(data stored in ACNUC7421 zone)

EMBL: BX640439

ID   BX640439; SV 1; linear; genomic DNA; STD; PRO; 346362 BP.
XX
AC   BX640439;
XX
DT   09-AUG-2003 (Rel. 76, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 6)
XX
DE   Bordetella bronchiseptica strain RB50, complete genome; segment 3/16
XX
KW   complete genome.
XX
OS   Bordetella bronchiseptica
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Alcaligenaceae; Bordetella.
XX
RN   [2]
RP   1-346362
RA   Sebaihia M.;
RT   ;
RL   Submitted (06-AUG-2003) to the INSDC.
RL   Submitted on behalf of the Pathogen Sequencing Unit, Sanger Institute,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA, E-mail:
RL   ms5@sanger.ac.uk
XX
RN   [3]
RA   Parkhill J., Sebaihia M., Preston A., Murphy L.D., Thomson N., Harris D.E.,
RA   Holden M.T.G., Churcher C.M., Bentley S.D., Mungall K.L.,
RA   Cerdeno-Tarraga A.M., Temple L., James K., Harris B., Quail M.A.,
RA   Achtman M., Atkin R., Baker S., Basham D., Bason N., Cherevach I.,
RA   Chillingworth T., Collins M., Cronin A., Davis P., Doggett J., Feltwell T.,
RA   Goble A., Hamlin N., Hauser H., Holroyd S., Jagels K., Leather S.,
RA   Moule S., Norberczak H., O'Neil S., Ormond D., Price C., Rabbinowitsch E.,
RA   Rutter S., Sanders M., Saunders D., Seeger K., Sharp S., Simmonds M.,
RA   Skelton J., Squares R., Squares S., Stevens K., Unwin L., Whitehead S.,
RA   Barrell B.G., Maskell D.J.;
RT   "Comparative analysis of the genome sequences of Bordetella pertussis,
RT   Bordetella parapertussis and Bordetella bronchiseptica";
RL   Nat Genet 35(1):0(2003).
XX
DR   MD5; c6f8c16ea98be0f8ffe9bfab1ca422bc.
DR   ENA-CON; BX470250.
DR   BioSample; SAMEA1705943.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   StrainInfo; 494021; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..346362
FT                   /organism="Bordetella bronchiseptica"
FT                   /strain="RB50"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:518"
FT   CDS_pept        62..1045
FT                   /transl_table=11
FT                   /locus_tag="BB0660"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LQQ9"
FT                   /protein_id="CAE31160.1"
FT                   /translation="MKKPIGILRATLLCGVAVLATGGHAFAQDNWPSKPIRLLVGFAPG
FT                   GPTDNVARILAEKMGTELGQPVIVENKAGAAGNIAATALTQATADGYTLLYNTSSIVIA
FT                   PWVYRSPGFDPLKDFAPAGLTAAVPLVLAANMQVPAQTPKALVDMVKAGPDKYNYASSG
FT                   VGAIEHLTAAQLLSTLGLKATHVAYKGTAPAQVDLISGATQFTTTTLNTVIAPVQAGKL
FT                   RALAITSRERWSGMPDVPTVAETLIPGFESLAWQGIVAPAGTPEPVLAKINKAINDALA
FT                   SPDVRQKLDQQGTIVLGGSVDKYRAYIKSEYDRWGKVVEQAGARID"
FT   misc_feature    62..142
FT                   /note="Signal peptide predicted for BB0660 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.993 between residues 27 and 28"
FT   misc_feature    74..142
FT                   /note="1 probable transmembrane helix predicted for BB0660
FT                   by TMHMM2.0 at aa 5-27"
FT   misc_feature    212..1033
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 8e-95"
FT   CDS_pept        complement(1091..1924)
FT                   /transl_table=11
FT                   /locus_tag="BB0661"
FT                   /product="putative enoyl-CoA hydratase/isomerase family
FT                   protein"
FT                   /db_xref="GOA:A0A0H3LHP0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHP0"
FT                   /protein_id="CAE31161.1"
FT                   /translation="MSPPMTTPAPASPCYARFSVDEAGIGLLTLDDPATQNAMSLAMMD
FT                   ALAAIHPVICATPQLRVLIVTGAGKAFSAGGNVHDMLERRGVFAPEDPLAARDLNLERV
FT                   HAIPRAIHGLPMPTIAAVNGHAVGGGCDVALMCDIRIASDQAVFAESFLRVGLLPGDGG
FT                   AWFLPRAVGLSRAMEMALTCDFIDAREAERIGLVSRVVPHSTLLDEAYALARRIARHPP
FT                   RIARMTKRLMQFGAHATLHDTLEMTASMQGMVQTADEHKDAARAIADAVASRSRR"
FT   misc_feature    complement(1319..1849)
FT                   /note="HMMPfam hit to PF00378, DE Enoyl-CoA
FT                   hydratase/isomerase family, score 2.6e-48"
FT   misc_feature    complement(1508..1570)
FT                   /note="PS00166 Enoyl-CoA hydratase/isomerase signature."
FT   CDS_pept        complement(1921..3324)
FT                   /transl_table=11
FT                   /locus_tag="BB0662"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR033891"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHQ3"
FT                   /protein_id="CAE31162.1"
FT                   /translation="MTRQRNREGLEFTAANAQAVEAFDETVKRYLQFHGDIGGALKATF
FT                   AHDAQMPMALILRGYFYLLMGLRPLADKAAQLAAGLQPGRAALTEREQRHLDALACWSR
FT                   DSLQAATEHWERIARAHPRDILAVKMAHFGYFYLGRSARIRDGIAQAIDSWSEDDALYP
FT                   YMLSMMAFGQVEAGELARGEASGRRALELTPHDPWAVHAVAHALEPTDRKADALAWIAR
FT                   HERHWSEANNFRHHIHWHRALIHLEQGDAQAALDWYDRTVFAADSVEYLDVCNEASLLM
FT                   RLELSGVDVGRRWEAVAQKSAARIDDQVMGFADVHYAMALCSSANPEHRQQAQALAERL
FT                   ERYSQGGTDNAQAYRQAVVPIVGALLAFRQGRYRESADALLACADVAHAAGGSHDQRDV
FT                   YEYLTAEALFRAAPAHPDTIAYLARRSFRAPHNPHNWRLYLQSLEQSGQDRTLAAATAR
FT                   RQAAAHATA"
FT   CDS_pept        complement(3321..4547)
FT                   /transl_table=11
FT                   /gene="gcdH"
FT                   /locus_tag="BB0663"
FT                   /product="glutaryl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.7"
FT                   /db_xref="GOA:A0A0H3LML1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LML1"
FT                   /protein_id="CAE31163.1"
FT                   /translation="MDTQTSSPDTKQHYQPFVWEDPFLLHEQLTEDERMIQATAHAYGQ
FT                   EQLLPRIVHAHRTETFDRKIFLELGQLGFLGATLEGYGCAGVNHVSYGLIGREMERVDS
FT                   AYRSSVSVQSSLVMYPIHTFGSEEQRQTYLPGLASGELVGCFGLTEPDHGSDPGGMATR
FT                   ARGVAGGYRLSGAKSWITNSPIADVFLIWAKDDAGDIRGFILDRGMQGLSTERIDGKFS
FT                   LRASITGTIAMDEVFVPQDRMLPHVKGLRGPFSCLNKARLGISWGALGAAEACLHQARD
FT                   YVLARTQFGRPLASNQLVQKKLADMETEIAIGLQASLQVARLMDQGRVSTEAISIIKRN
FT                   NCGKALEISRVARDMLGANGVSDEYHIIRHMINLEAVNTYEGTHDIHALIVGRAITGIQ
FT                   AFYDSGSTQ"
FT   misc_feature    complement(3360..3806)
FT                   /note="HMMPfam hit to PF00441, DE Acyl-CoA dehydrogenase,
FT                   C-terminal domain, score 7.9e-47"
FT   misc_feature    complement(3816..4109)
FT                   /note="HMMPfam hit to PF02770, DE Acyl-CoA dehydrogenase,
FT                   middle domain, score 2.4e-13"
FT   misc_feature    complement(4113..4463)
FT                   /note="HMMPfam hit to PF02771, DE Acyl-CoA dehydrogenase,
FT                   N-terminal domain, score 2.1e-17"
FT   CDS_pept        complement(4594..5394)
FT                   /transl_table=11
FT                   /locus_tag="BB0664"
FT                   /product="probable enoyl CoA hydratase"
FT                   /db_xref="GOA:A0A0H3LIZ0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIZ0"
FT                   /protein_id="CAE31164.1"
FT                   /translation="MSEFTPKTILVEVRDHVAWITINRPDAMNALARETVIEIDQALQL
FT                   LEARADVHALVFTGQGRAFCAGGDLKYFKETVGSGDMNKFRAYLNLCQNMYRRVENFPH
FT                   PTIAAVNGVAVAGGMELIISCDLVIAAESAKIGDGHANFGIIPGGGGAIRLPRKIPMAL
FT                   AKRLLFTGNLLPARELAEYGLVNQVVPDEQLTEAVQALLAQITKNSPLGVRLIKQLIND
FT                   GYEQPLDTALRLEVVAWESYGLSNDIKEGLQAFQDKRKPRFSGT"
FT   misc_feature    complement(4825..5343)
FT                   /note="HMMPfam hit to PF00378, DE Enoyl-CoA
FT                   hydratase/isomerase family, score 1.2e-49"
FT   misc_feature    complement(5014..5076)
FT                   /note="PS00166 Enoyl-CoA hydratase/isomerase signature."
FT   CDS_pept        complement(5413..6597)
FT                   /transl_table=11
FT                   /locus_tag="BB0665"
FT                   /product="probable thiolase"
FT                   /db_xref="GOA:A0A0H3LQR4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LQR4"
FT                   /protein_id="CAE31165.1"
FT                   /translation="MREAVIVSTARTPIGKAYRGAFNQTHGAELGGHSLRHAIARSKVD
FT                   PAEIEDVIIGCGMPQGATGYNIGRQIAICGGLPIETGGTTVNRLCASGLQAIAIAAQRI
FT                   MVDRVPVMAAGGLECISIVQDEHHNGVKKSPWIEAHKPHTYDAMLRTAEVVAQRYGVSR
FT                   DAQDDYAFQSQMRTAAAQRDGRFDDEIVPMTTVKLSKNKETGATYEEEVTLLRDEGNRP
FT                   DTTREGLATLQPVMEPDTSITAGNASQLSDGSSACILMEAKEAERRNLEPLGAFRGFVA
FT                   TGCEPDEMGIGPILAVRTLFQRFGLRMEDIDLWELNEAFASQTVYCRDQLGIPNELLNV
FT                   NGGAISVGHPYGMSGARMVGHALIEGRRRGARLVVVSMCVGGGMGAAGLFEVYR"
FT   misc_feature    complement(5422..5796)
FT                   /note="HMMPfam hit to PF02803, DE Thiolase, C-terminal
FT                   domain, score 3.7e-50"
FT   misc_feature    complement(5533..5583)
FT                   /note="PS00737 Thiolases signature 2."
FT   misc_feature    complement(5809..6597)
FT                   /note="HMMPfam hit to PF00108, DE Thiolase, N-terminal
FT                   domain, score 4.6e-63"
FT   misc_feature    complement(6286..6342)
FT                   /note="PS00098 Thiolases acyl-enzyme intermediate
FT                   signature."
FT   CDS_pept        6864..7838
FT                   /transl_table=11
FT                   /locus_tag="BB0666"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHP4"
FT                   /protein_id="CAE31166.1"
FT                   /translation="MIRSLLVGLLLTLGPAAAQAAESPDRYPSKPITIIVPFSAGGPAD
FT                   NVTRYIANQLGKTWNQQVVVENRTGAGGMIGAEAVARAAPDGYHLVLLVTGHTIMPGMQ
FT                   ASMPYRMPQDFTGITVVNRAPKLVVVHPSVPVASFAELIEKVKQEPGKYGSYGTSGVGS
FT                   MAHLSMELVNKLAGTKFVHIPYKGGGATQADLVAGRLPIGVLDLGSVLPHVQAGSLKVL
FT                   AVTSDTRSPLFPDVPTIAEVIPNFQATEWFGIAGPKGVPPAIADKLQAAIKAALSTPEA
FT                   RTRYIEGLGWELPASTPKEMDEVLASQTVKWGALVKELGLKAQ"
FT   misc_feature    6864..6923
FT                   /note="Signal peptide predicted for BB0666 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.997 between residues 20 and 21"
FT   misc_feature    7002..7826
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 1.4e-79"
FT   CDS_pept        7840..9282
FT                   /transl_table=11
FT                   /locus_tag="BB0667"
FT                   /product="putative acetyl-CoA synthetase"
FT                   /db_xref="GOA:A0A0H3LHQ8"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHQ8"
FT                   /protein_id="CAE31167.1"
FT                   /translation="MDAVAMKSVTQLTVNADHLQGAIGALFKARTVAVVGISADHAKLG
FT                   NVILRNVVKNGFAGNIYGVCRAPVEPGVFEAGYERVRFVQAFSEIEEPVDVALFAVPAD
FT                   MVVTALASVPLGRLRLAVILASGFTETGERGASLETALRQYCLETQLPVVGPNCQGVVV
FT                   PGVKLQMTFSPMYNQMLEGKVAIVSQSGAMAGYMANNLMRRGVGLCCVVSSGNEAVLTA
FT                   ADYIHALADKPECRVVLCYIEQIKNGRHFARSVQRLGPQQRIVVVKSGRSTAGVAAASS
FT                   HTGAMASDDRVIDGVFRQLGVVRARDSATAIDVAMALANGRRMKGGAVGILSVAGGLAV
FT                   ELSDLLEMDGFTVPPFDPDTLERLKAKVPEFGASRNPIDLSGAILTQESLFEEVLNLFA
FT                   RARNLDGFAIISTFIRNPAFAHAIVRMYRSTDKPVVVCWTGTPEQTPESLEILTRSGIP
FT                   IYGDTGRVALALRAIRGDTDIS"
FT   misc_feature    7915..8265
FT                   /note="HMMPfam hit to PF02629, DE CoA binding domain, score
FT                   2.6e-05"
FT   CDS_pept        9298..10011
FT                   /transl_table=11
FT                   /locus_tag="BB0668"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A0A0H3LML6"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LML6"
FT                   /protein_id="CAE31168.1"
FT                   /translation="MSTAISMAGAGTKLDEIDLLLQQWIDAGRQVVHEADSKRILAMAG
FT                   FPVPGEARGGPAVVKLCADEALHKSELGLVALDVAPGDVERTRRELQERSRRAGVAGGE
FT                   VLVESMVGDVLMEWFVGCRTDHTFGPVVVVGAGGIYAELLGAPEIRMAPLSARDAERAL
FT                   RHHKAFPIIDGARGREPADIGAFARLIADVSEFYYRRSHLIAELDLNPVMVRGRHLDPG
FT                   MVVADASIILQKPTF"
FT   CDS_pept        complement(9986..10942)
FT                   /transl_table=11
FT                   /locus_tag="BB0669"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LIZ5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIZ5"
FT                   /protein_id="CAE31169.1"
FT                   /translation="MQRMPPLNALRSFESAARHESFLKAAAELHVTPGAVSRLVKSLES
FT                   YLGVELFMRSHRGVAITPQGKAFAEDILEAFNKIGIATDRVQQHPGDRGLSICCHPTFA
FT                   AHWLTPRWAQVQAALPSTQINVKTTLAPELESTDDYDFVVKLGPDPAAEQACSGGVAAE
FT                   RVLDVETFPICSSAFLQRHGGELGLDDIERYPLIHAQLRPQDWNRWLQSVGQPALRQAP
FT                   ALVFESLTLAYNAAMSGAGMAIGIHAFIADDIASGRLVAPFPQVRKSHMGFNIYFNAQR
FT                   AARVPRIEQIRRWMVQERNKTRATDTAAALRKSAFAE"
FT   misc_feature    complement(10043..10681)
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 3.7e-16"
FT   misc_feature    complement(10745..10924)
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 6e-23"
FT   misc_feature    complement(10790..10882)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    complement(10820..10885)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1546.000, SD 4.45 at aa 20-41, sequence
FT                   ESFLKAAAELHVTPGAVSRLVK"
FT   CDS_pept        complement(11162..12019)
FT                   /transl_table=11
FT                   /locus_tag="BB0670"
FT                   /product="putative hydrolase"
FT                   /db_xref="GOA:A0A0H3LQR9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LQR9"
FT                   /protein_id="CAE31170.1"
FT                   /translation="MQRRDYRLAHAGLDFHVTEWGSPQGLPVVMLHGIRGYAETFAGIA
FT                   AALQPEYRVIAFDQRGRGRTDWDADCNYYTDTYVADLAAVADQLSLARFDLLGHSMGGI
FT                   NAIVYAARHPGRVGRLVVEDAGPGAFEDSDGARRIRRELAETPAGFASWDAASDFMRSL
FT                   RPSVSEQARQQRLESMLKPAPEGGYVWRYDHAGIARTRLHPDPARVVDLAAYVARIGCP
FT                   TLLLRGGRSDYLQPAMVERMRALNPRIEAVEIADAGHYIHDDQPAAFARHVCRFLKPHA
FT                   PAGA"
FT   misc_feature    complement(11189..11866)
FT                   /note="HMMPfam hit to PF00561, DE alpha/beta hydrolase
FT                   fold, score 1e-25"
FT   CDS_pept        complement(12045..12647)
FT                   /transl_table=11
FT                   /locus_tag="BB0671"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHP8"
FT                   /protein_id="CAE31171.1"
FT                   /translation="MKTPNFSVYHIRKWYLQVEDTLAGETGAPADGEPLRKIVLAACIH
FT                   NPYAGKYVEDLTLWIDASPGLGAEFGRRVREAAQGQAIASYGKACLVGADGEYEHGNAL
FT                   LTNPAANPVRDALGGAKSWVPSTGKRGGPGTIIDIPLAHKDALYVRSHYDTVSAQFNDG
FT                   PNRDEVVLIWAFATRGRLNARLGGLAACDVQGHDGLN"
FT   misc_feature    complement(12180..12209)
FT                   /note="PS00758 ArgE / dapE / ACY1 / CPG2 / yscS family
FT                   signature 1."
FT   CDS_pept        complement(12688..13722)
FT                   /transl_table=11
FT                   /locus_tag="BB0672"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHR2"
FT                   /protein_id="CAE31172.1"
FT                   /translation="MQGTILVGTAGQGILRSNDNGASWHRLGLKEAIEFDGTVRSLAVD
FT                   PANPARVLAGADAGICLSTDGGAHFSLVDSPANGQTIWSVAFSPRDPRLVFAGSGAPSR
FT                   ARMYRSRDGGQSWEQLSPELPEFCSGVHRPRILTVCAHPERAEEVWFGVEEGGAWRSTD
FT                   AGDTWERIDAPGRGINNSDIHSITLLPAASGQPATQIVVTVNSVCQSVDEARSFDCQAS
FT                   RERFDGLYYTRAVYPLDAAGQTLLLAVGDGTPGTRTRIYRSEDRGRSWAPALLHTAPNS
FT                   TVWAFGAHPSDPALVFAGTKYGHLLRSTDGGRSWYKEWRDFSEITSVAWTPHVAPVHAH
FT                   PQSI"
FT   misc_feature    complement(12772..12807)
FT                   /note="HMMPfam hit to PF02012, DE BNR/Asp-box repeat, score
FT                   3.5"
FT   misc_feature    complement(12907..12942)
FT                   /note="HMMPfam hit to PF02012, DE BNR/Asp-box repeat, score
FT                   15"
FT   misc_feature    complement(13213..13248)
FT                   /note="HMMPfam hit to PF02012, DE BNR/Asp-box repeat, score
FT                   1.2"
FT   misc_feature    complement(13366..13401)
FT                   /note="HMMPfam hit to PF02012, DE BNR/Asp-box repeat, score
FT                   0.45"
FT   misc_feature    complement(13507..13542)
FT                   /note="HMMPfam hit to PF02012, DE BNR/Asp-box repeat, score
FT                   1.5e+02"
FT   misc_feature    complement(13645..13680)
FT                   /note="HMMPfam hit to PF02012, DE BNR/Asp-box repeat, score
FT                   14"
FT   CDS_pept        13975..14613
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="BB0673"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="GOA:A0A0H3LMM0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMM0"
FT                   /protein_id="CAE31173.1"
FT                   /translation="MKFYHEVRGCSLAVDIVARELGLALDLQWVDMANKRLADGSDYLK
FT                   VNSKGTVPTLELSDGQFLSEGAVIMQYLADQRPQQGMLPAAGTLARYRVLEWMSFIAAD
FT                   LHKGGFMPLFKAITPPEYRRIARQYLDGRLQWLNDQLAGREFLMGETFTIADAHCYTIA
FT                   MWTRAHDIDTSAWPHLEAYLARVGARPSVRAAEQAARDEGERQRAAAAR"
FT   misc_feature    13981..14199
FT                   /note="HMMPfam hit to PF02798, DE Glutathione
FT                   S-transferase, N-terminal domain, score 4.1e-05"
FT   misc_feature    14227..14544
FT                   /note="HMMPfam hit to PF00043, DE Glutathione
FT                   S-transferase, C-terminal domain, score 1.9e-14"
FT   CDS_pept        14651..15616
FT                   /transl_table=11
FT                   /locus_tag="BB0674"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIZ9"
FT                   /protein_id="CAE31174.1"
FT                   /translation="MNWTKRIAIVLAGLAAAPLALAADPAAPLKLVVGFPPGGGTDGAA
FT                   RIVAEHLPQQLGRPVVVENRAGAAGTLGAQVVRRAPPDGNTLFFGTSAELLINPITRKT
FT                   APYDVQKDFMPVTEVGSVAFVLVAPASSTVRSVPDLIAAAKARPGKLNFSSFGMGSTNH
FT                   LIGELFLSTTGISASHIPYQGSAQAMTALLAGDVNFTFDTVAVAQPHIQSGKLIALATP
FT                   SPARLAELPEVPTLRELGYADLTAEGWMGIFAPVGTPPQDIASLNAAFAKVLALPDVRA
FT                   KLAARGVGIVGGSPEQYRDKLATESRKWRQVAQDSGISLE"
FT   misc_feature    14651..14716
FT                   /note="Signal peptide predicted for BB0674 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.989 between residues 22 and 23"
FT   misc_feature    14780..15604
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 3.3e-98"
FT   CDS_pept        complement(15662..16648)
FT                   /transl_table=11
FT                   /locus_tag="BB0675"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LQU3"
FT                   /protein_id="CAE31175.1"
FT                   /translation="MKRRTFNIGLLGLMASGALVRTRPAMAQDAALPSLVTLVAPFAPG
FT                   GGADQLAREFAHFAQSRAPGTTFVVENKPGANGAIAARHVARQQPDGATLLLGTSSTHA
FT                   LGPLIAKADPALIVKEFSPVTLLATTANVLAVASTSRWKTLDDFVADARGQALTYGTFG
FT                   TGSSAHLYGLLLAQSTGARLSHVPYKGSSQAATDLLGGHIDAVFLTSSALEGLAREGKV
FT                   RVLGVTGKTRTRVFPDARTFEEQRVAQLDFSGWFGLFAPAGTPAPRREAIAALAASLGK
FT                   DAAASQRMTGQGYDWVGSSPQALQDSLLDTLGIYQKVLATRPDGLGG"
FT   misc_feature    complement(15671..16498)
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 4.7e-44"
FT   misc_feature    complement(16568..16648)
FT                   /note="Signal peptide predicted for BB0675 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 27 and 28"
FT   CDS_pept        complement(16791..17489)
FT                   /transl_table=11
FT                   /locus_tag="BB0676"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LHS2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHS2"
FT                   /protein_id="CAE31176.1"
FT                   /translation="MRMMEPDVPHDGATDDKASMPLRRQAEDALRKTILSGRFMPGERL
FT                   KERELMELLNASRTLVREALRQVEAEGLIEIVPNRGPVVAVLSYEEAEEIYEVRGILEA
FT                   QTCTGFALRAGSGHMKTLAAAFDALSEAARQGDIPRTLALSDTFYDTIAAGCGNRLLGN
FT                   MLRQLHNRIVLLRRTSLSEPSRLPETLYELTQIFEALKARDEIAAGKAALHHVRQASRT
FT                   ALQVLRSRQS"
FT   misc_feature    complement(17238..17414)
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 1.6e-12"
FT   CDS_pept        17703..19232
FT                   /transl_table=11
FT                   /locus_tag="BB0677"
FT                   /product="probable aldehyde dehydrogenase"
FT                   /db_xref="GOA:A0A0H3LHT8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHT8"
FT                   /protein_id="CAE31177.1"
FT                   /translation="MTTVHSATPEETRRLLQQLGVDPARYDGGTLEVRSPIDGQAIARL
FT                   PELTAEQARARVADARQAFLAWRKVPAPRRGELVRLLGEELRAAKAELGRLVSIETGKI
FT                   LSEGEGEVQEMIDICDFATGLSRQLYGLTIATERAEHRMMETWHPAGPVAIISAFNFPV
FT                   AVWAWNAAIALVCGDSLLWKPSEKAPLTALATQALLERALARFGDAPAHLSQVLIGGRE
FT                   VGEALVDDPRIPIVSATGSTAMGRKVGPKVAERFGRSILELGGNNAAIICPSANLDLAL
FT                   RGIAFSAMGTAGQRCTSLRRIFVHEQIADDLVARLKQVYESVAIGDPRDSGTLIGPLRD
FT                   QAAFDAMQRSLADARAAGGRVTGGAREPVGGHDQAYYARPALVEMPAQSEVVERETFAP
FT                   ILYVMRYRDLDEAIALQNDVPQGLSSSIFTNDLREAERFVSAEGSDCGIANVNIGPSGA
FT                   EIGGAFGGEKETGGGREAGSDSWKAYMRRTTNTVNYGNALPLAQGVKFDVA"
FT   misc_feature    17784..19184
FT                   /note="HMMPfam hit to PF00171, DE Aldehyde dehydrogenase
FT                   family, score 2.1e-133"
FT   misc_feature    18483..18506
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT   CDS_pept        19249..20412
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="BB0678"
FT                   /product="cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /db_xref="GOA:A0A0H3LMQ5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMQ5"
FT                   /protein_id="CAE31178.1"
FT                   /translation="MKPDTRLVHLGRDPERFEGLVNIPPCRTSTFLHASVADYQAAASR
FT                   KQDSLYYGRFGSQTSRALEAACTELDGGHGAMLFPCGLAAITRVLGSLLEPGQHLLMAD
FT                   TVYGPARAFCEQELARLGVETTWYAPDADLDALVRPATRVIYGEAPGSLTFEMQDLRAL
FT                   AEVARRHGLVSVVDNTWATSWFCQPLALGIDISIQSASKYIVGHSDAMLGVAVANEAQF
FT                   PALRRAAAQYGNAVSPDDCYMALRGLRTLGVRLERHQASALRVAQWLRTRAEVEQVLHP
FT                   ALPDSPGHALWRRDFSGASGLFGVAFRAGDDAALARFVDDLRLFGIGVSWGGFESLALP
FT                   SHPVRNTSAAALGGRPLVRLHIGLEDPDDLIADLARALDRHMAAARG"
FT   misc_feature    19258..20385
FT                   /note="HMMPfam hit to PF01053, DE Cys/Met metabolism
FT                   PLP-dependent enzyme, score 4.8e-114"
FT   CDS_pept        20443..20793
FT                   /transl_table=11
FT                   /locus_tag="BB0679"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ22"
FT                   /protein_id="CAE31179.1"
FT                   /translation="MSDIQYVETSPRYSKAVIHGDTVYLAGQVADDPGGTVQDQMRQIL
FT                   AQIDALLARCGTDKSRLLSAMVLLKDMRDLEAINPLWDAWVVPGRAPTRTPSEARLALP
FT                   GYLVEVQVTAAR"
FT   misc_feature    20461..20787
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF01042, DE Endoribonuclease L-PSP,
FT                   score 1.4e-20"
FT   CDS_pept        21096..22055
FT                   /transl_table=11
FT                   /locus_tag="BB0680"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LQU8"
FT                   /protein_id="CAE31180.1"
FT                   /translation="MKKLIVAALFAVLPSMVGAQQAPRGTMTIVNPFTVSGLTDLVARM
FT                   VAEKAHAKFPDGVAVVSRPGGGGSIGIASVVNARPDGSSIGFTPTGAVVDAPQMMKGLA
FT                   YKTPDDIDPIINVFSSYQMLAVRGDADWKTAQDFIKAVRQSPGKYSLGHTGNGTASHLN
FT                   MAQLVQAAKLNVLEVPYKGWAQSSVALLGGHVDAIVINAGEGRALVDEGRLRILGVFQA
FT                   QRVPYHPDVPTFKEIGYDVGVGLKFFFFGPRNMDAGVKQYIHDAFKQAMQNDDFKKFIA
FT                   SREVEVDYMDGAQTKAMLWSEYKQHTKLLDSLGLLAKQ"
FT   misc_feature    21096..21152
FT                   /note="Signal peptide predicted for BB0680 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.961 between residues 19 and 20"
FT   misc_feature    21219..22040
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 9.1e-38"
FT   CDS_pept        22080..23192
FT                   /transl_table=11
FT                   /locus_tag="BB0681"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHS4"
FT                   /protein_id="CAE31181.1"
FT                   /translation="MASIKGLREVAYFDCAGGGQVYVQGNYAYIAHMDAPAGTTIVDIS
FT                   DPRHPRQVAHIPIPDGVHTHKVRVENDLMLVNWECPPPYILGENFQGGLAIYDVSDPTN
FT                   PRQICFWKTAGTGVHRFDFDGRHAYITPEVEGYHLNIAMILDLENPAKPREVGRWWMPG
FT                   QWVAGGETPDEGYRMTWCHQVLRRGNRLYVAYWHGGMVILDIEDMSKPKLVSKFAYSPT
FT                   FAHPTHTVLPLPFELAGRKIAIVADEDVRKVRPSPPPFMWLFDITDETQPVPISTYQIE
FT                   ELMDKNMPEFTGCHQPAEQVYGTEIPVAWFAKGLRVVDVKNPHAPREVAHFEPDIPGFD
FT                   RAQTNDVFLTKEGLMYIIDRNRGMHILERI"
FT   CDS_pept        23207..24229
FT                   /transl_table=11
FT                   /locus_tag="BB0682"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHU2"
FT                   /protein_id="CAE31182.1"
FT                   /translation="MSEATRKVPVTVLTGHLGAGKTTLLNRILTGQHGRKYAVIVNEFG
FT                   EIGIDNDLIVESDEEIYEMNNGCICCTVRGDLIGILHKLLRRPGRFDAIVVETTGVADP
FT                   APVVQTFMMDEEVREKTELDAVITMVDAKHFPLRLADSQEAEDQIVYADVVLINKVDLV
FT                   SAGEADQVQRRVAAINPYAACHRVQRAEIDLARILSIGAFDLQRCVELEARAAPAGCGH
FT                   EHEHDAHCQGGTDHHHHHHEISVMSVSLQAGALDGRRFFPWIHSLVEKQGPDILRMKGI
FT                   LALDDDARRYIIQGVHMIVEGEHQRAWRDDEPRASKLVFIGRGLDAQALRAGFEACRSQ
FT                   "
FT   misc_feature    23225..24220
FT                   /note="HMMPfam hit to PF02492, DE Cobalamin synthesis
FT                   protein/P47K, score 1.9e-139"
FT   misc_feature    23249..23272
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        24226..25227
FT                   /transl_table=11
FT                   /locus_tag="BB0683"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMR0"
FT                   /protein_id="CAE31183.1"
FT                   /translation="MKMLNRLDLGVPCLRAGFAGEQAFFLAMDGRLHVQQGDQRRVVAL
FT                   HDGDVLSACAAPGQADAAAWLLSAGEDGRVMRAGAGEPDCVASVPNKWVTALAVAADGA
FT                   LAYASGRTVWLAGGGGEAAALPQERPVQALRFSHGGRWLAVAGYDGLALYDRQAGGEPQ
FT                   RLDWKGMPTRVAFSPDDRFVLVATRDAVLHGWRLDTLRHFRMVGYPRAVGSWSWLAGGQ
FT                   WLATDGSAGAVLWPFEGEEGPIGSTPLALGERPDGEVSAVACHPARPWVAVGYADGLMV
FT                   LESTDGALRRILGQAGRDRVACLAWDRAGARLAYGTPSGACGVIQADTGEEG"
FT   CDS_pept        25230..25520
FT                   /transl_table=11
FT                   /locus_tag="BB0684"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ25"
FT                   /protein_id="CAE31184.1"
FT                   /translation="MCAEVDYEDRGTYRKVPPPSEALVERTRQVEAGMPGERVPEQAWG
FT                   TFFAVSCGVMDMGSFQRMFEARRIALSYLAMQRARYARRHGGGTGLRCIGD"
FT   CDS_pept        25610..26353
FT                   /transl_table=11
FT                   /locus_tag="BB0685"
FT                   /product="transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LQV2"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LQV2"
FT                   /protein_id="CAE31185.1"
FT                   /translation="MGKTLVKGLHLLERLAASPEPMGITELAADLDLVQSNVHRLLQTL
FT                   MESGYVQQDALTRRYRCTMRLWEMGTQIADRMDLSRIARPHMQALVKQSQETVHLAILD
FT                   GADVLYIDKIDSPQPVRSYTRVGGRAPAYCTGTGKMLLAYCDDLAAALPAKLVKHTARS
FT                   IASHAALKAELRRVREEGFSENAGEWREDVYGMGAPLFDATGKVSAAIGISGPLARMDA
FT                   AVVARVRPMLQETARIISRELGYRG"
FT   misc_feature    25673..25738
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1370.000, SD 3.85 at aa 22-43, sequence
FT                   MGITELAADLDLVQSNVHRLLQ"
FT   misc_feature    25787..26335
FT                   /note="HMMPfam hit to PF01614, DE Bacterial transcriptional
FT                   regulator, score 8.3e-54"
FT   CDS_pept        26746..27636
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="BB0686"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.2.1.52"
FT                   /db_xref="GOA:A0A0H3LHS7"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHS7"
FT                   /protein_id="CAE31186.1"
FT                   /translation="MLISARTLRGIITATPTPFTREGGVDREVLRSHIEFLIGRGAAGL
FT                   APLGGTGEYPALCARERADVVRWTVEAARGRVPVVAGVLATGYEDAVQAGLAAREAGAD
FT                   ALMVVTPYYALAGDAGVRAYFERYRAAVDLPIVLYEIPRRTNVELRAETIAAMAGDGTI
FT                   VGIKYSGSDFAKLTRLIHLAGDTLAVLSGEEPLFPAAVALGAVGGVLAMSNLDPAPWAR
FT                   IQSLVESGEMAQALQLHHRQGALADAVYSEMNPVGLKAALQLKGFAFGEARLPLQPAGP
FT                   QTLLRLQQAFEALES"
FT   misc_feature    26764..27630
FT                   /note="HMMPfam hit to PF00701, DE Dihydrodipicolinate
FT                   synthetase family, score 1.1e-59"
FT   CDS_pept        27637..28872
FT                   /transl_table=11
FT                   /gene="aatB"
FT                   /locus_tag="BB0687"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="GOA:A0A0H3LHU7"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHU7"
FT                   /protein_id="CAE31187.1"
FT                   /translation="MNTIYDSAAVAAGRRVAARMARVTTSKIYLAIAKVADMQAQGMQV
FT                   ASLTAGEPDFDTPAHVIEAAVQAMRGGDTHYTPVRGSLAMREAVRQKFQRENGLAFRDE
FT                   EVMVGTGSKQVIANALAVTLETGDEVLLPVPYWAAYTGMVYAAGGVPTFVGTRAEDGYK
FT                   LTPQALRAALGPRTRWVILNTPSNPSGLVYGSDELRALGEVLRERPDVLILTDEIYEHL
FT                   NYTAEPPASLRKLCPDLAERIVVVNGVSKAYAMTGWRLGFAGGPADIIEAMANLQAQTT
FT                   LAPCSISQAAAVAALNGPRESIDAMAAAYRRRRDLVMQIAGGQPGVRLQRPDGAFYAML
FT                   DLSEALAGGERFRGDPEPDQAFCEWLLETRHVAAVPGSVFGAPGSVRISFATDEQTIER
FT                   GLTGLLDAAAHC"
FT   misc_feature    27907..28860
FT                   /note="HMMPfam hit to PF00155, DE Aminotransferase class I
FT                   and II, score 1e-55"
FT   misc_feature    28378..28419
FT                   /note="PS00105 Aminotransferases class-I
FT                   pyridoxal-phosphate attachment site."
FT   CDS_pept        28957..29787
FT                   /transl_table=11
FT                   /locus_tag="BB0688"
FT                   /product="probable solute-binding periplasmic protein"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMR5"
FT                   /protein_id="CAE31188.1"
FT                   /translation="MNAVIRKMPAMLKWLMAVPLALGLAHAHAETVLEKARAKNEIRIA
FT                   TSDSLKPWGYMDDTNKPIGFNLDVSREMGKRMGFGKVTFVTDSYKNFISGLNADRYDMV
FT                   VAILTPTEERRKSADFSNPYMVVSKNIFVRDDNTSIRSLEDLAGKRLGVAAGTTDEAWA
FT                   RQHVKDAQIRVYDNFFLALQDLAIGRVDARITDRVTGMTAAKEGRFPVKIAGPDLSQDI
FT                   GAIAYKKGQDDLAAIVNKVIQEMVDDGSLNEISRKWLAGIEMGEELKKLPKDAR"
FT   misc_feature    28957..29043
FT                   /note="Signal peptide predicted for BB0688 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.735 between residues 29 and 30"
FT   misc_feature    29080..29739
FT                   /note="HMMPfam hit to PF00497, DE Bacterial extracellular
FT                   solute-binding proteins, family 3, score 4.5e-59"
FT   CDS_pept        29784..30434
FT                   /transl_table=11
FT                   /locus_tag="BB0689"
FT                   /product="putative permease component of ABC transporter"
FT                   /db_xref="GOA:A0A0H3LJ28"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ28"
FT                   /protein_id="CAE31189.1"
FT                   /translation="MIELLHKAAPIIQGALLMTLLLGLSSAVLGTALGLVLALFRLSPV
FT                   APLRWLAFWYVSIFRGTPLLLQLLLIYFGLPHYGIELEPVPTAILALSLCSAAYLSENF
FT                   RSGILGVDRGQIEAAQSLGMGAARSLFRIILPQAIRIAAPTMGTRYIALMKDTSLASTI
FT                   TVVELTKMAEQVGSNTFRYMEMFIIAGALYWVINQMLTFIQVWVESKLGKGVA"
FT   misc_feature    29784..29873
FT                   /note="Signal peptide predicted for BB0689 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.937) with cleavage site
FT                   probability 0.645 between residues 30 and 31"
FT   misc_feature    join(29826..29894,29931..29999,30042..30110,30336..30404)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB0689 by TMHMM2.0 at aa 15-37, 50-72, 87-109 and 185-207"
FT   misc_feature    30102..30326
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport systems inner membrane component, score 3.8e-14"
FT   misc_feature    30105..30191
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        30434..31213
FT                   /transl_table=11
FT                   /locus_tag="BB0690"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="GOA:A0A0H3LQV6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LQV6"
FT                   /protein_id="CAE31190.1"
FT                   /translation="MQHDQAAGAPVVQVEGLRKSFGANAVLKGVDLTIRRGEVVVVMGP
FT                   SGSGKTTFIRSLNFLEVPDEGAITICGTQVAVQARAGLKREQRRRVREIRQKTAMVFQS
FT                   FNLFSHMTVIKNIIEGPVQVKGAARDQAIEQARALLRQVGLAEKENEYPSRLSGGQKQR
FT                   VAIARALAMKPEVIFFDEPTSALDPELRDEVLSVMRKLADEGMTMVVVTHEVRFARDVA
FT                   DRVIFMEGGVVLEDAPSASFFDAPASERIRQFLRRVQ"
FT   misc_feature    30542..31126
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   2e-64"
FT   misc_feature    30563..30586
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    30899..30943
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        31210..32448
FT                   /transl_table=11
FT                   /locus_tag="BB0691"
FT                   /product="putative peptidase"
FT                   /db_xref="GOA:A0A0H3LHT1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHT1"
FT                   /protein_id="CAE31191.1"
FT                   /translation="MTAGARPGWAADPLVEAVGRETGELMRGIRHDLHAHPELSFEEHR
FT                   TAGRVRACLQEWGIPVLDGLGETAVVGVLRAGGGGQAIGLRADMDALPIHETNTFGHAS
FT                   RHAGRMHACGHDGHTAMLLGAARYLQRHPDFDGTIYLIFQPAEENGRGARAMIEAGLFR
FT                   DHPMQAVFGLHNWPGLAAGKFALTAGPIMASSSRVKVTYTGKGGHAALPEQAIDPVAAV
FT                   AALHQALQTVVTRNTAAHDSVVLSITQLGGSDNHCVIPDQAWLAGSLRTLSPAVLERTC
FT                   ARIRDIAQGVAAAFSCAARIEIEHAVPATINDAGATALCRDAIVQWLGAKWLNDGFIPT
FT                   MGAEDFAFMLQALPGCYLMLGNGGGREGETATVCGLHNPGYDFNDEIAAVGAAYWVRLA
FT                   GHCLPRGGAGPLA"
FT   misc_feature    31276..32229
FT                   /note="HMMPfam hit to PF01546, DE Peptidase family
FT                   M20/M25/M40, score 6.2e-70"
FT   CDS_pept        32521..33318
FT                   /transl_table=11
FT                   /locus_tag="BB0692"
FT                   /product="probable transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LHV3"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHV3"
FT                   /protein_id="CAE31192.1"
FT                   /translation="MASKKAAGEADKDHLFVNSVAKAFRLLEAFDKSRPMSGFSQAARE
FT                   IGMEKSAAQRAAHTLWRLGYLDKVGRDGEYRLSRRCLDIGQRYLETNRLVVCTNPYLKF
FT                   LRRKTNASVNLAMLDGTDTVFPVRYTSQEMLNNDLGERARIPAYCTATGIAIFSAMPDE
FT                   AVREVLERSDLKPLMPNSIWQMDRIMERVESARRDGYVLGVEEDFASDITIACPISDPA
FT                   TGDVAAIGVSYSSEVTAVEQVVQDWCPLVMSTAREVTARLAES"
FT   misc_feature    32743..33303
FT                   /note="HMMPfam hit to PF01614, DE Bacterial transcriptional
FT                   regulator, score 5.5e-22"
FT   CDS_pept        33356..34627
FT                   /transl_table=11
FT                   /gene="amaB"
FT                   /locus_tag="BB0693"
FT                   /product="N-carbamoyl-L-amino acid amidohydrolase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="GOA:A0A0H3LMS0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMS0"
FT                   /protein_id="CAE31193.1"
FT                   /translation="MTAAFASLGQTIVEQAARLASHSDMEGGLTCAYLTPAHRATQAQL
FT                   AQWMEAAGMAVRIDAIGNVIGRYAADPAVPAPRVLMTGSHFDTVRDGGRYDGRLGILLP
FT                   VAVAGALRDAGVRLPYHLDVVAFAEEEGLRFKTSFLASGVLAGSFDPALLARQDADGVT
FT                   LAQALAASGLPGAGDPAALRAAALDPATLLGFVEVHIEQGPVLLHHGLPLGVVTQIAGS
FT                   SRFMARVEGMAGHAGTTPMNLRQDAGAAAAEMVLLVESRCSQVPTLVGTVGQLQVPNGS
FT                   GNVIPGVCQFSIDIRAAEDPVREAAVADVRAGIEQIARRRGVRVSLDAVPPVGSVPCAR
FT                   WLMDQFGAALSEAGLAVHELPSGAGHDAMVMQRIADVAMLFVRCGNGGVSHNPLETLSA
FT                   EDAQQAAEVFAAFLRRFAPRGSGR"
FT   misc_feature    33392..34450
FT                   /note="HMMPfam hit to PF01546, DE Peptidase family
FT                   M20/M25/M40, score 8.8e-12"
FT   CDS_pept        complement(34624..35898)
FT                   /transl_table=11
FT                   /locus_tag="BB0694"
FT                   /product="probable amidase"
FT                   /db_xref="GOA:A0A0H3LJ31"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ31"
FT                   /protein_id="CAE31194.1"
FT                   /translation="MQPLHLLGLHEARERLMAGACDSVDLVQACLDRIAAREEQIRAWA
FT                   WVDAAGALRKARAMAGARPDPRRPLAGLPIAVKDIIDTADMPTAYGSPIYAGHRPAWSA
FT                   YCVAAIEAAGGIILGKTATSEFAHSAPPATRNPHAPQHTPGGSSGGSAACVADFMAPAA
FT                   LATQTGGSTIRPAAFCGVVGYKPSLGLIDRTGVKPMAESLDTVGLMARAVADIQLLAGV
FT                   LAGVPAAPPGSAAPRIGLYRTPHWERIDARSRDALLARLRRLERHGARVAEVPDLPALH
FT                   PLYQDQRDIMNQQASRALLHEYRQHREQLSPALRAALEAGQACSPDALRAAWQRTRRAR
FT                   RAYAELWADYDLIVTPAALGAAPAGIASSGDSLLNRNWSLLGVPTLSLPNGADPRGLPL
FT                   AMQLAGSHGGDAALLGWARWIEAAA"
FT   misc_feature    complement(34657..35826)
FT                   /note="HMMPfam hit to PF01425, DE Amidase, score 8.2e-85"
FT   misc_feature    complement(35083..35127)
FT                   /note="PS00616 Histidine acid phosphatases phosphohistidine
FT                   signature."
