcgaccaggc cgcgcctgcg cccggtgcgc gggggccggc    341400
     cggacaaggc cgtcccggcc aggaccgcgc ggccggacaa ggcggcccgc gcgccgacga    341460
     tgtttccgcg ccgcgccggg acgcgcgccc cagcccggac agcgtcccgc gccaggccgg    341520
     cgcgcgccag gaaaataccc gccaggaaaa cgtccgccgc aaccaaagca cgccgcgcca    341580
     ggaaagcgcc ccgcgccagc acaacgcgcc gcgccccgag cgcgcgcggc cggccgaacc    341640
     gcggcgcgac gccggcagcc ctcccgagcg gtcatcgcgc cccgcgccgg cgccgcgcgc    341700
     cgaatcgcgc ccccaggcag agcgcgccgc ctcgcagccg cgcgcgcctg gccgccagga    341760
     cggcggggca aggccgaacg cggcccgggc gagcgcggca acggcggcgg acgcgggcgc    341820
     gacggctagg tccttccgtc ctgctggacc gatccgccgc gaggccgcta cagtaagggc    341880
     atcggcccgc ctcgccgggc cctgcccatc cggagttcat catgtcacgc cccgcactgc    341940
     tgttggccgc cctcctgtcc atcgcggcgc ccgccgcgca cgccgccctg ccggtgggcg    342000
     cgcccgcgcc cgatttcagc gcgcaggctt cgcaaggcgg caacaccttc accttcgaac    342060
     tggcgcaggc gctgcgccag gggccggtgg tgctgtactt ctatccggcg gccttcaccc    342120
     agggctgcac catcgaggcc cgcaatttcg ccgaggccat cgaccagtat cgggcgctgg    342180
     gcgccaccgt catcggcgtc tccggcgacg acatcgaaac cctgcgcaaa ttctcggtcg    342240
     gcgaatgccg cggcaaattt ccggtggccg ccgatgcaga cggcgccatc atgaaggcct    342300
     acgatgccgt gcacgacagg cggcccgaat acgcccagcg catttcatac gtgatatcgc    342360
     cgcagggccg catcgtctac gagttcacgg acatgagccc ggaccgccac gtcgccaaca    342420
     ccctgcaggc cttgcgcgac tggcaggcca ggaagaaata gacgcccgcg cgcatccggc    342480
     cgtcaacgaa agcggcctgg cgcgtcttgc cgcgccaggc cgcaatcact cgccctcaat    342540
     cgggcgcgca ggttctgaag ccgccgccta cggcaggatt tcgcgcacgc tctcggccgg    342600
     gcggcacagg cgcgcgcccc gctcggtgac gacgaaaggc cggttgatca ggatggggtt    342660
     gtcgaccatg gcatcgagca ggccctcgtc gtccacgccg tccaggccca gttcctggta    342720
     gatcggctcc ttggcgcgca ccgcctcgcg cacgctcagc ccggactgct ggatcaggcc    342780
     ggccagcgtc tggcgcgacg gcggcgtctt caggtattcg atgatggtgg gctcgatgcc    342840
     cgcgtcgcgc agcatttgca gcacgttgcg cgacgtgctg caacgcgggt tgtggtagat    342900
     ggtggcagac atgcagactc ctcggtggaa catcaggcca ccctatagtc tacccgcggc    342960
     cgcctgcatt cagcgaaacg gccacacggt cgggtgcgaa cccggtggca tggccggccg    343020
     cgtccagcgc gccggcgtca acgagaactg cgccgcgtgg cgcacggcgg tcagctcgcc    343080
     gaaccccgac tcctcggcgt acagcagctc ctcgatcggc ggcatcggac aggcgagccc    343140
     gtcgggcacg cgtcccagct cgcgcagcca gcgcgccgtg ctggccagcg acacgcgcac    343200
     gtgccagctg ccgccctcga tacgctagcg cgccagcgcg gccagcgcgc cgaaggccat    343260
     caggtagccg ctggcatgat cgaggatctg cacaggcatg gccttggggg cttcctgccc    343320
     ggccgcctgg gcctcggcat ggttgaagcc ggtggccgtc tgcaccagcg agtcgaagcc    343380
     gcgccggccg gcccacggac cgctatcgcc gtaggccgac agcgacacgt acacgatgcc    343440
     gggacggatg cgcgcggcgt cctccgggcc gaaacccagc gcctgcaggc cgccgggccg    343500
     gtagccctgc acgaacacat gcgcgctgcg caacagattg cccagcgcaa tgcggccgtc    343560