FT   misc_feature    complement(35536..35559)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(35907..36833)
FT                   /transl_table=11
FT                   /locus_tag="BB0695"
FT                   /product="putative polysaccharide deacetylase"
FT                   /db_xref="GOA:A0A0H3LQW1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR017625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LQW1"
FT                   /protein_id="CAE31195.1"
FT                   /translation="MTMQTDRSLLTRRDFVGYGSTPPDPQWPGQARLALNIVVNYEEGS
FT                   EASFEDGDGRSELGLTEVTGSSFQGRDLAAESMFEYGSRVGIWRVLRLLRERGMTATFF
FT                   ACAQALERNPAVAQAIRAGGYDVCCHGWRWTPLQALSEAQEREEMQRAVASIERTTGQA
FT                   PAGWYCRYAPTVNTRKLVLEQGSFLYDSDSYNDELPYWVDAGDRHHLVIPYTQAHNDAK
FT                   FVRSGIATADDFFAFLRDSFDMLYAEGATQPKMMSVGLHMRLVGHPGRAAGLARFLDHV
FT                   AAHERVWVCRRLDIARHWHGLHRPAAR"
FT   misc_feature    complement(36207..36614)
FT                   /note="HMMPfam hit to PF01522, DE Polysaccharide
FT                   deacetylase, score 5.9e-05"
FT   CDS_pept        complement(36830..37321)
FT                   /transl_table=11
FT                   /gene="allA"
FT                   /gene_synonym="glxA2"
FT                   /locus_tag="BB0696"
FT                   /product="putative ureidoglycolate hydrolase"
FT                   /EC_number="3.5.3.19"
FT                   /db_xref="GOA:A0A0H3LHT5"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHT5"
FT                   /protein_id="CAE31196.1"
FT                   /translation="MSSMYLSASTLSADAFSQYGEVVENRGDTAKRPLSTPFGSARQGV
FT                   TLGFTVNRLHRQPLDGIRVRTLERHPHSAQTFIPLVPSRHVVVVGLSGPDGALALPTLR
FT                   AFVTNGRQGVSYRTGVWHYAFTAIDTDSQVAVILGKTGRDDDTEYTELDQDALVVFHEE
FT                   "
FT   CDS_pept        complement(37338..38630)
FT                   /transl_table=11
FT                   /locus_tag="BB0697"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LHV8"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHV8"
FT                   /protein_id="CAE31197.1"
FT                   /translation="MLLGALYFGGLVLFLMAGIHVASAIFMTAVVSDWMSMQVLPSMIG
FT                   NTMWSTMNEFLLVAIPLFILLGEILTRSGVADRMYKALAAWLQWLPGGLLHTNIATCAL
FT                   FAATSGSSVATSATVGTVALPTLQRLGYRERLVLGSIAAGGTLGILIPPSINMVVYGAL
FT                   AEVSVGKLFAAGIVPGIIVLLLMMAVIVIMALLGKVAPDNEKLIIPLAMRLKLLIDVLP
FT                   VVFIFGLVMGGIYLGIATPTEAAALGVVGAIAIAAANRTLSVAMLHAAFLSALRTTAMV
FT                   VLVVTTAFVLNFSLSLAGIPQALSEYIGQLGWSPTATIWVLVAFYLILGCFLEAIAMMV
FT                   TTVGVVVPLIVSLGFDPLWFGIFMTMMMELALITPPVGLNLFVAQNIRLSRGGISDVYI
FT                   GVLPFAFAMMVFVTLLIYFPQIALWLPNRLF"
FT   misc_feature    complement(join(37374..37442,37479..37547,37575..37628,
FT                   37632..37700,37728..37796,37833..37901,37914..37982,
FT                   38043..38111,38154..38222,38418..38486,38544..38612))
FT                   /note="11 probable transmembrane helices predicted for
FT                   BB0697 by TMHMM2.0 at aa 7-29, 49-71, 137-159, 174-196,
FT                   217-239, 244-266, 279-301, 311-333, 335-352, 362-384 and
FT                   397-419"
FT   misc_feature    complement(38535..38630)
FT                   /note="Signal peptide predicted for BB0697 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.807) with cleavage site
FT                   probability 0.350 between residues 32 and 33"
FT   CDS_pept        complement(38630..39244)
FT                   /transl_table=11
FT                   /locus_tag="BB0698"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LMS4"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMS4"
FT                   /protein_id="CAE31198.1"
FT                   /translation="MTRLLELLCGGLRAITNRACLAAGWALIALSVVIALNVLARKIFS
FT                   FSLQGVDEYGGYCLAICASIGFSQAAYDRAHIRISVLTDLLPQRLRACSDVFALALLTS
FT                   VALTLAVKATGVAYDSYSMQALATSALRTPLAIPQAMWAAALCWFGLVLATQLLHSLLL
FT                   LARRDWGGINRNYGNPSVDEEVAEELRSANERMAGKLEGAH"
FT   misc_feature    complement(join(38753..38821,38891..38959,39029..39097,
FT                   39125..39184))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB0698 by TMHMM2.0 at aa 21-40, 50-72, 96-118 and 142-164"
FT   misc_feature    complement(39179..39244)
FT                   /note="Signal peptide predicted for BB0698 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.717) with cleavage site
FT                   probability 0.564 between residues 22 and 23"
FT   CDS_pept        complement(39307..40353)
FT                   /transl_table=11
FT                   /locus_tag="BB0699"
FT                   /product="putative extracellular solute-binding protein"
FT                   /db_xref="GOA:A0A0H3LJ35"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ35"
FT                   /protein_id="CAE31199.1"
FT                   /translation="MKAILQRSIALLALAAGMSSVACADEVKMRVLGWYGNQPQSQQVE
FT                   RPFWKDLPKRSNGAFSANFRTIDELGLKGFESLRTLQSGAFDVVSFQISFVGGDAPVLM
FT                   GADLPGAAFDFDQLQKNLDAYRPILEKELNDRFKAKLLTAWSFPFQILYCKGDIKTLDD
FT                   LKGKKVRVSGTYTAKMVADLNAAGATLAGPEVYQGLMQGVVDCAITGSQYGNSNDWFEV
FT                   AHSLSPIPLGGAGVVLQVARNAFWDKLSADQQAALSAEMKQLETALWDISRKGHEDGIN
FT                   CNVGKQPCTGKPGKMQLVEPTEADVREVKQLLKTSIVPMWIEDCSKFSKTCGDDWFRTI
FT                   GAAAGIAR"
FT   misc_feature    complement(39382..40260)
FT                   /note="HMMPfam hit to PF03480, DE Bacterial extracellular
FT                   solute-binding protein, family 7, score 3.6e-08"
FT   misc_feature    complement(40282..40353)
FT                   /note="Signal peptide predicted for BB0699 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.796 between residues 24 and 25"
FT   misc_feature    complement(40285..40317)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        40495..41400
FT                   /transl_table=11
FT                   /locus_tag="BB0700"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LQW5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LQW5"
FT                   /protein_id="CAE31200.1"
FT                   /translation="MNLRLIEIFRAVMQSHTTVGAARALQISQPAVSSAIRQLESQVGF
FT                   TLFDRVGNRLSATEEAKILFRDSESIFLLSKALNHTVEELKNERLGQLRIVATPQLGHS
FT                   VLPAAINDLLKQRPKVKVFFDVRRSYNVVEIIESRAADIGFAIALEPELEQKLHMLPVA
FT                   RVQMVCLAPADHPLARRKSVTPQDISPYPLIGLELGSRLSPLVLNAFKQAGTPYRTAVE
FT                   VRYSETACLLAQAGVGVTVVDLFSAMAQARHGGGLKIIPFKPAIEVEAFAVSAKNRVPS
FT                   RLALLLVEETQKSIRRFQPA"
FT   misc_feature    40501..40680
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 3.2e-18"
FT   misc_feature    40540..40605
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1277.000, SD 3.54 at aa 16-37, sequence
FT                   HTTVGAARALQISQPAVSSAIR"
FT   misc_feature    40543..40635
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    40750..41382
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 1.6e-39"
FT   CDS_pept        41502..41888
FT                   /transl_table=11
FT                   /locus_tag="BB0701"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR032774"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHT9"
FT                   /protein_id="CAE31201.1"
FT                   /translation="MRLLPAMGALALLLHAPAAPAQDFDRHGHALVRDAQGWVYIDRAH
FT                   RPVLRPFIYDNGPDYYEEGLARFVEHGRMGFHDEALNIVIPAEYDFVFPFQGGKARAGM
FT                   DCRVQRHGEHGSVSCRRWTTLTRP"
FT   misc_feature    41502..41564
FT                   /note="Signal peptide predicted for BB0701 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.807) with cleavage site
FT                   probability 0.797 between residues 21 and 22"
FT   CDS_pept        complement(41885..42568)
FT                   /transl_table=11
FT                   /locus_tag="BB0702"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LHW2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHW2"
FT                   /protein_id="CAE31202.1"
FT                   /translation="MSARSAPKSQTRSSTEISEEILRRIQSGRYLPGDSLSQYELASEF
FT                   GTSRTPIREALRFLEARRAISLTDTGRAMVAIPSVRAIREAFEVRAELEGLAARLAVDW
FT                   IEDKHLKLLAQHQKHYASTLRSRVRNERGSEWLQHNFDFHHLITELSHNERLLDMVSEL
FT                   QSSSVSDVLGFASKMPPRLMEENIQQHEAIIAALTRRDGAAAREAMIEHVLRTMRLVID
FT                   WMESR"
FT   misc_feature    complement(42344..42520)
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 1.7e-10"
FT   misc_feature    complement(42398..42463)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1509.000, SD 4.33 at aa 36-57, sequence
FT                   LSQYELASEFGTSRTPIREALR"
FT   CDS_pept        42840..43325
FT                   /transl_table=11
FT                   /locus_tag="BB0703"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMS9"
FT                   /protein_id="CAE31203.1"
FT                   /translation="MSDIDPITSARILNPGGRGGPLTEAHQPMRAMHRDDIEWENLRYE
FT                   GQFSKMMFHPVQDDRTIPNAGIVRYEKGSGHPLHNHYFAQIWYVLSGKFEIEGKVYGEG
FT                   SMMFHPDPHYEYALNTLEDGEILYVQYMGPTTRQPAIYEGRFNMETRRPLEDESTAA"
FT   CDS_pept        43425..43949
FT                   /transl_table=11
FT                   /locus_tag="BB0704"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LJ39"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ39"
FT                   /protein_id="CAE31204.1"
FT                   /translation="MERLIQVLDLFSDRMGRLASMVMLPVLLVTFAVVVLRYVFGIGLI
FT                   WLQDSYVWLTSVFFICMAGNTFLHDRHVRVELFYSRMTARKRALVNALGVLLLLWPTLF
FT                   VTVQQSWRPIARSWRFLEASPNAGGLSFAYVHKSLVYVFCLVLFLQGLSLLLKSARTLA
FT                   GARGVAPEASP"
FT   misc_feature    join(43494..43562,43575..43628,43689..43757,43839..43892)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB0704 by TMHMM2.0 at aa 24-46, 51-68, 89-111 and 139-156"
FT   CDS_pept        43946..45301
FT                   /transl_table=11
FT                   /locus_tag="BB0705"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LQW8"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LQW8"
FT                   /protein_id="CAE31205.1"
FT                   /translation="MSLSDVLCLLMFATVMGTMMFGFPVAFTLSGVGVAFALLGSALDV
FT                   FEWRTMGGVMGRLYGIMSNEMLVAIPLFVFMGIMLEKSKAAERLLVTTSSLFGSLSGGL
FT                   AFTVVMVGTLLSAATGMVAATVATLALISVPAMRRAGYQPSYMAGSICASGTLSQLIPP
FT                   STVLILIGDMLRGVTPPDRPGGPVTVSDLFAGAVLPSVLLVVLFLGYVLYRALLRPDTC
FT                   PPLPRSAGQRVGLRQLLVDAVAPLALIIAVLGSILAGIATPTESAAVGAMGAVLIALLY
FT                   KALSWPVLKQVCMATGHLVAMVFTIMIGAAIFSLVFKGLGGEHLARELLSSVPGDLYGA
FT                   LLLVLLIAFVLGFFLDSFEIIFVVIPIFGPPLLSLGVDPLLFGVLLAVTLQTSYLTPPF
FT                   GFAIFYLQGVYKDIGAETAYRGVLPYIALQVGAVAALLSFPALATWLPTVLY"
FT   misc_feature    43946..44056
FT                   /note="Signal peptide predicted for BB0705 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.797 between residues 37 and 38"
FT   misc_feature    join(44006..44074,44117..44185,44210..44278,44288..44356,
FT                   44390..44458,44516..44584,44660..44728,44741..44809,
FT                   44828..44896,44954..45010,45023..45091,45104..45172,
FT                   45206..45274)
FT                   /note="13 probable transmembrane helices predicted for
FT                   BB0705 by TMHMM2.0 at aa 21-43, 58-80, 89-111, 115-137,
FT                   149-171, 191-213, 239-261, 266-288, 295-317, 337-355,
FT                   360-382, 387-409 and 421-443"
FT   CDS_pept        45342..46466
FT                   /transl_table=11
FT                   /locus_tag="BB0706"
FT                   /product="extracellular solute-binding protein"
FT                   /db_xref="GOA:A0A0H3LHU3"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHU3"
FT                   /protein_id="CAE31206.1"
FT                   /translation="MNPNSDNKRRTLLRAATVGGLGAVLAGAAPPALAKPRVRWRMGMA
FT                   WTRSAPGYTTPVVALADFLDKATGGAFQIEVFGAGDLVPAMQTFDAVLDGTLDCGHGYA
FT                   SYWSGKSIAMNLVMSMPFGTTAQEKNAWLQYGGGQALADKVYERLGAKFFPLGNCGVQP
FT                   MGWFRKEINSIDDFKGLKFRVSGLPGEVLRECGVAVVGMPLGEVLQAMQSGAVDACELT
FT                   GPYIDTTLGIQRIAKNYYFPGWHEPEGQFDLFINLDAWNKLSPEYKELVRVGAYYANGV
FT                   MLNELVAKNGKAFEDLRTEHGVTARLLPDDVLKRMHEITNDLLAGAYERDPLARELRDS
FT                   LRAFLGAAAPYSEYSELLFMQARANLSGRPRLGG"
FT   misc_feature    45342..45443
FT                   /note="Signal peptide predicted for BB0706 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.952 between residues 34 and 35"
FT   misc_feature    45375..45443
FT                   /note="1 probable transmembrane helix predicted for BB0706
FT                   by TMHMM2.0 at aa 12-34"
FT   misc_feature    45465..46334
FT                   /note="HMMPfam hit to PF03480, DE Bacterial extracellular
FT                   solute-binding protein, family 7, score 9e-53"
FT   misc_feature    45651..45674
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        46515..48023
FT                   /transl_table=11
FT                   /locus_tag="BB0707"
FT                   /product="probable GntR-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LHW4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHW4"
FT                   /protein_id="CAE31207.1"
FT                   /translation="MADRVTKAFQLATLKIRLNSADLERLDLHQRIQRALRALILDGAL
FT                   GPGVRLPATRALAGSLGVARDTVENAYVQLHRDGFIVRRQGSGSYVSETVGARLLGAAR
FT                   RRSMAAGEPRAEPAPEAGLSRRGRQIHDSGGVPDQRQVRAFATGLPETRTFPVDVWERL
FT                   QRQALKDHRAGVLLHGDPQGAQPLRRAIAAYLNLERGAQVDAEQILVLSSTRQALFLCA
FT                   QLLVDAGKPILMENPGYFGARKAFEAAEARIVPIDVDAHGLRTDLLKADRSGANCVYVT
FT                   PSHQYPTGATLSLERRLDLTAWAGAQGRWIIEDDYDSEFHYDGLPTACVQGLDRHQRTI
FT                   YLGTFAKTLYPGLRLGYMALPRQLVPAFTRARAIMDGHTPQITQLTLARFMDDGHYNSH
FT                   VRAMRKLYAGRRDALLDSLGQSLRGIATAVRPPGGLQVPCLLERGWSEARTIAQAAAAG
FT                   MRLAGLSGLYAGEDGRQGWILGYACLAAHEIEAAVLRLRRALKA"
FT   misc_feature    46608..46787
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 8.6e-14"
FT   misc_feature    47955..47975
FT                   /note="PS00290 Immunoglobulins and major histocompatibility
FT                   complex proteins signature."
FT   CDS_pept        complement(48038..49330)
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="BB0708"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /db_xref="GOA:Q7WPH6"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WPH6"
FT                   /protein_id="CAE31208.1"
FT                   /translation="MNDLLPAAAAPAGARALPLRHADPEIWRAVDAERQRQMHSIELIA
FT                   SENFVSQAVLDAQGSVMTNKYAEGYPGRRYYGGCRHVDVAERAAIERARRLFGCEYANV
FT                   QPHSGSQANQAVYLALLAPGDRILGLDLKAGGHLTHGAHVNLSGKWFEALSYGVDPVSH
FT                   RIDMDEVERTARRERPRLIIAGGSAYARVPDFARFRAIADATGALFVADMAHYAGLVAG
FT                   GAFPSPVPFAHVTTTTTHKTLRGPRGGMILTDDADIARRIDAAVFPGLQGGPLMHVIAA
FT                   KAVALGEALQPGFRAYARAVIDNARALCARLAEGGLSIVSGGTDCHLGVVDLRPWGLAG
FT                   NAAERALEEAGITVNKNAVPGDAASPAVTSGIRVGSAACTSRGMGPAEFRQIGDLVLAV
FT                   LGGLRDGGQAGGRDAVPARAAELSRRFPLPY"
FT   misc_feature    complement(48143..49276)
FT                   /note="HMMPfam hit to PF00464, DE Serine
FT                   hydroxymethyltransferase, score 2.5e-240"
FT   misc_feature    complement(48584..48634)
FT                   /note="PS00096 Serine hydroxymethyltransferase
FT                   pyridoxal-phosphate attachment site."
FT   CDS_pept        complement(49327..50562)
FT                   /transl_table=11
FT                   /gene="benE"
FT                   /locus_tag="BB0709"
FT                   /product="benzoate membrane transport protein"
FT                   /db_xref="GOA:A0A0H3LMT4"
FT                   /db_xref="InterPro:IPR004711"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMT4"
FT                   /protein_id="CAE31209.1"
FT                   /translation="MHTPTAVLRPADFLAPIVAALISVLVNYGGTFVLVFQAAELAGLS
FT                   AAQTTSWVWAVSIGVGVTGIALSWRYREPIITAWSTPGVAFLATVMPFTPYGEVIGAYL
FT                   AAALGFVVLGLSGAFEKLVRMIPAGIAAGLLAGILLQFGINAFGGASADPLLVIALLVS
FT                   YALLKRYTSRFAVVGILVIGLGLLAAQQRVDFAALHLSLAAPVFEMPRFSLHAMLGVAL
FT                   PLFVITLTGQYMPGMLVLRNDGFKTSANPILVATGLGSLVMAPFGAHTFNVAAITAAIC
FT                   TGRDAHEDPRKRYIAGLACGVFYILVGLFGVTLATLFMVLPKTFITTLAGLALLGTIGG
FT                   SLASAMADARTRETALITFLATAANVTLLGVGGAFWGLVAGLAAHGLIHFRQPEPAAAR
FT                   PALLSPTSQDTR"
FT   misc_feature    complement(49402..50532)
FT                   /note="HMMPfam hit to PF03594, DE Benzoate membrane
FT                   transport protein, score 3.5e-165"
FT   misc_feature    complement(join(49429..49497,49534..49593,49606..49674,
FT                   49735..49803,49861..49929,49996..50055,50119..50187,
FT                   50206..50265,50278..50337,50356..50415,50458..50526))
FT                   /note="11 probable transmembrane helices predicted for
FT                   BB0709 by TMHMM2.0 at aa 13-35, 50-69, 76-95, 100-119,
FT                   126-148, 170-189, 212-234, 254-276, 297-319, 324-343 and
FT                   356-378"
FT   CDS_pept        50801..51265
FT                   /transl_table=11
FT                   /locus_tag="BB0710"
FT                   /product="probable oxidoreductase"
FT                   /db_xref="GOA:A0A0H3LJ43"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ43"
FT                   /protein_id="CAE31210.1"
FT                   /translation="MATLTINGKSQDVDAPDDMPLLWVIRDRLGMTGTKFGCGMALCGA
FT                   CTVHLDGQPVRSCITPVAAAAGKRIVTIEAVGEDEVGRAVQQAWTEIGVPQCGYCQSGQ
FT                   IMSATALIKSNPKPSDEDIDAAMSGNICRCGTYPRIRAAIKQVAVKGVAK"
FT   misc_feature    50810..50992
FT                   /note="HMMPfam hit to PF00111, DE 2Fe-2S iron-sulfur
FT                   cluster binding domain, score 3.4e-08"
FT   misc_feature    50912..50938
FT                   /note="PS00197 2Fe-2S ferredoxins, iron-sulfur binding
FT                   region signature."
FT   misc_feature    51014..51238
FT                   /note="HMMPfam hit to PF01799, DE [2Fe-2S] binding domain,
FT                   score 6.7e-31"
FT   CDS_pept        51262..53613
FT                   /transl_table=11
FT                   /locus_tag="BB0711"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /db_xref="GOA:A0A0H3LQX2"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LQX2"
FT                   /protein_id="CAE31211.1"
FT                   /translation="MNAFDRFAPSHAALADEPCGLAPASPARREWLRTAAALTGLVLVV
FT                   GAGGVVRAAGEAAKEAKKYGGDGMPHGTVDDPLVFVSIAADGLVTIVAHRAEMGTGVRT
FT                   SLPMVVADELEADWNRVRVIQAPGDEPRYGNQDTDGSRSTRHFFLPMRRVGAAARAMLE
FT                   AAAARQWGVPVAEVAARQHEVVHEKSGRKLGYGELATAAAALPVPAEAALRLKQPAQFR
FT                   YIGKPGARSVDIEDIVTGKTHFGIDTRLDGMLYASVARPAVLGGKVKAYKAEAALKVPG
FT                   VVKVVELPAGPTPPVFAPLGGVAVIASDTWAALKGRQALEIEWDDGPHASYDSEAFRKT
FT                   LSEGAGKPAKPVRNDGDAMQALAGAARRIEAEYYLPHLAHATMEPPAATARLADGKCEV
FT                   WACVQSPYGTRENVARHLGLDIGAVTVHQTLLGGGFGRKSKSDFVVEAALLSKAMDGKP
FT                   VKVTWSREDDLANDYFHTVSVERLEAGVDAQGKAVAWLHRTAAPTIGSTFAAGAEGQQP
FT                   FELGMSAINIPFDIPNFRVESVPVPAHTRIGWFRSVSNIPHAFAVQSFVAEMAHALGRD
FT                   PRDYLLELIGPPRRIAPAAMSDGWNYGESPELYPLDTGRMRHVIEVATGAAGWGRKLEA
FT                   GRGLGVAVSYSFVTYIATVVEVEVGQDGAIAVPRVHVAVDCGPQVHPDRVRAQVEGACI
FT                   MGLSLATRSEISFAQGRATQTNFHQYEVARMPEAPREIVVHLVEHGFDVPLGGVGEPAV
FT                   PPFAPALCNAIFAATGKRIRALPIRDQLKA"
FT   misc_feature    51976..52251
FT                   /note="HMMPfam hit to PF01315, DE Aldehyde oxidase and
FT                   xanthine dehydrogenase, a/b hammerhead domain, score 0.03"
FT   misc_feature    52255..53448
FT                   /note="HMMPfam hit to PF02738, DE Aldehyde oxidase and
FT                   xanthine dehydrogenase, molybdopterin binding domain, score
FT                   3.2e-07"
FT   misc_feature    52483..52548
FT                   /note="Predicted helix-turn-helix motif with score 992.000,
FT                   SD 2.57 at aa 408-429, sequence GTRENVARHLGLDIGAVTVHQT"
FT   CDS_pept        53682..54632
FT                   /transl_table=11
FT                   /locus_tag="BB0712"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LHU8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHU8"
FT                   /protein_id="CAE31212.1"
FT                   /translation="MPSPSRSPATAYKKAPSLKGLPSIRQLRAFVAVYYTGTLSAAAEA
FT                   LSLTQPAVTILLKELEEKLGVRLFDRTTRALRRTTAALEAIAYAERVLGELDALSASMT
FT                   DLADVRRGRLRVAATSTVAQTLLPKVVRRFLDLHPGVKLSVDDCAPAMFAEHVLSEQVD
FT                   LGVGTLESAVPGLEQHQFLGDHLCAVATDAAFGHGRPMTWKQLSGLPVIVVQAGYGVRR
FT                   SIERAAQQAGVELQVAFEVSLLTTALAMAASGLGVAVVPQSILAHTHYTNLVARRLVRP
FT                   VVLRSTSVVFKEARALSPSAQAFAELLRREFSSPA"
FT   misc_feature    53751..53930
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 5e-19"
FT   misc_feature    53790..53855
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1614.000, SD 4.68 at aa 37-58, sequence
FT                   GTLSAAAEALSLTQPAVTILLK"
FT   misc_feature    53793..53885
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    54000..54620
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 6.8e-45"
FT   CDS_pept        complement(54629..55339)
FT                   /transl_table=11
FT                   /locus_tag="BB0713"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LHW7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHW7"
FT                   /protein_id="CAE31213.1"
FT                   /translation="MPRYPVRPADHAQSAEGGVTAVDRALTLLTAFRVTDQTLSLSELS
FT                   ERASLVPSTVLRLLASLMHFGFVLRRPDGRYALGPAAARLNRVYAASFNLQDVVLPALQ
FT                   ELVGQTRESASFHVRQGAHRLVLYRVSSPQPLSDQSHAGDLLPLDRGTGGHVLMAFSDT
FT                   PGEFYEALRLRGYMASPVSDRSPELAGISAPVFDAQGMLAGALTLTMPVHRYKDAHIPV
FT                   LREAAARLSAALGA"
FT   misc_feature    complement(54641..55114)
FT                   /note="HMMPfam hit to PF01614, DE Bacterial transcriptional
FT                   regulator, score 5.3e-09"
FT   misc_feature    complement(55160..55225)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1328.000, SD 3.71 at aa 39-60, sequence
FT                   LSLSELSERASLVPSTVLRLLA"
FT   CDS_pept        55432..56430
FT                   /transl_table=11
FT                   /gene="hmgL"
FT                   /locus_tag="BB0714"
FT                   /product="3-hydroxy-3-methylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /note="Similar to Rhodospirillum rubrum
FT                   3-hydroxy-3-methylglutaryl-CoA lyase HmgL SWALL:P95639
FT                   (EMBL:U41280) (303 aa) fasta scores: E(): 7.9e-37, 42.43%
FT                   id in 304 aa, and to Bacillus halodurans
FT                   hydroxymethylglutaryl-CoA lyase Bh1134 SWALL:Q9KDS7
FT                   (EMBL:AP001511) (303 aa) fasta scores: E(): 4e-38, 39.4% id
FT                   in 302 aa"
FT                   /db_xref="GOA:A0A0H3LMT7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMT7"
FT                   /protein_id="CAE31214.1"
FT                   /translation="MEKILISEVGPRDGLQNVQAVMPTEAKLQWIGALAAAGLREVEVG
FT                   SFVHPKWLPQMADADAVVPRARAIAGLTVLALVPNLKGAQRALAAGAHKITVPVSASQT
FT                   HNMANVRMTCEQSIEAIAAICAYRDEMAGAGPRVEVEAGIASAFGCSREGAVPERWVME
FT                   MAERLARAGVDSIGLSDSVGVAHPRQVKRMFGELLRLLGERAGGAHLHNTRGQGLANAV
FT                   AALEAGVTTLDASQGGLGGCPYAPGATGNIVTEDLVYLLESMGVDTGIDLERLLQARAI
FT                   LAAALPGEPLYGHLADAGVHRGFRYADPARAALAAPEGAFCPGGAQPTEAA"
FT   misc_feature    55465..56310
FT                   /note="HMMPfam hit to PF00682, DE HMGL-like, score 8.7e-45"
FT   CDS_pept        56427..57611
FT                   /transl_table=11
FT                   /locus_tag="BB0715"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein Rsp1421 or Rs03121 SWALL:Q8XQ65 (EMBL:AL646084)
FT                   (383 aa) fasta scores: E(): 6e-80, 55.87% id in 383 aa, and
FT                   to Rhizobium meliloti putative conserved membrane-anchored
FT                   protein Rb0848 or Smb21182 SWALL:Q92V66 (EMBL:AL603645)
FT                   (394 aa) fasta scores: E(): 9.4e-47, 39.58% id in 384 aa"
FT                   /db_xref="GOA:A0A0H3LJ47"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ47"
FT                   /protein_id="CAE31215.1"
FT                   /translation="MNTADAMLPLQGLRVIEMTHMVMGPTCGLVLADLGAEVIKVEPPG
FT                   AAERPGEHTRYLKGAGAGFFAACNRNKQSVILDLDTASGRETLYELAAGADVFLENFRP
FT                   GALAERGLGYEALSARNPGLVYCSLKGFLDGPYAERTALDEVAQMMSGLAYMTGPVGQP
FT                   LRAGAPVNDMMGGMFGAIAVMAALRQRERSGRGQHVVSGLFENAAWLVSTHMLQQAITG
FT                   VEPPPMSAGRRAWGVYDVFQSSDGKQIFIGVVTERQWQRFTEALGEPELRDPAYGDNNA
FT                   RAQARPTLIPLVGRLLARRTLDELQDLCTRAGLPFAPIARPWDLFDDPHLNAAQGLLPI
FT                   TLTDGRPAKVPGLPIQFDGRRLGVRRDVPRPGEHNEAVLSTLTGTAGRNQEEKQ"
FT   misc_feature    56649..57212
FT                   /note="HMMPfam hit to PF02515, DE CAIB/BAIF family, score
FT                   2.3e-47"
FT   CDS_pept        57608..58276
FT                   /transl_table=11
FT                   /locus_tag="BB0716"
FT                   /product="putative isochorismatase"
FT                   /note="Similar to Caulobacter crescentus isochorismatase
FT                   family protein Cc1170 SWALL:Q9A924 (EMBL:AE005795) (209 aa)
FT                   fasta scores: E(): 5.4e-17, 35.54% id in 211 aa, and to
FT                   Thermoplasma volcanium isochorismatase Tv0543 or Tvg0534221
FT                   SWALL:Q97BB4 (EMBL:AP000992) (208 aa) fasta scores: E():
FT                   2.1e-10, 24.88% id in 209 aa"
FT                   /db_xref="GOA:A0A0H3LQX7"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LQX7"
FT                   /protein_id="CAE31216.1"
FT                   /translation="MKLINGVEVRDTLEELIAPAHTALVVVDVQNDFCHPDGHFARHGK
FT                   NIDTIAGMLPALVPFVNAAQDMGIFTVFVQQLTLPHGRSDSPAWLRLKCRDGKSPEYTM
FT                   VGSWGAQLVDGLQPRAGDVMVQKFRPDAFVRTPLDGILRAQGIESLVIVGTTTEGCVES
FT                   TVRGASYHDYYVIPVTDLITGPIAQLHANSLAFMRARYPAAESAQVLQTWRAARGAAAA
FT                   "
FT   misc_feature    57656..58243
FT                   /note="HMMPfam hit to PF00857, DE Isochorismatase family,
FT                   score 3.7e-14"
FT   CDS_pept        58290..59270
FT                   /transl_table=11
FT                   /locus_tag="BB0717"
FT                   /product="putative exported protein"
FT                   /note="Similar to Comamonas testosteroni OrfJ protein
FT                   SWALL:Q9RHM9 (EMBL:AB029044) (326 aa) fasta scores: E():
FT                   8e-34, 39.48% id in 309 aa, and to Rhizobium meliloti
FT                   hypothetical protein Ra1058 or Sma1927 SWALL:Q92Y30
FT                   (EMBL:AE007292) (330 aa) fasta scores: E(): 1.5e-35, 38.15%
FT                   id in 304 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHV2"
FT                   /protein_id="CAE31217.1"
FT                   /translation="MTVSHVLRVAGRALLAACLLAAPAVQAAGYPDRPVRLLVGFAPGG
FT                   PTDLAARLVAKHLGADLGQAFIVENRAGAGGNIATKDAAGATPDGYTGLVAGINITINP
FT                   WMTADMHVDSRKDLLPVRIVAIAPTILVVRNDFPARDFQEFLREVRKHPDTYNSAAPGS
FT                   SPLLATELFSQQTGTRITPVPYKGASPAMIDLIAGHVDLSFATLGSVLPHIKSGKVRAL
FT                   ALAAPERDAQLPDVPTFAELGMQDFRFDAWAGVLMPAGTPPAVIDTLARSLDKLAGSAE
FT                   FEAQVLELGMKPVVQDSPSAFARTIDTELGLYKTLAQSVRGKIAQ"
FT   misc_feature    58290..58370
FT                   /note="Signal peptide predicted for BB0717 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.993 between residues 27 and 28"
FT   misc_feature    58437..59255
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 1.2e-73"
FT   CDS_pept        59267..60244
FT                   /transl_table=11
FT                   /gene="bcpA"
FT                   /locus_tag="BB0718"
FT                   /product="carboxyvinyl-carboxyphosphonate phosphorylmutase"
FT                   /EC_number="2.7.8.23"
FT                   /note="Similar to Streptomyces hygroscopicus
FT                   carboxyvinyl-carboxyphosphonate phosphorylmutase BcpA
FT                   SWALL:CPPM_STRHY (SWALL:P11435) (294 aa) fasta scores: E():
FT                   2.5e-40, 44.75% id in 286 aa, and to Anabaena sp.
FT                   carboxyphosphonoenolpyruvate phosphonomutase All1863
FT                   SWALL:Q8YVW0 (EMBL:AP003587) (287 aa) fasta scores: E():
FT                   1.4e-40, 43.4% id in 288 aa"
FT                   /db_xref="GOA:A0A0H3LHX2"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHX2"
FT                   /protein_id="CAE31218.1"
FT                   /translation="MTRVAAGMRAATIHQKYGVLLITSAHGKDYPLGLRQAQGRNAALR
FT                   RLLAAPELLVAPGAYDCVGARLVEQAGFAAIYLTGSGMSMSALGAPDVGLMSFSEILDR
FT                   AARVADMVSVPVIVDADTGYGGPLNLIRTVRAFERAGLSGIQIEDQAWPKKCGHEGGRN
FT                   LVSSAEMQGRIKAAVDARIDPDLVIIARTDARSDHGLDAALERAARYAEAGADVIFVES
FT                   PENEQELAAIAAAVKAPVLANMVEGGRTPILPASRLAQLGFAMAIYPNALTRCFAHAGL
FT                   EMLRGLAADGSTAGSAARMLSHRQLWSLFEYEKWIATEQRLGGA"
FT   CDS_pept        60323..61303
FT                   /transl_table=11
FT                   /locus_tag="BB0719"
FT                   /product="putative ABC transporter periplasmic
FT                   solute-binding protein"
FT                   /note="Similar to Rhizobium meliloti putative ABC
FT                   transporter periplasmic solute-binding protein Rb0039 or
FT                   Smb20036 SWALL:Q92XC3 (EMBL:AL603642) (338 aa) fasta
FT                   scores: E(): 3.3e-10, 24.85% id in 338 aa, and to
FT                   Fusobacterium nucleatum N-acetylneuraminate-binding protein
FT                   Fn1472 SWALL:Q8RDN9 (EMBL:AE010653) (327 aa) fasta scores:
FT                   E(): 5e-09, 25% id in 332 aa"
FT                   /db_xref="GOA:A0A0H3LMU1"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="PDB:4N4U"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMU1"
FT                   /protein_id="CAE31219.1"
FT                   /translation="MKKQLIGAVVATAMFAAPLAATAATWMAYTFGPSENLANVQGMKR
FT                   VMEDIEKNTGGEVKFRLRLAGSLPIQATDITQAVGNGTVRFADDGFYLGNVRIAGILRL
FT                   PMLLRSQEDFDKAYAIMKPYVERDFGKQGVVVLGHFSFPHQVIFSARKLESLADIKGQK
FT                   LRVSSPEQAAFVQRAGGIPVTLGGAEVPSALSAGTIDGALTASAGGGKIWGDMLKYNLR
FT                   LPVNYFDGFYLVNKKAFEALSPEMQAKMRESVARQAPGTTAQIAKEEGEVTDALRQKGM
FT                   VIVPSTPAMEQAATDLVSGYWEDWAREQGPEAVQALAEVRKALGR"
FT   misc_feature    60323..60391
FT                   /note="Signal peptide predicted for BB0719 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.887 between residues 23 and 24"
FT   misc_feature    60335..60403
FT                   /note="1 probable transmembrane helix predicted for BB0719
FT                   by TMHMM2.0 at aa 5-27"
FT   misc_feature    60401..61249
FT                   /note="HMMPfam hit to PF03480, DE Bacterial extracellular
FT                   solute-binding protein, family 7, score 4.5e-09"
FT   CDS_pept        61322..61846
FT                   /transl_table=11
FT                   /locus_tag="BB0720"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Rb0359 or Smb20373 SWALL:Q92WI0 (EMBL:AL603643) (155 aa)
FT                   fasta scores: E(): 0.00049, 31.57% id in 152 aa, and to
FT                   Halomonas elongata small transmembrane protein TeaB
FT                   SWALL:Q8VPB2 (EMBL:AY061646) (201 aa) fasta scores: E():
FT                   0.00084, 26.7% id in 161 aa"
FT                   /db_xref="GOA:A0A0H3LJ50"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ50"
FT                   /protein_id="CAE31220.1"
FT                   /translation="MNKPQSPARPGGLPLVSGLMRLQRLLSELIVLAMTLLIAAEVICR
FT                   ALFGFSLMIVEEVGGYLLVALVFLGMGVALHDGVLFRAEFVINALGERARLILQCVFDA
FT                   VCLAGMAMLSWQLGVQVYESYVRGVRAATTLATPLYLPQLFMVAGALSTALVLLSQLLE
FT                   GMTRLRSPHHE"
FT   misc_feature    join(61406..61474,61502..61570,61607..61675,61739..61807)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB0720 by TMHMM2.0 at aa 29-51, 61-83, 96-118 and 140-162"
FT   CDS_pept        61848..63140
FT                   /transl_table=11
FT                   /locus_tag="BB0721"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Agrobacterium tumefaciens putative
FT                   transmembrane protein DctM SWALL:Q9F7C8 (EMBL:AF282677)
FT                   (416 aa) fasta scores: E(): 4e-51, 40.97% id in 410 aa, and
FT                   to Pasteurella multocida hypothetical protein Pm1527
FT                   SWALL:Q9CKS9 (EMBL:AE006189) (442 aa) fasta scores: E():
FT                   6.5e-44, 35.51% id in 428 aa"
FT                   /db_xref="GOA:A0A0H3LQY2"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LQY2"
FT                   /protein_id="CAE31221.1"
FT                   /translation="MTQFVLVIAVFLVLLLAGMWIPFAIFLSASLYIVLYAGWDGLSGF
FT                   GLSSWGSMNSFTLTAIPLFILMAEIMLESGLSQRVYRGLARIVRRLPGGLLQTNIAGCA
FT                   AFSAISGSSVATAAAIGSVALPQLEARGYCLKLSTGTLAAGGTLGILIPPSIAMIIYGT
FT                   FTETSIAKLFMAGVVPGLALVVLFMCYVAVRCLVNPRLAPPPEQDTPPPLRQTLADLLP
FT                   FGALIVGVMGSLYAGLATPTEAAGVGACLAALIARIWGDCSIATLRRSLAKTVKACGAI
FT                   LFIVYAAFLFSYAIAMTGLTDSLTDLLDAWQLSRLELLLAVVLLYTVLGFLMDSIGMMV
FT                   ITVPILHPILASYGVDPIWFGVLLVVLIELGQITPPVGMNLFVVKSVSPSARLKDVVVG
FT                   SLPFCLLMYVLIAWLIYSPQLALWFPGRMTG"
FT   misc_feature    61848..62027
FT                   /note="Signal peptide predicted for BB0721 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.952) with cleavage site
FT                   probability 0.208 between residues 63 and 64"
FT   misc_feature    join(61857..61952,62010..62078,62139..62207,62265..62333,
FT                   62370..62438,62496..62564,62679..62747,62805..62873,
FT                   62892..62960,63033..63101)
FT                   /note="10 probable transmembrane helices predicted for
FT                   BB0721 by TMHMM2.0 at aa 7-38, 58-80, 101-123, 143-165,
FT                   178-200, 220-242, 281-303, 323-345, 352-374 and 399-421"
FT   CDS_pept        63145..64062
FT                   /transl_table=11
FT                   /locus_tag="BB0722"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Xylella fastidiosa hypothetical protein
FT                   Xf1742 SWALL:Q9PCN6 (EMBL:AE003997) (356 aa) fasta scores:
FT                   E(): 3.7e-15, 29.96% id in 307 aa, and to Xanthomonas
FT                   axonopodis gluconolactonase Xac0887 SWALL:AAM35775
FT                   (EMBL:AE011720) (286 aa) fasta scores: E(): 7.3e-15, 29.5%
FT                   id in 261 aa"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHV7"
FT                   /protein_id="CAE31222.1"
FT                   /translation="MFNPPSLIAAEVFCSVPERYRKRDQSAEWLRVQKRGATAHSFLEG
FT                   PAFDRAGNLYVTDIPYGRVFRISPAGDFELVAEYDGEPNGLKVHRDGRIFIADHKHGIM
FT                   LLDPASGAVVPYLDRPRLERFKGVNDLFFAPNGDLYFTDQGQSGLQDPSGRVYRYSAQG
FT                   QLSCLMDNIPSPNGIVLAPDGGSLLIAVTRANSVWRAPLLADGGVSKVAAFLNLSGGFG
FT                   PDGLALDQAGGLAVCHPGLGSVWLFDADGEPLARIRSQTGKVITNCAFGGPQRQWLYMT
FT                   EADSGLVLRARMPAPGIDLLEGQP"
FT   misc_feature    63241..64056
FT                   /note="HMMPfam hit to PF03758, DE Senescence marker
FT                   protein-30 (SMP-30), score 8.3e-07"
FT   CDS_pept        64059..64379
FT                   /transl_table=11
FT                   /locus_tag="BB0723"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli O157:H7 hypothetical
FT                   protein Z0890 or Ecs0759 SWALL:Q8X998 (EMBL:AE005251) (105
FT                   aa) fasta scores: E(): 7.3e-15, 46.46% id in 99 aa"
FT                   /db_xref="InterPro:IPR025496"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHX7"
FT                   /protein_id="CAE31223.1"
FT                   /translation="MKPSTPTRLVDVAKVIRSKNAGPLQTTLDLMFATAEHYRLARDSE
FT                   ALSAASVARLYGVAPDWVRVIPYEAAHAIKIVLDRPLPAGQPGDRDVYGAQQHYPLLDL
FT                   TL"
FT   CDS_pept        64376..65797
FT                   /transl_table=11
FT                   /locus_tag="BB0724"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli O157:H7 hypothetical
FT                   protein Z0891 or Ecs0760 SWALL:Q8X991 (EMBL:AE005251) (456
FT                   aa) fasta scores: E(): 5.5e-59, 37.96% id in 453 aa"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMU7"
FT                   /protein_id="CAE31224.1"
FT                   /translation="MTTAVQSLLAAGLKPGQPLRALAASGQLGYGIPTPAFHAGMARDP
FT                   HFVGCDMGSIDVGPYYLGSGRLATSEAITRRDLTLVLRGARERNVPLLIGTAGTSGAAP
FT                   HLSRTLEMLRDIARAERLDFKMAVIGADMPRDLVARQLQAGRVHPLGRIPPLDEAAVRD
FT                   AAHIVGQMGNEAFIRALACEPDVIVAGRACDTAVFASIPVMLGYDTALAVHMAKIIECT
FT                   SICCDPGGRDAILGTLERDSFTLESMNPERAATPVSVAAHSLYEQADPMTVQEPDGTLD
FT                   VGQARFEAVDARRTRVSGATWREASQKTVKIEGAQWVAERAVVCAGSCDPRVIANLAAI
FT                   EAGVRKNVAAVLEGSVADYELVFRVYGAGATQVYPGARIAAGAEVFFLLECLAATADAA
FT                   LAAATVAKQYLLHHGFPGRLSTGGNIAFPFTPPELRAGTAYRYSVYHVMECDDLPGLFP
FT                   VEVEQVRGGVQVAGG"
FT   misc_feature    64376..64444
FT                   /note="Signal peptide predicted for BB0724 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.646) with cleavage site
FT                   probability 0.637 between residues 23 and 24"
FT   CDS_pept        complement(65828..66604)
FT                   /transl_table=11
FT                   /locus_tag="BB0725"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Agrobacterium tumefaciens putative
FT                   transcriptional regulator SWALL:Q9F7C7 (EMBL:AF282677) (260
FT                   aa) fasta scores: E(): 1.7e-15, 30.73% id in 257 aa, and to
FT                   Streptomyces coelicolor putative IclR-family regulatory
FT                   protein Sco0574 or Sc5g5.06 SWALL:Q93RZ6 (EMBL:AL591823)
FT                   (277 aa) fasta scores: E(): 1.5e-15, 31.71% id in 227 aa"
FT                   /db_xref="GOA:A0A0H3LJ52"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ52"
FT                   /protein_id="CAE31225.1"
FT                   /translation="MKDSDSAELEEKPEKGGDSVRAVNRALDILLAFSRQDAELTASQL
FT                   LQRVGLSRPTLYRLLYTLEAKGFITASGDPQRFRLGPAVARLSHIWTETQDLAALAEPL
FT                   LRELWNETQETVAIFVEQGEMRLCLAELPSPQPLSFKRGVGYTERIAMGATGRAILAFK
FT                   EDALDHLEQYTRGLPLDPARFRRELKQTRQLGYATSRDELIVGAAAVAAPFFNGDRVAG
FT                   SIGLFGPATRLDEAAVAALGPRVVALARKLSQALGG"
FT   misc_feature    complement(65840..66373)
FT                   /note="HMMPfam hit to PF01614, DE Bacterial transcriptional
FT                   regulator, score 6.1e-22"
FT   misc_feature    complement(66422..66487)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1719.000, SD 5.04 at aa 42-63, sequence
FT                   LTASQLLQRVGLSRPTLYRLLY"
FT   CDS_pept        66768..67742
FT                   /transl_table=11
FT                   /locus_tag="BB0726"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Ra1058 or Sma1927 SWALL:Q92Y30 (EMBL:AE007292) (330 aa)
FT                   fasta scores: E(): 1.4e-36, 36.42% id in 324 aa, and to
FT                   Comamonas testosteroni OrfJ protein SWALL:Q9RHM9
FT                   (EMBL:AB029044) (326 aa) fasta scores: E(): 8.2e-30, 35.22%
FT                   id in 335 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LQY7"
FT                   /protein_id="CAE31226.1"
FT                   /translation="MRKSFLSGAAALLALACALGAPGARAAYPERPVSVVVGFAPGGTN
FT                   DILARLISAKLQARLKQPFVVENRAGANSIIAAEYVARAQPDGYTIFVASSGALTINPA
FT                   IYTKLGYDPQQAFKPVAMLGVFPLVVVTNAESKAERLADLKTLAAQRSDHTLNHGVGSS
FT                   TFQLAAEYYARQTGLSLMHISYRGTGPLLSALLANEVDVGFADVAAVVSQIGAGKLKPL
FT                   AVTTAERSSVLPDVPTIAEAGVPGYDVPVWTGLVVPKDTPDEVVRALQGALKEILADPD
FT                   TLAQYRPLGMEPGNVDGAALQQRIGDDIARWTKVAREADIKAN"
FT   misc_feature    66768..66845
FT                   /note="Signal peptide predicted for BB0726 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.720 between residues 26 and 27"
FT   misc_feature    66786..66818
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    66909..67730
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 6.7e-78"
FT   CDS_pept        67764..68765
FT                   /transl_table=11
FT                   /locus_tag="BB0727"
FT                   /product="electron transfer component of a dioxygenase
FT                   system"
FT                   /EC_number="1.18.1.3"
FT                   /note="Similar to Pseudomonas putida toluate
FT                   1,2-dioxygenase electron transfer component [includes:
FT                   ferredoxin; ferredoxin--NAD(+) reductase] xylZ
FT                   SWALL:XYLZ_PSEPU (SWALL:P23101) (336 aa) fasta scores: E():
FT                   3.2e-31, 34.25% id in 327 aa, and to Burkholderia sp. NK8
FT                   electron transfer component of chlorobenzoate
FT                   1,2-dioxygenase CbeC SWALL:Q9AQS2 (EMBL:AB024746) (342 aa)
FT                   fasta scores: E(): 2.1e-31, 35.41% id in 336 aa"
FT                   /db_xref="GOA:A0A0H3LHW0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHW0"
FT                   /protein_id="CAE31227.1"
FT                   /translation="MDTVPITLLFSDGAARRIDARCGASIVQAAGDAGLGLLTDCSNGQ
FT                   CGTCTATLVSGAIELGDYDRAVLPDGDRADGAILTCVSRITGPCVVELPYEVDEAQAQP
FT                   LPPMAGTVVALEQIAQETMLLEVEVAEAVGFQPGQYVRIRPEGLDAWRSYSMACGSGER
FT                   RLRFYVRLVEGGVFSTWLTQAARVGASVALSEPHGSFFLRSEARPRLFIAGGTGLAPFL
FT                   SMLQAIAADPAQQEIPTTLLVGARSGAHLFALDQLAALRERWPALRVRLAAESEPRGEC
FT                   HTGYATDLLAGLGLDPATRVYLCGPPAMVEAGRGAAEAVGLARRDMLCERFN"
FT   misc_feature    67788..68024
FT                   /note="HMMPfam hit to PF00111, DE 2Fe-2S iron-sulfur
FT                   cluster binding domain, score 1.1e-08"
FT   misc_feature    67884..67910
FT                   /note="PS00197 2Fe-2S ferredoxins, iron-sulfur binding
FT                   region signature."
FT   misc_feature    68088..68369
FT                   /note="HMMPfam hit to PF00970, DE Oxidoreductase
FT                   FAD-binding domain, score 1.4e-17"
FT   misc_feature    68379..68711
FT                   /note="HMMPfam hit to PF00175, DE Oxidoreductase
FT                   NAD-binding domain, score 1.8e-23"
FT   CDS_pept        68780..70144
FT                   /transl_table=11
FT                   /gene="hcaE"
FT                   /locus_tag="BB0728"
FT                   /product="hydroxylating alpha subunit of a dioxygenase
FT                   system"
FT                   /note="Similar to Escherichia coli and Escherichia coli
FT                   O157:H7 3-phenylpropionate dioxygenase alpha subunit HcaE
FT                   or PhdC1 or HcaA or HcaA1 or DigA or b2538 or z3809 or
FT                   ecs3404 SWALL:HCAE_ECOLI (SWALL:Q47139) (453 aa) fasta
FT                   scores: E(): 3.8e-63, 38.2% id in 445 aa, and to
FT                   Sphingomonas sp putative ring-hydroxylating dioxygenase,
FT                   large subunit SWALL:O86913 (EMBL:AJ223220) (416 aa) fasta
FT                   scores: E(): 4.4e-79, 48.44% id in 386 aa"
FT                   /db_xref="GOA:A0A0H3LHY0"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHY0"
FT                   /protein_id="CAE31228.1"
FT                   /translation="MPNMQPTHYDRMVDLKQGTISREIFSSKEIFEEELEKIFTRAWLF
FT                   VGHESQIPNPGDFYTSRMGAESVILTRDKKGKVHVFLNSCRHRGMKVCQYDHGNTQLFT
FT                   CPYHSWSYTTEGKLFGVPQYKAIYDGNLCKEDWSLIEVPKLETYKGTVWASWDKNAPDF
FT                   LTYLGDARTHLDLALDHRDGREGGSEVLVGVHKWIIPCNWKFAAENFLGDTYHNVSHRS
FT                   VDLIGIGPSAEVGVKGRRDNELEYARHLWVNFPAGHGVHSAIVPENAPFVDTFQNNPII
FT                   AEYFRHCHEERKRRLGEERSRLVPFVGTIYPNVSFHGKQPRNLCIWHPHGPEATEAWRF
FT                   FLVDADAPQEVKDFLRTYYMRYSGPAGMTEQDDMENWNYATAGSRGVIAKRYPYNYQQS
FT                   LGAVTNAGPVPGNVSLQVSEENPRQYYRRWRDYMNGADWDTLLGRNDSGPASFAQ"
FT   misc_feature    68903..69208
FT                   /note="HMMPfam hit to PF00355, DE Rieske [2Fe-2S] domain,
FT                   score 7.7e-30"
FT   misc_feature    69032..69103
FT                   /note="PS00570 Bacterial ring hydroxylating dioxygenases
FT                   alpha-subunit signature."
FT   misc_feature    69266..70093
FT                   /note="HMMPfam hit to PF00848, DE Ring hydroxylating alpha
FT                   subunit (catalytic domain), score 6.8e-52"
FT   CDS_pept        70141..70980
FT                   /transl_table=11
FT                   /locus_tag="BB0729"
FT                   /product="putative short chain dehydrogenase"
FT                   /note="Similar to Rhizobium etli putative short chain type
FT                   dehydrogenase reductase Yp008 SWALL:AAM54803 (EMBL:U80928)
FT                   (280 aa) fasta scores: E(): 1.1e-17, 37.27% id in 279 aa,
FT                   and to Ralstonia solanacearum probable toluenesulfonate
FT                   zinc-independent alcohol dehydrogenase oxidoreductase
FT                   protein TsaC or rsc2351 or rs01195 SWALL:Q8XWW9
FT                   (EMBL:AL646069) (252 aa) fasta scores: E(): 4.5e-18, 36.82%
FT                   id in 258 aa"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMV1"
FT                   /protein_id="CAE31229.1"
FT                   /translation="MSAQGNGPVTIVTGGTFGLGQAITLSLARRGHRVLAFGLESAQAS
FT                   STAAGFDGLRAALAEAGLQERVAVMAADVADEADTGRVVDEALRRYGRVDGLVNNAAIG
FT                   PLGTVLSTEPAMADRILAVNVKGVYLMSRAVIPHMRAQGGGAIVNIGSGAGYGKPDMAI
FT                   YAASKGAVLALSSAMAYDHFHDRIRVNVAIPGGGGIVSGMSVGRVGGDEALFRRRQAAG
FT                   SAAGRPASGEDLANAVAFLLSGEAEAISGTVVDVGCFANQGGPVPARPSTNRGHSHD"
FT   misc_feature    70156..70932
FT                   /note="HMMPfam hit to PF00106, DE short chain
FT                   dehydrogenase, score 1.1e-45"
FT   misc_feature    70639..70686
FT                   /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature."
FT   CDS_pept        70973..71557
FT                   /transl_table=11
FT                   /locus_tag="BB0730"
FT                   /product="hydroxylating beta subunit of a dioxygenase
FT                   system"
FT                   /EC_number="1.14.12.3"
FT                   /note="Similar to Pseudomonas putida benzene
FT                   1,2-dioxygenase beta subunit bedc2 SWALL:BED2_PSEPU
FT                   (SWALL:Q07945) (187 aa) fasta scores: E(): 1.9e-17, 36.99%
FT                   id in 173 aa, and to Rhodococcus erythropolis
FT                   isopropylbenzene 2,3-dioxygenase ipba2 SWALL:P72257
FT                   (EMBL:U24277) (187 aa) fasta scores: E(): 2.1e-18, 36.31%
FT                   id in 190 aa"
FT                   /db_xref="GOA:A0A0H3LJ54"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ54"
FT                   /protein_id="CAE31230.1"
FT                   /translation="MTETLACADSPAIAPLARDARYYELKREIEEHMYDECELLDTRQF
FT                   SRWLDTLAEDLVYFMPMNFNVKFGRHAQDEHTRVEKDMSWFNEGKWTLTKRAEQIMTGV
FT                   HWAEEPLSRLCRVVSNVQLTAIAEGADGALEVDARSRFVMYQNRCEYEEYYFTGRRYDR
FT                   LRRVGDGWQLVRREIHLPQNVLLAKNLTMFF"
FT   misc_feature    71075..71536
FT                   /note="HMMPfam hit to PF00866, DE Ring hydroxylating beta
FT                   subunit, score 4.5e-33"
FT   CDS_pept        71567..71755
FT                   /transl_table=11
FT                   /locus_tag="BB0731"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LQZ2"
FT                   /protein_id="CAE31231.1"
FT                   /translation="MLNLMQLQPGQLLALRDGRKGEVVENMGDGIWVQVRWLDQEGRPL
FT                   DGGEDELVHCEEVAGLA"
FT   CDS_pept        71880..73526
FT                   /transl_table=11
FT                   /gene="cadA"
FT                   /locus_tag="BB0732"
FT                   /product="FAD-monooxygenase"
FT                   /note="Similar to Pseudomonas putida FAD-monooxygenase CadA
FT                   SWALL:Q93AG2 (EMBL:AF421356) (553 aa) fasta scores: E():
FT                   1e-121, 56.37% id in 541 aa, and to Nocardia
FT                   aerocolonigenes putative monooxygenase SWALL:CAC93716
FT                   (EMBL:AJ414559) (529 aa) fasta scores: E(): 3.8e-36, 34.18%
FT                   id in 550 aa"
FT                   /db_xref="GOA:A0A0H3LHW6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHW6"
FT                   /protein_id="CAE31232.1"
FT                   /translation="MGSTEKHPVIVVGAGPVGLTVAMDMASRGVSVLVLERRHRGEAPS
FT                   VKCNHVSARSMEVFRRLGVAQAVRAAGLPDEYPHDVAYRTSATGIELTRIPIPGRAGRQ
FT                   RKDTGPDTNWPTMEPPHRINQIYLEPILFEHAAGMERIAIRNRVEVTEIEQDDEGVTVH
FT                   ARDLDSGESLRMRADYLVGCDGGRSAIRTAIGAKLVGDAVIQRVQSSYIRAPQLRQLFK
FT                   HEPAWATFTLNPARCGNMYAIDGKELWLVHNYLRDEEPDFESVDRDLCIRRILGVGEDF
FT                   EYELISKEDWYGRRLVADRFRDRRVFICGDAAHLWVPYAGYGMNAGIADAANLAWLLAA
FT                   TVNGWADARILDAYVSERHPITSQVSYFVMDHAHAMATERRIVPENIEAQDEAGAAVRA
FT                   QVGERAYALNVQQYCCAGLNFGYFYDQSPLIAYDGESQPAYTMGDFTPSTVPGCRTPHF
FT                   QLADGASLYDAMGDGYTVLRLKAGVDVQPLVEAAARRGMPLRVLDLEGEDAPPAYRHAL
FT                   VISRPDQHVAWRGDTLPADPQALVDQLRGAA"
FT   misc_feature    71904..72317
FT                   /note="HMMPfam hit to PF01494, DE FAD binding domain, score
FT                   2.3e-14"
FT   misc_feature    72405..72989
FT                   /note="HMMPfam hit to PF01360, DE Monooxygenase, score
FT                   8.7e-32"
FT   CDS_pept        73567..74532
FT                   /transl_table=11
FT                   /locus_tag="BB0733"
FT                   /product="putative exported protein"
FT                   /note="Similar to Agrobacterium tumefaciens hypothetical
FT                   protein Atu4727 or Agr_l_312 SWALL:Q8U6S9 (EMBL:AE009401)
FT                   (329 aa) fasta scores: E(): 1.3e-46, 46.68% id in 317 aa,
FT                   and to Comamonas testosteroni OrfJ protein SWALL:Q9RHM9
FT                   (EMBL:AB029044) (326 aa) fasta scores: E(): 6.3e-37, 37.53%
FT                   id in 325 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHY3"
FT                   /protein_id="CAE31233.1"
FT                   /translation="MKLLSHFFKAAAILAVSGAACAADAPMTLVVPYAPGGATDILART
FT                   VAQHMGDELKRSIVVENRPGGGTIIGAQLVSRAAPDSGMLLMATSTTLAINRTMYKSLP
FT                   YDPQAFAPVGLVAEVPLVVVVNPSVKADSLADLVALAKANPGTLTFGSAGSGSPQHLSA
FT                   EMFRAATGASMTHVPYKGTSAALNDLLGGQISMMFADLAPVLAHIRSGKLRALAVTSAQ
FT                   RQPNLPDTPTVRESQVPGTADYEAVAWQSLVAPPGTPAETVQAYNAALVKVLGEADVKA
FT                   RFEANGVSVRTSTPQELADYIRTEGDRWAKVVKASGASAD"
FT   misc_feature    73567..73632
FT                   /note="Signal peptide predicted for BB0733 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.795 between residues 22 and 23"
FT   misc_feature    73597..73629
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    73690..74520
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 3.1e-101"
FT   CDS_pept        74577..75251
FT                   /transl_table=11
FT                   /gene="hpaG"
FT                   /locus_tag="BB0734"
FT                   /product="putative fumarylacetoacetate hydrolase family
FT                   protein"
FT                   /EC_number="5.3.3.-"
FT                   /note="Similar to the N-terminal region of Escherichia coli
FT                   4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase HpaG SWALL:HPAG_ECOLI
FT                   (SWALL:Q46978) (429 aa) fasta scores: E(): 2.9e-20, 37.25%
FT                   id in 204 aa, and similar to Pseudomonas aeruginosa
FT                   hypothetical protein Pa4121 SWALL:Q9HWR0 (EMBL:AE004828)
FT                   (219 aa) fasta scores: E(): 7.1e-22, 37.25% id in 204 aa"
FT                   /db_xref="GOA:A0A0H3LMV4"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012686"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMV4"
FT                   /protein_id="CAE31234.1"
FT                   /translation="MSDPLSQLYDDPPYRLSGVVYGALLNQREALDRLGEAVNQPPYKA
FT                   PPKGPVLYMKPRNTLARDGQAIALAADVPAMRLGATLGLVLGRTACRVDAAEALDYVAG
FT                   VVLVADLTVPHDSFYRPSARFVARDRSCFIGPRIVPLAEAGDPDAMVIHVTVDGKPAQA
FT                   ASMGGRVRPAARLLADVTDFMTLSPGDILLLGTCVDQPQVGRGQAFALAAEGMGELHGE
FT                   TQ"
FT   misc_feature    74598..74618
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT   misc_feature    74706..75200
FT                   /note="HMMPfam hit to PF01557, DE Fumarylacetoacetate (FAA)
FT                   hydrolase family, score 3.6e-09"
FT   CDS_pept        75248..76015
FT                   /transl_table=11
FT                   /locus_tag="BB0735"
FT                   /product="putative fumarylacetoacetate hydrolase family
FT                   protein"
FT                   /EC_number="5.3.3.-"
FT                   /note="Similar to the N-terminal region of Escherichia coli
FT                   4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase HpaG SWALL:HPAG_ECOLI
FT                   (SWALL:Q46978) (429 aa) fasta scores: E(): 1.3e-42, 57.82%
FT                   id in 211 aa, and to Pseudomonas aeruginosa hypothetical
FT                   protein Pa4122 SWALL:Q9HWQ9 (EMBL:AE004828) (259 aa) fasta
FT                   scores: E(): 9.6e-58, 58.98% id in 256 aa"
FT                   /db_xref="GOA:A0A0H3LJ57"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012684"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ57"
FT                   /protein_id="CAE31235.1"
FT                   /translation="MKRARVAYGGAIHSATPHEQGLLLADGRVVAEDAVVWLPPVEVGT
FT                   LIVLGLNYADHVKELSKELTVTTRDEPLVFFKGPGAVVGHRAQTRRPRDATYMHYECEL
FT                   AVVIGKPAKDVKAADAMAHVAGYTVCNDYAIRDYLENWYRPNLRVKNRDTCTVMGPWLV
FT                   DAADVADPHALALRTLVNGKVTQQGSTADMINDIAALIEYLSGFMTLMPGDVILTGTPD
FT                   GVVNVEEGDEVVCEIEGIGALANTIVGDAVFGR"
FT   misc_feature    75437..75934
FT                   /note="HMMPfam hit to PF01557, DE Fumarylacetoacetate (FAA)
FT                   hydrolase family, score 7.6e-69"
FT   CDS_pept        76025..77494
FT                   /transl_table=11
FT                   /gene="hpaE"
FT                   /locus_tag="BB0736"
FT                   /product="5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /note="Similar to Escherichia coli
FT                   5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase HpaE SWALL:Q46979 (EMBL:Z37980) (488 aa)
FT                   fasta scores: E(): 7.9e-133, 67.82% id in 488 aa, and to
FT                   Salmonella typhimurium 4-hydroxyphenylacetate catabolism
FT                   HpaE or Stm1102 SWALL:Q8ZQ48 (EMBL:AE008747) (488 aa) fasta
FT                   scores: E(): 2.5e-133, 68.03% id in 488 aa"
FT                   /db_xref="GOA:A0A0H3LR06"
FT                   /db_xref="InterPro:IPR011985"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LR06"
FT                   /protein_id="CAE31236.1"
FT                   /translation="MRIEHLIDGKAVAGKQYFETINPATQETLAEVAAGGEAEVHAAVA
FT                   AAKAAFPKWAGLPAAERARLVRKLGDLIAAHVPEISRTETNDCGQTIAQTGKQLVPRAA
FT                   DNFYYFAEMCTRVDGHTYPTPTHLNYTLYHPVGVCALISPWNVPFMTATWKVAPCLAFG
FT                   NTAVLKMSELSPLTAARLGELALEAGIPPGVLNLVHGYGRDAGEPLVAHPDVRAVSFTG
FT                   STATGNRIVQAAGLKKFSMELGGKSPFVIFDDADLDRALDAAIFMIFSNNGQRCTAGSR
FT                   ILVQQSIYADFTQKFVERARRIRVGDPLDEGTIVGPLISPAHLAKVRGYIELGSKEGAT
FT                   MLCGGLDRPSYAPELDARVRDGNFVWPTVFADVDNRMKIAQDEIFGPVACLIPFRDEAH
FT                   AIELANDIEYGLSSYVWTESVGRAHRVAAAIEAGMCFVNSQNVRDLRQPFGGTKASGTG
FT                   REGGTWSYEVFCEPKNVAVSLGNHHIPHWGA"
FT   misc_feature    76052..77461
FT                   /note="HMMPfam hit to PF00171, DE Aldehyde dehydrogenase
FT                   family, score 6.1e-194"
FT   misc_feature    76745..76768
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT   misc_feature    76829..76864
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT   CDS_pept        77491..78360
FT                   /transl_table=11
FT                   /gene="hpaD"
FT                   /locus_tag="BB0737"
FT                   /product="homoprotocatechuate 2,3-dioxygenase"
FT                   /EC_number="1.13.11.15"
FT                   /note="Similar to Pseudomonas sp. DJ-12 homoprotocatechuate
FT                   2,3-dioxygenase HpaD SWALL:Q93A27 (EMBL:AF433158) (287 aa)
FT                   fasta scores: E(): 1.8e-101, 80.35% id in 285 aa, and to
FT                   Escherichia coli 3,4-dihydroxyphenylacetate 2,3-dioxygenase
FT                   HpaD SWALL:Q46980 (EMBL:Z37980) (282 aa) fasta scores: E():
FT                   8.1e-78, 66.54% id in 281 aa"
FT                   /db_xref="GOA:A0A0H3LHW9"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR011984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHW9"
FT                   /protein_id="CAE31237.1"
FT                   /translation="MTMGKLALAAKITHVPSMYLSELDGPNKGCRQAAIDGHKEISRRC
FT                   RELGVDTIVVFDVHWLVNSDYHINCAPRFSGCYTSNELPHFIKNMDYEYPGNPALGHLI
FT                   ADVANEMGVATRAHSETSLGMEYGTLVPMRYMNEDQHFKVVSVSGWCVWHDLATSVRFG
FT                   QAVRKAIEERYDGTVAVLASGSLSHHFAENGTAPEYMHKVWDPFLEQVDRRVVELWEQG
FT                   DWQTFCPMLKLYAEQCWGEGGMHDTAMLLGALGWTDYDQPVEVVTPYFGSSGTGQINAI
FT                   FPVSPLKV"
FT   misc_feature    77530..78330
FT                   /note="HMMPfam hit to PF02900, DE Catalytic LigB subunit of
FT                   aromatic ring-opening dioxygenase, score 1.2e-55"
FT   CDS_pept        78362..78799
FT                   /transl_table=11
FT                   /gene="hpaF"
FT                   /locus_tag="BB0738"
FT                   /product="5-carboxymethyl-2-hydroxymuconate
FT                   delta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="Similar to Escherichia coli
FT                   5-carboxymethyl-2-hydroxymuconate delta-isomerase HpaF
FT                   SWALL:Q46981 (EMBL:Z37980) (125 aa) fasta scores: E():
FT                   0.008, 25.71% id in 140 aa, and to Deinococcus radiodurans
FT                   5-carboxymethyl-2-hydroxymuconate isomerase Dra0227
FT                   SWALL:Q9RYT1 (EMBL:AE001863) (128 aa) fasta scores: E():
FT                   0.00078, 31.69% id in 142 aa"
FT                   /db_xref="GOA:A0A0H3LHY8"
FT                   /db_xref="InterPro:IPR004220"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="PDB:4JJ9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHY8"
FT                   /protein_id="CAE31238.1"
FT                   /translation="MPHLVILYSGNLDRDLDMGAVCRGLADAMLTVRDDEGRQVFPTGG
FT                   TRVLAYPAPHYAIADGGQAGRDAGESGDYGFAYLNLRMGRGRSEAVQRRAGETIAQAAR
FT                   ALLAPLLQQRRVGLTFQIDVGAEVYDAKFGNLHALFQKGEK"
FT   misc_feature    78365..78781
FT                   /note="HMMPfam hit to PF02962, DE
FT                   5-carboxymethyl-2-hydroxymuconate isomerase, score 6e-09"
FT   CDS_pept        78799..79614
FT                   /transl_table=11
FT                   /gene="hpcG"
FT                   /locus_tag="BB0739"
FT                   /product="2-oxo-hepta-3-ene-1,7-dioic acid hydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="Similar to Rhodococcus sp
FT                   2-oxo-hepta-3-ene-1,7-dioic acid hydratase BphE or EtbE
FT                   SWALL:O05150 (EMBL:D78322) (267 aa) fasta scores: E():
FT                   3.6e-61, 61.11% id in 270 aa, and to Escherichia coli
FT                   2-oxo-hepta-3-ene-1,7-dioic acid hydratase HpcG
FT                   SWALL:HPCG_ECOLI (SWALL:P42270) (264 aa) fasta scores: E():
FT                   2e-52, 56.27% id in 263 aa"
FT                   /db_xref="GOA:A0A0H3LMV9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012690"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMV9"
FT                   /protein_id="CAE31239.1"
FT                   /translation="MLSEALIGELAAQLYESERTRVQVEHFSKRHPEITIEDGYRISRA
FT                   WVAMQRADGRRVIGHKIGLTSRAMQQASQIDEPDYGTLLDHMLYTCQPGQELAIPFERF
FT                   IAPRVEVELAFVLKAPLRGPEVTVEQVLAATEYVTPAIEIIDSRIEQFDRHTRAMRKVF
FT                   DTISDNAANAGVVTGAQRVSPQALDLPWCGAVLRQNGVVEETGLAAGVQGHPAIGVAWL
FT                   ANKLAPWGETLEPGQLVLAGSFTRPVAARKGDAFEADYGPLGAMRFRFV"
FT   misc_feature    78808..79494
FT                   /note="HMMPfam hit to PF01689, DE Hydratase/decarboxylase,
FT                   score 1e-111"
FT   CDS_pept        79617..80426
FT                   /transl_table=11
FT                   /gene="hpaI"
FT                   /gene_synonym="hpcH"
FT                   /locus_tag="BB0740"
FT                   /product="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase"
FT                   /EC_number="4.1.2.-"
FT                   /note="Similar to Escherichia coli
FT                   2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase HpcH or
FT                   HpaI SWALL:HPAI_ECOLI (SWALL:Q47098) (262 aa) fasta scores:
FT                   E(): 4.3e-60, 64.88% id in 262 aa, and to Deinococcus
FT                   radiodurans 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase
FT                   Dra0291 SWALL:Q9RYM1 (EMBL:AE001863) (277 aa) fasta scores:
FT                   E(): 1.1e-65, 67.39% id in 273 aa"
FT                   /db_xref="GOA:A0A0H3LJ60"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR012689"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ60"
FT                   /protein_id="CAE31240.1"
FT                   /translation="MVMDIPRNTFKAALRQGQVQIGLWVGLADPYAAEAVAGAGYDWLL
FT                   IDGEHAPNDVRQMLSQLQAVAPYPVHPVVRPVIGDVPLIKQILDIGAQTLLVPVVESAE
FT                   EAATMVAATRYPPRGIRGVGSALARSSRWNQIPDYLHKADEEMCVLVQVETRAGMEQLD
FT                   AITQVEGVDGVFFGPADLSASMGHLGNPGHPDVQAAILDAIRRVRAAGKAPGILTADVK
FT                   LARQYIEAGALFVAVGVDTTLLVRGARDLVRQFKDEPAAQPSGPSVY"
FT   misc_feature    79626..80384
FT                   /note="HMMPfam hit to PF03328, DE HpcH/HpaI aldolase
FT                   family, score 2.4e-144"
FT   CDS_pept        80500..81414
FT                   /transl_table=11
FT                   /locus_tag="BB0741"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="Similar to Comamonas testosteroni TsaR SWALL:P94678
FT                   (EMBL:U32622) (298 aa) fasta scores: E(): 1.8e-19, 31.72%
FT                   id in 290 aa, and to Escherichia coli putative
FT                   transcriptional regulator AbgR or b1339 SWALL:ABGR_ECOLI
FT                   (SWALL:P77744) (302 aa) fasta scores: E(): 4.3e-19, 26.78%
FT                   id in 295 aa"
FT                   /db_xref="GOA:A0A0H3LR15"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LR15"
FT                   /protein_id="CAE31241.1"
FT                   /translation="MAVVSHGGFRAAARALDVSQGGLTKSIAALEQEYGVDLIERSAKG
FT                   VLLTPKGAAFVPLARAIVEEAERAEGWLRAQSGELSTSVSLGVSIEPSIRLAPAVLRDF
FT                   RKALPDTSVHLTQGVALDLLGALRENRIELAVIRLPRNFDSSDLKVQRLYQSEPVIVGR
FT                   AGHPGAGAASLRELVKYDWVVVGDTSRQGAMNDDSIWELFDREGLGRPRFAAVCNSLLS
FT                   IVAMLMESDALARVPRALLDHSLARRNLIPIPVAEPPVPYWIATVHKASRRLSPEAQTL
FT                   NAMLSSYARISGALSPERRPGEP"
FT   misc_feature    80500..80658
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 5.3e-10"
FT   misc_feature    80518..80583
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1012.000, SD 2.63 at aa 7-28, sequence
FT                   GGFRAAARALDVSQGGLTKSIA"
FT   misc_feature    80521..80613
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    80650..80673
FT                   /note="PS00030 Eukaryotic putative RNA-binding region RNP-1
FT                   signature."
FT   misc_feature    80728..81369
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 5.6e-29"
FT   CDS_pept        81557..82534
FT                   /transl_table=11
FT                   /locus_tag="BB0742"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Ra1058 or Sma1927 SWALL:Q92Y30 (EMBL:AE007292) (330 aa)
FT                   fasta scores: E(): 2.2e-34, 38.94% id in 303 aa, and to
FT                   Comamonas testosteroni OrfJ protein SWALL:Q9RHM9
FT                   (EMBL:AB029044) (326 aa) fasta scores: E(): 4.4e-33, 36.47%
FT                   id in 318 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHX3"
FT                   /protein_id="CAE31242.1"
FT                   /translation="MQAIFKGLIIAATALSAGAATAAPAYPSKPVTLIVPFAPGASADG
FT                   VARLLGRKLADGLGQPVVVENRPGAGGTTGLMALAHAAPDGYTLAIGATGAIAVNHHLP
FT                   DAAPLDAAKQLAPVAKVADIPLVFIASRQSQLRSMQDIAAQAARTKGGLSYGTSGQFTS
FT                   QHLAGELYADMAKTALVAVPYRGSSPALTDVIAGQVPLAVVDLTSAFPQIKAGKVTGLA
FT                   VTGTRRAIAAPDIPTVAELGFPGYAASGWLGMFAPAGTPAPVVAQVSAQLETILADPQV
FT                   GAELLTLAVEPAYLDPAEFAAYARAESDKWGKVIGAMGQAKSQP"
FT   misc_feature    81557..81622
FT                   /note="Signal peptide predicted for BB0742 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.968 between residues 22 and 23"
FT   misc_feature    81692..82516
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 2e-79"
FT   CDS_pept        82562..84238
FT                   /transl_table=11
FT                   /locus_tag="BB0743"
FT                   /product="Thiamine pyrophosphate enzyme"
FT                   /note="Similar to Citrobacter freundii valine-sensitive
FT                   acetohydroxy acid synthase SWALL:P94783 (EMBL:D89674) (561
FT                   aa) fasta scores: E(): 5.2e-35, 30.03% id in 536 aa, and to
FT                   Rhizobium meliloti putative acetolactate synthase isozyme I
FT                   large subunit protein IlvB1 or r00567 or smc02263
FT                   SWALL:Q92S59 (EMBL:AL591784) (537 aa) fasta scores: E():
FT                   3.6e-42, 35.49% id in 541 aa"
FT                   /db_xref="GOA:A0A0H3LHZ4"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHZ4"
FT                   /protein_id="CAE31243.1"
FT                   /translation="MKAAMTGGEVFVEGLVRNGVKDLFFIPGIQLDWAVEALRKRAGEI
FT                   NLYVPRHEQTTTYMADGYYRVTGKPGTAMVVPGPGALNAGAGLATAYASGSRMVFVTPQ
FT                   IHADGVGKGYGLLHEIKDQSGFVQGLTKWHRFVGAPADIGASVDAAYAQAGQGRARPVG
FT                   LEIPHNYFQAEVAGQDEAVPPARPAEPPMLDEQAIAAAAALIGQARLPVLYVGGGVFPT
FT                   GAHEAVRRVAERIGAPVVMSDNGRGALPDHHPLAMNSLAGRAVFQHADVVVVVGSRFID
FT                   ALMPAASWPAGRARFVYINIDAADMTAPRAPDVAIAADAAHALAALEERLRSRTAFTHE
FT                   QAARVKAWAQAQIDRIEPQAAYIRAMRDALPEDGIFVNELTQVGYLSRIAFPVHAPRTY
FT                   IGPGYQGTLGYGFPVALGAAVGGAGRRVLSITGDGGFGWNLQELATARRYNLPVTLVVF
FT                   NDGHYGNVRAIQKREFGAEVAVDLCNPDFQLLARAFGIPSEQVDSPAALGAAIKASLSG
FT                   GPALIEVKMGEVPSPWHLLRLQPMAGMAGPQAAANPLDGDY"
FT   misc_feature    82568..83098
FT                   /note="HMMPfam hit to PF02776, DE Thiamine pyrophosphate
FT                   enzyme, N-terminal TPP binding domain, score 2.2e-17"
FT   misc_feature    83141..83617
FT                   /note="HMMPfam hit to PF00205, DE Thiamine pyrophosphate
FT                   enzyme, central domain, score 3.7e-21"
FT   misc_feature    83615..84133
FT                   /note="HMMPfam hit to PF02775, DE Thiamine pyrophosphate
FT                   enzyme, C-terminal TPP binding domain, score 1.2e-35"
FT   CDS_pept        84235..85674
FT                   /transl_table=11
FT                   /locus_tag="BB0744"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /note="Similar to Rhodococcus ruber 6-oxolauric acid
FT                   dehydrogenase CddD SWALL:Q938F1 (EMBL:AY052630) (474 aa)
FT                   fasta scores: E(): 1.9e-68, 43.46% id in 474 aa, and to
FT                   Deinococcus radiodurans aldehyde dehydrogenase Dra0126
FT                   SWALL:Q9RZ27 (EMBL:AE001862) (495 aa) fasta scores: E():
FT                   7.5e-68, 46.48% id in 469 aa"
FT                   /db_xref="GOA:A0A0H3LMW4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMW4"
FT                   /protein_id="CAE31244.1"
FT                   /translation="MMDYAEFYADGAFHPCGGAAVLPVYNPATEQAEASVRACSADDLE
FT                   RAVRAAAAAGPGWGAAPPAQRRDALDRLAKALRQRAPDIVAGLAREIGCPVWLGELMQV
FT                   PMAMKGMAHARDGMDAIAWRERIGNGLVERVPVGVIAAITPWNFPLHQIVAKVAAALAA
FT                   GCTVVLKPSELAPGAAWQFIQACHDAALPPGVVNLVWGDAAIGQALVAHEAVDQVSFTG
FT                   STEVGRSIMAEAGRHLKRTTLELGGKSAAVLLPDAELERALPVVLRMAVANSGQACVSQ
FT                   SRLIVPRQRLAEAEQALAALAQAWPQGDPLDAATRLGPLANARQFERVNAMVSRALQQG
FT                   ARLVAGGPGRPAGQARGWHVPVTILSDVTPDMELAQEEVFGPVLALMPYEDGGQDGGEA
FT                   QALALANATRYGLSGAVWSADAARAAAFARRMKTGQVIINGADQNLATPFGGRGASGVG
FT                   RENGRFGIEECLTWQSLHGAP"
FT   misc_feature    84268..85668
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00171, DE Aldehyde dehydrogenase
FT                   family, score 1.3e-127"
FT   misc_feature    84961..84984
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT   CDS_pept        85780..86742
FT                   /transl_table=11
FT                   /locus_tag="BB0745"
FT                   /product="putative lipase"
FT                   /note="Similar to Pseudomonas sp. lipase LipP SWALL:O52270
FT                   (EMBL:AF034088) (308 aa) fasta scores: E(): 8.7e-33, 41.4%
FT                   id in 285 aa, and to Mycobacterium tuberculosis
FT                   carboxylesterase family protein rv1399c or mtcy21b4.16c or
FT                   mt1443 SWALL:P71667 (EMBL:Z80108) (319 aa) fasta scores:
FT                   E(): 5.1e-33, 44.89% id in 274 aa"
FT                   /db_xref="GOA:A0A0H3LJ63"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ63"
FT                   /protein_id="CAE31245.1"
FT                   /translation="MAYDPGIQAYVERARRALGDMAGLKALSLAQRRVRADRYAALVRE
FT                   PYPESLEVSDTYIVQPGHEIPVRVYRPRAEGPLPTIVYLHGGSFVAGSPQGHDFITTSL
FT                   ACNTGAQVLSVHYRRAPENPYPAPTDDAYAALCWAQREAELLGVDPERIAVAGDSAGGN
FT                   LAAACALMARDRGGPALRMQALIYPTLDADLDTPSYLNNTADAFLTREAMAFAVNAFLP
FT                   QGLDTRDGYALPLRAADHAGLPPAYLLLADHDPLLDDGTRYAARLREAGNAVQLRIGAG
FT                   MIHGFLRARRLSATADAEFHLLCAALRQALGLPEPAARW"
FT   misc_feature    86236..86274
FT                   /note="PS01174 Lipolytic enzymes 'G-D-X-G' family, putative
FT                   serine active site."
FT   CDS_pept        complement(86753..87358)
FT                   /transl_table=11
FT                   /locus_tag="BB0746"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator Pa4987 SWALL:Q9HUH8
FT                   (EMBL:AE004911) (199 aa) fasta scores: E(): 4.2e-15, 35.29%
FT                   id in 187 aa, and to Rhizobium loti hypothetical protein
FT                   Mll7669 SWALL:Q985H7 (EMBL:AP003012) (205 aa) fasta scores:
FT                   E(): 1.6e-11, 33.15% id in 190 aa"
FT                   /db_xref="GOA:A0A0H3LR38"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LR38"
FT                   /protein_id="CAE31246.1"
FT                   /translation="MQADDTRLVGQAIRRIRKEKKISLQTLAARSGVATGMLSQIERDL
FT                   GNPSLKTLARIRQALDVPLSALFEADDETAADAAGAGDLAAHVRRNGTRRVMQFGTPLM
FT                   TKEMLTPPAGQRLQFMVLNIQPGGTSGAPPLSYAAEKGGMVLQGAFELELDGQTLQLQR
FT                   GDSFQFDGATPHVFRNPYDEPASILWIIAHEPAAQRHF"
FT   misc_feature    complement(87158..87322)
FT                   /note="HMMPfam hit to PF01381, DE Helix-turn-helix, score
FT                   1.5e-13"
FT   misc_feature    complement(87230..87295)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1212.000, SD 3.31 at aa 22-43, sequence
FT                   ISLQTLAARSGVATGMLSQIER"
FT   CDS_pept        complement(87379..88380)
FT                   /transl_table=11
FT                   /locus_tag="BB0747"
FT                   /product="putative exported protei"
FT                   /note="Similar to Variovorax paradoxus, and Burkholderia
FT                   cepacia 2,4-diphenoxyacetic acid gene cluster SWALL:Q9RHQ7
FT                   (EMBL:AB028643) (337 aa) fasta scores: E(): 6.1e-38, 40.38%
FT                   id in 312 aa, and to Rhizobium meliloti hypothetical
FT                   protein Ra1058 or Sma1927 SWALL:Q92Y30 (EMBL:AE007292) (330
FT                   aa) fasta scores: E(): 1.8e-40, 41.87% id in 320 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHX6"
FT                   /protein_id="CAE31247.1"
FT                   /translation="MSKSLLSRLARLTRRAAGVALLAGAATAQAAYPERPVTLVVPFAT
FT                   GGNSDIVARLIAERMGQALGQTVIVENRAGAGGLVGNQAVARAKPDGYTLLLGGMSTQI
FT                   LLAGTAPQLPYDPVKDFSAVALISKVPLVLVVPASSPAQDLKSFAEYLRQKPGAYNFSS
FT                   AGAGTSGHVTAQYFADAIGAKVVHVPYRGSSPALVDLVEGRNAYLVDTPPVIKELVKSG
FT                   KIRALASFTETRLADLPEVPTVAEAGLGEVIKEKMQPWQALFVPAGTPPEVEARIHDAL
FT                   GKAMADPALQQRLTQMGLVPMSGSLADAKQLFEVDYAKWIPILDGMGLKTPR"
FT   misc_feature    complement(87394..88227)
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 4.8e-88"
FT   misc_feature    complement(88291..88380)
FT                   /note="Signal peptide predicted for BB0747 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.912 between residues 30 and 31"
FT   CDS_pept        88672..89046
FT                   /transl_table=11
FT                   /locus_tag="BB0748"
FT                   /product="putative exported protein"
FT                   /note="Weakly similar to Escherichia coli O157:H7 z3937
FT                   protein z3937 or ecs3506 SWALL:Q8X978 (EMBL:AE005493) (131
FT                   aa) fasta scores: E(): 0.22, 27.61% id in 105 aa"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHZ9"
FT                   /protein_id="CAE31248.1"
FT                   /translation="MIRRLLLILMLCAPLAACETLQSGQGGADKYSPTALRENLKKGVT
FT                   TVEDVRRIYGEPRSINQGPEGVTMMVYDPDTSRNDMLSTAMSAVGLGSVGGAARPESRS
FT                   LYVHFERNRVESYSLSSSKN"
FT   misc_feature    88672..88722
FT                   /note="Signal peptide predicted for BB0748 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.627 between residues 17 and 18"
FT   CDS_pept        89096..89434
FT                   /transl_table=11
FT                   /locus_tag="BB0749"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   10.8 kDa protein rv1214c or mtci364.26c or mt1252
FT                   SWALL:O05315 (EMBL:Z93777) (110 aa) fasta scores: E(): 7.2,
FT                   28.44% id in 109 aa"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMW8"
FT                   /protein_id="CAE31249.1"
FT                   /translation="MLKTLCKTALAAGAALGLAGACAAQGAETHLAMAEMGGTMHAAAQ
FT                   ACGDYKPAELSDMKARQQQAMAGMGVSAEQFETAFAAGLEKGRQQIAGASAQQKQQMCE
FT                   QLRAMPRQ"
FT   misc_feature    89096..89173
FT                   /note="Signal peptide predicted for BB0749 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.823 between residues 26 and 27"
FT   misc_feature    89129..89161
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(89444..90253)
FT                   /transl_table=11
FT                   /locus_tag="BB0750"
FT                   /product="probable enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="Similar to Escherichia coli probable enoyl-CoA
FT                   hydratase PaaG or b1394 SWALL:PAAG_ECOLI (SWALL:P77467)
FT                   (262 aa) fasta scores: E(): 1.2e-24, 34.6% id in 263 aa,
FT                   and to Caulobacter crescentus enoyl-CoA hydratase/isomerase
FT                   family protein cc2575 SWALL:Q9A582 (EMBL:AE005925) (265 aa)
FT                   fasta scores: E(): 3.6e-44, 49.24% id in 266 aa"
FT                   /db_xref="GOA:A0A0H3LJ65"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ65"
FT                   /protein_id="CAE31250.1"
FT                   /translation="MSKFLRHDRDGAIWTVTLDQPETRNALTGNTAVQEIVDLCEEVAR
FT                   DDSVRVIILTGADPVFSSGGNVKDMRRFFDDSISAADIRQEYRHGIQRLTRALYNIDVP
FT                   TIAAVNGAAIGAGCDLACMCDIRIASEQASFAESFIKVGIVPGDGGAWLLPRVVGMSRA
FT                   LEMSFTGDAMAAAEALACGLVSRVVPHDQLLAQARQLAERIAANPGATLRLTKRLLREG
FT                   QELGLDSLLEQSASAQAIAHKTPEHREAVTAFIEKRRPDFSRAARRG"
FT   misc_feature    complement(89687..90214)
FT                   /note="HMMPfam hit to PF00378, DE Enoyl-CoA
FT                   hydratase/isomerase family, score 9.9e-51"
FT   CDS_pept        complement(90289..91104)
FT                   /transl_table=11
FT                   /locus_tag="BB0751"
FT                   /product="probable short-chain dehydrogenase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3187"
FT                   /note="Similar to Cavia sp peroxisomal trans 2-enoyl CoA
FT                   reductase SWALL:Q9JIF5 (EMBL:AF232010) (302 aa) fasta
FT                   scores: E(): 3.4e-26, 39.92% id in 253 aa, and to Rattus
FT                   norvegicus putative short-chain dehydrogenase/reductase
FT                   MrnA, complete cds SWALL:Q9WVK3 (EMBL:AF099742) (303 aa)
FT                   fasta scores: E(): 6.3e-27, 39.14% id in 258 aa"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LR47"
FT                   /protein_id="CAE31251.1"
FT                   /translation="MTSSSAPPIDDLRVLRADALAGRSAFVSGAGSGIGRGIALRLLSL
FT                   GMNVFGTGRRAEPLAETASLAQGLSGRFDHAPCNVRETAAIEALVAEVGQRQGMDLLVN
FT                   NAGGQFFAPAAEISRKGWDAVIDVNLNAVFVVTKAAYPFLKARKGAVVNISLSGVDRGS
FT                   MGIAHSIAARAGVLGLTRTLALEWARDDIALNCIGPGAVITEGLAGEAARAMLDRLVEA
FT                   TPMGRPTRVEEVAELVAFLATPAAHLMTGQLIQIDGAAHLGSGLHMLAA"
FT   misc_feature    complement(90325..91044)
FT                   /note="HMMPfam hit to PF00106, DE short chain
FT                   dehydrogenase, score 5.8e-55"
FT   CDS_pept        complement(91151..92245)
FT                   /transl_table=11
FT                   /locus_tag="BB0752"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3188"
FT                   /note="Similar to Streptomyces coelicolor hypothetical
FT                   protein sco2032 or sc3a3.10 SWALL:Q9S2Y3 (EMBL:AL109849)
FT                   (404 aa) fasta scores: E(): 7.9e-21, 33.93% id in 330 aa,
FT                   and to Rhizobium loti hypothetical protein Mlr6096
FT                   SWALL:Q98A97 (EMBL:AP003008) (387 aa) fasta scores: E():
FT                   1.6e-19, 32.78% id in 305 aa"
FT                   /db_xref="GOA:A0A0H3LHX8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHX8"
FT                   /protein_id="CAE31252.1"
FT                   /translation="MPEPAAHLPRPLAGRRVVDLSQFIAGPTAAQYLADFGADVVKIES
FT                   PQGDGVRTLQGNAYGSYYARSFNTGKRSQVLDLRVAADRAALDALLETADAFICNLAPS
FT                   SLAKLDLRGPALRARFPRLVIALVSGYGQQDERVCMDTIAQCESGFALLNGDEDGSPRL
FT                   STSWPVDMFSGMYTGMSCAMAMLDPAGQGCLIDLSMMEVAAAMLIGPAALAVSEGDALG
FT                   PPMGNRDRASAPSSIYRCADGHVYILGGVDTYWARLRPLIGAEDAPFTERLRRAAHFDA
FT                   QVEAWTLPQRREAVLARMHELQIPAGNVRPPEEALAMIRGLRPGAVSRPLPSGEHVPAF
FT                   PALFDGQRLPRTATPHVGGGRRAG"
FT   misc_feature    complement(91166..91198)
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT   misc_feature    complement(91472..92026)
FT                   /note="HMMPfam hit to PF02515, DE CAIB/BAIF family, score
FT                   9.8e-12"
FT   CDS_pept        complement(92238..93572)
FT                   /transl_table=11
FT                   /locus_tag="BB0753"
FT                   /product="coenzyme A ligase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3189"
FT                   /note="Similar to Archaeoglobus fulgidus coenzyme F390
FT                   synthetase af2013 SWALL:O28266 (EMBL:AE000964) (440 aa)
FT                   fasta scores: E(): 8e-55, 39.18% id in 444 aa, and to
FT                   Methanosarcina acetivorans coenzyme A ligase ma2244
FT                   SWALL:Q8TNN9 (EMBL:AE010911) (433 aa) fasta scores: E():
FT                   1.7e-47, 37.81% id in 439 aa"
FT                   /db_xref="GOA:A0A0H3LI04"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI04"
FT                   /protein_id="CAE31253.1"
FT                   /translation="MKQQERQPYSDTIWDEAETWSRDRIEQFQLDALRRQLQRVARTSN
FT                   HYRQVFAAAGFEPGDLKSLDDLRRLPFTHKRDYLAGLQAEPPFGSLAAVAPGEAVRVHF
FT                   SSGTTARPAPVLWTQADIERWADLYARYLYGQGLRRGDVFQCMFNYAWFVGGLGATLAA
FT                   QHVGALVIPASSGDTQRQIETIYQYGTQCVIGTPSFMAHMAEAAQAMGRDLATSPVRMV
FT                   CVGGEPGASIPGTRERIERQWGARMYDCYGALECQPIGWDTAAQLGPTLAEDFIYVEIL
FT                   HPETHEPVADGERGVLVLTHLDKQACPLVRWWTGDIVVRDSRPAPDGRTHARLTGGVLG
FT                   RSDDMLIVRGVNLFPSAIEDVVRAFPGLTNEYVIVLDDSLKDPNTGFLTGVKLRVERES
FT                   GAAADVGERLSQRLREKLQVRFQVEVVESGTLPRTVHKAKRVIHA"
FT   CDS_pept        complement(93526..94209)
FT                   /transl_table=11
FT                   /locus_tag="BB0754"
FT                   /product="TetR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3190"
FT                   /note="Similar to Bacillus halodurans transcriptional
FT                   regulator bh2958 SWALL:Q9K8P5 (EMBL:AP001517) (215 aa)
FT                   fasta scores: E(): 5.2e-09, 24.73% id in 190 aa, and to
FT                   Deinococcus radiodurans transcriptional regulator, tetr
FT                   family dr2376 SWALL:Q9RRV9 (EMBL:AE002068) (197 aa) fasta
FT                   scores: E(): 5.1e-08, 27.97% id in 193 aa"
FT                   /db_xref="GOA:A0A0H3LMX6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMX6"
FT                   /protein_id="CAE31254.1"
FT                   /translation="MASAHQTPADANGGESRDEILRAAAELFMEFGYAATSIDAVAQRL
FT                   GSTKGRIYHHYRSKADLFFDVQVTAMNRLTAQVEPLAREGGGAVGRLAAMALRHTQILL
FT                   KEMPMQKVAVQGLERHLLEASSAAKRLRAVVKMRDDYEQMFVEVIDDGIREGSFVDLPP
FT                   RLLSKPFFGALNWATVWYSQRRLQSEEAIDDIAHALAAYALRGLLKDSNDEAARETALF
FT                   RYDLG"
FT   misc_feature    complement(94012..94152)
FT                   /note="HMMPfam hit to PF00440, DE Bacterial regulatory
FT                   proteins, tetR family, score 3.2e-16"
FT   misc_feature    complement(94039..94104)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1421.000, SD 4.03 at aa 36-57, sequence
FT                   TSIDAVAQRLGSTKGRIYHHYR"
FT   CDS_pept        complement(94235..95398)
FT                   /transl_table=11
FT                   /locus_tag="BB0755"
FT                   /product="putative acyl-CoA dehyrdogenase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3191"
FT                   /note="Similar to Thermoanaerobacter tengcongensis acyl-CoA
FT                   dehydrogenases CaiA or tte0545 SWALL:Q8RC91 (EMBL:AE013024)
FT                   (380 aa) fasta scores: E(): 2.7e-50, 40.1% id in 379 aa,
FT                   and to Pseudomonas aeruginosa probable acyl-CoA
FT                   dehydrogenase pa2552 SWALL:Q9I0T2 (EMBL:AE004683) (375 aa)
FT                   fasta scores: E(): 2.7e-49, 40.22% id in 363 aa"
FT                   /db_xref="GOA:A0A0H3LJ69"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ69"
FT                   /protein_id="CAE31255.1"
FT                   /translation="MTVIWKPALDDAATRWQTLAERLGRERFGPLAPELDRDQRYPWET
FT                   IEALVEHKFAGLFLPTQWGGQGANLTTTVAAVEALGTHCASTSAIMCAYQLGAFPILLA
FT                   GTDAQKDFYLREMTLGRATSFALSERIAGSDAAAIEATATREGDGWRLRGEKYWIGNGG
FT                   ASRYYVVFAKTDPAAGGRGVSAFMVDKEQPGAEIDELSDKMGIRGTQTSNLKLDLVVPD
FT                   SARVGELNRALRLALQTLNVGRIMVAAQSLGVALGAYREAAGRAVARRAFGQPIGENQA
FT                   IGFRLADMATEISAARMMLYEAARAYDAGQDVSNLGAMAKLFSSEVSHRVVDNTVQIWG
FT                   GLGYCKPTVAERLYRDQRILEIYEGSSEIQRLVLSRAVRKEAEEAAN"
FT   misc_feature    complement(94262..94711)
FT                   /note="HMMPfam hit to PF00441, DE Acyl-CoA dehydrogenase,
FT                   C-terminal domain, score 1.4e-59"
FT   misc_feature    complement(94721..95023)
FT                   /note="HMMPfam hit to PF02770, DE Acyl-CoA dehydrogenase,
FT                   middle domain, score 5.1e-27"
FT   misc_feature    complement(94985..95023)
FT                   /note="PS00072 Acyl-CoA dehydrogenases signature 1."