     ggcggtctcg aggtcggcgt gcaccgacag cttgccgcgg ctggtgtcga tgatgttgtc    343620
     gatattgggc agatgcggcg aattgatcag catcacgtcg gcgccgtagg cggccagcgc    343680
     gcgtccgcat accgggccgg cgatgatgcg cgtgagatcg agcacgcgga tgtcctgcag    343740
     cggcgtggcc tcgtgcccgt acttgggcag aggccgcgga tcggcgttgt cgatgcgttc    343800
     gatgcgcacc accggctgcg aagcggtcgc caggccttgc ggatggcggt cccattgatc    343860
     gaagctgcgc atggcggcga ccaccatgcc ggcatcggcg gcgacttgct cgaaatcgcc    343920
     cgcgcgccag cgcgccgtcg cgatggtgcg ggaaattggc atggatgcgc acccagccgc    343980
     cgtcgccgca tgggtagacg ccggtgatct tgtcccagat attgggcgtc acgccgttga    344040
     tcttgaagta gctgcggcac tcctgcgccg cgtggcgcat gtccaccgcc acgcgttggc    344100
     gctgcccgcc gcgcagatgc cagatctcgg ccgcggccag cgcggcggcc gcgatgctgg    344160
     cctgggcggc cgtgccgacg gcgaacgacg agggcagcac cggctcggcg ccatgcagct    344220
     cgacgtggtc gagcgcctcg tcgggcaggc ctgcggcgcc ccacaggttc tgcagggcta    344280
     cccgggcccc cttggcggta tgtgcttgcc ctcgcgccac gggcgggtgg agatccttca    344340
     ggtttcccat tgcagtcttc ggtgctcacg agctgatgag gcgattacat gtccagccct    344400
     gggttgcgtc aagatgcggg cgccgcgacg gtgtttcacg aattgaccgc gccggcgggc    344460
     gccactggcc gcgtccatgg cgccggcgtc acatctgttt gtaaatttta catagggtgt    344520
     agcgcggtcg ccgcgcccta gccgccgtgc tacgcgtctt cgcgcgccaa tcgccgcagg    344580
     aaaacctgca attccttgac cacttgctgg tcgccgcgcg actgcgcggc cgccagtccg    344640
     ctttcccagg cctggcgcgc gccggcgcgg tcgccctgtc cctgcagcgt cttgcccagc    344700
     cacttccagg cgaccgagta cgtgggatcg aaatcgagcg ccgcgcgcag gtgcggcaag    344760
     gccgcgtcga attgttcgtg ttcggcgtag gtcttgccca gcgtgaaacg caacaacatg    344820
     ttgtcggtac cctgcgccag catggcttcc aggcgctcgg tcatggcttg cataaggccc    344880
     tctccggcaa aggcgcccca gggcgccgcg ttcgttcatg ataggccagc tcccgccgcg    344940
     acgcccgcat gtccgcgttc cgacagggga aaaccgtctg tgtcggtgcg tatcaaatcg    345000
     atgtgcaggg cgaattattc cgccatagtg cgatccgata cctgaacaat gcaggaaccc    345060
     actgtgccat cgatcgtgct gtttccatcg tggatgaaag tctggcgccg gctggcctgc    345120
     gccgccctgc tggccggcgc cgccgccagc gcgccggccg cgccggccgc cgcgcaagcc    345180
     gccccggccg gcccgcaacg cctggccgcc caggtcgacc gcgtcagctg gggcgtcacc    345240
     cccaccgaac tggcccgcgc gcagcggctg agctggaccg tctatctgca ggagcagttg    345300
     cggccgcggc cggccgcgct gccgccggcg gtgcaggccg ggatcgacgc gctgtcgatc    345360
     acgcgcgtgc cggcgcgcga cgcgctgctg gcgcaacgcg cgcggaccgc gaaaatccgc    345420
     cagatcgaag accccgcccg caagctggcg gcctcgcgcg agaaccgcat ggtgtcgcgc    345480
     cagcgcgcca acgaaaccat gcagcgcgcc gtctggctgg cgctttattc ccccaaccag    345540
     ttgcaggagc agatgacctg gttctggatg aaccacttca gcatctacgc cggcaaggcc    345600
     aacgtcggca cggtgctcga cgcctacgaa gaccaggcca tacggccgca tgcgctgggc    345660
     aagttccgcg acctgctggc cgccaccgcc cgttcgcccg ccatgctgat ctacctggac    345720
     aacatccgca acagcgccgg ccacatcaac gagaactacg cgcgcgaact gctggagctg    345780