FT   misc_feature    complement(95024..95350)
FT                   /note="HMMPfam hit to PF02771, DE Acyl-CoA dehydrogenase,
FT                   N-terminal domain, score 2.2e-07"
FT   CDS_pept        complement(95395..96396)
FT                   /transl_table=11
FT                   /locus_tag="BB0756"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3192"
FT                   /note="Similar to Deinococcus radiodurans branched-chain
FT                   amino acid ABC transporter, permease protein Dr0282
FT                   SWALL:Q9RXM8 (EMBL:AE001889) (334 aa) fasta scores: E():
FT                   2.3e-21, 31.77% id in 321 aa, and to Archaeoglobus fulgidus
FT                   branched-chain amino acid ABC transporter, permease protein
FT                   Af0824 SWALL:O29434 (EMBL:AE001047) (323 aa) fasta scores:
FT                   E(): 4.6e-21, 28.57% id in 294 aa"
FT                   /db_xref="GOA:A0A0H3LR52"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LR52"
FT                   /protein_id="CAE31256.1"
FT                   /translation="MIRLPLRRAALLPLAVIVLYLPAWLGGSPAIYSAAVLIAILAVMS
FT                   YGLDVVVSDLGEVSLGHTVFFATGAYVTALLSTRTGAGAWTTLAATIVAALGVSAVVGL
FT                   VTLRLREFVFSLVTYAVAVVAVTVAANWAFLGGSDGLRGLPTLDLSVAGLSLTAGNDEE
FT                   LWPYAFGLLVVVIYLIDRFRHSRLGTAAIMVHQNPRLATMSGIDPARVRLQVFLFSAPI
FT                   SAAAGWLYAYQRAYVSADILETYFLILMLTAVVLVGRRQLLGPLLATALVLIQEKFFSF
FT                   GGYVDKIVLGSLLVLVLAFFPQGLMGLVRPLARLARRRQPATPVATTLENPK"
FT   misc_feature    complement(join(95467..95535,95626..95694,95860..95907,
FT                   95995..96063,96082..96150,96163..96222,96241..96309,
FT                   96319..96372))
FT                   /note="8 probable transmembrane helices predicted for
FT                   BB0756 by TMHMM2.0 at aa 9-26, 30-52, 59-78, 83-105,
FT                   112-134, 164-179, 235-257 and 288-310"
FT   misc_feature    complement(95467..96396)
FT                   /note="HMMPfam hit to PF02653, DE Branched-chain amino acid
FT                   transport system / permease component, score 1e-05"
FT   misc_feature    complement(96322..96396)
FT                   /note="Signal peptide predicted for BB0756 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.985) with cleavage site
FT                   probability 0.390 between residues 25 and 26"
FT   CDS_pept        complement(96396..97268)
FT                   /transl_table=11
FT                   /locus_tag="BB0757"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3193"
FT                   /note="Similar to Deinococcus radiodurans branched-chain
FT                   amino acid ABC transporter, permease protein dr0281
FT                   SWALL:Q9RXM9 (EMBL:AE001889) (285 aa) fasta scores: E():
FT                   1.8e-25, 31.57% id in 285 aa, and to Brucella melitensis
FT                   high-affinity branched-chain amino acid transport system
FT                   permease protein livh / high-affinity branched-chain amino
FT                   acid transport ATP-binding protein livg bmeii0874
FT                   SWALL:Q8YBM5 (EMBL:AE009721) (916 aa) fasta scores: E():
FT                   1.3e-26, 34.5% id in 284 aa"
FT                   /db_xref="GOA:A0A0H3LHY2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHY2"
FT                   /protein_id="CAE31257.1"
FT                   /translation="MNLLQQLINGIVLGHAYALIAIGWTLLLGVARLVNFGHGQMYMVG
FT                   AFVTWWATTSAGMPYLLALPTAMALGALIGLAMQRIMLRATFEQNLVSIMIMTLGFGYV
FT                   IQGAASLIFGSTGQILDTAWSQRDIEVGELWVTWQDAAIVVAAIAVFAGLKWLLEGSRA
FT                   GRLVRMVAEDPKLAQLAGVDVRRIYYGVFAFEGAAVAFAAGMVAPRTPILTSMGFEEVI
FT                   ITFVVVVLGGIGSVTGSYAAGVALGVFTALFSALVSPAYATAAAFLVLIGVLVLRPGGL
FT                   SAGAARGVH"
FT   misc_feature    complement(96411..97262)
FT                   /note="HMMPfam hit to PF02653, DE Branched-chain amino acid
FT                   transport system / permease component, score 5e-20"
FT   misc_feature    complement(join(96450..96518,96537..96605,96648..96707,
FT                   96795..96863,96930..96998,97035..97103,97167..97235))
FT                   /note="7 probable transmembrane helices predicted for
FT                   BB0757 by TMHMM2.0 at aa 12-34, 56-78, 91-113, 136-158,
FT                   188-207, 222-244 and 251-273"
FT   CDS_pept        complement(97265..98014)
FT                   /transl_table=11
FT                   /locus_tag="BB0758"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3194"
FT                   /note="Similar to Deinococcus radiodurans branched-chain
FT                   amino acid ABC transporter, ATP-binding protein dra0260
FT                   SWALL:Q9RYP9 (EMBL:AE001863) (238 aa) fasta scores: E():
FT                   4.8e-30, 49.19% id in 248 aa, and to Ralstonia solanacearum
FT                   probable amino-acid composite ATP-binding transmembrane ABC
FT                   transporter protein rsp0707 or rs01742 SWALL:Q8XRX4
FT                   (EMBL:AL646080) (247 aa) fasta scores: E(): 5e-30, 45.37%
FT                   id in 238 aa"
FT                   /db_xref="GOA:A0A0H3LI07"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI07"
FT                   /protein_id="CAE31258.1"
FT                   /translation="MNAPPSDQAVLSARQLEVGYAGNRALGLDALSVGRGEIVGVIGAN
FT                   GAGKSTLVNALLGWSRGRPTVRGEIRLDGRRIDATPTHQRVRAGLLLVPEGRLIFASMN
FT                   VEENLSAAFDAGSTDGRRFYTRDEVFQLFPRLAERRRHLGAQLSGGERQMLGIGRALMM
FT                   GPRVLLLDEPSIGLAPMLVSQVLQTLQTLARSGLSILLVEQNVRAAMEVVDRLLLLERG
FT                   RLVLEGPAASVGADPRIAQAYLGAHAA"
FT   misc_feature    complement(97349..97909)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   1.1e-37"
FT   misc_feature    complement(97532..97576)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(97865..97888)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(98011..98802)
FT                   /transl_table=11
FT                   /locus_tag="BB0759"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3195"
FT                   /db_xref="GOA:A0A0H3LMY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMY6"
FT                   /protein_id="CAE31259.1"
FT                   /translation="MIAQPEAAAPAPALSVQALGVRYGALVALEDVSWEVRAGELLGII
FT                   GPNGAGKSSCYDAVSALIPRTGTVCLHGRDISAVPAHGLAALGIKRAFQQNAFFDDLSV
FT                   LENMMAVLGEQAQAGLLASALNPLGAARRRAQARAWAAGQLERFGVPAACHDLHPKEIS
FT                   YGMQRMLSIALAYGRSATVLLLDEPAAGLGGADMAALVRLLGELKSEGVALVVIEHHME
FT                   LIMAVADRICVLNLGRPLACGAPAAIQNDPRVLEAYLGSAQ"
FT   misc_feature    complement(98092..98622)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   5e-10"
FT   misc_feature    complement(98275..98319)
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        complement(98799..99938)
FT                   /transl_table=11
FT                   /locus_tag="BB0761"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3196"
FT                   /note="Similar to Citrobacter freundii leu/ile/val-binding
FT                   protein precursor LivJ SWALL:LIVJ_CITFR (SWALL:P25399) (367
FT                   aa) fasta scores: E(): 2.4e-14, 28.41% id in 359 aa, and to
FT                   Rhizobium loti ABC transporter, binding protein mlr7721
FT                   SWALL:Q985D9 (EMBL:AP003012) (399 aa) fasta scores: E():
FT                   4e-17, 26.68% id in 371 aa"
FT                   /db_xref="GOA:A0A0H3LJ74"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ74"
FT                   /protein_id="CAE31260.1"
FT                   /translation="MKRIHRLFTAGLLALSLGAAAQAQQTPIKVGVIFPLSGGAGPQGQ
FT                   HVTQAIQAMAAVINESGGVMGRQIEIVSRDDESTPAVGVSRATELISAGVSVIIEGWNS
FT                   PVTLAMQPVIARAGVLDITAISKADPILSGEGNPLAIRLNSSNSQDGAVIADYIKSVGA
FT                   KRVAFLTENDAYGNGAQESIETSLKKLGYAYEKVAEEKFPFTQADFRVAMTNVRAAKPD
FT                   VTVAINANEGLGMPAIIRQARQSRLPGKLVSAVGTVAPSVINVAGDAADGLIGADIYFP
FT                   DVEPFASNPANQRFVAKTQEMFKYTPDKFMALGATSLQVWAMAANELKTLDREAIAKRI
FT                   RGGAFKGTAMGDLQFEPNGQLKSNYYLFRVDGRKIVVQP"
FT   misc_feature    complement(98805..99875)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF01094, DE Receptor family ligand
FT                   binding region, score 0.053"
FT   misc_feature    complement(99870..99938)
FT                   /note="Signal peptide predicted for BB0761 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.863 between residues 23 and 24"
FT   CDS_pept        100263..101030
FT                   /transl_table=11
FT                   /locus_tag="BB0762"
FT                   /product="short chain dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3197"
FT                   /note="Similar to Bos taurus 3-hydroxyacyl-CoA
FT                   dehydrogenase type II HadH2 SWALL:HCD2_BOVIN (SWALL:O02691)
FT                   (261 aa) fasta scores: E(): 4e-41, 52.17% id in 253 aa, and
FT                   to Mycobacterium tuberculosis oxidoreductase, short-chain
FT                   dehydrogenase/reductase family rv1144 or mtci65.11 or
FT                   mt1177 SWALL:O06544 (EMBL:Z95584) (250 aa) fasta scores:
FT                   E(): 4.8e-47, 58.98% id in 256 aa"
FT                   /db_xref="GOA:A0A0H3LR56"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LR56"
FT                   /protein_id="CAE31261.1"
FT                   /translation="MDTQGISALVTGGASGLGLAAARRLLAAGARVVIADLPGSPGEEV
FT                   ARELGPDARFAPADVTREDDMNAACDLAESLGPLRALVHCAGRGGPVRLLDKEGNPGPM
FT                   DTYADIVRVNLLGTFNTLRLVAARMARNPLTPEGERGVCVLTASVAAYEGQIGQIGYAS
FT                   SKAGVVGMTIVAARDLASKAIRVCTIAPGIFDTPMLARVSAEARKTLAASVPHPARLGS
FT                   PDEYAQLAQHIIGNAMLNGETIRLDGALRMAPR"
FT   misc_feature    100263..100343
FT                   /note="Signal peptide predicted for BB0762 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.847) with cleavage site
FT                   probability 0.456 between residues 27 and 28"
FT   misc_feature    100272..101012
FT                   /note="HMMPfam hit to PF00106, DE short chain
FT                   dehydrogenase, score 8.5e-43"
FT   misc_feature    100704..100790
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature."
FT   CDS_pept        101063..101845
FT                   /transl_table=11
FT                   /locus_tag="BB0763"
FT                   /product="enoyl CoA dehydratase/isomerase"
FT                   /EC_number="4.2.1.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3198"
FT                   /note="Similar to Escherichia coli carnitinyl-CoA
FT                   dehydratase CaiD or b0036 SWALL:CAID_ECOLI (SWALL:P31551)
FT                   (260 aa) fasta scores: E(): 2.5e-30, 42.52% id in 254 aa,
FT                   and to Rhodococcus fascians enoyl CoA hydratase EchA1
FT                   SWALL:Q9ZHG2 (EMBL:AF063588) (275 aa) fasta scores: E():
FT                   1.1e-57, 63.6% id in 250 aa"
FT                   /db_xref="GOA:A0A0H3LHY6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHY6"
FT                   /protein_id="CAE31262.1"
FT                   /translation="MSVQAPDAAEVLVDRADGILTITINRPQARNAINPAVARGIAAAV
FT                   DELDASDELRIGILTGAGGSFCAGMDLKGFLRGELPSIEGRGFGGLTARPPRKPLIAAV
FT                   EGYALAGGFELVLACDLVVAADNAQFGVPEVKRGLAATAGGLVRLPRQLPYRIALELAL
FT                   TGDMFPARRAHGYGLINQLTEPGQALDAARELARRIVANGPLAVAASKRVVVESQDWPA
FT                   DEVWERQAALTEHVFESADAREGSAAFAEKRQPVWQGK"
FT   misc_feature    101120..101614
FT                   /note="HMMPfam hit to PF00378, DE Enoyl-CoA
FT                   hydratase/isomerase family, score 8.4e-42"
FT   misc_feature    101363..101425
FT                   /note="PS00166 Enoyl-CoA hydratase/isomerase signature."
FT   CDS_pept        101849..102238
FT                   /transl_table=11
FT                   /locus_tag="BB0764"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3199"
FT                   /note="Similar to Archaeoglobus fulgidus hypothetical
FT                   protein Af1292 SWALL:O28977 (EMBL:AE001015) (136 aa) fasta
FT                   scores: E(): 5.3e-05, 31.62% id in 117 aa, and to
FT                   Methanopyrus kandleri predicted nucleic-acid-binding
FT                   protein containing a zn-ribbon mk1377 SWALL:Q8TVL2
FT                   (EMBL:AE010431) (134 aa) fasta scores: E(): 0.0002, 33.02%
FT                   id in 109 aa"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI11"
FT                   /protein_id="CAE31263.1"
FT                   /translation="MATDTRFDGPGPDACYHAALAEGRLLLQHCEDCAAVRFPPALVCR
FT                   ACGGARLAWRESSGRGSVYAATTVRDRAGDYNVSLVELEGGARMMSRVEGIEAARVRIG
FT                   QPVRARIVAGEEPYVVFAPHDGGAA"
FT   misc_feature    101879..102220
FT                   /note="HMMPfam hit to PF01796, DE Domain of unknown
FT                   function DUF35, score 4.7e-13"
FT   CDS_pept        102235..103386
FT                   /transl_table=11
FT                   /locus_tag="BB0765"
FT                   /product="putative thiolase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3200"
FT                   /note="Similar to Rhodococcus sp. NCIMB 9784 non-specific
FT                   lipid carrier-like protein CampC SWALL:Q93TU4
FT                   (EMBL:AF323755) (408 aa) fasta scores: E(): 3.7e-23, 31% id
FT                   in 387 aa, and to Pseudomonas aeruginosa hypothetical
FT                   protein Pa1016 SWALL:Q9I4V7 (EMBL:AE004534) (383 aa) fasta
FT                   scores: E(): 1.2e-90, 62.14% id in 383 aa"
FT                   /db_xref="GOA:A0A0H3LMZ0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMZ0"
FT                   /protein_id="CAE31264.1"
FT                   /translation="MSRALRGRAVIAGIGNTHRWQAPGRTPFDQLQEAAVLALEDCGLA
FT                   MAQVDGLFCAMSTSGLPVLNVAERLGIRPRHADGTMVGGASFLFHLQAAIAALETGLCE
FT                   VALICYGSNQLTAGGKLASMPDPQPYEAPFRPRYPMSSYALAAARHMHQYGTTREQLAD
FT                   VAVAARLWARRNPHAYARDPLARADVLGARMISDPLTKADSCLVTDGGAALVLVRAERA
FT                   ADLPRPPVYVLGTGVAVSHRQISAMPDLTVTCAVESGRRACEMAGVAPRDMDHVMLYDA
FT                   FTINTLLFLEDLGFCAKGEAGAFVESGAIAPGGSLPVNTNGGGLSCNHPGMYGLFTVIE
FT                   SVAQLRGECGERQVEGARLSMAHANGGVLSSQATVILGTAETL"
FT   misc_feature    102931..103359
FT                   /note="HMMPfam hit to PF02803, DE Thiolase, C-terminal
FT                   domain, score 0.0047"
FT   CDS_pept        103383..104258
FT                   /transl_table=11
FT                   /locus_tag="BB0766"
FT                   /product="putative hydratase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3201"
FT                   /note="Similar to Pseudomonas aeruginosa PhaJ2 or pa1018
FT                   SWALL:Q9LBK1 (EMBL:AB040026) (288 aa) fasta scores: E():
FT                   8.9e-40, 46.45% id in 282 aa, and to Mycobacterium
FT                   tuberculosis maoc family protein rv3389c or mtv004.47c or
FT                   mt3496 SWALL:Q11198 (EMBL:U27357) (290 aa) fasta scores:
FT                   E(): 1e-31, 41.61% id in 298 aa"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ79"
FT                   /protein_id="CAE31265.1"
FT                   /translation="MRAAMAIDPDRLLAAEIPAVEQQYDWRQCVLYALGIGAGLDPEDG
FT                   LDLPFVDETRLKVAPTFACVLADPGFWMRDLPLGLDWLRTVHGEQSMRVHRPLAGRASV
FT                   RGVTRIVDVADKGRDKGALIYAERELIDLADGAPLATLSQTVFCRGDGGFGGKPSARPP
FT                   PPPVPARAPDASVHARTSLQSALIYRLSADLNPLHIDPAVARRAGFPRPILHGMASFGA
FT                   VGQALVKACCGGEPAAVRGMGGRFSAPVFPGETVRVDIWRAGPGRAAFQARVAARDVVV
FT                   MDNGTFDYEA"
FT   misc_feature    103869..104234
FT                   /note="HMMPfam hit to PF01575, DE MaoC like domain, score
FT                   8.6e-28"
FT   CDS_pept        104294..105382
FT                   /transl_table=11
FT                   /locus_tag="BB0767"
FT                   /product="hypothetical protein Xcc2124"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3202"
FT                   /note="Similar to Xanthomonas campestris hypothetical
FT                   protein Xcc2124 SWALL:AAM41409 (EMBL:AE012319) (354 aa)
FT                   fasta scores: E(): 1.3e-28, 32.7% id in 370 aa, and to
FT                   Arabidopsis thaliana hypothetical 44.2 kDa protein t22a6.50
FT                   or at4g24220 or at4g24220, t22a6.50 SWALL:Q9STX2
FT                   (EMBL:AL078637) (388 aa) fasta scores: E(): 1.3e-17, 30.42%
FT                   id in 378 aa"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LR60"
FT                   /protein_id="CAE31266.1"
FT                   /translation="MTGSTAGKVLVVGALGVVGRAALEHFGQRPGLARVGLSRRAPDFA
FT                   PEATWISADLRDAQATRAALAAHGDATHVVYAALNEQPDLLKGWRDSGNVDLNTRMLRN
FT                   TLDALREAPLRHVTLLQGTKAYGVHTGRPMPVPARETDAVRDHANFYFDQQDLLAERAA
FT                   AQGFAWTIFRPQIVLGVALGSAMNPVATLGAYAALSREAGQPLRYPGHPHLLTECTDAR
FT                   LIARAIAWAWDEPRAHGEAFNIANGDVVLWQPVFERLAALFGMPLGEPVDTRMREAMPE
FT                   QAERWRAIAERERLAVPQLRDLIGLSWQYADATWAARHPLPVPPLVSTIKLRQAGFGDC
FT                   IDTQECIVEHLREMQRLRYLPR"
FT   CDS_pept        complement(105416..106396)
FT                   /transl_table=11
FT                   /locus_tag="BB0768"
FT                   /product="putative exported protein"
FT                   /note="Similar to Comamonas testosteroni OrfJ protein
FT                   SWALL:Q9RHM9 (EMBL:AB029044) (326 aa) fasta scores: E():
FT                   2.2e-40, 39.56% id in 321 aa, and to Rhizobium meliloti
FT                   hypothetical protein ra1058 ra1058 or sma1927 SWALL:Q92Y30
FT                   (EMBL:AE007292) (330 aa) fasta scores: E(): 5.2e-38, 39.24%
FT                   id in 316 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHZ1"
FT                   /protein_id="CAE31267.1"
FT                   /translation="MSVRIKALALAAALALPAAALAQDPAARYPDKPVTLVIPFPPGGT
FT                   SDVVGRQLAQQLGETLGGSFVVNNKAGASTLIGATYVARAPKDGYTLLLSSGSTFTVTP
FT                   HLMRQMPYTLEDFAPVAAIATVPFAFVVKKDFPARSVAEYVAYAQTHPGKINNATNGQG
FT                   SMVHLLGELVATGLRAQVTQVHYKGAAPATMDMIGGIVDSNVEALTSALPNVQAGQYRA
FT                   LAVLSAERQPLMPDVPTFRELGYPSIVGETWYAVFAPAGTPAPVVEKLNAALREITGST
FT                   RFAEAMRKLGNEARTSTPAELTRITQRESQRWGELIKQAGIPPVQ"
FT   misc_feature    complement(105431..106252)
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 4.4e-93"
FT   misc_feature    complement(106331..106396)
FT                   /note="Signal peptide predicted for BB0768 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 22 and 23"
FT   CDS_pept        complement(106498..107520)
FT                   /transl_table=11
FT                   /locus_tag="BB0769"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical
FT                   protein sco6307 or scif3.09C SWALL:Q93RT4 (EMBL:AL590982)
FT                   (320 aa) fasta scores: E(): 6.7e-06, 30.83% id in 334 aa,
FT                   and to Arthrobacter nicotinovorans hypothetical polyketide
FT                   cyclase SWALL:Q93NG4 (EMBL:AF373840) (310 aa) fasta scores:
FT                   E(): 0.0014, 30.26% id in 337 aa"
FT                   /db_xref="GOA:A0A0H3LI16"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI16"
FT                   /protein_id="CAE31268.1"
FT                   /translation="MDSPRWKKRPEGSNWGDFGPDDQIGRMNLLTPQARLRAIREVEHG
FT                   IAFCLSLPLDYPGGNTLFQHRKAPRFFYEKRGPSHNYNFRLSNVCGCFSDVVSDDAVLM
FT                   YTQYSTQWDGLGHVGQMFDANDDGIPEKVYYNGYRGGVDVVGPDDAPDNLGAKAIGIER
FT                   LATAGVQGRGVLVDLERRHGRERALVGYDGLMAALDAQRASVEPGDFLCLYTGFADLVL
FT                   EMNKQPDGEVLARSCAVLDGRDEKLLQWITDSGIVAICADNFAVEAYPAGPGKGEHYPG
FT                   LPLHAHCLFKLGLNLGELWYFAELAQWLRQHDRSSFLLTAPPLRLPGAVGSPATPIATV
FT                   "
FT   CDS_pept        complement(107802..108599)
FT                   /transl_table=11
FT                   /locus_tag="BB0770"
FT                   /product="probable transcriptional regulator"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   transcription regulator protein rsc3411 or rs01720
FT                   SWALL:Q8XTY4 (EMBL:AL646075) (262 aa) fasta scores: E():
FT                   5.1e-31, 42% id in 250 aa, and to Rhodococcus opacus PcaR
FT                   pcaR SWALL:O67983 (EMBL:AF003947) (265 aa) fasta scores:
FT                   E(): 1.3e-20, 36.32% id in 234 aa"
FT                   /db_xref="GOA:A0A0H3LMZ5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LMZ5"
FT                   /protein_id="CAE31269.1"
FT                   /translation="MAARHRKASTPMAESALLIQSLEKGLAVLEAFRNSETMNLQEIAR
FT                   ACGITSGSAQRVAYTLERAGYLRKDPVSRRYRVTVKAVGLGYSFLAREPVFQHAHAVLH
FT                   QLNQECGEIVNLSVPDGEDNMVFVMRIPTSKHIPVYMPAGTRIPMLSSASGRALLAHLP
FT                   PEQLEARLARMAVPRHTSRTTTDLAVLRHLIDEAREHRYAYADEEFYQGDINVAATIVD
FT                   ETGAPVAAVNISVPKPRWSLERAREDLGPLAVRAARAISKNAL"
FT   misc_feature    complement(107811..108374)
FT                   /note="HMMPfam hit to PF01614, DE Bacterial transcriptional
FT                   regulator, score 4.3e-35"
FT   misc_feature    complement(108423..108488)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1120.000, SD 3.00 at aa 22-43, sequence
FT                   MNLQEIARACGITSGSAQRVAY"
FT   CDS_pept        108728..110035
FT                   /transl_table=11
FT                   /locus_tag="BB0771"
FT                   /product="putative FAD dependent oxidoreductase"
FT                   /note="Similar to Proteus mirabilis amino acid deaminase
FT                   AaD SWALL:Q51890 (EMBL:U35383) (473 aa) fasta scores: E():
FT                   1.9e-39, 34.33% id in 431 aa, and to Agrobacterium
FT                   tumefaciens oxidoreductase AgaE or atu3050 or agr_l_3510
FT                   SWALL:Q8UBG6 (EMBL:AE009235) (449 aa) fasta scores: E():
FT                   2.1e-67, 45.54% id in 426 aa"
FT                   /db_xref="GOA:A0A0H3LJ83"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ83"
FT                   /protein_id="CAE31270.1"
FT                   /translation="MLSLFDKIMQDSKPVNEALPRRVDVAIIGGGIIGVSTAYALARAG
FT                   VSVALFEKGRLAGEQSSRNWGWVRTLCRDAAEIPLALRAHALWTEIQAEVDVGYRRTGM
FT                   LYLQEDERDAAAHQRWIEQARAYGVDAALLGRAAALRCLPASCRPWSGAMYSASDGVAE
FT                   PELATHGIATLARRHGAALFEQCAVRGLDTAAGRVDGVVTERGRVAAEAVVMAAGAWSR
FT                   LLCGNSGADFPQLKVRGSVLRTAPCDLPLAATVNGKDFTCRKRADGGYTVSQFGASMAD
FT                   IVPDSFRLLGKFYRAWLANNAFVKLRLGKRFFEELAIPRRFALDRATPFEQCRVLDPAP
FT                   SASAVARAWQRLVQAFPDFRATSVAASWGGYIDVTPDALPVISPVPALDGAYLASGFSG
FT                   HGFGIGPAVGELVADMIRGRAAQSAVQPFRFTRFSE"
FT   misc_feature    108794..109990
FT                   /note="HMMPfam hit to PF01266, DE FAD dependent
FT                   oxidoreductase, score 0.00064"
FT   CDS_pept        110032..111105
FT                   /transl_table=11
FT                   /locus_tag="BB0772"
FT                   /product="putative dipeptidase"
FT                   /note="Similar to Brevibacillus borstelensis thermostable
FT                   dipeptidase Bdp SWALL:Q9KH70 (EMBL:AF268476) (307 aa) fasta
FT                   scores: E(): 1.9e-16, 33.69% id in 184 aa, and to Ralstonia
FT                   solanacearum putative dipeptidase protein rsp0056 or
FT                   rs02031 SWALL:Q8XTQ0 (EMBL:AL646076) (323 aa) fasta scores:
FT                   E(): 4.6e-33, 37.95% id in 332 aa"
FT                   /db_xref="GOA:A0A0H3LR64"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR028536"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LR64"
FT                   /protein_id="CAE31271.1"
FT                   /translation="MISSGREADSHFVQGEMQMALAADLHRDAVVVDGLVFFSDGSTRD
FT                   MLAGGVSAINLTVTEMSADFEQALKDVMAWRQRCQDPASGWTLVERAADIARAKREGKL
FT                   GLIMGWQNARPLGDRLERIALFHTLGMRVIQLTYNEANLIGDGCLEKRNAGLSNLGIEM
FT                   VREMNRVGIAIDLSHCAEQTCLDAARHSTRPVLLTHANANAVIARPRNKSDAVIKAVAA
FT                   TGGVIGCSIHAYLNWRGQAGQQPTLDDFVANIRYIGDLVGYEHVGIGTDFPAVDTYEAV
FT                   RHVMVMSRTKYAASGGDFSNAFGDVMEARYPVETPTPAQFGGLTEALARGGLSDAQIRG
FT                   VLGGNFVRAFDACWQPA"
FT   misc_feature    110032..111096
FT                   /note="HMMPfam hit to PF01244, DE Renal dipeptidase, score
FT                   0.00011"
FT   CDS_pept        111122..112090
FT                   /transl_table=11
FT                   /locus_tag="BB0773"
FT                   /product="putative exported protein"
FT                   /note="Similar to Alcaligenes eutrophus hypothetical 35.6
FT                   kDa protein in gbd 5'region precursor SWALL:YGB7_ALCEU
FT                   (SWALL:Q44018) (327 aa) fasta scores: E(): 2e-47, 42.3% id
FT                   in 312 aa, and to Comamonas testosteroni OrfJ protein
FT                   SWALL:Q9RHM9 (EMBL:AB029044) (326 aa) fasta scores: E():
FT                   4.4e-25, 29.19% id in 322 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LHZ5"
FT                   /protein_id="CAE31272.1"
FT                   /translation="MNLHRKFGAALAALAGAACVAGAAQAADFPNRTLRIIVPYQPGGS
FT                   TDIVVRKFAELAAPELGQSIIIENKGGAGATMGARTLATATPDGYTLAILPSPVFRMPH
FT                   IQNVGYDPTRDFTYVMMLSGYTLGVAVAADAPYRNWGEFIAHAKAHPGDVAYGTASVGS
FT                   ASNVMMEDIAARNGVSWRHVPYKGESDVIQGVMGGQLTAYAGSTTVLPMVQSGKMRMLV
FT                   TWGGHRSAQFPDVPSLNELDGTPAVYAPFGIAAPKNLPADVRKTLHDTFKRVAQSDAFK
FT                   EVLTQYGQELVYMDGETYAAYAAEQFEAEKAIVKKLGLAGN"
FT   misc_feature    111122..111199
FT                   /note="Signal peptide predicted for BB0773 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 26 and 27"
FT   misc_feature    111146..111178
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    111266..112078
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 4.2e-60"
FT   CDS_pept        complement(112213..115872)
FT                   /transl_table=11
FT                   /locus_tag="BB0774"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="GOA:A0A0H3LI23"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI23"
FT                   /protein_id="CAE31273.1"
FT                   /translation="MNVQVVGETPAAQPYADTGALPFSRLRLLGGFELVVRGVDRTGAF
FT                   PYEKAKLLLAVLALAPGERISRRELAAWLWPELPDNDARARLRHALHALRKVFAQAPEM
FT                   LRIEKDSLSLDAALLDIDALAVLGLHPRLDYSAADKLAAYQGALLAGIGLPDGESMRGW
FT                   RDGSQARIEIELALARSQLTDFHIGQGREQEALVLAKRWVSRWPEDEACHRHLIRLLVA
FT                   LDDREAAMRAFDHCTQVLADRLGAAPSNETWALLEPGQHAMPAIAAKPARIRPGLYRPL
FT                   AVLAINVDIDAATCHDDAERAIDIQQRAMLLIERHALALGGWLAPRATSTVLAYFGYPA
FT                   LSERPAHPAARLADRLAAADLPDGVTLGMGLHAGVALTEPDGQPDAGGLAARQAVRLAW
FT                   QARDRETLVTQACAVRLSEWQLVQTGRRSDDHQALGAPTAHAPARRMFGRNHEFERLTA
FT                   LWNQLKGRERPQTVLLRGVAGIGKTALAQALIEYARQSGGEAYLLAGQEHMAAAPWHPV
FT                   KAWLRAHSGIAETEPGAGRAAHAHLVERLRAHTGLRAAAAERLWQWLHGADDGGRGEAP
FT                   HDIDLTEILTSILLQRTPAGRPQLIVWENLHWMDPASLGLIEHLAGRVVSGPTLLLATA
FT                   RDVYAPVWDHQAITVPPLDREATAQLAASLARTYRLSQGQRAQVQQESMGNPLYAGELA
FT                   RCAAQLALPQGVPSLADRVALQLNLLAEPERHALQMLCLLCGDAPADAGRLAEVLQTAA
FT                   AALATRLETLGRHGLLDGDANQGWRCPPPIAQAVRRYMLREQRGALHQRIAQHLQQNAG
FT                   APHEIARHLQQAGDPQAAQWWRTAVWEVVRRGDYAQAHRYLDNALALRQQIESDAERDE
FT                   FEFACHMVRGELAGNLDGPGSMAAAQAYTLAVRVSPGDPQSRFTALWALWNTCQHSGDY
FT                   DEAVSLSHQLLNMANEHGKSGWRTWALYAMAICELWKGDVIESERLLRQALHGLVFPHT
FT                   DIGPAPILGENAGALIHAMLALTVATQGRGDEAMQSVQTAMAYAQQDNNPLMLATSSMM
FT                   LVKFSYLYEDWAQMGMVAGALKQSMDAHPLRPQFLYALTSCYVDLAAALQGDASVLDNF
FT                   EPALETIRRALPTAEVAGQCLLACALNALGRPDRALLALDRADLLCARFRIAGMMPETL
FT                   CLRGDALLLLGDLEQACAAWRQAIGHANRLAALQYARWAQRRLDANQLVETGQ"
FT   misc_feature    complement(112285..112386)
FT                   /note="HMMPfam hit to PF00515, DE TPR Domain, score 1.1"
FT   misc_feature    complement(112405..112506)
FT                   /note="HMMPfam hit to PF00515, DE TPR Domain, score 8.8"
FT   misc_feature    complement(112765..112866)
FT                   /note="HMMPfam hit to PF00515, DE TPR Domain, score 22"
FT   misc_feature    complement(114424..114447)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(115708..115737)
FT                   /note="PS00215 Mitochondrial energy transfer proteins
FT                   signature."
FT   CDS_pept        116001..117071
FT                   /transl_table=11
FT                   /locus_tag="BB0775"
FT                   /product="putative transcriptional regulator"
FT                   /note="Similar to Agrobacterium tumefaciens transcriptional
FT                   regulator, AraC family atu4132 or agr_l_1441 SWALL:Q8U8G0
FT                   (EMBL:AE009344) (347 aa) fasta scores: E(): 1.3e-06, 27.88%
FT                   id in 269 aa, and to Caulobacter crescentus transcriptional
FT                   regulator, AraC family cc0713 SWALL:Q9AA93 (EMBL:AE005746)
FT                   (446 aa) fasta scores: E(): 2.2e-05, 25.42% id in 354 aa"
FT                   /db_xref="GOA:A0A0H3LN00"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN00"
FT                   /protein_id="CAE31274.1"
FT                   /translation="MSKVSMNAFSLPRPLHFVPLPGVPAPWLAGARAPLPAARGRTDGA
FT                   GAAANDALAGAAFDSAAYARPDDALAELGACGLLSLRAHRAGGARRARIHGQTGPGAAA
FT                   LDCQAGGFSVAREAAAIARDARRGALAVVLRAGDVRLAQDGGERAAAAAGDCLLLDLAR
FT                   PWRLDLSDDFAGYLAWTEGAGQPASAGTVAPGASVTAHRLAGMLPALVAGPLSATQLRG
FT                   LHDTVAAALARADGAALGDGHCHPLAQIRAYIDACLHDQGFGYEAVCQRFALSRSTLFR
FT                   LFKAHGGFARYLKMRRMQQCFDLLTSERMRHDNVKAVYLSCGFDNAQQFSRVFSGVYGV
FT                   APSVLRQLTRQRFHAG"
FT   misc_feature    116787..116852
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1506.000, SD 4.32 at aa 263-284, sequence
FT                   FGYEAVCQRFALSRSTLFRLFK"
FT   CDS_pept        complement(117068..117787)
FT                   /transl_table=11
FT                   /locus_tag="BB0776"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="GOA:A0A0H3LJ88"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ88"
FT                   /protein_id="CAE31275.1"
FT                   /translation="MRRRVRPGPSMQNRNTARRARAQQGFTLVEISVVLVIIALIIGAV
FT                   TVGRDVYRNAVNQRMISDFVQPWAMAYSQYVAATGLPPGDDPANPTGRVNAALDRPLCN
FT                   TDTNPELSTLMLRAGIRPPQGRGPGLEDRYVYQDSQGLPQELQVCLRAANWSEAATTPT
FT                   TYQAVTRNVMELRRLTPELAAMLDRQVDNQIDARFGRLREDSRAGDLTQDGAPWSKTEA
FT                   NLDNGQAATMTGYLLMP"
FT   misc_feature    117071..135913
FT                   /note="possible type II secretion system"
FT   misc_feature    complement(117647..117715)
FT                   /note="1 probable transmembrane helix predicted for BB0776
FT                   by TMHMM2.0 at aa 25-47"
FT   misc_feature    complement(117656..117718)
FT                   /note="PS00409 Prokaryotic N-terminal methylation site."
FT   CDS_pept        complement(117784..118995)
FT                   /transl_table=11
FT                   /locus_tag="BB0777"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="GOA:A0A0H3LR69"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LR69"
FT                   /protein_id="CAE31276.1"
FT                   /translation="MSMHVSRRARRQRGFSLVEAAISLVILGIITVALWRFIDFSGRNT
FT                   QAGQVDDLLARADRALIGYALAHARLPCPASSTAGMENCGAGEASGYLPYATLGLPEPR
FT                   AGQIRYGVLRGAAAIDLSADTPILTTLRTGMAAHQQPLRMLDSFDGDPVNSPGPRGQDL
FT                   CLRLNAAMKSADHADRLHIDGGAAGAGGQRLQAYALALPVAPGAGHGAGAAGDGRISRG
FT                   PAFAPARGASAVSDQPAGLSASPRELWDRLRCGDAMSASARAHANASLAAHMLTQSTRD
FT                   YYYQLDVLHQLAVASKKLSDAKAVEAGVGVLTGTAGVLNSTSQTLWSFGVQSYLIPLYI
FT                   AAEAHAIANAAKSAAVAIEAADLVDQLARIKDATENLADELITLNENVQAHSLAAARSG
FT                   VFLY"
FT   misc_feature    complement(118891..118959)
FT                   /note="1 probable transmembrane helix predicted for BB0777
FT                   by TMHMM2.0 at aa 13-35"
FT   misc_feature    complement(118897..118959)
FT                   /note="PS00409 Prokaryotic N-terminal methylation site."
FT   CDS_pept        complement(118992..120029)
FT                   /transl_table=11
FT                   /locus_tag="BB0778"
FT                   /product="putative membrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="GOA:A0A0H3LI00"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI00"
FT                   /protein_id="CAE31277.1"
FT                   /translation="MTDRLAMRRQGGWSLLEAATLLAVAGLFGVMLWNLLPVLRQAGGA
FT                   PAQQAALEQARQALTGFVQSHGRLPWPAPPGSNDGLENAAAAGGAQALLPWKTLGLAAD
FT                   PRLGYQVRGALASPAAVSFTPANPALPATELARTQRNDLDFCADLVRLQRADGAAATPP
FT                   HAFAVSAQGDGQGAAPLRQETGVGELAAQLHCPAYLARAAGAAHSAFAAQDLRAIAALY
FT                   ATYSERHYDIRVAERDYADYQVSMAQLTVMLATYQMAHAAAMIAGMTIGTASAVISMGK
FT                   STAVLAAAGYSLKSASDTRDEKDKALDRAMVFRAATHVYQARVEDYARNEIDNAQLVLG
FT                   RGLQP"
FT   misc_feature    complement(119184..119207)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(119925..119993)
FT                   /note="1 probable transmembrane helix predicted for BB0778
FT                   by TMHMM2.0 at aa 13-35"
FT   CDS_pept        complement(120022..122289)
FT                   /transl_table=11
FT                   /locus_tag="BB0779"
FT                   /product="putative membrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="GOA:A0A0H3LI26"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI26"
FT                   /protein_id="CAE31278.1"
FT                   /translation="MSPPMSAPRLSPPPGRPAAQRGISLVWTAVLITVIGLAMTAGYLL
FT                   IQAGAESRQARQQDAALAWAGQLLDGYASAFGRLPCPASTADGLEDCGANPNGKGWLPM
FT                   RTLEQHGALALRPDLQASRPEGTAPAIRYLVYRDAASGLDLARQGAPGADSRYRAKRPE
FT                   YKPSAPAAGDYYVRDGDQSSTADLCQALHAISPLQLPAATSDTWQFNAPDARAGTTAAA
FT                   HVRDPGGRVVNVAYGLAIAGKGSGAGLFGGANATAANTLEWPARAHDAQYGDRVRVAGA
FT                   AQLARTLQCAPVMASLDAMAASRAAMEQVVAQRVENVASASSARTSVLLAYALNTAGLL
FT                   GDAAAIKTAVSNITVSSVFLGNAVAGCASIILAPGFCWQIPIHTAALTTAKVALVQASA
FT                   ALAMHASMYAPIALADAQVKEATSKLDGKYGAPDSEDPAICSMVDAIAEQQDEIRREAD
FT                   ENRAELAKNREEMARLRKIIEDAEKEFRNEPRQGSSETHRQEIARITAARIVAEQAYDA
FT                   VKSEIDSIDQRIKDSKKGMDSMRKQIDDIDQDKAVIKPDGASAEQFEMSKEYWRDVRAR
FT                   LVEQLAKEEQKQRDLEQEKRDKQELLKQRDTQRKSARQAFSALQSRADSVEISKPQPPT
FT                   DADPSPPPIVYFAYCTGQKTSAFLNMCGLLIARYYNASRDYKHIADAEPALEADIADKD
FT                   QQIRDLEKDKANARAVCEAARDGQHADDYDGNLYNPWQQAQKLMNASMHYGSTAPVELR
FT                   ND"
FT   misc_feature    complement(122152..122220)
FT                   /note="1 probable transmembrane helix predicted for BB0779
FT                   by TMHMM2.0 at aa 24-46"
FT   CDS_pept        complement(122286..123539)
FT                   /transl_table=11
FT                   /locus_tag="BB0780"
FT                   /product="putative type II secretion system protein"
FT                   /note="Similar to Pseudomonas putida type 4 fimbrial
FT                   assembly protein PilC SWALL:PILC_PSEPU (SWALL:P36641) (401
FT                   aa) fasta scores: E(): 7.2e-28, 29.68% id in 411 aa, and to
FT                   Pseudomonas aeruginosa general secretion pathway protein F
FT                   XcpS or pa3102 SWALL:GSPF_PSEAE (SWALL:Q00513) (405 aa)
FT                   fasta scores: E(): 5.1e-27, 27.42% id in 412 aa"
FT                   /db_xref="GOA:A0A0H3LN03"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN03"
FT                   /protein_id="CAE31279.1"
FT                   /translation="MNLYYYRLLLPNGKLRSGLVKLSVERDASARLWLERQYGATVVRL
FT                   RRMPRWAAEAHRSISDVFRPGIRPKELSGMLRDLAVMTGSGIPLLEAVRTVSEENASKR
FT                   SNVARVGRRLLEDLDAGAPISEAVGRQPDIFPETVRNLILIGDETGSMDRMLLESAEHL
FT                   ERIAAMKADTRQALIYPAFVFLAIFGAAGFWIHYVIPNLVGLFQQMNAKLPALTIAVLD
FT                   GAAWLTRHFGKVTLGMAVLFVSLWLAWRYFRPMRRAGFYLLHRLPVSRVIVTSSGLAFF
FT                   AEYMAILIHAGLDVVKSLSILGRAIGDDYYRDRIVAIRQIMERGEGISTAMRHVGGFPP
FT                   IMMRMIAVGEETGTLDRQLSYLAKEYGTRLARVIAMLSEVIKPLVILIAGAMFTLLIVA
FT                   LLLPVYDLVRQSMAARPM"
FT   misc_feature    complement(122319..123314)
FT                   /note="HMMPfam hit to PF00482, DE Bacterial type II
FT                   secretion system protein F domain, score 3e-47"
FT   misc_feature    complement(join(122325..122393,122661..122729,
FT                   122787..122840,122943..123011))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB0780 by TMHMM2.0 at aa 177-199, 234-251, 271-293 and
FT                   383-405"
FT   CDS_pept        complement(123536..125161)
FT                   /transl_table=11
FT                   /locus_tag="BB0781"
FT                   /product="putative type II secretion system protein"
FT                   /note="Similar to Pseudomonas putida XcpR protein
FT                   SWALL:Q52292 (EMBL:X81085) (482 aa) fasta scores: E():
FT                   8.6e-51, 43.21% id in 405 aa, and to Vibrio cholerae
FT                   general secretion pathway protein E EpsE or vc2732
FT                   SWALL:GSPE_VIBCH (SWALL:P37093) (503 aa) fasta scores: E():
FT                   6.2e-50, 38.51% id in 457 aa"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ93"
FT                   /protein_id="CAE31280.1"
FT                   /translation="MVERGLLTPVQLLYAEQKHTVEPLPLSRLLIQNGLAEERVVVATL
FT                   AELQGIEFVAGDVLPEADPQVLAMFNRELCLTHNFLPLRRQDGELQVLLGEAVPARVAA
FT                   LVLQRTSLRCRFMQAEFSLVTRLIRHSYYFAQNPLESLLAREVRRLSDDPDHVFSPDKV
FT                   LDYLLHLAVRERTTDIHITAEASSLHVLFRVDGVLRPMMALPPSLQRLLGYIKLTAEMD
FT                   ISDQRRPQDGSFRAHILDAALTIRVSTIVTEHGERMVMRLLPEHNNLSGLADLGFFAED
FT                   VERLERLFAKPNGLVLITGPTGSGKSSSLHAALRMQSLIERNVLTVEDPLEYRVPGAGQ
FT                   TEVNRRAGYDFTTALRHFLRHDPDVILLGEMRDAETAQAAVEAAATGHLVLSTLHVTSV
FT                   FGVVPRLQPLGLDSQSIAENLLVVVNQRLVRQNCPFCAAEVAFTAAERAWLGVDEHATG
FT                   RRGAGCGRCRQTGYLGRLPAYEILEIDETLANAIADTAGREAIRSLAHARGFRGMAELA
FT                   RERVRRGQTTAEEVLRVVGDGPAS"
FT   misc_feature    complement(123854..124711)
FT                   /note="HMMPfam hit to PF00437, DE Type II/IV secretion
FT                   system protein, score 2.6e-91"
FT   misc_feature    complement(124043..124087)
FT                   /note="PS00662 Bacterial type II secretion system protein E
FT                   signature."
FT   misc_feature    complement(124241..124264)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(125229..126608)
FT                   /transl_table=11
FT                   /locus_tag="BB0782"
FT                   /product="putative type II secretion system protein"
FT                   /note="Similar to Aeromonas hydrophila general secretion
FT                   pathway protein A ExeA SWALL:GSPA_AERHY (SWALL:P45754) (547
FT                   aa) fasta scores: E(): 8.2e-19, 37.69% id in 260 aa, and to
FT                   Vibrio cholerae general secretion pathway protein A vc2445
FT                   SWALL:Q9KPC7 (EMBL:AE004314) (529 aa) fasta scores: E():
FT                   5.1e-18, 32.55% id in 301 aa"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LR74"
FT                   /protein_id="CAE31281.1"
FT                   /translation="MHTPPFPPTPDAEHYFHTEWLQARQAEAAHCLASGKGFILLTGEI
FT                   GTGKSTFLRQLLAALAERQALRTSLVFNTFLQGEALLAAILKDFGLPAHGSAADHVERL
FT                   NAFLLEQWRAGALCVLCIDDAQNLSLESLELLRLLSNLESGQEKLLQIVLCGQPELAER
FT                   LARPEIRQLTSRIGEHIRLHTLDRAETGRYAAFRLAVSGAAGRIDLSPRAVAALYRRSR
FT                   GNARRIHQILDRALYGVLQQGHGRIDAALVRRAAAEAGMAHATAPRATRRARLPMAAAV
FT                   LAAGVLGTGALYAAGPWRAAPTAPAAAAAQAAPAPAHAFDACLAALAAAGADAAGLLWV
FT                   SDAPAGVAALAQGRPGLCARERDGRTDLAWRAPWRPEDFASGGPHPSVQALQQRLGAAG
FT                   LLATRADGIYGAQTRQALASFQRDHALPATGSPDPATLLLAALALPAEAPALIEEPVTH
FT                   D"
FT   misc_feature    complement(125277..125465)
FT                   /note="HMMPfam hit to PF01471, DE Putative peptidoglycan
FT                   binding domain, score 1.8e-07"
FT   misc_feature    complement(125316..125333)
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT   misc_feature    complement(126459..126482)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(126643..127545)
FT                   /transl_table=11
FT                   /locus_tag="BB0783"
FT                   /product="putative membrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="GOA:A0A0H3LI05"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI05"
FT                   /protein_id="CAE31282.1"
FT                   /translation="MSLIYDALRNGPSATGPGAPVGRGFAGAPARPARGGQFARSLAVA
FT                   VVFGASLGMAGWILAADGLADGAGPARPLPPPAAPDGLPAQAARGPASDAQQLNALLRQ
FT                   MMANQERLERMQAELAAMAPPAAPAVGFPLPAAGMPGAALAAASYEAPAARMEPPSVPA
FT                   GAFIVQDKPARAGAANANAVAAMAEAFDRAAAAGDLGTARRQLDSLRAALPGESLTLLR
FT                   RQAWLHMYGGNDRAAAESYRALLARLPNDENAGLNLAIIEARQGRVADARALLERLRQQ
FT                   HPDSRGVRALQEQIGHEQR"
FT   misc_feature    complement(127366..127434)
FT                   /note="1 probable transmembrane helix predicted for BB0783
FT                   by TMHMM2.0 at aa 38-60"
FT   CDS_pept        complement(127542..129179)
FT                   /transl_table=11
FT                   /locus_tag="BB0784"
FT                   /product="putative type II secretion system protein"
FT                   /note="Similar to Vibrio cholerae mannose-sensitive
FT                   hemagglutinin D MshD SWALL:Q56673 (EMBL:L19085) (559 aa)
FT                   fasta scores: E(): 1.8e-19, 24.1% id in 560 aa, and to
FT                   Xanthomonas campestris general secretion pathway protein D
FT                   precursor XpsD or PefD or xcc0670 SWALL:GSPD_XANCP
FT                   (SWALL:P29041) (759 aa) fasta scores: E(): 3.4e-14, 26.76%
FT                   id in 426 aa"
FT                   /db_xref="GOA:A0A0H3LI31"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013358"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI31"
FT                   /protein_id="CAE31283.1"
FT                   /translation="MKSRSFAPLAPLALVLALAGCADTPRSVQNFPKTDHAALQTTSNA
FT                   VAEESAKLLAHNDEMLQRVQRIQPTVPKLDPIAPQYDPLEDKIISVNMHDAKVGQLLWA
FT                   LSDQLRMNLVVDPQVLDMPQRASLYLQRVSAREVFDRILQVFDLHGAVHGNVLTVSLMQ
FT                   ERVFTIEMLGGNTALDIQTGGDVFGGSGSSGGSSTLRGDLKLSGKVGDDADAYKQLAEA
FT                   IGKVLEDTSSGVPGGAPAEKSRYSLDRTTGSLYVRARPAKVRAVEELIRRNQATIRRQI
FT                   QVEAQLIDIELNDGFEFGVDWNLLTNHLSGRYGSGAITANTPAGTQPGSGLLPRSINIP
FT                   AQVIGSAAGVGGGIGFANDSFSVALNALRSFGSVKVLSNPTVRVRNGVPAYLSVGANVR
FT                   YVTEISTTFNNIGGGSSNSSSDVQTDSLFSGVVVGVAPFIHEDGRVELFVHPMQTQVQP
FT                   QSLALVDVGNGNSVTLPIINTKSITTTLNLNNGDTVVLGGLIDQQFTNANKGLPGLSDI
FT                   PGAGVLFDNRSDSHKSRELVIILRVRVI"
FT   misc_feature    complement(127548..128447)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00263, DE Bacterial type II and III
FT                   secretion system protein, score 1.3e-45"
FT   misc_feature    complement(129114..129179)
FT                   /note="Signal peptide predicted for BB0784 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.730 between residues 22 and 23"
FT   misc_feature    complement(129117..129149)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(129193..129957)
FT                   /transl_table=11
FT                   /locus_tag="BB0785"
FT                   /product="putative membrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="GOA:A0A0H3LN08"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN08"
FT                   /protein_id="CAE31284.1"
FT                   /translation="MTRRARPSAAGRQQGYTLLEVAIALAVVGLLGAGLYGAQQALYSH
FT                   GSQGQAQAEAERARQAVLAYALRMQRLPCPDTTGNGWASHADGQCSQASGWLPYETLGL
FT                   AGAAAPGTNGRRLAYAALRVPGGPDLFRPSAGAAPVDYSPGGEAALYETLRRAGQMPYD
FT                   GAALRLATARQGVADPCAGATQVNPAFVVIAPATPAAGGALPVFSAAHAALARGAALCA
FT                   IAPAGGRANQNSDAVAAVGTAELLGWLAARAH"
FT   misc_feature    complement(129829..129897)
FT                   /note="1 probable transmembrane helix predicted for BB0785
FT                   by TMHMM2.0 at aa 21-43"
FT   misc_feature    complement(129856..129918)
FT                   /note="PS00409 Prokaryotic N-terminal methylation site."
FT   CDS_pept        complement(129954..130553)
FT                   /transl_table=11
FT                   /locus_tag="BB0786"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJ97"
FT                   /protein_id="CAE31285.1"
FT                   /translation="MRIRVYATLAVLAIAAAGLLAYRQFAPPPEHAAPLEPPLSAERPQ
FT                   PPAPPVLPEPAAASAPPPWAAGNRARPAPAARPAPAAAPAPSAREQAMAEAHARLQRLS
FT                   ASPAPDLAELDRALRDLEQAHGSPEVGGVRLDVLRANLRVAERLSVLGQQLQALQQQPA
FT                   SEPGRAEAMRRIGDEVAALQKQLRTDYVIDTPAARP"
FT   misc_feature    complement(130458..130553)
FT                   /note="Signal peptide predicted for BB0786 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.904 between residues 32 and 33"
FT   CDS_pept        complement(130579..131088)
FT                   /transl_table=11
FT                   /locus_tag="BB0787"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LR79"
FT                   /protein_id="CAE31286.1"
FT                   /translation="MKPRHYALSALAAWLLLGGWAAYNYATQPSVRLYAMRAPAAAVPP
FT                   ALLRDIEAADKLAATLQSMAQADAAGAAPARNVALATDAQPGLPRAGAAPGRAGSGESA
FT                   RVVTMIMAGGRGARLAIVDGEYVREGQRLADGTRVARIDMAAVTLEDAIGLQRTYPLRH
FT                   AFKDNP"
FT   misc_feature    complement(131017..131088)
FT                   /note="Signal peptide predicted for BB0787 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.425 between residues 24 and 25"
FT   CDS_pept        complement(131085..132455)
FT                   /transl_table=11
FT                   /locus_tag="BB0788"
FT                   /product="hypothetical protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI09"
FT                   /protein_id="CAE31287.1"
FT                   /translation="MHIQSILLHHEGAWRLLADGQLTAQAGYPTLARPVVAVSDFGQAT
FT                   LGMTLLEGSPQHAAAVIEKKLRADGMIDQESRILVHHVKHFGKGYQALYTAVTLADWQN
FT                   LTTWSGNQADHCPLVPLAALLWSAVGSGRGVMLRLGRQLIFMAQAKHRMLYASAITFSD
FT                   QEEDLDTAVLNLAASIRDEVGDNPEDVERLLISWTVSLAADSLEMDERLARRFAEQSGL
FT                   ATRLAPAEALRDEAGRAVYSALPALVAAAPVRVAVNDNASKLMYLAERALPWASVASLT
FT                   LAAVLSVQAGSWALKAGKAQQQALQETRDSEPLRAEIGRLAATRAMPEAYPAQRAFLER
FT                   ADALREQTDPVEVLNALRSASAGGIRILRVHVTTTRPQQAGAAGERLLAVDGVLDGSQG
FT                   STPGALLARFVGVLRENGYVATSVDPNAASASSQPPAGFFSYHLRQAPPVALARKQP"
FT   CDS_pept        complement(132460..132966)
FT                   /transl_table=11
FT                   /locus_tag="BB0789"
FT                   /product="putative exported protein"
FT                   /note="no significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI34"
FT                   /protein_id="CAE31288.1"
FT                   /translation="MPRFPRLSGRRWQLSRKRSLQLFALSLLVLAVAAYGFHGARQDLD
FT                   HAYAALSLSERQRVQTTQELTVARKEAERADAARRILASAEATGFAAGGWSERRISIQQ
FT                   SAMTRHAVNDLLREASTGTGRLFGAEQFDLSVTRPEDGLFHATSGNNPDVVLTLRGTLL
FT                   FRLDR"
FT   misc_feature    complement(132865..132966)
FT                   /note="Signal peptide predicted for BB0789 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.429 between residues 34 and 35"
FT   CDS_pept        complement(132973..133767)
FT                   /transl_table=11
FT                   /locus_tag="BB0790"
FT                   /product="putative type II secretion system protein"
FT                   /note="Similar to Escherichia coli CFA/III pilin CofA
FT                   SWALL:Q59393 (EMBL:D37957) (238 aa) fasta scores: E(): 7,
FT                   25.74% id in 202 aa, and to Escherichia coli hypothetical
FT                   type II secretion protein GspG gspG SWALL:Q8VRM7
FT                   (EMBL:AF426313) (151 aa) fasta scores: E(): 1, 28.7% id in
FT                   108 aa"
FT                   /db_xref="GOA:A0A0H3LN12"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN12"
FT                   /protein_id="CAE31289.1"
FT                   /translation="MNAPQRSRQLQAGFTLVEMAVVLVIIGIILGAVMIGRDAQRNAEY
FT                   TRIRQNFVNQWALAYNNYVQRTGVPPGDDQRAPRLMVNGAKFTGSNGSLSGGDMSRISN
FT                   LPSAICNGGTAPGIDRPVDGDVQLREVMLRAGITLPQGRGQGYEDRYVYLDTNGNPQEI
FT                   QVCFQWNPPGTHSGSGNVMILTGLTPDLARSLSSAIDGNGDASGGSFRQNSVASGAGSQ
FT                   PGVEWKGNNTQTYGSTGDAEKVETGNAEGQVLTLIAHYKMNQ"
FT   misc_feature    complement(133663..133731)
FT                   /note="1 probable transmembrane helix predicted for BB0790
FT                   by TMHMM2.0 at aa 13-35"
FT   misc_feature    complement(133672..133734)
FT                   /note="PS00409 Prokaryotic N-terminal methylation site."
FT   CDS_pept        complement(133802..134842)
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="BB0791"
FT                   /product="twitching mobility protein"
FT                   /note="Similar to Pseudomonas aeruginosa twitching mobility
FT                   protein PilT or pa0395 SWALL:PILT_PSEAE (SWALL:P24559) (344
FT                   aa) fasta scores: E(): 1.1e-74, 66.37% id in 339 aa, and to
FT                   Xanthomonas axonopodis twitching motility protein PilT or
FT                   xac2924 or xcc2755 SWALL:AAM42027 (EMBL:AE011934) (345 aa)
FT                   fasta scores: E(): 1.6e-83, 70.46% id in 342 aa"
FT                   /db_xref="GOA:A0A0H3LJA1"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJA1"
FT                   /protein_id="CAE31290.1"
FT                   /translation="MTIDELLALTVARGASDLHLSAGLPPMLRINGDVVRQDVAALTPD
FT                   ALRAMIHQLMQPAQREEYETRQELDFSIDVEGLARFRVNAFNQQRGPAAVLRTIPSAIR
FT                   TLDELGCPASFKELVRQPQGLILVTGPTGSGKSTTLAAMIDHLNREGEHHILTIEDPIE
FT                   FVHPSRRSLVNQREVGRDTHSFSAALRSALREDPDIILVGELRDLETMRLAMTAAETGH
FT                   LVFATLHTNSAAKTVDRIIDVFPAGEKSMIRSMLSESLRAVIAQVLLKQEGGGRCAAWE
FT                   IMVGTPAIRNLIREDKIAQMVSSIQTGQAHGMQTLDQALQDLLRKKLISAEQALAYARD
FT                   RRSLGL"
FT   misc_feature    complement(134012..134839)
FT                   /note="HMMPfam hit to PF00437, DE Type II/IV secretion
FT                   system protein, score 4.9e-27"
FT   misc_feature    complement(134222..134266)
FT                   /note="PS00662 Bacterial type II secretion system protein E
FT                   signature."
FT   misc_feature    complement(134432..134455)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        135089..135916
FT                   /transl_table=11
FT                   /gene="gspO"
FT                   /locus_tag="BB0792"
FT                   /product="type 4 prepilin-like proteins leader peptide
FT                   processing enzyme"
FT                   /note="Similar to Burkholderia pseudomallei type 4
FT                   prepilin-like proteins leader peptide processing enzyme
FT                   [includes: leader peptidase gspO SWALL:LEP4_BURPS
FT                   (SWALL:Q9ZF70) (275 aa) fasta scores: E(): 5.3e-41, 51.35%
FT                   id in 259 aa, and to Erwinia chrysanthemi type 4
FT                   prepilin-like proteins leader peptide processing enzyme
FT                   outO SWALL:LEP4_ERWCH (SWALL:P31711) (283 aa) fasta scores:
FT                   E(): 3.7e-37, 49.43% id in 267 aa"
FT                   /db_xref="GOA:A0A0H3LR83"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LR83"
FT                   /protein_id="CAE31291.1"
FT                   /translation="MEIRLPGLDGAGWLAGAAVLGLALGSFLNVVLARLPAMLEYRWRL
FT                   DVQPDGAAACAPPPGLAHPPSRCPHCATALRWRHNVPVLSWLWLRGRCAFCAAPIAARY
FT                   PLVEAATGALCAGIAVLYGPTLLALALMGLAAMLLVLACFDLEHLLLPDCLTLPLLWAG
FT                   LLANAAGMGLATPAQAIAGAAAGYALLAGVAWAFRRRTGRDGLGLGDAKLLAALGAWLG
FT                   WQALPALLLAAGLWGVAAGLLARWRRRAALQPLGPGLAFGAALIVAGAGLMAR"
FT   misc_feature    135089..135907
FT                   /note="HMMPfam hit to PF01478, DE Type IV leader peptidase
FT                   family, score 1.1e-78"
FT   misc_feature    join(135116..135184,135443..135511,135611..135679,
FT                   135740..135808,135836..135904)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BB0792 by TMHMM2.0 at aa 10-32, 119-141, 175-197, 218-240
FT                   and 250-272"
FT   misc_feature    135485..135517
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        136065..138428
FT                   /transl_table=11
FT                   /gene="vrgS"
FT                   /locus_tag="BB0793"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Salmonella enterica subsp. enterica
FT                   serovar Typhimurium VrgS protein SWALL:Q93IR3
FT                   (EMBL:AJ320483) (729 aa) fasta scores: E(): 5.1e-85, 41.82%
FT                   id in 593 aa, and to Escherichia coli VgrE protein
FT                   SWALL:O52660 (EMBL:AF044499) (702 aa) fasta scores: E():
FT                   4.4e-54, 29.18% id in 699 aa"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI12"
FT                   /protein_id="CAE31292.1"
FT                   /translation="METILAMAERIVRALTPLPPQALQFRSMHGHEGLSALYEFEVDLL
FT                   AATHTLELKSLLGKPVSLEIETGGAPRYLSGQATRCALVGREGDSARQYVYRVTMRPWL
FT                   WYLTQTSDSKIFQQMSVVDVLRQVLADYPFPVEYRLAGSYRRWEYCVQYQETDFAFVSR
FT                   LMEHEGIYYWFRHESGRHTLVLTDDITQHDECPGAAQLPYYGPDRATVPQEQYVSQWQV
FT                   AEEITPDGFATVDYDFKKPAASLDAQSSNPGAYEPGGLQVYEWLGGYTEPDQGERYSRI
FT                   RLEALQAHGESVTGACNVRAFAPGYLFTLRNHPRPAENRQYLIAQAHYRIQEGGYASGA
FT                   EDAVFDIDFRVLPATVPFRVARATPVPRTHGPQTATVVGQAGEEIWTDEYGRVKVHFHW
FT                   DRYGKKNENSSCWVRVSSPWAGGGFGGIQLPRVGDEVIVDFIGGYPDRPIVIGRVYNAS
FT                   NMPPWDLPGNATQSGFLSRSKNGDRGTANALMFEDSAGAERIWLHAERDMDCEVEANES
FT                   HTVDGNRTTLIGGNDTLTVRGTRTTTIDGLDTETFNAGATRTVTGEVSETTTGNETRTF
FT                   NGDVTETVNGVETRTVNGDWKETITGEMTETRTGDETRTVTGAVTETITGDVTQTITGA
FT                   VTQTQTGAHDITITGDQTSSITGAVSHTVTGAYTQTVTDPVTVNANTSMTVVTPSWTVS
FT                   SASQQAFWTANTLRGTPARLTVVGAAADFWGVRQQVYGGINSQWSTVKIDLAAFKNGSN
FT                   GFESGQAGAQIKAIGAQIKTGGAAVISRVINLFT"
FT   misc_feature    136185..136217
FT                   /note="PS00435 Peroxidases proximal heme-ligand signature."
FT   CDS_pept        138445..138858
FT                   /transl_table=11
FT                   /locus_tag="BB0794"
FT                   /product="putative exported protein"
FT                   /db_xref="GOA:A0A0H3LI39"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI39"
FT                   /protein_id="CAE31293.1"
FT                   /translation="MGSTAWWIAGTLATLAAVGLVALLVRGGARPYETERALAAQLART
FT                   GRPAQAEVLALDRQPGGELYAAPMKLALRYADAMGRARQAELHVYIDSELLVNFMPGQA
FT                   IHVRFDPNDAARIAVDRERSPTEISAAWRRRHP"
FT   misc_feature    138445..138525
FT                   /note="Signal peptide predicted for BB0794 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.718) with cleavage site
FT                   probability 0.208 between residues 27 and 28"
FT   misc_feature    138457..138525
FT                   /note="1 probable transmembrane helix predicted for BB0794
FT                   by TMHMM2.0 at aa 5-27"
FT   CDS_pept        138855..141479
FT                   /transl_table=11
FT                   /locus_tag="BB0795"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN14"
FT                   /protein_id="CAE31294.1"
FT                   /translation="MKIVKPLRLGLLSRPYRMRGRQRLGLAVFALATLDEQALLQPEAD
FT                   LWSLAGEALGEDGVLDLAVPKPCAEFLVSGAAYTAHQQDRTACMARVRVGELEKTLAVF
FT                   GDRYWLDGKPTPPAPFEAMPLDWAHAFGGPEYADNPHGRGAGDERIAGVRTRRLPNVEP
FT                   ARGRMQRPDQRPEPAGFGPVSPLWPRRFARAGQYHESWLDEGFPGFLDTLDPHFFNAAA
FT                   PDQWWPGQPGLAAGTPYALWNLHPRLPCQQGALPRWRARCLLRRAGETALEDVALRLTT
FT                   AWFFPDRERLLLIYHGATDIAQDDGADIELAMPALDAADAPRPLAHYEAVLAQRLDAQD
FT                   GALHALRDKDLLPAQALGPWDALQAANPMEQPFAVNQRARGAAIRAQLGEQARAHGVDP
FT                   RAYEPPPAPMPAAPQLDDLPDIARHMRQAAQEARIDALHARRRMAEALQARGAELPPAM
FT                   GAAALAAAADGAGRGGPPSLHSHPALATLQELARAQPLGSGADRLDAGSVGARLREAQQ
FT                   QLGRLYLHAAHHQPPAEAARPARAARLRRRVQALMAGSRDLAGLDLTGADLSGLDLRGA
FT                   RCVGTWMEGADLSGALLDDADLSQAVLARAHAEGGSWRRAVLAGANLGQAALDGVDLAG
FT                   ARLSSPVLDGIVLVDCALSASRWNDCHLAGARLERCRFDQAELDTVTFWQGTLLRETGF
FT                   AAARLARVTWLDCELDGLDFAGARLRRCAWVQSQCGAAPNWAGAELQTCCVVETDMPHA
FT                   VFAGATLRECSLRDTVLDHADFTGAALWRCDLSQASLGGASLARARAPDSLFIRADLGG
FT                   ASLAEADLPGALLQKATLTHADLRGANLFRADLGLAVLDDTSDTRGAYTHLANTRPRAR
FT                   HGR"
FT   misc_feature    138855..138968
FT                   /note="Signal peptide predicted for BB0795 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.690) with cleavage site
FT                   probability 0.455 between residues 38 and 39"
FT   misc_feature    140535..140654
FT                   /note="HMMPfam hit to PF00805, DE Pentapeptide repeats (8
FT                   copies), score 2.1e-07"
FT   misc_feature    140655..140774
FT                   /note="HMMPfam hit to PF00805, DE Pentapeptide repeats (8
FT                   copies), score 0.061"
FT   misc_feature    140790..140909
FT                   /note="HMMPfam hit to PF00805, DE Pentapeptide repeats (8
FT                   copies), score 0.22"
FT   misc_feature    140913..141032
FT                   /note="HMMPfam hit to PF00805, DE Pentapeptide repeats (8
FT                   copies), score 1.5"
FT   misc_feature    141111..141230
FT                   /note="HMMPfam hit to PF00805, DE Pentapeptide repeats (8
FT                   copies), score 5.1e-05"
FT   misc_feature    141261..141380
FT                   /note="HMMPfam hit to PF00805, DE Pentapeptide repeats (8
FT                   copies), score 5.5e-09"
FT   CDS_pept        141469..142530
FT                   /transl_table=11
FT                   /locus_tag="BB0796"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJA9"
FT                   /protein_id="CAE31295.1"
FT                   /translation="MDAETLRDWVRQGRPLVGLDLRAAALQGADLAGALLQDCDLRGAA
FT                   LAGSRWRDSRFSGCRMEQTDWRGADVAQCAFFRCELAEAVFAAAECAGASWVECRAAGA
FT                   DFRATPLHGSHFVQCALDGARLDRAEMREGGFAECTLEQASLAGAALRQTLFFRADLRT
FT                   ADLAGARLERVVFVECDLSGQRLAGQFLGGSQFVEARMDGCDLREASMAQCNFKGASLR
FT                   RACLAGASGARAMFAQADLGGADCSGARMPQSLWADAILDGAVFSGADLAQAMLHRARA
FT                   AGARFDGAGLHYADFSYADLRDADLRGARCLRTQLHRALQEGARWDSRIGVLENDPALY
FT                   EAELWSARRRAGP"
FT   misc_feature    141538..141657
FT                   /note="HMMPfam hit to PF00805, DE Pentapeptide repeats (8
FT                   copies), score 1e-05"
FT   misc_feature    141733..141852
FT                   /note="HMMPfam hit to PF00805, DE Pentapeptide repeats (8
FT                   copies), score 0.79"
FT   misc_feature    141883..142002
FT                   /note="HMMPfam hit to PF00805, DE Pentapeptide repeats (8
FT                   copies), score 0.00034"
FT   misc_feature    142033..142152
FT                   /note="HMMPfam hit to PF00805, DE Pentapeptide repeats (8
FT                   copies), score 0.0028"
FT   misc_feature    142183..142302
FT                   /note="HMMPfam hit to PF00805, DE Pentapeptide repeats (8
FT                   copies), score 5.2e-05"
FT   misc_feature    142318..142437
FT                   /note="HMMPfam hit to PF00805, DE Pentapeptide repeats (8
FT                   copies), score 0.039"
FT   CDS_pept        142561..143469
FT                   /transl_table=11
FT                   /locus_tag="BB0797"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="InterPro:IPR026835"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LR87"
FT                   /protein_id="CAE31296.1"
FT                   /translation="MFADCQLMGMDLAFPDICKTPPALLPIPYPNFALGPMGIPNVWNV
FT                   LLMAMPAHNLLTTIALSNGDNPGIGMGLISQTVMAQARRITCVPNVLFGCIPATRLTGL
FT                   TVQNTINTVGMRVVPSQLKVVLLGGGGGGGGAARAAKSAKAGKGPGARAGATARRGAGG
FT                   KGGAAGKGGQGGGKAAGSGKSGGGKGAKPRKPGDDPRYRRGKFRKGVRDKAWDQEARRS
FT                   KDGVVRDPVSGKKMKKDEPWDMGHKPGYEHRKHVRSAKERDIDRKQFLDEYNDPSHYRP
FT                   ELPKSNRGHQGELKTDDYFGP"
FT   CDS_pept        143510..144070
FT                   /transl_table=11
FT                   /locus_tag="BB0798"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR020941"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI17"
FT                   /protein_id="CAE31297.1"
FT                   /translation="MARHALKVFGGTPVVHAYRHDQIDTLSIDMLAVDDSPDDGLVSYS
FT                   TLGLFDLELRHDDGQPMATRVELCADMPEDLQSWANVLATAAFGLMRSGQAVMPGSVLP
FT                   DCVAEYYPDATVPHLYLCVPFSWQDGEFPRCDADGLLVNWLQAVPISETERQFIETAGP
FT                   DAFEDELLEADPDIYDLSRPAVR"
FT   CDS_pept        144473..145522
FT                   /transl_table=11
FT                   /locus_tag="BB0799"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI44"
FT                   /protein_id="CAE31298.1"
FT                   /translation="MPRMTTNMEFADLLKTLTPSLPCGEDLEYDADFLQLQQAAVGRSE
FT                   QQFGATIIPAQAPDWRAVERLALGLLERTRDLRIIAYLTRAWTEMRGLPGYAEGVTLAA
FT                   GTLEQYWDAVHPMLASGGEEDPMPRVNALASLGDPQGCVRGMRSACLLDDVHGRLSLRD
FT                   AEALLDGGRSEADYPGGRTRLIENLRQARLRRDDAALAVGAAAGALRRIQQQATQRLGS
FT                   AWCPDYAQALRALDALLRTWSDLDETAAAPAAAMPAEAHHAAPAPEPQPAPASWHDARI
FT                   ATREDAMAMLAKVSAYFETHEPSHPAPYLIRRVQQLIPLDFHDILRNLAPQGLAQFEAW
FT                   TAREAASQS"
FT   CDS_pept        145565..146128
FT                   /transl_table=11
FT                   /locus_tag="BB0800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN18"
FT                   /protein_id="CAE31299.1"
FT                   /translation="MATTLKGSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVL
FT                   ADLAGKSNTPQPEVGERKFLDVDIDNFDERMKSVAPRAAFQVANTLTGAGHLNVDITFE
FT                   SIDDFSPATVARKVGALNEMLEARTQLANLLTYMDGKTGAEELIGQVLQNPALLGALAA
FT                   APKPADAGPADADAESAQPGPQAR"
FT   CDS_pept        146150..147652
FT                   /transl_table=11
FT                   /locus_tag="BB0801"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJB1"
FT                   /protein_id="CAE31300.1"
FT                   /translation="MTAVARRERAQAESSLAADDLSALLKKEFKPKTEQAREAVEHAVR
FT                   TLAHQALENSGLGLSSDAYRTIQAIIAEIDRKLSEQINLVMHHPDFQQLEGAWRGLHYL
FT                   VTNTETDELLKIRFMCLSKNELGRTLKRYKGVGWDQSPIFKRVYEEEYGQFGGEPIGCL
FT                   VGDYSFDHSPPDVELLGEIARISAAAHCPFIAGASPNVMQMDSWQELSNPRDLTKIFTN
FT                   TEYAAWRSLRESEDARYVGLAMPRFLARLPYGARTNPVDEFDFEEETDGANHDRYTWAN
FT                   SAYAMAANINRSFKLYGWCTSIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDR
FT                   REAELAKNGFMPLVHRKNSDFAAFIGAQSLQRPQEYHDADASANAKLAARLPYLFACCR
FT                   FAHYLKCIVRDKIGSFRERSDMERWLNDWIMNYVDGDPANSSQETKARKPLAAAEVQVT
FT                   EIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSKLPSLKQNEG"
FT   misc_feature    146417..146452
FT                   /note="PS00213 Lipocalin signature."
FT   CDS_pept        147728..148195
FT                   /transl_table=11
FT                   /locus_tag="BB0802"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LR91"
FT                   /protein_id="CAE31301.1"
FT                   /translation="MKIEGANGESKDANHKDWTDIVSFSWGATQPASLATGGGQGAGKA
FT                   SFNDLHVVARIDKAAPAVMKHCASGKHLGKIELSVCKAGGAQVEYSKVTLEDVLVTSVQ
FT                   IAADNGSEAVLVNYAFQAAKVRQQYWEQTESGGKGAESLVAWDIKQNKEIG"
FT   CDS_pept        148245..149054
FT                   /transl_table=11
FT                   /locus_tag="BB0803"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI21"
FT                   /protein_id="CAE31302.1"
FT                   /translation="MQTSVLAMPPRDGGLAGQAAAVQARIRRAPADADLRAQLFQLAAV
FT                   QGDWRRAAEQLQLCARLNPLAQPMANLYLAAIHGELRREAVLAGQAEPGFLAERPCWCE
FT                   PLLQALRAQASDPERAAMLRAQAFDAAQASAGTLEDAAAGQAGYAWICDGDSRLGPVCE
FT                   LILDGSYAWLPFAQVAAVHLPAPQGLCDLVWARAEIALADGAVVRGLVPARYPPSAGQD
FT                   DGLRLGRATCWRPLGQDGYAGEGQKMWLTDAGEFALLDVRALRQQAP"
FT   CDS_pept        149051..149569
FT                   /transl_table=11
FT                   /locus_tag="BB0804"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI50"
FT                   /protein_id="CAE31303.1"
FT                   /translation="MRIADERVARDRLQPSLLDRLVDDEPWRRSEAPEAALLTHAGLRA
FT                   AVLRDLRWLLNTVNLASSQDLAPYRHVPASSVNFGVRAMAGRRMSEIDWVDVETSIRDA
FT                   IAAFEPRILESSVEVRCVSDTRTLEHHNVLSLEIRGMLWCVPHPREFLFRTDIDLESGH
FT                   MDLRDLGGA"
FT   CDS_pept        149569..151482
FT                   /transl_table=11
FT                   /locus_tag="BB0805"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN23"
FT                   /protein_id="CAE31304.1"
FT                   /translation="MDARLLDYYNRELVYMRELGAEFARQHPKVAGRLGMHGTEVADPY
FT                   VERLLEGFSFLAARIHLKMDAEFPRFTQRLLEVVHPHYLAPTPAMAVAQFSPSMNEGTL
FT                   AGGFTLPRGTVLRGGLARGEQTPCEFMTGHALRLWPLRVTAAELTGAPTDLPLARLGLG
FT                   GREAGVASALRLRLEVCGGVSLEELDLDQLVFYLNGPDAPMQRLLELIMCHTVAVLGHD
FT                   SERPVSWINRLPADAVRHEGFADDQALLPTDTRVFQGYRLLQEYFAFARRYLFFSLNGL
FT                   KQGLCTRRAAPAAAAGPAGTRRFDLTLLLSAAAPELEGAISAGNLALHCAPIVNLFPRR
FT                   ADRVAVTPRHHEYHVVVDRTRPLDFEVYSLTRVLGHMSAQRPEQEFRPFYGSFGADADD
FT                   YGAYYSLRREPRLASDSARRHGTRTSYTGSEVYLSLVDRHEAPFADTLRHLGIDALCTN
FT                   RDLALLLPLGGASDFSLRVSAPVGAIKVLHGPSRPAAAMADHGTAWQLISHLGLHYHSL
FT                   TDLDETRGAQTLRELLNLYGNLADPVARKHISGVRHVRVEPMHHRLPVPGPIVYGRGVR
FT                   IDLQVDETAFSGISPYLFGAVLEQFFARHVSINMMSALTLSTPQRGAVASWRPRMGRRP
FT                   AV"
FT   CDS_pept        151517..152176
FT                   /transl_table=11
FT                   /locus_tag="BB0806"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR021927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJB6"
FT                   /protein_id="CAE31305.1"
FT                   /translation="MQTRNARRLYPVYDPVHLIGTVARREDDGAWTVWCDGRPWRVRRA
FT                   ASCLLVPEEGDTALISGPDAERVYLIAVIEQADAAQATLELEGRVSLRSRTADVSLEAA
FT                   GEVRLRGAQAVRVETEALSVKAGQAACAAARMHYVADEVEGAVGSMRLVGKVYEAVLDR
FT                   LTQLARMAVRQTSEVEHVRAGTLDYQAEQSARVHAPYTMLTADALVKVDAKQIHMG"
FT   CDS_pept        152173..153267
FT                   /transl_table=11
FT                   /locus_tag="BB0807"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LR95"
FT                   /protein_id="CAE31306.1"
FT                   /translation="MSMDAAARTDRHAALAVLPPAFWQALAAAPHGHDLFHVLRWIDAR
FT                   AGARAPLGRGASPRHEPVRMRQEPSLAFAPATLAAARAPGEGAAPELSIYSFGLFGPNG
FT                   PLPLHLTEHARERRQHHGDHSLAAFADLFHHRLILLFYRAWADAQSTASLDRGQERFSG
FT                   YVASLLHLGAPSLRRRDSVMDHAKYHMAGHLLRQTRNPEGLCQVLRAFFGLPVGVDEFV
FT                   AQWIRLEAGQRLRLGAGGGLGGGAPLGVAVRDAQHKFRIRLGPLDWQDYLAFLPGSARA
FT                   RQLLHWVRLYVGVEFAWEVRPVLRRDAVRGVRLGAAAPLGLASWLGRRPPRLGDAAELL
FT                   LDYEGRERQAARRAQAFHEKEQAA"
FT   CDS_pept        153264..153797
FT                   /transl_table=11
FT                   /locus_tag="BB0808"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI25"
FT                   /protein_id="CAE31307.1"
FT                   /translation="MIHDMSYDGQILAWPGHGQFRATSGMRGFQHPGQACTPDSGPVPP
FT                   GLYRVLLADRGVALDDGRGVCNLAPAWGIQQVPRGAAAGECEPYWANWGENRARMEPAD
FT                   AATRNRCAPARGGFYLHDSTKGFSHGCIEVEGRIFALLRSYARQRGRNAMILKVAYVAD
FT                   RATNGGTAGDGHAR"
FT   CDS_pept        153787..154164
FT                   /transl_table=11
FT                   /locus_tag="BB0809"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR018696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI52"
FT                   /protein_id="CAE31308.1"
FT                   /translation="MRADRHAWLLAACLAPALAAAGPLRVENRLAECVRVQPGLRSVEH
FT                   NVVLQRFDLTVVRPIGDCGCKSALVAYQASVVREDGTRGASQSGVFGAMRSGPRTLPLA
FT                   SDAALLGERPVALGLGCAPAD"
FT   misc_feature    153787..153849
FT                   /note="Signal peptide predicted for BB0809 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.635 between residues 21 and 22"
FT   CDS_pept        154188..156797
FT                   /transl_table=11
FT                   /locus_tag="BB0810"
FT                   /product="putative ATPase with chaperone activity"
FT                   /db_xref="GOA:A0A0H3LN26"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN26"
FT                   /protein_id="CAE31309.1"
FT                   /translation="MSDIGRAELFGKLDSLSYRALEDATALCKLRGNPYVELAHWVHAI
FT                   AHAQDSDLHHIARAFELDLGALQQDLVRALDQLPRGAGAVSDLSEHVDHVVERAWALAS
FT                   LRYGAARIRSGHLLLALLRDPSLRGVLAGMSGQFARVVPDLLLQGLPEMTRGSPEARAD
FT                   AAVADAPPDGGGAAGALARYAVDLTAQARAGRLDPVTGRDDEIRQLIDVLMRRRQNNPL
FT                   LTGEAGVGKTAVVEGLALRLARGDVPAPLREVALYLLDIGLLQAGAGVKGEFEQRLRQV
FT                   IDAVQGSERPIVLFIDEIHTLVGAGGAAGTGDAANLLKPALARGQLRTIGATTWAEYKQ
FT                   YIEKDPALTRRFQAIQVHEPDEAGARRMLRGLAGALQAHHGVLLLDEAVEAAVRLSHRY
FT                   IPARQLPDKAVALLDTACARVAVSQQATPAALEDARRRIDALDLELEIAAREARLDAGP
FT                   AERVAGLREQGQAARAEADALAARWEREAALAGQVFGLREQLDAADEQSAPALRAALRE
FT                   AADALARSQGEAPLIHPAVDAAAVAAVVADWTGIPVGRMVRDEAQAVLALADTLERRVV
FT                   GQRHALELIARRIQTARAGLTDPGKPVGVFLLCGPSGVGKTETALALAEALYGGEQNLI
FT                   TINMSEFQESHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPHSVVLLDEVEKAHADVHEI
FT                   FFQVFDKGWMEDGEGRYIDFRNTVILLTANVGADLIASLCADPELAPEPDALAAALRAP
FT                   LRDVFPAALLGRLAAVPYLPLSDSMLAHIVALQFERVGQRLRERHGMDLEVEPAAAELV
FT                   VARCVEVESGARMVDAILSQRVLPQIGRELLGASLQQRTWRRVRVRAVDGEFACEYE"
FT   misc_feature    154845..155429
FT                   /note="HMMPfam hit to PF00004, DE ATPase family associated
FT                   with various cellular activities (AAA), score 8.4e-07"
FT   misc_feature    154860..154883
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    155124..155162
FT                   /note="PS00870 Chaperonins clpA/B signature 1."