     cacaccctgg gcgtgcaagg cggctacagc cagcgcgacg tgcaggaact ggcgcgcgtg    345840
     ctcacgggcg tgggcctgaa ccagaccggc gaggcgccgc gcgtcaagcc cgcgcagcgc    345900
     gagcagctgg tcgaagacgg cctgttcctg ttcgatccgg ggcgccatga ccacggcgac    345960
     aagaccgtgc tgggccacac catacgcggc gggcgcggcc tggccgaact ggacgaggcg    346020
     ctcgacctgc tggcgcgcca tcccgccacg gcccgccacg tcagccgcaa gctggcgcag    346080
     tacttcgtgg ccgaccagcc gcccgatgcg ctggtgcagc ggatggcgcg cgcgttccgg    346140
     ggcagcgacg gcgacatcgc cgccacgctg gccgccatgt tcgagtcgcc cgaattcgag    346200
     gcttcgctgg cgcgcggaaa attcaaggac ccggcccact acctgtactc ggccctgcgc    346260
     ctggcctacg acggcaggga accgctgcgc aatcccgacg ccgcgctgga ctggctcaag    346320
     cgcatgggcc agccgctcta ccagcggctg acgccggacg gctatcccat gaacgaatcc    346380
     gattgggccg gttccggaca gatgaccacg cgcttcgagg cggcgcgcgc cattgccgcc    346440
     gcgcccgcga ccttctaccg cgccgaccgc gacgacaggc cgcgcgtgcc gcccctgccg    346500
     cccctggtcc aggcctatgg cgccggcgcg gggccgttct cggcgctgtc gccggccacg    346560
     cgccgcgcca tcgaatcggc ccccaacgtc cgcgacgcca atacctacct gctggcctcg    346620
     ccggaattca tgcgccgctg aacgcccgca ttccaggaat cgccatgcac cgacgccaac    346680
     tgctcaaact ggccgccgcc gccccgctca ccctgtacgg cacccgcctg ctggccgccg    346740
     gcccgcccga cacccgcctg ctggtggtgt tcatgcgcgg cgcctacgac gccaccagcc    346800
     tgctcgtgcc cacgaccagc gagttctatt acgagtcccg tccgcacatc gccattgccc    346860
     gcgacgccgc cgccgcgctg tccgacggct gggccctgca cccggccgtc aaggacagcc    346920
     tgctgccgtt ctaccagcgc ggcgagctgg ccttcgttcc tttcgccggc accgacgacg    346980
     ccagccgcag ccacttcgag acccagaacc gcatcgaact gggccgcgcc ggcggcagcg    347040
     gcgccgcgcc cgcctccggc tttctcaacc ggctggccgc ccagttcgac ggcaaggccg    347100
     gcaggccggc ggccttcacc gaggacgtgc cgcagatctt ccgcggccag gcgcgcgtgc    347160
     ccaatatcga cctgggcggg gccaagcgca agtcgcgcct gacggccgac agcagcagcg    347220
     ccatcgccca gatgtaccag ggcaccggcc tggatgcctc ggtcaacgaa ggcctggccg    347280
     ccatgggcca ggcgcgcgcc gcgctggagg ccgaaatgcg cgaggccaac ggcggtgccg    347340
     gcagcaccga gaaactggag caggaggcgc gccgcatcgg cactttcatg gccgagcgct    347400
     acaacctcgg cttcgtggac gtgggcgggt gggataccca cgtcggccag ggcgcggcca    347460
     acggcgtgct ggccaccaag ctgggccagc tgggacgcgc gctggccgcc tacgcgcagg    347520
     cgatgggccc ggcctggcgc cataccaccg tggtcgtcat cagcgaattc ggccgcaccc    347580
     tgcgcgagaa cggcaacaag ggcaccgacc acggccatgg cagcgtgtac tgggtgctgg    347640
     gcggcggggt gcgcggcgga cgcatcgccg gcgagcaggt ggcggtcaag cgcgacacct    347700
     tgttccagga tcgcgactac cccgtgctga ccgactaccg cgcgctgttc gcgggcctgt    347760
     tcggccgcct gtatggcctc gacgcgcaac gcctgcaggc cgtgtttccg ggcgcgcgtc    347820
     cgctcgacct caagctggtc tgacgcgcac gccactgacg gcgcgctggc gctacactgg    347880
     ccacgcaggc cgct                                                      347894
//

If you have problems or comments...

PBIL Back to PBIL home page