FT   misc_feature    156015..156038
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(156896..157696)
FT                   /transl_table=11
FT                   /locus_tag="BB0811"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJC1"
FT                   /protein_id="CAE31310.1"
FT                   /translation="MMLTLIVRNPEPGASARRADFHAPGGTLGRDAENCLALPAAPGQL
FT                   CRVQAALRADAQGWRLHNLSGMAAVHINDAALAPGAVRAIQAGDTLRVGAHTLEVSGPD
FT                   APDARPAALPEAAADTPADAPRRGQAGAGAAEDIFSGLFGPGTLPVGGIADAATHPFDL
FT                   DSAQARNAADPLAHLPAGDAAVSRPAGDPLALFDAPHGGADVFADATPSALPAHDPLAP
FT                   LRADPVRDTLLPRHAAGDGPAAHDHAPAGGTFLRPAAPRADQAD"
FT   CDS_pept        complement(157724..158119)
FT                   /transl_table=11
FT                   /locus_tag="BB0812"
FT                   /product="putative lipoprotein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LR99"
FT                   /protein_id="CAE31311.1"
FT                   /translation="MTLRFHATLLGCAILLAGCASPTSERAGEPASDQAERDLQQIRQS
FT                   YSAGAYGDVIRQVAHADALAQAPQSMRIEAWKLQAFSYCVTDHRVLCEAGFRRILQADP
FT                   AFTLEPNEAGHPQWGPAYERARAAPAG"
FT   misc_feature    complement(158039..158119)
FT                   /note="Signal peptide predicted for BB0812 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.813 between residues 27 and 28"
FT   misc_feature    complement(158063..158095)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        158384..158926
FT                   /transl_table=11
FT                   /locus_tag="BB0813"
FT                   /product="putative lipoprotein"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI29"
FT                   /protein_id="CAE31312.1"
FT                   /translation="MLVAVPTRRALRAAAWIAVAVLAAGCASTASRKAAPYAIELKADP
FT                   RVNPDASGRPSPIQVTLYELRSSAEFEARDFFTLEGDAQAALGKSLIETDQVILQPGET
FT                   RKLSYPGNTEARVVGIVAAYRDLERSPWRIVVPLPQAQNTNIYKFWQFSPNEETVRVAV
FT                   GGQGVQIVDRERSWWPF"
FT   misc_feature    158384..158485
FT                   /note="Signal peptide predicted for BB0813 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.992) with cleavage site
FT                   probability 0.607 between residues 34 and 35"
FT   misc_feature    158429..158461
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    158630..158653
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        158972..160306
FT                   /transl_table=11
FT                   /locus_tag="BB0814"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI59"
FT                   /protein_id="CAE31313.1"
FT                   /translation="MALDNKVVWSEGMFLRPQHFQQFERHIEAQLRVRAAAASGCGWGY
FT                   TALEIDRDALALGKLALARAAGVLPDGTPFEFERADEGPPALDIDPAMRDARVMLALPR
FT                   RRAGACEVVYEDGADTLARYCVHEGEIEDSGSVGLEPALVQLGRLRLRLVPETELGDEW
FT                   VALGAARVLERRADHRVVLDEMYIPPWLAADANPALRGYAGELSGLLQARAAALAQRLA
FT                   QPGRGGVSEVADFLLLALVNRYAGALWHARQVPALHPERLFRDWLMLACDLATYTCATR
FT                   LPEVLPDYRHDDLQASFGPLMAELRRSLSVVLEQHAVQIPLHDRGQGVRVAQIADAELL
FT                   RSAGFVLAVHADMPAETVRTRFPAQVKIGPVERIRDLVHLQLPGVAVRALPVAPRQIPY
FT                   SAGHVYFELDKNGEFWRQLERTGALALHLAGEFPGLALEFWAVRD"
FT   CDS_pept        160327..161607
FT                   /transl_table=11
FT                   /locus_tag="BB0815"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="GOA:A0A0H3LN29"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR017733"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN29"
FT                   /protein_id="CAE31314.1"
FT                   /translation="MHAANPPFPDFGADAAADPGAASRLRPHEYVISGSNPLVAAANPL
FT                   LDLIPQIRATTAHPAPAMLREYLVDEVRQFELRAQQAGIPNETILGARYCLCTALDEAA
FT                   ALTPWGGGGVWSAHSLLVTFHNETWGGEKFFQLLAKLSQNPGQHLDLLELLYYCLLLGF
FT                   EGRYRVIDNGRTQLETLRQRLLRILRGARGEYPRALSPHWRDTPVQQALRRLPVPLWAY
FT                   GALAAALALALFWGLSWRLGERSDAVFAAVARLKPPTVQIAPAPRPAPAPRLAVFLQPE
FT                   VRDRLVTVRDEVDRSVVVLRGDGLFESGAVAVRDRYAPVLARVAEALGQTRGDIVVRGY
FT                   TDNVPIRTARFPSNWHLSQARAEAVKAVIDARLGQAGRVRAEGRGEADPLAPNDTPAGR
FT                   SVNRRVEITVMVPPAPHARTPEEGATP"
FT   misc_feature    160975..161043
FT                   /note="1 probable transmembrane helix predicted for BB0815
FT                   by TMHMM2.0 at aa 217-239"
FT   misc_feature    161239..161535
FT                   /note="HMMPfam hit to PF00691, DE OmpA family, score
FT                   6.2e-21"
FT   CDS_pept        161604..165209
FT                   /transl_table=11
FT                   /locus_tag="BB0816"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LJC4"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJC4"
FT                   /protein_id="CAE31315.1"
FT                   /translation="MIPRLFGWLFSRGLWSFLGLVALALLVWIAGPLLAIGALRPLESE
FT                   TARVLVIAALFAFALLRLLWRKWREGRLNAQLLGQLRRPARPEAEAAAEPPPSDLRELE
FT                   GRFDEAVELLRKTRFDGGGGRGWLQRYSRQYLYQLPWYVIIGAPGSGKTTALVNSGLDF
FT                   PLAERFGKAALRGVGGTRNCDWWFTDDAVLLDTAGRYTTHESDPTGDEESWRGFLGLLT
FT                   RFRGRQPINGAMLTVSIEDLLAASDAERARHAAVLRRRLQELREQLGIHFPVYVLVTKA
FT                   DLLAGFEQYFASFSREDLEQVWGFTLPYARAQEPDFDLYEAFHAEYRLLQRRLDDALPE
FT                   VLAAEPDEARRALAYLLPQQFAGLQAVLGHFLSDVFASSRFEERLVPRGVYFTSGTQGG
FT                   ETFDQVTGHLKRYLRIESGPAPAAAEEGRSFFLKRLLQDVIFPEAGLAGRNLRWERRYR
FT                   RLHWAGYGLITLAFLGLAAGWLASYGNNVRYLDEVARRVPTVDKLGRDIKITRSGDVLG
FT                   LMPFLDGLWYLPRDAAFEPDAPPLSYRFGLYQGGKMHAAMQGVYRGTLDSVLLPQVARR
FT                   IEAALRAARADDLEYGYEALRAYLMLYEADHYDAEFMHAWLLSDMQGTLPEGYTRRQYD
FT                   LMSLHLRQLAQGGVLASPFPRDEALVRQARDELARHTLAQRAYSRLRRMLAGADDQPPT
FT                   TAVTLGGPQASAVFVRKSGKPLAQGIAALYTYRGYWDVFNPRVTRVAERLRSDDAWVLD
FT                   IAPPGVLDEAARQQLIVDIKRLYLNDYVARWDGYLDDLALAPRSSLLQSIQLARTLSAP
FT                   DSPLVRLTQGVARETTLLRDAGGDERSLADQARDRVSSTREALEQMFGPTGPGAATRAD
FT                   AGDGKLERVVDQHFEPWRRLARADGQGGAPIAATTSLVNELYTYLTAADAALRSASPAP
FT                   ASDVVTKLRAEAGRLPRPLRDVLDDLSTGAAGEVSGVARERLGEDLYATIGLFCRQAIA
FT                   GRYPFAPGSPRDVAPNDLARLFAPNGMMDEFFQKNLVSQIDVSEARWRFKPGMDGTPGQ
FT                   ASALLDSFQRAAAIRDAYFMAGSAEPAFRVSIRPVEMDPAITQFVMDVDGQTVRYAHGP
FT                   QVATSVQWPGPRGANQVRIELTPQAGAAGLSASGPWALNRLLDQARVTRGASPEISLAS
FT                   FDIGGRKVVLEIRAGSVRSPFHLAEMRGFSCPGRS"
FT   misc_feature    161604..161708
FT                   /note="Signal peptide predicted for BB0816 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.941 between residues 35 and 36"
FT   misc_feature    join(161640..161708,161739..161798,162981..163049)
FT                   /note="3 probable transmembrane helices predicted for
FT                   BB0816 by TMHMM2.0 at aa 13-35, 46-65 and 460-482"
FT   misc_feature    162039..162062
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        165206..165940
FT                   /transl_table=11
FT                   /locus_tag="BB0817"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR017748"
FT                   /db_xref="InterPro:IPR038225"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRA3"
FT                   /protein_id="CAE31316.1"
FT                   /translation="MSGGRAMPGADPDGGVGWYGKIPAAGDFMRRRLSHGLVAWWDKWL
FT                   QYGLAALRQMPAGGAERAYAAAPLWNFAIPAGAGAGAVLLGGMAPSRDRVGRAYPLSAM
FT                   AVVPAQAYQPGLLEDAGDYYRQLGATLLAAVRRGGAAEQLDRQLQAMPLPVAMPPARPA
FT                   PAGQDILDILNAGQAGNAPLAGARGLAAWPELPFCFNPGSHTSYWWTNQADGAALQTYV
FT                   HGGALNATLFLRLFAAPPAWRV"
FT   CDS_pept        165965..167143
FT                   /transl_table=11
FT                   /locus_tag="BB0818"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0H3LI35"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI35"
FT                   /protein_id="CAE31317.1"
FT                   /translation="MRPSSATDTASVLEAAAPRPLDVDGAAPMPPARVRRVLADLLEQL
FT                   APLHERWRVHGRIAPRTVGLDGDGRARLLVDAAQPAADAEALAHAAGFAAFEQYSDDPG
FT                   QPCGPWTDIYGLSALAYALATGAAPPSALRRCVRDDCAPLARRLDEKRWQALAQAIDAG
FT                   LAPDYRDRPASLAAFARLLDAADRQAEPPPIAPVAPATSATVAVAQAPAPATLPSRAPA
FT                   RRPARTSALAVLAVLAVLAVVLYAALGGRAGDEPAASLAAAPMPAPTPAPEPAPEPPAP
FT                   APEPSPASEPAPLPEPTPTPESVSAPAPQPAPAPAAPPPAAPQPVSVRVDIRPWGEVWI
FT                   DGRSRGVSPPLKQLSLPPGCYAVTVRNPAGPDHRLDLHVAAGQGAAIAHAFE"
FT   misc_feature    166646..166714
FT                   /note="1 probable transmembrane helix predicted for BB0818
FT                   by TMHMM2.0 at aa 228-250"
FT   CDS_pept        167241..168407
FT                   /transl_table=11
FT                   /locus_tag="BB0819"
FT                   /product="putative calcium/proton antiporter"
FT                   /db_xref="GOA:A0A0H3LI62"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI62"
FT                   /protein_id="CAE31318.1"
FT                   /translation="MSSIHPAPTDSRTLVPRATRIRLAIAWLVTLLFLTLGEGLLAAPT
FT                   APLATLLSVLLVGTIIMAAFVVVREADHLAEQLGEPYGTLILTLSVVGIEVILIAAVML
FT                   GPGEFPTIGRDSIFAVMMIILNLVTGLCVLLGAWRHGAQAYNAQGASAYLAMIALLTGM
FT                   ALLLPNATVSGGPGMFSPAQAIAFSVLTVALYAAFLALQTGRCRHLFIQPAGGAMAIAA
FT                   PASAPRPEAGHGAGGRRTALVRSLVLLAALLPIVLLSHSLAVVVDYGISAAGLPAALGG
FT                   LVIAIIVFTPESVTAVRAARANEMQRVMNLCLGAFVSTVGLTVPAVLAIGLLTGKTVVF
FT                   GISAAETVLFALTLLLSLFTFMGQRTTPVTGLAHLALFAVFGVLLFAP"
FT   misc_feature    join(167301..167369,167379..167447,167484..167552,
FT                   167595..167654,167688..167756,167784..167843,
FT                   167964..168032,168042..168110,168171..168239,
FT                   168249..168317,168342..168401)
FT                   /note="11 probable transmembrane helices predicted for
FT                   BB0819 by TMHMM2.0 at aa 21-43, 47-69, 82-104, 119-138,
FT                   150-172, 182-201, 242-264, 268-290, 311-333, 337-359 and
FT                   368-387"
FT   CDS_pept        168581..169993
FT                   /transl_table=11
FT                   /locus_tag="BB0820"
FT                   /product="putative lipoprotein"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN35"
FT                   /protein_id="CAE31319.1"
FT                   /translation="MGKATWRQVWERARALAGAAALAVLAGCAAPGAQDPGQARNTARE
FT                   AYIYAYPMLYHYRSMYEQAIDTASPAYLGGFGVFQHRAEPYTPQSVDVATPNVDTLYSR
FT                   AWLDLRAEPWVLSLPAVPKSRYNAFQLVDMYTYNLAYLGTRATGFGSGHYLIAGPGWTG
FT                   PVPKGITQVVRADTDFVAVLGRTALNGPADIKAVHALQARYGLRPLSAYTGTAAPAGAP
FT                   PVDWLPWNEQRASSIGFIAYLNQLLAHTQPQPESEADMMARFARIGVAPGRDFEPARLD
FT                   AATRRAMDAGIVDAQQAIEQGARHAAAPATPASLYGSREQLGGDYLKRAVAAAVGIYGN
FT                   TADEAIYLTIGEDAQGRPLDGARAYELRFAPGRQPPVRFFWSISVYALPARGLAENPID
FT                   RYAIGSRTKGIKRGRDGSLTVYLQHDAPARAHAPNWLPTPAGPFVVVARFYGPQPALRD
FT                   GAWVMPALVPAR"
FT   misc_feature    168581..168679
FT                   /note="Signal peptide predicted for BB0820 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.663 between residues 33 and 34"
FT   misc_feature    168632..168664
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(170001..172964)
FT                   /transl_table=11
FT                   /locus_tag="BB0821"
FT                   /product="autotransporter"
FT                   /db_xref="GOA:A0A0H3LJC9"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJC9"
FT                   /protein_id="CAE31320.1"
FT                   /translation="MLRHLGWLAACCAASAYAADYPGLTLNPGDDFTLQGNDTVNGATA
FT                   VRMSSATLNFGAGPITVNATGTGIFATNGAGALINFLPSSVVTLNVTSPTAGVGILTSS
FT                   SSNTAIDLQADSSLTINAYQGINLAHTPRAAPNRLSIGDGATLRVNASGTGMAPKGLLI
FT                   NNNNSVVVASGGTLGLGTSGGRYARALELSISLTYPDAAADKFTAAPGSNLNLSTTGQD
FT                   SDAFYMLGVGEALMQGNTDIHTTGANSTGFYLYRYGAPTSHLLVAPHAGGHATILTEGQ
FT                   GSHGLWAINGSQAEFANASLQTRGDEAAGLYALTTIGETATQVRAADTAIATAGAQSYG
FT                   VLAQGYGTDVALTRGTVATSGAQAHAVVVAGESRFSADGTAIQAQGDGAMALLMSSDRD
FT                   AQTATVSGGSLRSLRGSAIGIEGGTARVELDGTAVDGATNWLHVADSGALAVLRDVTVP
FT                   GRDPSQTDAPAFPAILHGTRAAGIAATATVVARNADLTGAAITEPGNTSHVTLIDTTWH
FT                   MTGSSTITNLVNDPSLIDFAAPQGGAYKTLTVGNYSGDGTIALNTYLGADDSPSDKLVI
FT                   DGGTASGSSKLRIKNTGGPGAATQAQGILVVDTRNGGTTTATAFSLSEPVVVGAYDYQL
FT                   YRGAQTPEQEQNWYLRSAILPPVDPTNPDQPGEPIPTYRPETPGAVMAPEVARQVGARM
FT                   LDTFHDRMGDQYALLNSAQRKAGWGRVIGQRLTQRWDGDVEPRFKGNIWIAQAGADMLE
FT                   RDRDDGLSDRLGLFGAYGQADGRVDGFVQGEHGKQAGKLRVEAYGLGLYWTRLKHTNWY
FT                   WDNVLMGNYYTGRSRSDRGVAASLEGWGFTASSEAGYSFFPRHDIMLQPQAQLVYQYTS
FT                   LDDTHDAYSTIRYHGGGALTGRIGLLLQGNADQPERIRPYARINLWHRFSHGESVSFGP
FT                   SDSIRTEYGSTSMDLRIGLAAPLNRQTELYASAGYGFDLDGNQRQAYYGNIGVRYSW"
FT   misc_feature    complement(170007..170873)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF03797, DE Autotransporter
FT                   beta-domain, score 6.1e-22"
FT   misc_feature    complement(171009..171383)
FT                   /note="HMMPfam hit to PF03212, DE Pertactin, score 4.4e-09"
FT   misc_feature    complement(172911..172964)
FT                   /note="Signal peptide predicted for BB0821 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.997 between residues 18 and 19"
FT   CDS_pept        173414..174892
FT                   /transl_table=11
FT                   /locus_tag="BB0822"
FT                   /product="putative phospholipase D protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3092"
FT                   /db_xref="GOA:A0A0H3LRA8"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRA8"
FT                   /protein_id="CAE31321.1"
FT                   /translation="MPPPVDRTASHALDASQARATPLGQGIGDLADAHPGLSGFHALGD
FT                   AQDAFAARMLLARAATRTLDVQYYIWRNDMTGTLLLQALHAAAERGVRVRLLLDDNGIS
FT                   GLDDALAALDAHPNAEVRLFNPFPTRSFKALGYLTDFSRLNRRMHNKSFTVDNQATIIG
FT                   GRNIGDEYFGATDGVLFADLDVLAVGPVVGDVSAEFDAYWASESAWPAGPLLPAPGAQT
FT                   LRALAERAARIEQDPAAGDYMSALRELPFIRELMAGRLPLQWAPARMVSDDPAKGLGKA
FT                   PPAGLLTQQLRNILGEPRRTLDLVSPYFVPTEAGTQAFAALARGGAQVRVLTNALEATD
FT                   VAVVHSGYAKRRKALLQAGVRLYEMRRSYAGPKPQGRGRFGSSGSSLHAKTFGVDGERV
FT                   FIGSFNFDPRSANLNTELGFVIESPDMARHIAATFDQDIPAATYEVRLDDDGSLYWLEQ
FT                   RDGATVRHDSEPGVSLWRRFSVWLFSLLPLEPLL"
FT   misc_feature    173843..173926
FT                   /note="HMMPfam hit to PF00614, DE Phospholipase D. Active
FT                   site motif, score 0.33"
FT   misc_feature    174560..174643
FT                   /note="HMMPfam hit to PF00614, DE Phospholipase D. Active
FT                   site motif, score 4.6e-05"
FT   CDS_pept        complement(174899..176008)
FT                   /transl_table=11
FT                   /gene="modD"
FT                   /locus_tag="BB0823"
FT                   /product="molybdenum transport ATP-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3093"
FT                   /db_xref="GOA:Q7WP62"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR011868"
FT                   /db_xref="InterPro:IPR015852"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WP62"
FT                   /protein_id="CAE31322.1"
FT                   /translation="MPSDFPPGQAGIHARFRVDYPEFSLDVDLRLPGRGVTALFGQSGS
FT                   GKTTCLRCMAGLAPVSDGYLDINGEVWLDSAARRAVPTHKRALGYVFQEASLFEHLDVL
FT                   ANLRYGMKRVPPALRRVDLEQATGLLGIGHLLARMPAGLSGGERQRVGIARALLTSPRL
FT                   LLMDEPLAALDVQRKREILPYLERLHDELDIPVIYVSHSPDEVARLADHLVLLEQGRAV
FT                   ASGPLDALLTRLDLPMAMTDDASVVVTGEAAGFDPGYALLTLQLPGGRARLRFVHQAAP
FT                   AGQRLRVVVHARDVSLALQQPREGSILNVLAVRVLEMAPAANPAHVMVRLDADGTPLLA
FT                   RITRYSRDRLALAPGMQAWAQIKAVSLLA"
FT   misc_feature    complement(174905..175096)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF03459, DE TOBE domain, score
FT                   2.2e-11"
FT   misc_feature    complement(175352..175909)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   3e-48"
FT   misc_feature    complement(175538..175582)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(175865..175888)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(176020..176700)
FT                   /transl_table=11
FT                   /gene="modC"
FT                   /locus_tag="BB0824"
FT                   /product="molybdenum transport system permease protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3094"
FT                   /db_xref="GOA:A0A0H3LI41"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI41"
FT                   /protein_id="CAE31323.1"
FT                   /translation="MSLTSADWAAIWLTIELASLTTLLLLVIGTPIAWWLARTRSRLKG
FT                   PVGAIVALPLVLPPTVIGFYLLVAMGPNGYVGQLTQSLGLGTLPFTFAGLVVGSVFYSM
FT                   PFVVQPLHNAFEAIGRRPLEAAATLRAGPWDRFVSVALPLARPGFVTAGILGFAHTVGE
FT                   FGVVLMIGGNIPGKTRVVSVQIFDHVEALEYAQAHWLAGGMVVFSFIILLLLYSRRQRA
FT                   TAAL"
FT   misc_feature    complement(join(176053..176121,176179..176247,
FT                   176377..176445,176488..176556,176590..176658))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BB0824 by TMHMM2.0 at aa 15-37, 49-71, 86-108, 152-174 and
FT                   194-216"
FT   misc_feature    complement(176131..176361)
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport systems inner membrane component, score 1.9e-13"
FT   misc_feature    complement(176167..176190)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(176722..177477)
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="BB0825"
FT                   /product="molybdate-binding periplasmic protein precursor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3095"
FT                   /db_xref="GOA:A0A0H3LI68"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI68"
FT                   /protein_id="CAE31324.1"
FT                   /translation="MKIRAIPTLWALAATLLAAPALAGEVQVAVAANFTAPMQAIAKAF
FT                   EEDTGNRAVASFGATGQFYAQIKNGAPFEVFLAADDSTPAKLDAEQETVPGSRFTYATG
FT                   ALALWSARAGYVDDQGAVLKQGDFKHLSIANPKTAPYGLAATQVLAKLGLADKLAPRIV
FT                   EGQSISQAYQFVASSNAELGFVALSQIYKDGKLTGGSAWIVPASMHEPIRQDAVILKKG
FT                   QDNATARAFVEYLKSPRSAAIIKSFGYQL"
FT   misc_feature    complement(177409..177477)
FT                   /note="Signal peptide predicted for BB0825 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.974 between residues 23 and 24"
FT   CDS_pept        complement(177613..178497)
FT                   /transl_table=11
FT                   /locus_tag="BB0826"
FT                   /product="putative hydrolase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3096"
FT                   /db_xref="GOA:A0A0H3LN40"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN40"
FT                   /protein_id="CAE31325.1"
FT                   /translation="MMPGNAAPRPVHYRHEQVGDVKIFYREAGDPASPAVLLLHGFAAS
FT                   SYMYRDVIAALADGYRVVAPDLPSFGFTESPARDAYAYTFDNITRTMDRFTEQLKLDRY
FT                   ALMVHDYGAPVGWRLASAHPDRVTALVSQNGNAYEEGLAQGWDAIRRYWASPTAENRAA
FT                   LHGFPTPASIKWQYLEGVPDPSLVAPDGYTLEGLQVSRPGNAEIQLDLLLDYASNVQRY
FT                   PQFQAYFRDRQPPLLAVWGRNDPYFLPAGAEAWKRDIPAAEVRFYDTGHFALETHGAEI
FT                   IPAIRAFLDAKVR"
FT   misc_feature    complement(177631..178320)
FT                   /note="HMMPfam hit to PF00561, DE alpha/beta hydrolase
FT                   fold, score 4.5e-24"
FT   CDS_pept        178522..179166
FT                   /transl_table=11
FT                   /locus_tag="BB0827"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3097"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJD5"
FT                   /protein_id="CAE31326.1"
FT                   /translation="MNLKVTWIRCNLSISNSLVTNMATPATHPPHFIANNLALDFINSA
FT                   FGVGPASHDCLGDDESVLAWLEAAGHVPAGLARPPAGLAELARALREAAARMVRAAQAG
FT                   QGGDAALVNQVLEAGRPARKLAWDDGQGGYTLAECPRDHSAASLLEPVAAALADLLAGD
FT                   ALRHVRRCEAHDCTLVFLDVTKSHRRRWCSMALCGNRMKVAAFRSRRQGAG"
FT   CDS_pept        complement(179268..179390)
FT                   /transl_table=11
FT                   /locus_tag="BB0828"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRB3"
FT                   /protein_id="CAE31327.1"
FT                   /translation="MKQFAVTLLALFGVDAQASVAGPQRLLPILPGEPTRTERR"
FT   misc_feature    complement(179328..179390)
FT                   /note="Signal peptide predicted for BB0828 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.890 between residues 21 and 22"
FT   CDS_pept        complement(179436..179735)
FT                   /transl_table=11
FT                   /locus_tag="BB0829"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3099"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI45"
FT                   /protein_id="CAE31328.1"
FT                   /translation="MRTFTSAALLAAALFGFNAFAGSGELDYPPAGAQGGSLTRSQVQH
FT                   ELAIARAAGQLVFGESQEPAPQLAGSAATRAQVQAELAQARNASAASEYVETGA"
FT   misc_feature    complement(179673..179735)
FT                   /note="Signal peptide predicted for BB0829 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.991 between residues 21 and 22"
FT   CDS_pept        complement(179887..180312)
FT                   /transl_table=11
FT                   /locus_tag="BB0830"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3100"
FT                   /db_xref="GOA:A0A0H3LI73"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI73"
FT                   /protein_id="CAE31329.1"
FT                   /translation="MRGSSWAYPAANLAHLLGLVLLVGAMLLLDLRLLGLGRRFALADV
FT                   SAVLTPLAAGGLLLQLASGALLFSADAAPLSGNALMQYKAAGIALGVANALLFRALWGA
FT                   RLAGWDSRPPPWGRLQAALSLLLWLAVATLGRLIAYA"
FT   misc_feature    complement(join(179896..179964,180007..180075,
FT                   180112..180180,180208..180276))
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB0830 by TMHMM2.0 at aa 13-35, 45-67, 80-102 and 117-139"
FT   CDS_pept        complement(180382..180735)
FT                   /transl_table=11
FT                   /locus_tag="BB0831"
FT                   /product="putative exported protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN47"
FT                   /protein_id="CAE31330.1"
FT                   /translation="MTIRHLLAAGGLAAALAAPAWAHHGWSSYDADQTLTIEAPLTEVR
FT                   YRNPHAEVKVDYQGASWEVVLAPVSRMESRGLAKDALAVGKTVTIVGYPRKDGTHEVRA
FT                   ERITVDGKTIELR"
FT   misc_feature    complement(180670..180735)
FT                   /note="Signal peptide predicted for BB0831 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.635 between residues 22 and 23"
FT   CDS_pept        complement(180803..182902)
FT                   /transl_table=11
FT                   /locus_tag="BB0832"
FT                   /product="probable TonB-dependent receptor"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3101"
FT                   /db_xref="GOA:A0A0H3LJE0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJE0"
FT                   /protein_id="CAE31331.1"
FT                   /translation="MNTLRRLRILGAAATLGGPAAAQEAPAMLEPVRISGTRTGTSVLD
FT                   TPASVDVVDGHELRARNLQVNLSEGLAGVPGLQLQNRQNYAQDLQLSIRGFGARSTFGV
FT                   RGVRLYVDGIPATMPDGQGQTSNIDIGSAGRVEVLRGPFSALYGNSSGGVVQVFTEQGS
FT                   DPPEATGSAAAGSFGTWRYGAKLRGASAADGLDYVLDFNRFTTEGYRDHSAARKNLGNA
FT                   RLGLRMDDGSRLTLSANHVDLTAQDPLGLTREQFEDDPRSAPVAERFDTRKTVRQTQGG
FT                   LLYERAFDTRNDLRVMLYYGQRRTTQYQSIPVAVQQSPTQAGGVIDLGRDYGGADLRWT
FT                   SRQQVAGLPLTLIGGLAYDTMKEQRRGYDNYTGPPAAPTGLGVKGALRRDETNTVYNLD
FT                   PYLQASWQFAERWTLDAGLRYSTVRFDSDDHYQAPGNGDDSGRATYRKALPVAALRYAA
FT                   NENLSLYASYGRGFETPTLNELSYRPDRAPGLNFGLRPAVSTNLEAGVKWRTGAGLVTA
FT                   ALFHTQTDDEIVSAGSLGGRATYRNAGRTRRDGVELQWNGEFARHARAQLAYTWLDARY
FT                   RDDGPGAIRAGNRIPGVAAQALYAALSWAPPQGWQAGIEARYLGRIEVNDANSEAAPAY
FT                   FVAAASAGYAWRAGAWSWNAYARVDNLFGRRYAGSVIVNEANQRYYEPAPGRNGSIGLS
FT                   AAYTF"
FT   misc_feature    complement(180812..181141)
FT                   /note="HMMPfam hit to PF00593, DE TonB dependent receptor
FT                   C-terminal region, score 1.7e-10"
FT   misc_feature    complement(182837..182902)
FT                   /note="Signal peptide predicted for BB0832 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.977 between residues 22 and 23"
FT   CDS_pept        complement(182899..183402)
FT                   /transl_table=11
FT                   /locus_tag="BB0833"
FT                   /product="putative regulatory protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3102"
FT                   /db_xref="GOA:A0A0H3LRB8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRB8"
FT                   /protein_id="CAE31332.1"
FT                   /translation="MAILRQYGADRQLRLAICPNGLETAMDHALDALDRRLLALLRADA
FT                   RLPTATLARQLHVSRGTVQNRMARLERSGIVAGYTVRLRNEDEHGIRAITLIEVRGAAT
FT                   DAVVAALRRIPEALQVHSTNGRWDLVVELRAADLPAFDRVLRDLRSIDGVANSESNLLL
FT                   TAHR"
FT   misc_feature    complement(182944..183243)
FT                   /note="HMMPfam hit to PF01037, DE AsnC family, score 8e-07"
FT   misc_feature    complement(183199..183264)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1449.000, SD 4.12 at aa 47-68, sequence
FT                   LPTATLARQLHVSRGTVQNRMA"
FT   CDS_pept        183481..184722
FT                   /transl_table=11
FT                   /locus_tag="BB0834"
FT                   /product="ornithine aminotransferase"
FT                   /EC_number="2.6.1.13"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0539"
FT                   /db_xref="GOA:Q7WP51"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR034757"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WP51"
FT                   /protein_id="CAE31333.1"
FT                   /translation="MNMPAPAATRRDRIEDELGAHNYQPLDVVLARGSGVWLYDTAGRR
FT                   YLDCLSAYSAVNQGHCHPRILAAMVEQAQRLTLTSRAFRHDQLAPLYEDLARLTGAHKV
FT                   LPMNSGAEAVETALKAVRKWGYEARGVPAGQAEIIVCANNFHGRTLGIVGFSTDPDARG
FT                   GYGPFAPGFTVVPFGDFAALQAAVTPRTVAFLVEPIQGEAGVILPPPGYFRQVRKLCSE
FT                   RDIVLILDEIQTGLGRTGAFLAEAHEGIEADVTLIGKALSGGFYPVSAVLSNQAVLGIF
FT                   QPGQHGSTFGGNPLACAVARAALRVLHDEGMIDNAREQGAYFMQRLRALPGPVREVRGR
FT                   GLMLALELEPDAGPARAYCERLMARGMLVKDTHGQTLRLSPPLIVTREQIDWACAQLAH
FT                   VLAHSAPGSSGGPS"
FT   misc_feature    183529..184695
FT                   /note="HMMPfam hit to PF00202, DE Aminotransferase
FT                   class-III, score 6.9e-161"
FT   misc_feature    184159..184272
FT                   /note="PS00600 Aminotransferases class-III
FT                   pyridoxal-phosphate attachment site."
FT   CDS_pept        184719..185663
FT                   /transl_table=11
FT                   /locus_tag="BB0835"
FT                   /product="arginase"
FT                   /EC_number="3.5.3.1"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0538"
FT                   /db_xref="GOA:A0A0H3LI48"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI48"
FT                   /protein_id="CAE31334.1"
FT                   /translation="MIAASFPHGVSLIGAPTDIGAGQRGASMGPEALRVAGLVRLLERR
FT                   GLQVTDRGNLQGAPNPWRPPANGYRHLNEVIGWNQLVHDAVSAELRQERLPILLGGDHS
FT                   LAIGSISAVARHCRASGRKLRVLWLDAHADFNTNRLTPTGNVHGMPVACLCGNGPAALT
FT                   GMAGRTPAIEPGWVRQIGIRSVDEGERNLVYDAGLEVYDMRYLDEVGMRAVMEAALAGL
FT                   DPQTHLHVSFDVDFLDPELAPGVGTTVPGGPTYREAQLCMEMIADTGLMRSLDIVELNP
FT                   ALDVRNKTAQVAVDLVESLFGKSTLMRRRPGSA"
FT   misc_feature    184734..185633
FT                   /note="HMMPfam hit to PF00491, DE Arginase family, score
FT                   3.5e-92"
FT   misc_feature    185013..185054
FT                   /note="PS00147 Arginase family signature 1."
FT   misc_feature    185094..185120
FT                   /note="PS00148 Arginase family signature 2."
FT   misc_feature    185409..185474
FT                   /note="PS01053 Arginase family signature 3."
FT   CDS_pept        complement(185680..186489)
FT                   /transl_table=11
FT                   /locus_tag="BB0836"
FT                   /product="two-component response regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0176"
FT                   /db_xref="GOA:A0A0H3LI77"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI77"
FT                   /protein_id="CAE31335.1"
FT                   /translation="MNSTLDVIFLVRDDAAHQKQLEHLAYLGFKIRACTELIEVYDNCA
FT                   AHACPLVILSAPLADIHIAAARLRAIDRRVGIIAMEAFADSESRIRTLLCGADACLPTD
FT                   VSGLELAAVLQALLRRIVALAPLPETAELARGSEPGIDLGMEALALEPAMAPPDSKWHL
FT                   TNQGWTLVSPGGRTLGLTTGEREFLSRLMRAPERKISREALIADDLSAPGAADQGAQRS
FT                   RFVDVMISRLRRKAAHHQMPLPIRALHGWGYMFAAEVADEAGARGRH"
FT   misc_feature    complement(185734..185964)
FT                   /note="HMMPfam hit to PF00486, DE Transcriptional
FT                   regulatory protein, C terminal, score 0.00045"
FT   misc_feature    complement(186124..186468)
FT                   /note="HMMPfam hit to PF00072, DE Response regulator
FT                   receiver domain, score 0.022"
FT   CDS_pept        186802..187329
FT                   /transl_table=11
FT                   /locus_tag="BB0837"
FT                   /product="putative lipoprotein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0177"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN51"
FT                   /protein_id="CAE31336.1"
FT                   /translation="MPIRPFTRACLVAALGAVLAGCASNTGQAQAEGAAAANAATSADS
FT                   FAQTTWELVRWTKADGGYRVIPHGDNGEPIFLTFFAQGKQYRVSGFAGCNRYTGAYRLR
FT                   DGKLQITAPASTRMACPQPERARLEADYLRALAQIRSFTLDSGGAPRHLTFNVQGGDVL
FT                   DFMRRQDPPTPE"
FT   misc_feature    186835..186867
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    186907..187272
FT                   /note="HMMPfam hit to PF03724, DE Domain of unknown
FT                   function (306), score 5.8e-13"
FT   CDS_pept        187421..188236
FT                   /transl_table=11
FT                   /locus_tag="BB0838"
FT                   /product="putative lipoprotein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0178"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR025485"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJE5"
FT                   /protein_id="CAE31337.1"
FT                   /translation="MSAISPGRVALSFSLLLALAACAADPAGGGASRAQAPERHSDMLA
FT                   QTNWELARWTRPGGALRPVPHGGAGKTAPITLSFTHQRGAARLAGFAGCNNYSGQYTIA
FT                   NGLLIVTAPPVSTRMACANADLARLEQDYLAGLTAVTASRLDHDTRPQRLTLALRSGDV
FT                   LDFARRADPLAGGQPGAAKLVYVASSKAPCSAGAGRAQCYQVRDSASQPWQLWYGDITG
FT                   FAFQPGIEYRLRVVEVRDPNPPADASGVRWVLDHVVEQRVAAPRPAPAP"
FT   misc_feature    187421..187489
FT                   /note="Signal peptide predicted for BB0838 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.771 between residues 23 and 24"
FT   misc_feature    187454..187486
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    187535..187894
FT                   /note="HMMPfam hit to PF03724, DE Domain of unknown
FT                   function (306), score 2e-14"
FT   CDS_pept        188297..189031
FT                   /transl_table=11
FT                   /locus_tag="BB0839"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0179"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WP46"
FT                   /protein_id="CAE31338.1"
FT                   /translation="MTAVVNIAAYKFVSIANPADLREPMLEQAGQRQLKGTVLLAPEGI
FT                   NLFLAGAADAIEGFLRWLRADARFADLQAKYSESARMPFRKLLVKVKREIIRMDHPAIR
FT                   PEAGRAPAVDAATLRRWLAQGRDDQGRELVMLDTRNAFEVEVGTFRGALDWRIERFTQF
FT                   PQAVRDNQAALAGKTVVSFCTGGIRCEKAAIYMAEAGIEHVYQLEGGILKYFEETDGAG
FT                   FDGACFVFDERVALDAALAPQA"
FT   CDS_pept        complement(189069..191147)
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="BB0840"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0180"
FT                   /db_xref="GOA:Q7WP45"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WP45"
FT                   /protein_id="CAE31339.1"
FT                   /translation="MSRTLFVTTALPYANGSFHIGHIMEYIQADIWVRSMRMAGHTVHF
FT                   VGADDAHGAPIMLKAEKEGITPQALVARYAAERPRYLDGFHIRFDHWHSTDTPENVALS
FT                   QEIYRALKSEGLIETRSIEQFYDPVKGMFLADRYIKGECPRCHAKDQYGDSCEVCGAVY
FT                   APTELINPYSALTGAAPVLKSSDHFFFKLSDPRCVEFLQQWTTGANRQGVKHLQAEVQA
FT                   KTREWLGGDDGEAKLGDWDISRDAPYFGIEIPDAPGKYFYVWLDAPVGYLASLKSYCAV
FT                   KGLDFDALLDPAGPTEQVHFIGKDIIYFHALFWPAMLKFAGRKTPDQLNVHGFITVSGE
FT                   KMSKSRGTGISPLRYLEIGMDAEWLRYYMAAKLNARVEDMDFNPEDFVARVNSDLVGKY
FT                   VNIASRAAAFITRHFDGELAYDGDTDALAAEFAQQAESIRAAFEAREYNRAVREIMAHA
FT                   DRINQAFDAAQPWVMAKGIGAADAATRARLQDICSRALAGFKALSVMLAPVLPALASRV
FT                   ARELFGANADFAWGDAQQLPQRVAPFKHLMQRVDPKLLDDLFEPPAAEASAPAALPGGE
FT                   ALADTITIDDFAKIDLRIARIVNCEEVEGSTKLLRLTLDVGEGRHRNVFSGIKSAYQPQ
FT                   DLVGKLTVLVANLAPRKMKFGVSEGMVLAASHADEKAEPGIYVLEPWPGAQPGMRVR"
FT   misc_feature    complement(189078..189374)
FT                   /note="HMMPfam hit to PF01588, DE Putative tRNA binding
FT                   domain, score 4.4e-31"
FT   misc_feature    complement(189993..191144)
FT                   /note="HMMPfam hit to PF00133, DE tRNA synthetases class I
FT                   (I, L, M and V), score 5.5e-06"
FT   misc_feature    complement(191079..191114)
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT   CDS_pept        complement(191397..191669)
FT                   /transl_table=11
FT                   /locus_tag="BB0841"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0181"
FT                   /db_xref="GOA:A0A0H3LRC3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRC3"
FT                   /protein_id="CAE31340.1"
FT                   /translation="MVNTLFRFFSAALFALLGLIGMMMALVFMASTAIAVGVLYLVAKV
FT                   RGKPFGVRAYWSQRQAARPGPFQAASAPFGQPRGDVIDVEAREVR"
FT   misc_feature    complement(191544..191612)
FT                   /note="1 probable transmembrane helix predicted for BB0841
FT                   by TMHMM2.0 at aa 20-42"
FT   misc_feature    complement(191565..191669)
FT                   /note="Signal peptide predicted for BB0841 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.867 between residues 35 and 36"
FT   CDS_pept        191768..192856
FT                   /transl_table=11
FT                   /locus_tag="BB0842"
FT                   /product="putative iron sulfur binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0182"
FT                   /db_xref="GOA:A0A0H3LI54"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI54"
FT                   /protein_id="CAE31341.1"
FT                   /translation="MMSITIEQIRGALAGVADPQTGLELNVCVKDRDIHLAADPAALTI
FT                   ELGYPAGGVADSVRALAGAALAAAGLGAVRVAVTWNIIAHAVQPGLKPLPQVRNIIAVA
FT                   SGKGGVGKSTTAVNLALALAAEGARVGLLDADIYGPSVPAMLGLAGRPESRDNKTMEPL
FT                   VGHGLQANSIGLLIDADAPAIWRGPMVTQALEQLLRQTNWRDLDYLVVDMPPGTGDIAL
FT                   TLAQKVPVAGAVIVTTPQDIALLDARKGLRMFQKVHVPILGVVENMAVHICPQCGHAEH
FT                   IFGAGGGRRVAEQYEVPWLGSLPLQRAIREQTDAGNPTVAAEPDGEVAGIYRDIARRVA
FT                   ARIAALPRDMAGKLPAVVVRPA"
FT   misc_feature    192083..192106
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    192374..192424
FT                   /note="PS01215 Mrp family signature."
FT   CDS_pept        192860..194764
FT                   /transl_table=11
FT                   /locus_tag="BB0843"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0183"
FT                   /db_xref="GOA:A0A0H3LI80"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI80"
FT                   /protein_id="CAE31342.1"
FT                   /translation="MRRILRVCPALLFALAAGQVHAKLPEVIVDPGGVPPAALQAINSA
FT                   VDAIARLSEDQDGGEIDRLRRRARDATLAALATQGYFTPTVTLTPGTDVGGETWDIAIE
FT                   PGPRARVASVDLKFTGRVARPEYAARIQKWRDDWALKAGQPFINGDWNKAKSGLLDAVS
FT                   TRDFLLAHMTHSLAEVDAETAQVRLSVEIDSGPAVRMGALQTDGLQRVPESLVRRYVKY
FT                   SEGAAYDQDKLDQWQQELQSTAFFRGAFVTLDQGARGGQDDVKVTAPGAGARAPGSSGL
FT                   ASVAPAGDAEVAGGPTAAAPVLDSQGEITLPVDVRVVEAPPKRLAVSLGVDDEAGVRFE
FT                   TIYRQNVVFGQPVTMETGLGVDRLRQRAYLDFNLPPDERGRKDSFGLLFDHSDVQGLDV
FT                   TRYALGVTRLQERKGAGDSRVEYETRWGGLLAHDHVKIDGGDEYDLPTATLTAEWLRRD
FT                   VNSKYDPREGNLIAVGGGVGATLDDGQPYMRLRLRGQKWWPIGKLDVLTLRGEVGRLWS
FT                   NGRTRVPDDFGFRTGGARSIRGYRYQSIGVEQDDAIVGAPTLAVASVEYDHYFNERWGI
FT                   GVFVDAGDAAESFGDMDIAVGYGVGARVRTPAGPLFLDVAYGQRERDLRLHFSLGIAF"
FT   misc_feature    192860..192925
FT                   /note="Signal peptide predicted for BB0843 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 22 and 23"
FT   CDS_pept        194761..198435
FT                   /transl_table=11
FT                   /locus_tag="BB0844"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0184"
FT                   /db_xref="GOA:A0A0H3LN55"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN55"
FT                   /protein_id="CAE31343.1"
FT                   /translation="MSKIWGVVRHILVWWVPGVAMLAALACGFVFWTVASQNGTRLLLD
FT                   TVARQLDGEIAGVRGSVLRGLRVDRIRLSVADVDVAVDDLRLDVAWRALGQRLLHVREL
FT                   AATRVEVGLHTPATPPPDSDEPFALRLPVELALDRLSLGEFVLRQDGEPLPVSAGELQA
FT                   SLAAGRHGARLTLDSLRVTHAVGTLRAQGRLDVASLAQPWPLTASLDLQAQGSGPESPL
FT                   CLAPLLDARDKTAKDKAAKDKGKDKDKGKDKGKDKDKGKDKGKDKGKDDAGEKPDEPAD
FT                   PCGLALQVQAQGTLEQLEAELTGAGQGLALEARAGLLPQAPFPLRTASLKLTREDKSSL
FT                   AATLDWQPQPGQPGRDRVVATFEAERLDLQRLAGEAIPPAMLSARGGLDAEVDDLSRLH
FT                   RATLTLDVTKGSSWNRHPLAGKVAASVSALGDPPGAFATAAPAQPHALPGGLRVDQLDV
FT                   DLQLGPNRVRAQGKLDERAGALKLDAQAPRLDAFWPGIPGAASVKAALDGALARHRGRI
FT                   EAAYTPADARARVLGRARAQAQLEFSGGWGAGPAAEGAAAGWRGSVSRLTADSAGFALA
FT                   LERPVTLAYVPEALAPQWQWQVGATTLALTFPDKQRVALAHAASRGGAGRWETAGRADA
FT                   LVITAAMVRQILVALDPEAVARAERDSGSPVNAPVPAAQRRISLDASWDLKFAGALAGK
FT                   VRVARRDGDLRIPGDPPIPLGLRTLVLEANATPTGGQASRLDARLDMATARMGAINGTA
FT                   SATLGGLALDPRQPIRVALDADVTDLAWLGLFVGDTLEVGGMLKANVRAQGSLDGKWNA
FT                   SGTVNGDKLRVVRIDDGVRLIDGTLRARLQDDRVILDSLRFPASLRVMPAEWRTREWVS
FT                   TNPDAKGGYLEATGQWELSAARGQVRLQLHRFPALQRSDRYGMVSGVVTLDAALPRISI
FT                   NGDITADAGWVSLEILQGVPTLDDDVKVVRAGQKNAQGDGPPLQIDMNLKVDMGPRFYI
FT                   TGMGLDAGLLGSIQIRLQEGRLTGYGALRTRGGGIEAYGQKLRLRRGTLTFQGRLDNPL
FT                   LDIEALRTGEQVEAGVRVAGTAQRPRIDLVSYPDVSDVEKLSWLVLGRGPDASGGDTAL
FT                   LLSVGTALLGGGQPFYKQFGLDDVSVRSGAIGSSGSLLPDRTVAAGVNRDSDADLATQF
FT                   LVASKRFANGITLSVEQALAGSETVGRASYRLARGLSLDLKAGSVNGIALVYRILLDD"
FT   misc_feature    194761..194838
FT                   /note="Signal peptide predicted for BB0844 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.928) with cleavage site
FT                   probability 0.359 between residues 26 and 27"
FT   misc_feature    194794..194862
FT                   /note="1 probable transmembrane helix predicted for BB0844
FT                   by TMHMM2.0 at aa 12-34"
FT   misc_feature    194809..194841
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        198496..199059
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /gene_synonym="dus"
FT                   /gene_synonym="paxA"
FT                   /locus_tag="BB0845"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0185"
FT                   /db_xref="GOA:Q7WP40"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WP40"
FT                   /protein_id="CAE31344.1"
FT                   /translation="MSIKSDRWIRRAAEAGMIEPFEPGQVRTAGGNRIVSYGTSSYGYD
FT                   VRCADEFKIFTNINSTIVDPKQFDEKSFVDFKGDVCIIPPNSFALARTVEYFRIPRSVL
FT                   TICLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSNTTPLPAKIYAGEGCAQMLFLESDE
FT                   VCETSYRDRGGKYQGQRGVTLPRT"
FT   misc_feature    198667..199053
FT                   /note="HMMPfam hit to PF00692, DE dUTPase, score 0.0031"
FT   CDS_pept        complement(199067..199489)
FT                   /transl_table=11
FT                   /locus_tag="BB0846"
FT                   /product="conseved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0186"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJE9"
FT                   /protein_id="CAE31345.1"
FT                   /translation="MPAPATVASPVVTCLRYRNASAAIEWLVHAFGFEAQRIVPGPADT
FT                   IVHAQLTLGSGMIMLASVTDTPFSRYMKQPDEVGGVETQSVYLVVADPDQAYRDAQAAG
FT                   AEILIDIADADYGGRGFSCRDPEGHIWSVGSYDPWQ"
FT   CDS_pept        complement(199517..199936)
FT                   /transl_table=11
FT                   /locus_tag="BB0847"
FT                   /product="putative lyase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0187"
FT                   /db_xref="GOA:A0A0H3LRC7"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRC7"
FT                   /protein_id="CAE31346.1"
FT                   /translation="MQAQVLINIDVPDAARAALFYERAFGLRPRRRLGPQAIEMAGAAV
FT                   PIYLLEKATGSQAATGTSQGRDYARHWTPVHLDFVVDDCDRAVATAVAAGAMLEDPPHS
FT                   HAWGRIAHLSDPYGNGVCILQFLGEGYDALAAAAP"
FT   CDS_pept        complement(199965..200483)
FT                   /transl_table=11
FT                   /locus_tag="BB0848"
FT                   /product="putative acetyltransferase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0188"
FT                   /db_xref="GOA:A0A0H3LI57"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI57"
FT                   /protein_id="CAE31347.1"
FT                   /translation="MNLSTIRPLTPEDAAEFQRVRLAALREAPEAFGSSYEEESVDTIA
FT                   QWRARLAPREGYVLLGAFVDGALAGVGGVARGHTMKQRHKAEIWGIYVVPAQRRGGLAR
FT                   QLTEALLARAARMTGVRHVLLSVGADNGAAHALYASLGFAEYGREPDAMLVGGRLLANI
FT                   LMIRPLAAR"
FT   misc_feature    complement(200052..200306)
FT                   /note="HMMPfam hit to PF00583, DE Acetyltransferase (GNAT)
FT                   family, score 3.5e-14"
FT   CDS_pept        200536..201033
FT                   /transl_table=11
FT                   /locus_tag="BB0849"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0189"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI86"
FT                   /protein_id="CAE31348.1"
FT                   /translation="MKIREKRGCFAAQEPQMFGFRRKDTQQYDQEAQDAFVERVAAAAR
FT                   DFVAAVPAGAGLDYSPASIAALDAVLEQAHLGALALDPVQRVGAAAYLYEVARRRHGGL
FT                   YEVCDDDDPVVLVTGEPEFDVCLCAIAKVERRIDAGPQEDLRPFFGRYEQAVAARRPDI
FT                   IR"
FT   CDS_pept        201188..203458
FT                   /transl_table=11
FT                   /locus_tag="BB0850"
FT                   /product="probable orn/arg/lys decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0190"
FT                   /db_xref="GOA:A0A0H3LN60"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN60"
FT                   /protein_id="CAE31349.1"
FT                   /translation="MKFRFPIFIIDEDYRSENASGLGIRALASAIEAEGVEVIGVTSYG
FT                   DLSSFAQQQSRASAFILSIDDEEFDVDSPEDVAGAIKNLRTFIGELRFRNADIPIYLYG
FT                   ETRTSEHIPNDILRELHGFIHMFEDTPEFVARHIIREARSYVDGLPPPFFRELVKYAQD
FT                   GSYSWHCPGHSGGVAFLKSPVGQMFHQFFGENMLRADVCNAVDELGQLLDHTGPVAESE
FT                   LNAARIFHADHCFFVTNGTSTSNKVVWHANVAAGDVVVVDRNCHKSILHAITMTGAIPV
FT                   FLRPTRNHLGIIGPIPLDEFDPENIRRKIEANPFAREALNKKPRILTLTQSTYDGVIYN
FT                   VEMIKEKLGTYVDTLHFDEAWLPHAAFHEYYRDMHAIGPDRPRSQDAMVFATHSTHKLL
FT                   AGISQASQIIVQESESRKLDRNLFNEAYLMHTSTSPQYAIIASCDVAAAMMEPPGGTAL
FT                   VEESIREAMDFRRAMRKVASEFGKDDWWFKVWGPNRLAPEGIGHRDDWVLESGDHWHGF
FT                   GDLAPGFNMLDPIKATIITPGLDMSGSFGESGIPAALVSKYLAEHGVVVEKTGLYSFFI
FT                   LFTIGITKGRWNTLLTALQQFKDDYDRNQPLWRILPEFCRGHRRYERMGLRDLCQQIHE
FT                   AYRERDVARLTTEMYLSDMVPALKPSDAFARMAHREVERVEIDQLEGRVTGVLLTPYPP
FT                   GIPLLIPGERFNRTIVQYLQFAREFNERFPGFETYIHGLADEEGPDGAKRYYVDCLKDA
FT                   GEQ"
FT   misc_feature    201638..202996
FT                   /note="HMMPfam hit to PF01276, DE Orn/Lys/Arg
FT                   decarboxylase, major domain, score 3e-185"
FT   misc_feature    202361..202405
FT                   /note="PS00703 Orn/Lys/Arg decarboxylases family 1
FT                   pyridoxal-P attachment site."
FT   misc_feature    203018..203410
FT                   /note="HMMPfam hit to PF03711, DE Orn/Lys/Arg
FT                   decarboxylase, C-terminal domain, score 4.3e-30"
FT   CDS_pept        203502..204734
FT                   /transl_table=11
FT                   /locus_tag="BB0851"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0191"
FT                   /db_xref="GOA:A0A0H3LJF3"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJF3"
FT                   /protein_id="CAE31350.1"
FT                   /translation="MSSREYPVSMFDVAVIGAGAAGMMCAAVAGQRGLRVVLIDHAAKL
FT                   AEKIRISGGGRCNFTNLGAGPANFLSDNPHFCRSALAGYTPQDFLGLLRRHRVHWHEKH
FT                   RGQLFCDDSSETIIEVLRAECGQGGVAWRMPCRVDEIARREGGGFTLRTSTGAIDARAV
FT                   VVATGGMAIPQLGATDYALKVARQFGLKVVEPRPALVPLTFDPAQWQPFAALSGVALEV
FT                   TLSTGQGKGRAAFLEDLLFTHRGLSGPAILQISSYWKPGEPIVLDLAPGRDLAAELIGA
FT                   KPGNRQQLHTVLAGLWPRRLADTWLDVAGRAVGADLAAARLADVPDRTLRALAALIHDW
FT                   RLVPSGTAGYKKAEVMRGGVDTRALDQKSMQARGVPGLYFIGEAVDVTGWLGGYNFQWA
FT                   WASGYACGNAL"
FT   misc_feature    203502..203588
FT                   /note="Signal peptide predicted for BB0851 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.778) with cleavage site
FT                   probability 0.687 between residues 29 and 30"
FT   misc_feature    203538..203591
FT                   /note="1 probable transmembrane helix predicted for BB0851
FT                   by TMHMM2.0 at aa 13-30"
FT   misc_feature    203664..204713
FT                   /note="HMMPfam hit to PF03486, DE HI0933-like protein,
FT                   score 6.3e-131"
FT   CDS_pept        204780..205472
FT                   /transl_table=11
FT                   /gene="sodA"
FT                   /locus_tag="BB0852"
FT                   /product="superoxide dismutase [Mn]"
FT                   /EC_number="1.15.1.1"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0193"
FT                   /db_xref="GOA:A0A0H3LRD2"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRD2"
FT                   /protein_id="CAE31351.1"
FT                   /translation="MVNGNDYHLSLPNANAGDRMPYVLPALSYAYDALEPHIDARTMEI
FT                   HHTRHHQTYVNGLNAALEGAGLDSEEPVEQLLRRIPALPPGIHGAVRNHGGGHANHSLF
FT                   WTVMSPSGGGRPDGRLAADIQAQLGGHDAFQAAFTQAALGRFGSGWAWLTVTPAGRLRV
FT                   DSSANQDSPLMEGNTPILGLDVWEHAYYLQYQNRRPEYIEAFYRVVDWAEVARRYEIAL
FT                   AELGREAA"
FT   misc_feature    204837..205106
FT                   /note="HMMPfam hit to PF00081, DE Iron/manganese superoxide
FT                   dismutases, alpha-hairpin domain, score 7.1e-44"
FT   misc_feature    205116..205448
FT                   /note="HMMPfam hit to PF02777, DE Iron/manganese superoxide
FT                   dismutases, C-terminal domain, score 4.7e-61"
FT   misc_feature    205329..205352
FT                   /note="PS00088 Manganese and iron superoxide dismutases
FT                   signature."
FT   CDS_pept        205469..206362
FT                   /transl_table=11
FT                   /locus_tag="BB0853"
FT                   /product="probable metal transporter"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0194"
FT                   /db_xref="GOA:A0A0H3LI64"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI64"
FT                   /protein_id="CAE31352.1"
FT                   /translation="MNTHSRHRVRPALTSVSAMTLAVLVACLACYQLWEFLDRRWPHVA
FT                   LAMAGGMVAAGATALGAVPVLFSQTLSQRVQDCMFGFGAGVMLAASAFSLVAPGIAAAG
FT                   AQGYGPWGAGILVGAAILLGGAVLLASDRLLPHEHFIKGKEGRASRTLRRTWLFVFAIM
FT                   LHNVPEGLAIGVGYAGSDSLRGAALATGIAIQDVPEGLVVALALLAAGYGRAFSVALGM
FT                   LSGLVEPLGAIVGAAVVGWSAAMLPWGLGFAAGAMLFVISHEIIPESHRKGHEVPATAG
FT                   LMLGFVLMMLLDTALG"
FT   misc_feature    205469..205555
FT                   /note="Signal peptide predicted for BB0853 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.982) with cleavage site
FT                   probability 0.671 between residues 29 and 30"
FT   misc_feature    join(205505..205573,205601..205669,205706..205774,
FT                   205787..205855,205934..206002,206030..206098,
FT                   206117..206185,206198..206266,206285..206344)
FT                   /note="9 probable transmembrane helices predicted for
FT                   BB0853 by TMHMM2.0 at aa 13-35, 45-67, 80-102, 107-129,
FT                   156-178, 188-210, 217-239, 244-266 and 273-292"
FT   misc_feature    205517..205549
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    205916..206347
FT                   /note="HMMPfam hit to PF02535, DE ZIP Zinc transporter,
FT                   score 3e-24"
FT   CDS_pept        206757..207857
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="BB0854"
FT                   /product="glycine cleavage system T protein"
FT                   /EC_number="2.1.2.10"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0195"
FT                   /db_xref="GOA:Q7WP31"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WP31"
FT                   /protein_id="CAE31353.1"
FT                   /translation="MSAPLKRTPLAEEHLAAGARMVDFGGWDMPLAYGSQLEEHHAVRQ
FT                   DAGMFDVSHMLNVDVGGADATAFLRRLVANDVARLATPGKALYSCMLNPQGGIIDDLII
FT                   YYFAPDQWRVVVNAGTADKDIAWMQRVAAADGFDVAIAPRRDLAMVAVQGPNARAKVWA
FT                   ARPAWQAASEPLAPFSAAAVEAGTLVARTGYTGEDGFEIVLPADAVVQLWRDLLAQGVR
FT                   PCGLGARDTLRLEAGMNLYGQDMDELVHPDQAGLSWTVALKDEARRFVGRDAIEQFAVP
FT                   RAFVGLKLQERGVMRAHMPVRCAQGMGELTSGTMSPTLGVSVGFARVPVGVQPGDAVEV
FT                   EIRGKWVPALVCKLPFVRHGKAVEHS"
FT   misc_feature    206901..207833
FT                   /note="HMMPfam hit to PF01571, DE Glycine cleavage
FT                   T-protein (aminomethyl transferase), score 4.6e-118"
FT   CDS_pept        208002..208313
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="BB0855"
FT                   /product="glycine cleavage system H protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0196"
FT                   /db_xref="GOA:A0A0H3LI90"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI90"
FT                   /protein_id="CAE31354.1"
FT                   /translation="MFVVGITDNAQEQLGDLVFVGDVKVGATLKAGETAGVVESVKAAS
FT                   DIYAPVDGEIVAFNDELEANPSLINESAYTAWIFKIKPANAADLDKLLDAAGYQAVAG"
FT   misc_feature    208002..208307
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF01597, DE Glycine cleavage
FT                   H-protein, score 1.1e-26"
FT   CDS_pept        208373..211237
FT                   /transl_table=11
FT                   /gene="gcvP"
FT                   /locus_tag="BB0856"
FT                   /product="glycine cleavage system P protein"
FT                   /EC_number="1.4.4.2"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0197"
FT                   /db_xref="GOA:Q7WP29"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WP29"
FT                   /protein_id="CAE31355.1"
FT                   /translation="MSRAPDTHSDFIPRHIGPSDEDQATMLAAIGAASLDALIDEVVPP
FT                   RIRSRAPLALPAARSETDVLQDLKRMAARNQIYRNYIGQGYYGTHTPNVVLRNVLENPA
FT                   WYTAYTPYQPEISQGRLEALLNYQTMVADLTGLDISNASLLDEGTAAAEAMTLARRGSR
FT                   SSSPVFFVSQHCHPQTLEVVRTRAEGLGIELVIGDESRGLPECFGVLLQYPHSLGGVAD
FT                   YRELAQAAHAQGAVVACVTDLLALALIEPPGQWGADIAVGSAQRFGVPFGFGGPHAGFM
FT                   SCRDAYKRNMPGRLVGVSKDAQGNPALRLALQTREQHIRREKATSNICTAQVLLAVMAG
FT                   LYAVWHGPRGVRRIAERVQSLTGALRAALAGLGVKVANDTWFDTLLLETGVATPAILAA
FT                   ADCARINLRQVDGARLAVSLDETVTLADLQALVNVFAAGLGKDEVALPAPQASLDGIPA
FT                   AVRRQGPILSHPVFSSVQSETDMLRYLRKLADKDLALDRTMIPLGSCTMKLNATAEMIP
FT                   ITWPEFALIHPFAPASQTPGYRELIDGLSAQLCEITGYDGISLQPNSGAQGEYAGLLAI
FT                   RAYHQANGQPQRNVCLIPASAHGTNPASAQLAGMDVVVVASDANGNVDLADLRARIAQV
FT                   GERLAALMITYPSTHGVFEEAVTEICDAVHEAGGQVYLDGANMNAMVGVAQPGKFGSDV
FT                   SHLNLHKTFCIPHGGGGPGVGPVAVRAHLAPYLPGVLDAQGRLDPEAKVGPVSAAPYGS
FT                   AGILPIPYVYIALMGAEGLRRATEVAILNANYIAARLRDHYPVLYAGRNGRVAHECILD
FT                   VRPLKETSGISAEDIAKRLMDYGFHAPTMSFPVAGTLMVEPTESEGLAELERFIEAMIA
FT                   IRAEIAQIESGERDRDDNVLRNAPHTAQMLLAEEWHHDYPRQQAAYPVASLRENKYWPP
FT                   VARVDNAYGDRNLVCACLPVEAYA"
FT   misc_feature    208409..209677
FT                   /note="HMMPfam hit to PF02347, DE Glycine cleavage system
FT                   P-protein, score 3.2e-247"
FT   CDS_pept        complement(211592..212332)
FT                   /transl_table=11
FT                   /locus_tag="BB0857"
FT                   /product="putative GntR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0198"
FT                   /db_xref="GOA:A0A0H3LN66"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN66"
FT                   /protein_id="CAE31356.1"
FT                   /translation="MKTVETNPNPLGPIKAVRSRDLLADALREQILSGARPSGVALPSE
FT                   RELTEETGLSRAAVRDALRVLESEGLIETRQGRYGGSVVKLPANDALARPVALFARARG
FT                   ISLQEMIEARVAIEPTIAELAALRRTPEDLQALIQATDLLQEALPRVEQFLDLNVRWYF
FT                   ALADACHNDLLRAFIVSIAGLILAATSREGQTPEPTRRLILQSHRRVVDAVIAGDAPAA
FT                   RRRMERHVAGYQEHYERLGLTPSA"
FT   misc_feature    complement(212081..212266)
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 1.2e-11"
FT   misc_feature    complement(212141..212206)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1063.000, SD 2.81 at aa 43-64, sequence
FT                   PSERELTEETGLSRAAVRDALR"
FT   CDS_pept        212402..213613
FT                   /transl_table=11
FT                   /locus_tag="BB0858"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0199"
FT                   /db_xref="GOA:A0A0H3LJF7"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJF7"
FT                   /protein_id="CAE31357.1"
FT                   /translation="MAAVSSSVPPTPLGGVRVLDLSKVLAGPLCTQYMADMGADVIKVE
FT                   AAGQGDDTRGWPPFQDGQAAVFLSCNRNKRSIALDLKSAHGRAVVQRLAAWADVVVHSF
FT                   GPGVAQKLGVDWEALSEINPRLVYCAISGFGPVGSLSHGKGFDVVLQAFCGMISITGET
FT                   EGGAVRSPFSPVDQATGLHALIGILAALRQRDASGRGVTVDASLFDTALGFMGYFMQGY
FT                   WARGTEPARAGAGHESLCPYQDFATADKPIILGIANDALWRAFCTLAGRPELVSDPRFA
FT                   TNAQRVANRAQTLAATRELLAARTRGEWLPALEQAGIPCSPIHTLAEVDAHPHTRESGM
FT                   VFDYPETGADTGPLKGVAQPVRFDGMRLTTPKRPPSLNQDWASVLADAGYSDPEVRDLL
FT                   QQMA"
FT   misc_feature    212630..213196
FT                   /note="HMMPfam hit to PF02515, DE CAIB/BAIF family, score
FT                   6.3e-63"
FT   CDS_pept        213642..214610
FT                   /transl_table=11
FT                   /locus_tag="BB0859"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0200"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRD7"
FT                   /protein_id="CAE31358.1"
FT                   /translation="MMNVLIRRALCAAIASLAAAAAHAAYPEQPVRIVVAFAPGSGTDN
FT                   VARYYATRLSEELKQPFVVENKPGANGSIAATQVARTQPDGYTLFLGSNSTLSAAPFLF
FT                   KKLPYEPLKDFTAVARLSDIPSMLVVGADSPIRDFDQFIGKARAEPGRVTWANANTAHL
FT                   AAGMALTKQAQLDMISVPYKSSPQALTDVIGGQVTAMVVDTSAGTAFVQQGKVRALAVT
FT                   TARPVAAMPGVPSMSERFPGIDVYSWLGIVGPAGMPDEVVSVVNQAILKINASEDTVRF
FT                   LRENAGAEPPPSSSPAEFTQFMHAQLEVWRKLLRDANVEPM"
FT   misc_feature    213642..213713
FT                   /note="Signal peptide predicted for BB0859 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 24 and 25"
FT   misc_feature    213777..214598
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 1.2e-72"
FT   CDS_pept        214607..215440
FT                   /transl_table=11
FT                   /locus_tag="BB0860"
FT                   /product="probable enoyl-CoA hydratase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0201"
FT                   /db_xref="GOA:A0A0H3LI67"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI67"
FT                   /protein_id="CAE31359.1"
FT                   /translation="MSQQESRMSAPACVSEFVRYDVDAGVARITLDRPDRRNAIDVPMR
FT                   AALLAAVQAATADPAVRAVVLTGAGGHFCSGGDVSTMRGASMSAEQGRDRMAPIGACAR
FT                   ALLEMPKPVIAAVDGIAFGGGFGLCLCADLVLATPAARFCLSFMRIGLVPDFAAAFTLP
FT                   RLVGLQRARQLIYTAAEIDGRQALEYGLVSELVDAGRLAPRAAEVATAMAGMPATAFAL
FT                   TKQALLRSSSSELAAMVEMEMTSQGVAFNTGYHQQAVERLLEKKPPLYSFPAPTA"
FT   misc_feature    214685..215197
FT                   /note="HMMPfam hit to PF00378, DE Enoyl-CoA
FT                   hydratase/isomerase family, score 6.8e-45"
FT   misc_feature    214946..215008
FT                   /note="PS00166 Enoyl-CoA hydratase/isomerase signature."
FT   CDS_pept        complement(215491..217515)
FT                   /transl_table=11
FT                   /locus_tag="BB0861"
FT                   /product="putative exported protein"
FT                   /db_xref="GOA:A0A0H3LI97"
FT                   /db_xref="InterPro:IPR010352"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI97"
FT                   /protein_id="CAE31360.1"
FT                   /translation="MKKSIGITAGVIVVLAGGWLGGTWYTGKRIETETQQRLGVLNEKL
FT                   AAVVPGYTLRVDQLKYERGFFTTQARYGLSLSQDIKEESGTVTPLPLGSTEFDARFEHG
FT                   PFPRSALASGQFLPQMAFVHAELARTELVKPLFELTKNAAPLWSDTIVSYSGNASTRSG
FT                   LAPIDFTEDDVTLSFSGATLTGTFQRATRSGTARLDAEYVRFTADGDQDTQMSATGWSV
FT                   DMRSHQGKHGFTLGESTMAIKRIAMIDKRESLDISLDDLSYRALATEDGDYIDIEAAYK
FT                   TGPLTVNKIPFGSGELNVKASRLDGQALKALSDGYNQLLRGYFATGETDEGLKDEQLTM
FT                   LIENGGRLLAGGPSLSLGPVAWRTEKGESSLMSSIVLVKPATTSGELTPREYLEEAVKA
FT                   IDVKMVVSKPMVRDLAIHYETSQGKTPEEAAKEADETIDAFAGMAEILNIGRNDGDKLV
FT                   GTFTYAAGVAKLNGRDVPVNELFDNLYDSASASLDDDEHNHEDDAAMSAEAASEAVEAA
FT                   AEAAAAEAAQEAADAAAWATEGDSLRSVNAGLLTSILAEGGYDSTTEEGASGPVIVIDA
FT                   NGLPLRDLRAELYCIDDDECMDVSMKASFGKRKTSLKALNAWNQKYRWTRAYLDDDNQA
FT                   VLRMDLSAEGGVGRENLSIMVNTFMQMVGNFEDEVYAAR"
FT   misc_feature    complement(217435..217503)
FT                   /note="1 probable transmembrane helix predicted for BB0861
FT                   by TMHMM2.0 at aa 5-27"
FT   misc_feature    complement(217468..217515)
FT                   /note="Signal peptide predicted for BB0861 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.721) with cleavage site
FT                   probability 0.681 between residues 16 and 17"
FT   CDS_pept        complement(217643..219091)
FT                   /transl_table=11
FT                   /locus_tag="BB0862"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR010352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN71"
FT                   /protein_id="CAE31361.1"
FT                   /translation="MKKSVAVTTGVIIVAVGGWLAGTWYTGQRIETESQTRLNEINAQL
FT                   AAAFPEFPVRINQLKLERGFFTSQARYGVEVGKSEETGKPEATVEVDARIEHGPFAPGA
FT                   LARGKLMPQLAFVHAEVANTEDLKKVFEVTKGATPLWSDTVVAYNGDSTSTGGLAAIDY
FT                   SGDEGKFAFSGATFDGSYQRATQAAIGSLKADSLALDASADDDGGPLLFTLDGLAVTVD
FT                   SRMGKSGLSIGDSALSVKRLEVKQPEGDAHLTVADMAYAARIGEQDEFINGEISYGAGE
FT                   ITYNGIALGNGRAVFKAERLNAAAIKVVADEYNKAIKLQAEGKDPVPDNAEMRKLLMAQ
FT                   ADTLLAGKPVLTLDPVQWKTAQGESVFNARVALSKPASSDLMAVDYFSQAIESIDASAT
FT                   LSKPMIKALMVGYLQSQEGMDAQQAAAAADQQVSSLAGMAEMMNLGKNEGDNIVSKFHY
FT                   AAGTVDLNGRKMPADQLLGSILGG"
FT   misc_feature    complement(219011..219079)
FT                   /note="1 probable transmembrane helix predicted for BB0862
FT                   by TMHMM2.0 at aa 5-27"
FT   CDS_pept        complement(219267..220742)
FT                   /transl_table=11
FT                   /locus_tag="BB0863"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3163"
FT                   /db_xref="GOA:A0A0H3LJG3"
FT                   /db_xref="InterPro:IPR009197"
FT                   /db_xref="InterPro:IPR010799"
FT                   /db_xref="InterPro:IPR015995"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJG3"
FT                   /protein_id="CAE31362.1"
FT                   /translation="MRWLLAMIKHETNTFSPVPTPLERFFRGSPEILAGERAIRAYENT
FT                   DSGLGGYIEVARREGAEIVVPVAAESWPSAPTDRATYERLCGLVLDEARRGGFDAILLD
FT                   LHGAMVAEGVEDAEGDLLRRLRDIAPAIPVGVTLDMHANIYDDIVRHATVISGFHTYPH
FT                   VDIRAAGLRAANAIARTLRGEIKPVMSWANKPMLPHIMRQGTHAEPNKSLQARCKALES
FT                   EGVIAASVFVGFPHADIREAGLSAVVCTDANLAQAEQYRDELLETAWRGRADWVFHAEP
FT                   LAPTIARAKAIENGPVVLLDHYDNTGSGGTMDTTAVLAEILDQGLENVAFYAICDPQAA
FT                   QQAAAAGVGATVTLPLGGKVAMPALRQASPPLHLTARVKLLFDGVYLNRGPMYRGVRND
FT                   TGLTVVLDTGKVEIVVVSRHQEPFDINCLLSAGIDPLQKRYVALKSRVHWRAGFADMAT
FT                   HVIECTGVGVTTSDYGQVEFRHVRRPVYPLDAI"
FT   misc_feature    complement(219519..219539)
FT                   /note="PS00307 Legume lectins beta-chain signature."
FT   CDS_pept        complement(220786..222444)
FT                   /transl_table=11
FT                   /locus_tag="BB0864"
FT                   /product="putative ABC transpoter ATP-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3162"
FT                   /db_xref="GOA:A0A0H3LRE2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRE2"
FT                   /protein_id="CAE31363.1"
FT                   /translation="MPYAPYPPAGDTSAAVLAIRNLSVSVCGAGNRVVRNLSLDVHAGE
FT                   TVCVVGESGSGKSVTSLAVMGLLPEGILEVSGGSARVLGEDIVTASARRRRELRATRMA
FT                   MVFQEPMTALNPVHRVGSQVDEVLRLHRRMPRAQRRAKVLEMFRSVHLPDVERIYDAYP
FT                   HQLSGGQRQRIVIAMALILEPKLLIADEPTTALDVTTQKQILALIRELQDRHQTAVLFI
FT                   THDFGVVAEIADRIVVMNRGDLTEAGTRDEILARPSQNYTRRLVSSVPSLVPTQREAPG
FT                   GEPVLRITGLGRTYAERRSLFGATRTVVAASEVDLTLRRGEILGIVGESGSGKSTVARC
FT                   IVRLIEPSAGRMLLGETDIARLSGAGLRPLRRKVQIVFQDPYRSLNPRRAVGESIIEGL
FT                   LNFGMPRAQALVRAARTLGVVGLGPDVMRRYPHQFSGGQRQRLCIARALVMDPEVLVAD
FT                   EAVSALDVSVQAQVLELIEQVRERTGVSVLFITHDLRVAAQVCDTIAVMQHGKVVETGA
FT                   AQTVLTRPGHAYTRALIDAAPGRGWDFRNFRPLPA"
FT   misc_feature    complement(220915..221484)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   3.9e-65"
FT   misc_feature    complement(221101..221145)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(221440..221463)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    complement(221719..222315)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   2.4e-60"
FT   misc_feature    complement(221905..221949)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(222271..222294)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(222448..223347)
FT                   /transl_table=11
FT                   /locus_tag="BB0865"
FT                   /product="putative peptide ABC transporter permease
FT                   protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3161"
FT                   /db_xref="GOA:A0A0H3LI72"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI72"
FT                   /protein_id="CAE31364.1"
FT                   /translation="MPTHSDAVADGALPENGPPQAGAWRRVRREFSGAPVLAALAVLAL
FT                   VVGAALLAPWLGTVDPTAIDPGARLKPPFGDYLFGTDAFGRDIWSRVVYGARVSLVAGL
FT                   GAALVSVTLGLVIGVIAGWFRTLDGLIMRTMDAVMAIPGILLAIALVSVTGASLATVLV
FT                   AITIPEIPRVVRLVRGQILSVRGEPYVEAALALGTPLPLLLWRHLVPSTVAPLTVQGTY
FT                   VFASAMLTEAILSFLGAGIPPEIASWGNIMSEGRMYFRMLPGLILFPGLFLSLTVLSVN
FT                   ILGDALRDALDPKMTRRT"
FT   misc_feature    complement(join(222499..222567,222625..222684,
FT                   222721..222789,222847..222915,222976..223044,
FT                   223180..223248))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BB0865 by TMHMM2.0 at aa 34-56, 102-124, 145-167, 187-209,
FT                   222-241 and 261-283"
FT   misc_feature    complement(222577..222807)
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport systems inner membrane component, score 0.0033"
FT   misc_feature    complement(222718..222804)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        complement(223350..224291)
FT                   /transl_table=11
FT                   /locus_tag="BB0866"
FT                   /product="putative ABC transporter permease protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3160"
FT                   /db_xref="GOA:A0A0H3LIA2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIA2"
FT                   /protein_id="CAE31365.1"
FT                   /translation="MLAFIARRLLATIPVLIMVAVVVFAILRASPGDPAIIMAGDAATP
FT                   ERIAQIRQVMGLDQPLVKQFFIWTGRLVRGDMGTSLMSGVPVTQLIGQRLEPSLSLAVI
FT                   TLAFTLAVAIPLGILAAWRRGRLLDRAVMGFSVLGFSVPVFVTGYVLIWAFAIKLGWFN
FT                   VQGYTPLAQGFWPYLHRLVLPSLALSTVYVALIARITRTSIIEVMGEDFIRTARAKGLG
FT                   ETGVLLGHALRNAAVPIATVIGVGVALLISGVVVTESVFNIPGLGRLVVEAVMARDYPV
FT                   IQGLTLFFAFVYVFINLVVDCAYTVFDPRIRY"
FT   misc_feature    complement(join(223371..223439,223521..223589,
FT                   223695..223763,223821..223889,223926..223994,
FT                   224199..224267))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BB0866 by TMHMM2.0 at aa 9-31, 100-122, 135-157, 177-199,
FT                   235-257 and 285-307"
FT   misc_feature    complement(223467..223682)
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport systems inner membrane component, score 0.031"
FT   misc_feature    complement(223593..223679)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   misc_feature    complement(224163..224222)
FT                   /note="PS00187 Thiamine pyrophosphate enzymes signature."
FT   misc_feature    complement(224217..224291)
FT                   /note="Signal peptide predicted for BB0866 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.916) with cleavage site
FT                   probability 0.462 between residues 25 and 26"
FT   CDS_pept        complement(224337..225902)
FT                   /transl_table=11
FT                   /locus_tag="BB0867"
FT                   /product="putative extracellular solute-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3159"
FT                   /db_xref="GOA:A0A0H3LN76"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN76"
FT                   /protein_id="CAE31366.1"
FT                   /translation="MLKSVRIAALAGAMLLAAQGAGAETVIKAVMHSPLRLTDPHATTA
FT                   YITTWHGYMIYDTLLATDADNKIQPQMLEKWEVSPDGKTYTMTLRPGQKWHDGKPVTAE
FT                   DCVASIKRWAGGDGMGRTLMKFTDRIEAVDDQTLRIVMKEPTDLALRALSKPTGTAAFM
FT                   MPKRIADIPIGQPITDMTGSGPFKVAEFKPGVKTVYVRNADYVPRQEPASGLAGGKAVH
FT                   IDRVEWNVMPDALTTANALLGGEIDFVEQFPYDLLPMVEGNPALKEEALSPVGYFTMYR
FT                   FNFKYPPFDNRKIRQAAMYAIGQEDVMKALVGNPKYWQTCASLWGCGTPFETDIGKDMV
FT                   VPSNIEKARALLKEAGYDNTPILVMHATDVGTLSAQPVVMAQALRKAGFNVNLAAMDWQ
FT                   SVATRRASKAAPAQGGWNIHNTNWYATDIMDPVRSAPAAANGDNAWFGWPDIPEIETLR
FT                   TRFALSSDPAEQKKLAEEAQRIGIDEGLYVPLGQMSVPTVYTTKLSGLVHAPVFAFWNV
FT                   KKAP"
FT   misc_feature    complement(224346..225902)
FT                   /note="HMMPfam hit to PF00496, DE Bacterial extracellular
FT                   solute-binding proteins, family 5, score 2.1e-20"
FT   misc_feature    complement(225834..225902)
FT                   /note="Signal peptide predicted for BB0867 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.917 between residues 23 and 24"
FT   CDS_pept        complement(226188..227681)
FT                   /transl_table=11
FT                   /gene="mmsA"
FT                   /locus_tag="BB0868"
FT                   /product="putative methylmalonate-semialdehyde
FT                   dehydrogenase [acylating]"
FT                   /EC_number="1.2.1.27"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3158"
FT                   /db_xref="GOA:A0A0H3LJG7"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJG7"
FT                   /protein_id="CAE31367.1"
FT                   /translation="MKTIPHFINGQPYEGRNGRYTQGFNPATGEVSSSIPLASAQDVDT
FT                   AVAAAAAAFPAWSETPPLKRARILFKFKALLDEHQDELAALITAEHGKVFSDAKGEVTR
FT                   GIEVVEFACGIPHLLKGQYTDQIGGGIDNWSMRQPLGVVAGITPFNFPMMVPCWMFPVA
FT                   LACGNTFVLKPSERDPSAALRLAELLKEAGLPDGVFNVVQGDKQAVDALIAHPQVEALS
FT                   FVGSTPIAEYIYAEGTRRGKRVQALGGAKNHMVVMPDADLDQVTDALMGAAYGSAGERC
FT                   MAISVAVAVGEVADEVVARLAPRVRALVVKDGMQADAEMGPLVTAQHRAKVTGYIEDGQ
FT                   ACGATLVVDGRGLQVPGNEGGFFLGGTLFDHVTPAMNIYREEIFGPVLCIVRVPDFAAA
FT                   VELINAHEFGNGVSCFTSDGGIARAFARQIKVGMVGINVPIPVPMAWHSFGGWKRSLFG
FT                   DHHAYGEEGVRFYSRYKSVMQRWPDSIGKGAEFTMPVAK"
FT   misc_feature    complement(226239..227651)
FT                   /note="HMMPfam hit to PF00171, DE Aldehyde dehydrogenase
FT                   family, score 8.2e-167"
FT   misc_feature    complement(226827..226862)
FT                   /note="PS00070 Aldehyde dehydrogenases cysteine active
FT                   site."
FT   CDS_pept        complement(227713..228996)
FT                   /transl_table=11
FT                   /locus_tag="BB0869"
FT                   /product="omega-amino acid--pyruvate aminotransferase"
FT                   /EC_number="2.6.1.18"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3157"
FT                   /db_xref="GOA:A0A0H3LRE6"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRE6"
FT                   /protein_id="CAE31368.1"
FT                   /translation="MPFTANRQFKSQPRLLARAEGMYYTSTDGRQILDGTAGLWCVNAG
FT                   HCRPEIVQAIASQAGEMDYAPGFQLGHPLAFEAATAVASFMPAGIDRVFFTNSGSESVD
FT                   TALKIALAYHRARGDAQRTRLVGRERGYHGVGFGGISVGGISANRKTFSGALLPAVDHL
FT                   PHTHSLEHNAFSKGQPAWGEHLADELERIVALHDASTIAAVIVEPMAGSTGVLVPPKGY
FT                   LQRLREITARHGILLIFDEVITAYGRLGSPTAAEHFGVTPDIITMAKGVSNAAVPAGAV
FT                   AVKREVHDAIVNGVQGGIEFFHGYTYSAHPLAAAAILATLGIYRRDDLFGRARDLSPAF
FT                   EKAAHALQGAPHVIDVRNIGLVAGIELASRPDAPGARAAEAFRKCFDSGLMVRYTGDIL
FT                   AVSPPLIIDEAQIGELFEGIGKVLKEIA"
FT   misc_feature    complement(227719..228990)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00202, DE Aminotransferase
FT                   class-III, score 1.2e-124"
FT   misc_feature    complement(228172..228201)
FT                   /note="PS00599 Aminotransferases class-II
FT                   pyridoxal-phosphate attachment site."
FT   CDS_pept        229221..230678
FT                   /transl_table=11
FT                   /locus_tag="BB0870"
FT                   /product="probable GntR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3156"
FT                   /db_xref="GOA:A0A0H3LI76"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI76"
FT                   /protein_id="CAE31369.1"
FT                   /translation="MIDFQPVRGRAQAPSLVEQVVQAFSSAIARQELRPGMPVPSVREF
FT                   ARQHGISTFTVASAYSRLAAQGWLAARPGSGYRVASPQAAAPRAGTPGQWSPPRLNDSW
FT                   LLSDIYADHSIPIKSGCGWLPPEWLHEEGLHQALRHLGRVPALRIAGYGHPYGYAPLRE
FT                   TIAAGLGAAGMPAEADQVLLTQGVTHGLDLVMRTLLRPGDTVLVEQPCYANLLQLLRLA
FT                   GMRVVSVPRGVDGIDCEALDAAALAHRPRALFVNTVLQNPSGASLGMANAFRVLQAAER
FT                   HGLWIVEDDISRELMPAIAPLLAALDGAQRVVYLSGYSKAISPSVRVGYIVAHRDLVRD
FT                   LARTKMAAGLTSPEIMERVVHQVIREGRYRAHVLRTRERLGQAHAQVVQAMDEHGLQLC
FT                   ARPQAGLFLWARPGGAWRERGANALAELALKDGIWLAPGSYFDAADADIPWLRFNVAYS
FT                   DAAALWRFLRGAGASAQPATRSYSTKS"
FT   misc_feature    229278..229457
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 1.9e-10"
FT   CDS_pept        complement(230642..231139)
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /gene_synonym="tmrA"
FT                   /locus_tag="BB0871"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3155"
FT                   /db_xref="GOA:A0A0H3LIA6"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIA6"
FT                   /protein_id="CAE31370.1"
FT                   /translation="MPATPLLSLVVAYSTNRVIGRDNALPWKLPGDLAHFKRTTLGHPI
FT                   IMGRNTWESLGRPLPGRTNIVITRNPAYGAAGAVVVGSLNAAIQACGDAAVACVIGGAQ
FT                   IYAQALPLAQRVVATEVHAEIEGDAFFPPLPAGQWRETQRAAQPAENGLRYDFVEYERV
FT                   AG"
FT   misc_feature    complement(230654..231124)
FT                   /note="HMMPfam hit to PF00186, DE Dihydrofolate reductase,
FT                   score 1.5e-63"
FT   misc_feature    complement(231020..231088)
FT                   /note="PS00075 Dihydrofolate reductase signature."
FT   CDS_pept        complement(231170..232141)
FT                   /transl_table=11
FT                   /locus_tag="BB0872"
FT                   /product="putative thymidylate synthase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3154"
FT                   /db_xref="GOA:Q7WP13"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WP13"
FT                   /protein_id="CAE31371.1"
FT                   /translation="MKQYLDLVQSILDQGAWQENRTGVRTLSLPGAALRFDLQQGFPAV
FT                   TTKKLAFKSAIGEMVGFLRATRSAAQFRALGCKVWDQNANENEQWLANPYREGPDDLGP
FT                   VYGVQWRHWPAYKLLPRSAGGQVADALARGYRQVAEVAENGAPHVLLYKAVDQLRQCLD
FT                   TIHQSPGDRRILFHGWNWAQIEEMALPPCHLLYQFLPNAGTREISLCLYIRSNDVGLGT
FT                   PFNLTEGAALLHLVGRLTGYKPRWFSYFIGDAHVYENHLPMLREQLTREPYPAPQLVLS
FT                   DRIPDFAVTGKYEPQWLEQVEPGDFTLSGYQHHAPLTAPMAV"
FT   misc_feature    complement(231176..232141)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00303, DE Thymidylate synthase,
FT                   score 3.3e-93"
FT   CDS_pept        complement(232194..232631)
FT                   /transl_table=11
FT                   /locus_tag="BB0873"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3153"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN79"
FT                   /protein_id="CAE31372.1"
FT                   /translation="MQMECTIDWGGPAGMLFTASTGSGHVAVMDGAVDGGGHDLAPRPM
FT                   EMLLAGTGGCTAYDVVLILKRGRHAVTGCSVKLQAERADADPKVFTRIHFAFTVTGSKL
FT                   PRAAVERAVQLSHEKYCSASAMLEKTAELSFSVDIVDTQAA"
FT   misc_feature    complement(232212..232619)
FT                   /note="HMMPfam hit to PF02566, DE OsmC-like protein, score
FT                   2.6e-30"
FT   CDS_pept        232755..233423
FT                   /transl_table=11
FT                   /locus_tag="BB0874"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3152"
FT                   /db_xref="GOA:Q7WP11"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WP11"
FT                   /protein_id="CAE31373.1"
FT                   /translation="MSTSSSASALGRRAGPLDGLIGEIDRALRVLSGAATAARPYPAQA
FT                   PEAPDALSERERRHAAGLMRVNHVGEVCAQALYRGQAAACREPAARELLRQAAAEEVDH
FT                   LAWCNERLRELGSRPSLLNPFWYTGSFALGVLASYAGVPRNLGFMAETERQVEAHLDGH
FT                   LRTLPVQDRRSRDIVQKMKEDEAQHRASAERAGGVPLPAPVRGAMRAMSKVMTSTAYWL
FT                   "
FT   misc_feature    234097..245572
FT                   /note="Region possibly encoding a lipopolysaccharide
FT                   O-antigen"
FT   CDS_pept        234151..235254
FT                   /transl_table=11
FT                   /locus_tag="BB0875"
FT                   /product="probable glycosyltransferase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3151"
FT                   /db_xref="GOA:A0A0H3LJH1"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJH1"
FT                   /protein_id="CAE31374.1"
FT                   /translation="MTWLYICVVAFMVGGLIVASERWHGAFTGDSDLNKPQASHTRATP
FT                   RVGGLAVLAGSLAGLLVLGPSNMTLTWLWPALFVAALPVFVAGLLEDITKDIGASKRLL
FT                   AAFASAAIAWWLLGGVSRVGIAPVDWVLSFWPVSLIFTMFAVGGCTHALNIVDGMNGLA
FT                   GMIATLMAVSISLVALQVGDMPIFMIAAALASATLGFLVWNFPFGRVFLGDGGAYFLGF
FT                   MLAELAVLLVVRNPSVSPFYALAVLFYPVFETGFSIWRRRFKRGVPVDQPDALHLHQLV
FT                   FRRLVRVTFSRGRRHAVPALCNALASPYMWVLALIGLVPATIWWDNAWFLCASLVVFAA
FT                   VYTWLYMRLVSWRRPGWLLLPSVIRTH"
FT   misc_feature    join(234160..234228,234289..234342,234352..234420,
FT                   234457..234525,234541..234609,234628..234696,
FT                   234706..234774,234793..234849,234859..234927,
FT                   235039..235107,235117..235185)
FT                   /note="11 probable transmembrane helices predicted for
FT                   BB0875 by TMHMM2.0 at aa 4-26, 47-64, 68-90, 103-125,
FT                   131-153, 160-182, 186-208, 215-233, 237-259, 297-319 and
FT                   323-345"
FT   misc_feature    234367..234861
FT                   /note="HMMPfam hit to PF00953, DE Glycosyl transferase,
FT                   score 6.1e-13"
FT   misc_feature    234565..234597
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        235261..236634
FT                   /transl_table=11
FT                   /gene="wbpO"
FT                   /locus_tag="BB0876"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3150"
FT                   /db_xref="GOA:A0A0H3LRF9"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRF9"
FT                   /protein_id="CAE31375.1"
FT                   /translation="MAPVPARGVLQRYKHVQTTYNSVAVTRLIGRFILRIDDVKLAVVG
FT                   LGYVGLPLAVEFGKKRPVIGFDINERRIAALKAGHDHTLEVEDDELAQAAQLSYTAERA
FT                   DLAQANVFIVTVPTPIDEYKQPDLTPLVKASETIGAVLKRGDIVIYESTVYPGATEEDC
FT                   VPVLERVSGLKFNQDFYAGYSPERINPGDKAHRVNTIKKVTSGSTPEVAELVDQLYNEI
FT                   ITAGTHKASSIRVAEAAKVIENTQRDVNIALINELALIFNKMGIDTEAVLQAAGTKWNF
FT                   LPFRPGLVGGHCIGVDPYYLTHKAQSIGYHPEIILAGRRLNDSMGGYVVSQLVKAMAKR
FT                   RIHVEGARVLLMGLTFKENCPDLRNTRVVDIVRELGEYHVDVDVYDPWVDPAEAEHEYG
FT                   ITPVAKPAAGAYDAVILAVSHHQFVEMGAEAIRKFGKAEHILYDLKYVLAPDQADLRL"
FT   misc_feature    235375..235932
FT                   /note="HMMPfam hit to PF03721, DE UDP-glucose/GDP-mannose
FT                   dehydrogenase family, NAD binding domain, score 1.4e-73"
FT   misc_feature    235957..236241
FT                   /note="HMMPfam hit to PF00984, DE UDP-glucose/GDP-mannose
FT                   dehydrogenase family, central domain, score 4.3e-44"
FT   misc_feature    236308..236592
FT                   /note="HMMPfam hit to PF03720, DE UDP-glucose/GDP-mannose
FT                   dehydrogenase family, UDP binding domain, score 2.8e-31"
FT   CDS_pept        236646..237671
FT                   /transl_table=11
FT                   /locus_tag="BB0877"
FT                   /product="UDP-N-acetylglucosamine C4 epimerase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3149"
FT                   /db_xref="GOA:A0A0H3LI81"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI81"
FT                   /protein_id="CAE31376.1"
FT                   /translation="MTNRFETTCAQLRAQPQKWLVTGCAGFIGSNLLETLLGLDQAVVG
FT                   LDNFATGHQHNLDEVRAAVTPEQWARFTFIEGDIRDLAACQRAVQGVDRVLHQAALGSV
FT                   PRSLKDPITTNEVNIGGFLNMLVAARDAQVQAFVYAASSSTYGDHPDLPKVEERIGNPL
FT                   SPYAVTKYVNELYADVFARSYGFSSVGLRYFNVFGKRQDPDGAYAAVIPKWTAAMIKGE
FT                   DVVINGDGQTSRDFCFVENAVQANLLAAMAAPEGANQVYNVAYNARTTLTELFEHLRRA
FT                   LAGQGVSYEKAPVYAEFRAGDVRHSQADIGKAGKLLGYEPAYDILRGLEAAMPWYTQFL
FT                   R"
FT   misc_feature    236700..237665
FT                   /note="HMMPfam hit to PF01370, DE NAD dependent
FT                   epimerase/dehydratase family, score 2e-115"
FT   CDS_pept        237673..239043
FT                   /transl_table=11
FT                   /locus_tag="BB0878"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3148"
FT                   /db_xref="GOA:A0A0H3LIB1"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIB1"
FT                   /protein_id="CAE31377.1"
FT                   /translation="MKAIRRKLDAIHPDHQRIFKGAFRVAVFLILGKAAGAIKEMAVAY
FT                   RYGVSDAVDAYQFTMTMATWLPVTIVGALSVVLIPVLVRLRRAGGHERDRFVRELQGWS
FT                   LAAGLALALLTWMAWPHVLDWLGGGLSGTVDGMTHELLLAFAPVAALLLMAGISAARLR
FT                   SHERHVNTLLDSVPAVTTLAWVMLAASADSVGPLLWGTLVGYAIQAAWLAWLAARADGG
FT                   FWGWPAFTLRSPHWPELAAAAGVMLVGQVAMSFVGPLDQYAAANLGSNANATLGYASRL
FT                   LSLVLGIGAVSVGRAALPVLADVQSRGDGARARAMALKWSALMVGAGAAAVVVGWLLAP
FT                   WGVALLFERGAFTAENTQAVAQVLRWGLLQLPFYFGVLILVQLLASQNRYRIMALIAVA
FT                   NFLLKAVLNTVLAPRMGTAGIMLATSLMYLLSFACYTVVALRPAPGADGGDDDREKR"
FT   misc_feature    join(237733..237786,237853..237921,237982..238041,
FT                   238084..238152,238255..238323,238381..238449,
FT                   238510..238578,238636..238704,238759..238827,
FT                   238840..238908,238927..238995)
FT                   /note="11 probable transmembrane helices predicted for
FT                   BB0878 by TMHMM2.0 at aa 21-38, 61-83, 104-123, 138-160,
FT                   195-217, 237-259, 280-302, 322-344, 363-385, 390-412 and
FT                   419-441"
FT   misc_feature    237799..239037
FT                   /note="HMMPfam hit to PF03023, DE Virulence factor MVIN,
FT                   score 4.9e-07"
FT   CDS_pept        239044..240180
FT                   /transl_table=11
FT                   /locus_tag="BB0879"
FT                   /product="putative glycosyltranferase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3147"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN83"
FT                   /protein_id="CAE31378.1"
FT                   /translation="MPGPAERPLRVLIFIHSLHGGGAERVAADLSAHWARDGRAVMLVT
FT                   QADASGDVYPLHPQVLRRTLDTAGEGGGWRGVLANLRRIRALRALIKDFQPDIVLGMMT
FT                   TASVLAVLAARGLGCRVVATEHTHPPSQALSGMWLRLRRWTYPRAARVVALTRGTADWL
FT                   RTHVPGSRLAVIPNPVHWPLPRTEPVLVPPADGRPRLLAVGRLHPDKGFDVLIDAYARI
FT                   APRYPDWDLVILGEGDERAALQRRVDEAGLAQRVALPGRAGNVGDWYACAALYVLTSRF
FT                   EGLSNTLLESMASGLMPVSFDCDTGPREIVRPGVDGVLVRPAGDAGAMAQALAAAIDDE
FT                   PGRRAMAARAIDVRERFSARHVLDLWQQLFDDALSQAK"
FT   misc_feature    239593..240102
FT                   /note="HMMPfam hit to PF00534, DE Glycosyl transferases
FT                   group 1, score 1.4e-39"
FT   CDS_pept        240227..242152
FT                   /transl_table=11
FT                   /locus_tag="BB0880"
FT                   /product="putative asparagine synthase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3146"
FT                   /db_xref="GOA:A0A0H3LJH6"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJH6"
FT                   /protein_id="CAE31379.1"
FT                   /translation="MCGIVGIWGPLRDKANVLAESCRRIRHRGPDSNGYWEDAEADLAL
FT                   AHVRLAILDLTEAGHQPMVSACGRYVIVLNGEIYNHMELRERLQQDGLAPAWRGHSDTE
FT                   TVLACFAGWGLEQTLQAAVGMFAIALWDRAERKLALMRDRMGEKPLYYGYSQANLLFGS
FT                   ELKAFMPVPGFGRELDRNALASFMRHNYIPAPQSIYAGIRKLPPGAWVEIDAAQMRRGE
FT                   LPEPQVYWSARRAADQGLGDRRRFESDAQAIDALEQVVSQAVRGQMLSDVSLGAFLSGG
FT                   IDSSTVVALMQAQSAQPVRTFAIGFHEKGYNEAEHAKAVAAHLGTEHTELYVTAEDGLA
FT                   VVPSLADMYDEPFADSSQIPTSLVTRMARQHVTVALSGDGGDELFGGYSRYFRVDNWWR
FT                   KCAAMPGPLRHLAGAALRGSAALPGAGAWRGKVGKLGELLGADTRGEFYRLFVSYWADP
FT                   GRVVIGGTEPLSPFEQPMEGSTFDAMMKLDTVTYLPDDILVKVDRAAMAVSLETRVPLI
FT                   DHRVYEFAWQLPFEYKVRGGTGKWLLRQLLYRHVPQAMVDRPKRGFAVPLAAWLRGPLR
FT                   DWAEALLDPARLRQEGWFEPEPILRKWREHLSGHRNWDSHLWGVLMMQAWLDRYRAGAG
FT                   DEAGRR"
FT   misc_feature    240227..240244
FT                   /note="PS00443 Glutamine amidotransferases class-II active
FT                   site."
FT   misc_feature    240230..240685
FT                   /note="HMMPfam hit to PF00310, DE Glutamine
FT                   amidotransferases class-II, score 8.9e-17"
FT   misc_feature    240953..241909
FT                   /note="HMMPfam hit to PF00733, DE Asparagine synthase,
FT                   score 2.3e-53"
FT   CDS_pept        242149..243270
FT                   /transl_table=11
FT                   /locus_tag="BB0881"
FT                   /product="putative glycosyltransferase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3145"
FT                   /db_xref="GOA:A0A0H3LRH8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRH8"
FT                   /protein_id="CAE31380.1"
FT                   /translation="MKILLLVSSMHAGGAERVAATLANGWAARGDQITLMPTYSSKGTC
FT                   FYPLSDDVELLWLADRAGTRSGGAVAAWQRLRALRAVVRERAPDVVVSFLTNVNVAAIL
FT                   ATRGLKTPLIVCERTNPVVDTSIGRVWRVLRRVLYPLADMVTVQADATVEPFARQVPGL
FT                   KQLCVIPNPLPPELFDATPAAGSGAAPAARKRLMAMGRMVPDKRFDLLIDAYAGLADEF
FT                   PDWDLWIWGEGPRRDDLQAQVAARGLATRIHMPGRTAAPWDELAKADAFVLSSAVEGFP
FT                   NVLLEAMSLGLPCAAFDCPSGPAEMTRGGRDALLVPAGQRDALRDALGRLMRDPELRRD
FT                   LGRRAAQSVRQRYALPAVLAQWDALFERVRGGA"
FT   misc_feature    242683..243192
FT                   /note="HMMPfam hit to PF00534, DE Glycosyl transferases
FT                   group 1, score 3e-37"
FT   CDS_pept        243267..244421
FT                   /transl_table=11
FT                   /locus_tag="BB0882"
FT                   /product="putative glycosyltransferase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3144"
FT                   /db_xref="GOA:A0A0H3LI85"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI85"
FT                   /protein_id="CAE31381.1"
FT                   /translation="MTRILRVMHVITGLGQGGAESVLFRLATWPDQRVRHSVISLTDEG
FT                   VYGTRLRAAGVPVHALGMPRGRVTLGGMLALRALLRRERPDAVQTWMYHADLIGGVAAR
FT                   LAGIRAVAWGIRNSGEHLDRSSRSARLVLKLCARLSARLPAAIVCAAQDAATRHRRHGY
FT                   DGARMVVIPNGYDLSRYAPDAQARERMRSLWGVAPETPLVGCVARWDPLKDHANLLAAL
FT                   GGLVREGRDRGLQCALVGRGMSPGNAGLAALIDAEGLRGRVLLAGPSDDVPAVMNALDL
FT                   HVLSSCAEGFPNVVAEAMACGTPCVATDVGDAAYIVGDTGGVAPAQQPAALAAAIEAAL
FT                   AGIAARGRDAAGAAGRQRVLAEFDLRRMVESYEAVWRRISGERA"
FT   misc_feature    243822..244340
FT                   /note="HMMPfam hit to PF00534, DE Glycosyl transferases
FT                   group 1, score 2.4e-25"
FT   CDS_pept        244418..245548
FT                   /transl_table=11
FT                   /locus_tag="BB0883"
FT                   /product="putative glycosyltransferase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3143"
FT                   /db_xref="GOA:A0A0H3LIB7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIB7"
FT                   /protein_id="CAE31382.1"
FT                   /translation="MTSPRRLLFVVNNPAFFLSHRLPLAEAARADGYEVHVATMDGPSV
FT                   PDIVARGFVHHAIPMTRSGKQPLQELRSVWALVRLFRRLRPGLVHLVTIKPVLYGGIAA
FT                   RLAGVPAMVAAISGLGFVFVAGGLKARLLRAAVGRLYRLALGHRNSRIVFQNTADRDVL
FT                   ARLGAVRAEQVVMIRGSGVDLGQYRVVPEPAAPVTALMAARLLRDKGVREFVEAARLLR
FT                   GRGLSVRMQLAGGVDPGNPASITPEQAAQWQDEGCVEVLGERKDIAALYGAAHMAVLPS
FT                   YREGLPKSLLEAAACGRAVVTTDVPGCRDAIDPDVTGLLVPPRDAPALADAIARLAEDA
FT                   SLRQRMGAAGRALAEREFGIEDVCRRHLAIYRALAR"
FT   misc_feature    244733..244801
FT                   /note="1 probable transmembrane helix predicted for BB0883
FT                   by TMHMM2.0 at aa 106-128"
FT   misc_feature    244964..245476
FT                   /note="HMMPfam hit to PF00534, DE Glycosyl transferases
FT                   group 1, score 3.3e-32"
FT   CDS_pept        complement(245556..247121)
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="BB0884"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3142"
FT                   /db_xref="GOA:Q7WP01"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WP01"
FT                   /protein_id="CAE31383.1"
FT                   /translation="MPTPLPSSSAWLAFADAARHSSRRGARLRVIEAAGLRVDLTAQAH
FT                   SDDLDSAAEDLLAQQDFDNARAQLFDGGPANWTEHRPAWHTALRAARPPTPVAGAILGE
FT                   RDRLRRFVQDADMRGAYRHVLHLGIGGSDWGPRMVTRALRHNGLKREVRFASNVDSHAV
FT                   ADALHHLDPHDTLIIVASKSFTTTEPLANAEVAMNWLRNAGVADPVRQVVAITANVDAA
FT                   LDFGISPQHIFRFWDWVGGRYSLWSAIGLPVALALGCDALDELLAGAAAMDQHFLHTPM
FT                   RRNAPLQMALAGVANRSVLGYGSLAITPYDSRLTHLVPWAQQLEMESLGKVAGHDGSPA
FT                   GVPTGPVVWGMTGTDCQHTFFQWLHQDTAGAPVDFIVCEQADHPYDHFHKLLIANCLAQ
FT                   RAALLRGKPFDEALKEARLVESDPQQAEILAHHRVHPGGRPSTLIMLPRLSAHALGALL
FT                   AMYEHKVFAQGVLWGINPFDQWGVEYGKALARNIIRELENPSSEVNQQDPSTRYWIDAL
FT                   RKQP"
FT   misc_feature    complement(245580..247007)
FT                   /note="HMMPfam hit to PF00342, DE Phosphoglucose isomerase,
FT                   score 1.2e-158"
FT   misc_feature    complement(245664..245717)
FT                   /note="PS00174 Phosphoglucose isomerase signature 2."
FT   misc_feature    complement(246345..246377)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   misc_feature    complement(246372..246413)
FT                   /note="PS00765 Phosphoglucose isomerase signature 1."
FT   CDS_pept        complement(247128..248510)
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="BB0885"
FT                   /product="phosphoglucomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3141"
FT                   /db_xref="GOA:A0A0H3LN88"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN88"
FT                   /protein_id="CAE31384.1"
FT                   /translation="MAHPFPASVYKAYDIRGSVPDQLDPVFARALGRALAASARAQGIG
FT                   ALVVGRDGRLSSPDLAGALQEGIMEGGVDTLDIGQVPTPLVYFAAHTQGTGSGVAVTGS
FT                   HNPPQYNGFKMMMGGQALYGPAVQALRPAMLAPAAAPGTWGERRQLDVVPAYIERIVSD
FT                   VKLARPMKIAVDCGNGVAGALAPQLFRALGCEVDELYCEVDGTFPNHHPDPAEPRNLQD
FT                   LIAHVTSTDCELGLAFDGDGDRLGVVTKSGQIIWPDRQLILFARDVLARCPGATIIYDV
FT                   KCSRHVGVAIEQSGGVPLMWQTGHSLVKAKLAETGAPLAGEMSGHIFFKERWYGFDDGL
FT                   YTGARLLEIVSRETDASRPLEALPQALSTPELKLEMAEGEPHALIAALQQQGEFASASR
FT                   LVTIDGVRAEYPDGFGLARASNTTPVVVLRFEAETEPGLARIQQEFRQQLLRLAPQAKL
FT                   PF"
FT   misc_feature    complement(247149..247400)
FT                   /note="HMMPfam hit to PF00408, DE
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain,
FT                   score 4.7e-09"
FT   misc_feature    complement(247401..247745)
FT                   /note="HMMPfam hit to PF02880, DE
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain III, score 5e-35"
FT   misc_feature    complement(247749..248051)
FT                   /note="HMMPfam hit to PF02879, DE
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II, score 5.3e-48"
FT   misc_feature    complement(248076..248501)
FT                   /note="HMMPfam hit to PF02878, DE
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I, score 1.8e-35"
FT   misc_feature    complement(248175..248219)
FT                   /note="PS00710 Phosphoglucomutase and phosphomannomutase
FT                   phosphoserine signature."
FT   CDS_pept        248789..249400
FT                   /transl_table=11
FT                   /locus_tag="BB0886"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3140"
FT                   /db_xref="GOA:A0A0H3LJI2"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJI2"
FT                   /protein_id="CAE31385.1"
FT                   /translation="MSADISFVSTRRRMAPGRVDLTAGGERRLDIPVHAGIDGSVEAGR
FT                   AWERCVWRAARVLIAECPAPRLSARLEATLRGVAVRIARDRGWRGIGTVVFSLDVGTGM
FT                   FRMIEARLCGLQQGGPAADAASGGHALEVRISACADSGRRGAHLLTYGATRGEALRRAY
FT                   QALAKLPGLAQADRAFLMDRIASPAFCSGLTGSQLDRIAS"
FT   CDS_pept        249492..250907
FT                   /transl_table=11
FT                   /locus_tag="BB0887"
FT                   /product="putative oxidoreductase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3139"
FT                   /db_xref="GOA:A0A0H3LRJ1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRJ1"
FT                   /protein_id="CAE31386.1"
FT                   /translation="MTLPSELRALLGPSHVLTGDDAEPFLLDWRRRYRGRALAVARPGS
FT                   AEEVAAVVRLCQAHGAPLVPQGGNTGLCGGATPDDSGSAVVLSTTRLNRVRAIDTDNDT
FT                   ITVEAGCVLQAVQQAAEQAGRLFPLSLAAEGSCTIGGNLATNAGGTQVLRYGNARELTL
FT                   GLEVVTAEGEIWNGLRGLRKDNTGYDLRDLYVGSEGTLGIITAATLKLFPLPVATCTAL
FT                   LALDSIDAAVEVLSRARGGFGASLTGFELMAADCLQAVTRLFPQQRLPFDGASADSPWF
FT                   ALLELSDSESEAHARARFEAVVGAAIEDGLVADAAIAENLAQSQALWHLRESIPLAEAE
FT                   LGKSIKHDVSIPISAIAAFVHQTNGLLQGRFPGVRNVIFGHLGDGNLHYNVARGPGQTE
FT                   ADLLGLQSQVYDAVHGSVQAFAGSISAEHGVGQLKRDELPRYKSAVELALMKRLKAALD
FT                   PRGLLNPGKVLQA"
FT   misc_feature    249600..250091
FT                   /note="HMMPfam hit to PF01565, DE FAD binding domain, score
FT                   7.4e-64"
FT   misc_feature    250131..250895
FT                   /note="HMMPfam hit to PF02913, DE FAD linked oxidases,
FT                   C-terminal domain, score 3.5e-72"
FT   misc_feature    250500..250523
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        250922..251632
FT                   /transl_table=11
FT                   /locus_tag="BB0888"
FT                   /product="putative two-component system response regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3138"
FT                   /db_xref="GOA:A0A0H3LI91"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI91"
FT                   /protein_id="CAE31387.1"
FT                   /translation="MTAAPANRHFRVLIVEDDLTIAANLYDYLQVRGFVPDAAYDGRSA
FT                   LALLDEHAFDAMVLDVGLPGMDGHAVLHALRVERRAALPVLMLTARDGLDDKLAGFAHG
FT                   ADDYLTKPFALAEVEARLLALIQRSRGAVVDSLRSFGPLQFDSATREVAVHGKPVHLTR
FT                   KCGMIVEVLLRDPGRVVSREQLENALWGDDPPSSDALRSQVHLLRRALADAGFDGIETV
FT                   HGTGWRLALPAGGA"
FT   misc_feature    250949..251311
FT                   /note="HMMPfam hit to PF00072, DE Response regulator
FT                   receiver domain, score 2.2e-29"
FT   misc_feature    251390..251599
FT                   /note="HMMPfam hit to PF00486, DE Transcriptional
FT                   regulatory protein, C terminal, score 8.8e-13"
FT   CDS_pept        251629..252951
FT                   /transl_table=11
FT                   /locus_tag="BB0889"
FT                   /product="putative two-component system sensor protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3137"
FT                   /db_xref="GOA:A0A0H3LIC2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIC2"
FT                   /protein_id="CAE31388.1"
FT                   /translation="MSARPVSGNGSGSLTQRVVWALTGSVALFVTALVLLSYLTFDKME
FT                   DDLVNDILSTETDRLIQHVAADDHFLPDRGARELGGAMRAWLVRAGAAQSDLPQPLHGL
FT                   GVGMHLLEPGAETWHVMVADVEDARIYVLYDATDNEARVHDFGLFVLGVGAICIVAAYG
FT                   ISRRVAGVAVGPLVELTRRLANWAPGAPDLAVTRDDEAGRLIEAFNRVQNQVDRSIARE
FT                   REFSVNVSHEVRTPLAAIRSDSEMMLLAAGLDEGLRTRLVRIVANVDNVSTALESARAM
FT                   ARDEPRAPERVDLAACMDDAWRGLEVNAEAAGLAFANRIPAGSAHVLDRYAMLTVLCNL
FT                   VRNAIEHAAPATLTAALRPDGALELRDDGRGIAAEELPFVFQRFYSGRLRDSADNGSNE
FT                   LPRGLGLAIAKRVCDMQGWQLSVDSERDGPARGTRFVLRFT"
FT   misc_feature    join(251680..251748,252064..252123)
FT                   /note="2 probable transmembrane helices predicted for
FT                   BB0889 by TMHMM2.0 at aa 18-40 and 146-165"
FT   misc_feature    252076..252279
FT                   /note="HMMPfam hit to PF00672, DE HAMP domain, score 0.023"
FT   misc_feature    252289..252489
FT                   /note="HMMPfam hit to PF00512, DE His Kinase A
FT                   (phosphoacceptor) domain, score 0.0003"
FT   misc_feature    252610..252945
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF02518, DE Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase, score 2.7e-18"
FT   CDS_pept        253031..254992
FT                   /transl_table=11
FT                   /locus_tag="BB0890"
FT                   /product="putative sulfatase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3136"
FT                   /db_xref="GOA:A0A0H3LN91"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN91"
FT                   /protein_id="CAE31389.1"
FT                   /translation="MRVFFCNEADEALALPPPTRNPVRRLTIRFAIAILVLLTLSRLGL
FT                   SAWQWDRVQAAGGLGPIMLGGLRMDLRLLALVLALPAVLAPWFGHRAWAASATAWWYRV
FT                   WWMLFVLLEVSTPQFIAEYDTRPNRLYFEYLVHPREVASMLWEGYKGVLLASFVVLVLA
FT                   AWLAVRLFPTGRQDGFMKWWKRPFVTLAVLAVVVLAARGTLQHRPINASMVAFSSDAMV
FT                   NTLPLNSLGNVLDAAYRLQDERSSAALYPPMKTEEMNRIVRAAAGLEDPPLDARYPSLH
FT                   KQTATVRRDKPLNLVIILQESLGAQYVGSLGGRDLTPQLDRLAKDGWMFNRAYATGTRS
FT                   VRGLEAVTAGFLPTVAEAVLKLPRSQTGFFTLADLLGRHGFHSRFIYGGEAHFDNMRGF
FT                   FLGNGFNEVIDRQSFVDPVFVGSWGASDEDMFNQLDRLLRADDGKSTFTLAFSVSNHSP
FT                   WEYPAGRIEPVGDPASVDNTVRYADWAMGQFFDKARKAPYWDNTVFLVIADHDSRVYGA
FT                   NLVPVRHFQIPALILGGTVPPRSDDRIVSQIDMGPTLLSLIGLDNVNPMLGADLTQRDP
FT                   NRAIMQYGDNFGYLKGDSLLVIEPGKDPREYRYTAAASMRDEKYIPIDIDPALRDEALA
FT                   FALWPSWAYREERYKLPK"
FT   misc_feature    join(253112..253180,253238..253306,253325..253393,
FT                   253481..253549,253586..253645)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BB0890 by TMHMM2.0 at aa 28-50, 70-92, 99-121, 151-173 and
FT                   186-205"
FT   misc_feature    253907..254980
FT                   /note="HMMPfam hit to PF00884, DE Sulfatase, score 4.3e-06"
FT   CDS_pept        complement(255104..256417)
FT                   /transl_table=11
FT                   /gene="fahA"
FT                   /gene_synonym="fah"
FT                   /locus_tag="BB0891"
FT                   /product="fumarylacetoacetase"
FT                   /EC_number="3.7.1.2"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3135"
FT                   /db_xref="GOA:A0A0H3LJI7"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJI7"
FT                   /protein_id="CAE31390.1"
FT                   /translation="MSKLNETHDPALQSWVASANAADTSFPIQNLPFAAFRRKGTQDPF
FT                   RPGVAIGDAIVDLAALAAQAPFDGTAAAALAACQGERLNALMALDQAHWSALRLALSRA
FT                   LRTGSALQGRIEPLLVAQAEAEYTTPAHIGDYTDFYISVHHATAVGKQFRPDNPLLPNY
FT                   KWVPIGYHGRASSIGVDQRFARPVGQTRPAAEGEAPQFGPCQRLDYELELGIFVGRGNA
FT                   QGERIALGEAESHVFGLCILNDWSARDIQAWEYQPLGPFLAKNFASTISPWIVTLEALE
FT                   PFRAAWTRDAADPQPLPYLESAENRAHGAFDVQMEVLISTEQSRAKHAQPALLSRSNFR
FT                   DAYWNIAQLVAHHTVNGCNLQPGDMMGTGTLSGPQASEAGSLLELTNGGKQPLDLPWGE
FT                   QRTFLQDGDQIIMRAECSKPGYPRIGFGDCVGTVLAAK"
FT   misc_feature    complement(255281..255952)
FT                   /note="HMMPfam hit to PF01557, DE Fumarylacetoacetate (FAA)
FT                   hydrolase family, score 5.9e-55"
FT   CDS_pept        complement(256526..257824)
FT                   /transl_table=11
FT                   /gene="hmgA"
FT                   /locus_tag="BB0892"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.5"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3134"
FT                   /db_xref="GOA:Q7WNZ3"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR022950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WNZ3"
FT                   /protein_id="CAE31391.1"
FT                   /translation="MSLQYQTGFGNACATEALPGALPAGRNSPQICPYGLYAEQLSGTA
FT                   FTAPRAENRRSWLYRIRPGVQHLPFAPFAGAQRWLSDFGRQPVTPNQLRWSPLPMPDAP
FT                   TDFIDGMHTWGGNGGPEEQSGVGIHLYAANRSMQGRFFYNADGEMLIVPQQGRLRLATE
FT                   LGLIDIEPYEIAVVPRGVRLRVELLDDVARGYMLENFGTAMRLPELGPIGSNCLANARD
FT                   FQIPVAWYEDVEGDFELIAKFTGGFWRAPIAHSPLNVVAWHGTHAPYKYDLRNFNTVGS
FT                   ISYDHPDPSIFTVLTSPSDTPGTANMDFAIFPPRILAMENTFRPPWFHRNIASEFMGLI
FT                   HGVYDAKAEGFAPGGASLHNCMSGHGPDADTFEKASHADTSQAHYIRDTMAFMFETRRV
FT                   IRPTAQALASPQRQDDYYQCWQGLQKHFDPEQA"
FT   CDS_pept        258007..258915
FT                   /transl_table=11
FT                   /locus_tag="BB0893"
FT                   /product="putative LysR-family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3133"
FT                   /db_xref="GOA:A0A0H3LRJ6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRJ6"
FT                   /protein_id="CAE31392.1"
FT                   /translation="MAELRNIDLNLLVIFQRLLQERSISAVARQLDLSQPAVSNALRRL
FT                   RAACGDDLFVRTAQGMQPTPHAERLGGPVGEALALLSHALDATQDFEPQASTRRFRIAM
FT                   SDVGEIHFMPRLMDQCARHAPGVRIDSLRLQGADLQREMDAGRVDLAIGAFADLGGAVM
FT                   QRMLFRQGYATLYRQGHPSAHEGMSLKAFRAAHHLVVSHATPYGQVNQSLERAGVTLGE
FT                   HFSVPHFAAVPYIVSTTDLLATVPQKLAASAAPHFGLGLLTPPLRMPTLQTNLYWHRRF
FT                   QRDSGSQWLRALIVQAFADAP"
FT   misc_feature    258031..258210
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 9e-19"
FT   misc_feature    258070..258135
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2098.000, SD 6.33 at aa 22-43, sequence
FT                   RSISAVARQLDLSQPAVSNALR"
FT   misc_feature    258283..258903
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 2.4e-17"
FT   CDS_pept        complement(258925..259134)
FT                   /transl_table=11
FT                   /locus_tag="BB0894"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3132"
FT                   /db_xref="InterPro:IPR021233"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LI95"
FT                   /protein_id="CAE31393.1"
FT                   /translation="MPLITTPNLAGPDNFYEALIDTHRDLSDEQSRELNAALILLLANH
FT                   IGDMAVLRAALEHARQSVVAPPAP"
FT   CDS_pept        complement(259146..260825)
FT                   /transl_table=11
FT                   /locus_tag="BB0895"
FT                   /product="putative oxygenase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3131"
FT                   /db_xref="GOA:A0A0H3LIC8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIC8"
FT                   /protein_id="CAE31394.1"
FT                   /translation="MGDIDYQAIEFAYTKCADQQRDTPARHCVIVVGAGPVGLTTALDL
FT                   ARQGLRVVVLDDDYRLSTGSRAICFAKRTLEIWDRLGVGQRMVDKGVSWNVGKVFFRDQ
FT                   EVWRFDLLPEPGHRRPAFINLQQYYAEGYLHELASAQPGIELRWKSKVVGVAQQADGVQ
FT                   VTVDTPDGAYALHADWLVACDGARSPVRKLLDLETHGRVFKDRFLIADVKMAADYPAER
FT                   WFWFDPPFHPNQSVLLHMQPDNVWRIDFQLGWNADPVEAVKPENVLPRIRALLGPDADF
FT                   ELEWVSVYTFACERMDHFRHGRVVFAGDSAHRVSPFGARGANSGVQDAENLAWKLKLVL
FT                   AGHAPESLIDSYAAEREYAADENILNSSRSTDFITPKSEVSRTFRNAVLNLARQHPFAR
FT                   TLVNSGRLSVPAAYADSPLNTPDSDPYAGTMRPGAVALDAPVRADAQPGWWLSQLDGGF
FT                   ALALFCGAETPRADMLDALRALQQGEVPVQPILVCDAGAAPAAAPAGVRVVEDSEGWLA
FT                   RRYDARPGTCYLIRPDQHIAARFRAFDAQAVRRALARAIGRA"
FT   misc_feature    complement(259722..260300)
FT                   /note="HMMPfam hit to PF01360, DE Monooxygenase, score
FT                   1.7e-36"
FT   misc_feature    complement(260322..260741)
FT                   /note="HMMPfam hit to PF01494, DE FAD binding domain, score
FT                   7.5e-11"
FT   misc_feature    complement(260721..260753)
FT                   /note="PS00639 Eukaryotic thiol (cysteine) proteases
FT                   histidine active site."
FT   CDS_pept        complement(260927..261946)
FT                   /transl_table=11
FT                   /locus_tag="BB0896"
FT                   /product="putative cyclase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3130"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN96"
FT                   /protein_id="CAE31395.1"
FT                   /translation="MHKNKRRAIFPSTHSYKWKEPTVSKQFASHADLEDKVVSFEKLSD
FT                   NAYAYTAEGDPNTGIIVGDDAVMVVDTQATPVMAQDVIRRVREVTDKPIKYILLSHYHA
FT                   VRVFGASAYGAQEILASRDTYDLIAERGEQDKASEIGRFPRLFRNVESIPPGLVWPTMT
FT                   FKGEMTVDLGNLEVKLLQVGRGHTKGDTIAWLPEQKILFAGDLVEYQSTPYCGDCYFRE
FT                   WPATLDALAGFEAEKMVPGRGPALKSATEVRQGLAGTRAFLTDLYAAVNRGVADGKDLK
FT                   TIYREVYDFMKPRYSQWVIFDHCMPFNVSRAYDEATGHYDPRIWTDKRDIEMWQQLEG"
FT   misc_feature    complement(261221..261796)
FT                   /note="HMMPfam hit to PF00753, DE Metallo-beta-lactamase
FT                   superfamily, score 5.5e-11"
FT   CDS_pept        complement(261970..262701)
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /gene_synonym="fpg"
FT                   /locus_tag="BB0897"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3129"
FT                   /db_xref="GOA:A0A0H3LJJ1"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJJ1"
FT                   /protein_id="CAE31396.1"
FT                   /translation="MRWPIPPALPDLLAGRTVLECGRRGKYLLLRFDHGVQIVHLGMSG
FT                   SLRRVPEQEAPRKHDHVDWVFDHAVLRLHDPRRFGAVLWHPDEAGPIAAHPLLARLGIE
FT                   PFDPRFDGRWLHAYFRGRRVAIKQALLAGDAVVGVGNIYASESLFRAGIDPRTAAQRVS
FT                   AARCDRLAAAIRATLSDALDSGGSTLRDYVGASGEPGAYFAIHAAVYERAGLPCRVCGT
FT                   PIRRLVQGQRATYFCPSCQKR"
FT   misc_feature    complement(261979..262053)
FT                   /note="PS01242 Formamidopyrimidine-DNA glycosylase
FT                   signature."
FT   misc_feature    complement(261979..262701)
FT                   /note="HMMPfam hit to PF01149, DE Formamidopyrimidine-DNA
FT                   glycosylase, score 4.9e-73"
FT   CDS_pept        262796..264682
FT                   /transl_table=11
FT                   /locus_tag="BB0898"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3128"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRJ9"
FT                   /protein_id="CAE31397.1"
FT                   /translation="MSQCKIINCVYEDCAINRTGRVKLSLKHINFGVAALALALAGLQS
FT                   LPAQAAEVRPRDATGPRLIQPSKQPETEVIRLRPGQLPYVSLTADIFYRIVGAELAAQR
FT                   GMYGTAAATLVTLARETGDPRLARRGLEFQLAGGNLPGALDAARAWSSLAPNDIEASST
FT                   ELALAAANGETSGLATALRKRIDTARDKPAAIVQAMGVLSRLNDRRLALRILDESLSDS
FT                   ARKLPAAHLALADVAQAAGDYPRAANEAYAALAADPKSEAAAQRVLEYGAKVDATRAQH
FT                   QARAFINRNPDARKLRLMLAGQIADGGDYDGALAELQAMARRSPEDFDLMFMQAQLAYK
FT                   AGRLDQARGYLQQYLDVQNQRQMATAPGATDAGAAAADAHVLLSRIAEDQGRYDEAIRE
FT                   LGRIDDPAMRYSAHMRQATLRARQGRIDDALAMVDRADPQDDEERTLGVLTKAQILRDA
FT                   DQVDRAVAILVAADKAMPDTVEIKYELAMLYERQGRIDQLERLLREVIALDPDHAHAYN
FT                   ALGYTLADRNQRLPEALDLITQALELSPEDPFILDSMGWVKFRMGEPSAAIEYLKRAYA
FT                   LRPEADIAAHLAEVLWVQGERDSATELLRTAYAKDPKNRALLDTMRRLEVRP"
FT   misc_feature    262796..262945
FT                   /note="Signal peptide predicted for BB0898 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.999 between residues 50 and 51"
FT   misc_feature    263309..263332
FT                   /note="PS00687 Aldehyde dehydrogenases glutamic acid active
FT                   site."
FT   misc_feature    263474..263575
FT                   /note="HMMPfam hit to PF00515, DE TPR Domain, score 10"
FT   misc_feature    263777..263878
FT                   /note="HMMPfam hit to PF00515, DE TPR Domain, score 25"
FT   misc_feature    264230..264331
FT                   /note="HMMPfam hit to PF00515, DE TPR Domain, score 0.7"
FT   misc_feature    264332..264436
FT                   /note="HMMPfam hit to PF00515, DE TPR Domain, score 1.6"
FT   misc_feature    264437..264538
FT                   /note="HMMPfam hit to PF00515, DE TPR Domain, score 0.32"
FT   CDS_pept        264679..265278
FT                   /transl_table=11
FT                   /locus_tag="BB0899"
FT                   /product="putative outer membrane lipoprotein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3127"
FT                   /db_xref="GOA:Q7WNY6"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WNY6"
FT                   /protein_id="CAE31398.1"
FT                   /translation="MSACPAPRSPFRWLHAFTLCLLLAVLAGCVSVPKPMAGAGEDVFS
FT                   RVGRFAITVTESDGKQQAVQGGFAWRDDGGSYLLDLTNPLGSTEARVEGRPGMAVLTRA
FT                   NGERLAAEHPDALAEDALGSPVPVTGLRDWLRGRLMAGAAPDGLERDAQGRPTAFEQDG
FT                   WNARLSRYDAQGPQLLVLQRQEPGRRILVRLVITQP"
FT   misc_feature    264679..264789
FT                   /note="Signal peptide predicted for BB0899 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.796) with cleavage site
FT                   probability 0.502 between residues 37 and 38"
FT   misc_feature    264715..264774
FT                   /note="1 probable transmembrane helix predicted for BB0899
FT                   by TMHMM2.0 at aa 13-32"
FT   misc_feature    264718..265233
FT                   /note="HMMPfam hit to PF03550, DE Outer membrane
FT                   lipoprotein LolB, score 9.3e-09"
FT   misc_feature    264733..264765
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        265327..266226
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /gene_synonym="ipk"
FT                   /locus_tag="BB0900"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3126"
FT                   /db_xref="GOA:Q7WNY5"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WNY5"
FT                   /protein_id="CAE31399.1"
FT                   /translation="MTLYDVPAPAKLNLFLHVVGRRADGYHLLQTAFRFIDLADTLHFE
FT                   ARADGAIGRAYELPGVAESDDLVVRAARSLQRATGTRQGAQIGLHKRIPQGGGLGGGSS
FT                   DAATTLIALNRLWGTGLSRSQLMQLALPLGADVPVFVFGQSAFAQGVGEDLTAVALPPA
FT                   AYLVVQPDAGVPTAAIFSDPDLTRDCASVTIADFLALPTFCFGRNDLEPVVLRRYPEVS
FT                   GAVRWLFEHGLRVRMSGSGACLFAEFPTLPEAVLAQEEITATMRVAGKTTSHTHPGFRL
FT                   VQASTGLTEHPLRNWIAS"
FT   misc_feature    265333..266172
FT                   /note="HMMPfam hit to PF00288, DE GHMP kinases putative
FT                   ATP-binding protein, score 3.3e-20"
FT   tRNA            266228..266304
FT                   /note="tRNA Gln anticodon TTG, Cove score 77.70"
FT   CDS_pept        266453..267385
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /gene_synonym="prs"
FT                   /locus_tag="BB0901"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3125"
FT                   /db_xref="GOA:Q7WNY4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WNY4"
FT                   /protein_id="CAE31400.1"
FT                   /translation="MIFTGTANTRLAVDVVNHLDMSLGKMTVGRFSDGEVMVEINENVR
FT                   GKDVFVLQPTCAPTNDNLMEIMVMVDALRRASAGRITAAIPYFGYARQDRRPRSARVAI
FT                   SAKVVANMLQVAGVDRVLTMDLHADQIQGFFDIPVDNIYAGPILLGDIWRRNFSNLVVV
FT                   SPDIGGVVRARALAKQLEADLAIIDKRRPRANVSEVMNIIGEVDGRTCIIMDDMVDTAG
FT                   TLCKAAQALKDRGAGAVYAYCTHPVLSGGAIERIETSSLDELVVTDTIPLSEQGQACGK
FT                   IRQLSCAALLGETILRISNAESVSSLFAD"
FT   misc_feature    266795..266824
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT   misc_feature    266825..266872
FT                   /note="PS00114 Phosphoribosyl pyrophosphate synthetase
FT                   signature."
FT   misc_feature    266846..267256
FT                   /note="HMMPfam hit to PF00156, DE Phosphoribosyl
FT                   transferase domain, score 2.9e-36"
FT   misc_feature    267083..267121
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT   CDS_pept        267508..268122
FT                   /transl_table=11
FT                   /gene="rplY"
FT                   /locus_tag="BB0902"
FT                   /product="50S ribosomal protein L25"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3124"
FT                   /db_xref="GOA:Q7WNY3"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WNY3"
FT                   /protein_id="CAE31401.1"
FT                   /translation="MKFNATARSVQGSSASRRLRRAGRVPAIVYGGTAAPLNIELDHNE
FT                   IYHALRKEEFHASILNMVIEGGKTEEVLLRSVQWHAYKPQVMHVDFQRVDANQALHTKV
FT                   PLHFINAEVSPAVKLSGAIISHVLTELDITCLPALLPQFIEVNLGDLLGGGSIHLADIK
FT                   LPKGVTFNAHGGDTNPLIAAAVVKGGGAADEGDAAAEQPAA"
FT   misc_feature    267514..267780
FT                   /note="HMMPfam hit to PF01386, DE Ribosomal L25p family,
FT                   score 2.4e-27"
FT   misc_feature    267961..267993
FT                   /note="PS00626 Regulator of chromosome condensation (RCC1)
FT                   signature 2."
FT   CDS_pept        268200..268847
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="BB0903"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3123"
FT                   /db_xref="GOA:Q7WNY2"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WNY2"
FT                   /protein_id="CAE31402.1"
FT                   /translation="MRRVLYFTNTRPDAYATMSDPIRLIVGLGNPGPDYETTRHNAGFW
FT                   LADHLADDLRTAFALEKGFFGMLAKARHAGENVVLLKPITYMNRSGQSVGAVARFYKLA
FT                   PEQVLVLHDELDLLPGQVKIKQGGGHAGHNGLKDIQAALGSPNFWRLRIGIGHPRSLGL
FT                   AQQVADFVLHPPRREEQQQIDTVIDRCRAVVPAMLAGDFALATRELHGANGA"
FT   misc_feature    268260..268829
FT                   /note="HMMPfam hit to PF01195, DE Peptidyl-tRNA hydrolase,
FT                   score 6.1e-71"
FT   misc_feature    268302..268343
FT                   /note="PS01195 Peptidyl-tRNA hydrolase signature 1."
FT   misc_feature    268584..268616
FT                   /note="PS01196 Peptidyl-tRNA hydrolase signature 2."
FT   CDS_pept        268844..269626
FT                   /transl_table=11
FT                   /locus_tag="BB0904"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3122"
FT                   /db_xref="GOA:A0A0H3LIA0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIA0"
FT                   /protein_id="CAE31403.1"
FT                   /translation="MSDVTTARQGAARATTFRQDLADCWRFLRRPTLSGRLPGRRADSG
FT                   WASDWRPGVGASRLLAWAAVLWALNLFALGPIAVTVAGAGGAMHRLDPANIPWLTAILW
FT                   APLVEELLFRYGLRRPAQALWFCPMVLPAILWGAQGWTLALVAVAVWLAWLSLRRGRAS
FT                   LAGWDTSWRRYYSYRFGLVFHLVALTFAAVHLNNFSLSQTPVWLLPLLVLPQWATGLVL
FT                   GWMRVRRGIGAAIALHALFNGGPVLMIWLLMTLMPAGA"
FT   misc_feature    join(269018..269086,269240..269308,269369..269428,
FT                   269456..269515,269534..269602)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BB0904 by TMHMM2.0 at aa 59-81, 133-155, 176-195, 205-224
FT                   and 231-253"
FT   misc_feature    269129..269590
FT                   /note="HMMPfam hit to PF02517, DE CAAX amino terminal
FT                   protease family, score 0.015"
FT   CDS_pept        269699..270790
FT                   /transl_table=11
FT                   /locus_tag="BB0905"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3121"
FT                   /db_xref="GOA:A0A0H3LID4"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LID4"
FT                   /protein_id="CAE31404.1"
FT                   /translation="MALQCGIVGLPNVGKSTLFNALTRAGIAAENYPFCTIEPNVGVVE
FT                   VPDPRLDKLAEIVKPERILPATVEFVDIAGLVAGASQGEGLGNQFLSHIRETNAIINVV
FT                   RCFEDPNVVHVAGKVDPIADIEVIETELALADLQTAEKALHRHSKTARSGDKDAQRLVT
FT                   VLEKCIAQLNQAKPVRGLDLSDEEQALIAQLCFITAKPAMYVGNVSDDGFTDNPLLERL
FT                   AEFAKSRNAPMVAICAAIESEIVDLPEEDRQAFLSDMGMEEPGLNRLIRGAFTLLGLQT
FT                   YFTAGVKEVRAWTIPIGATAPQAAGVIHTDFERGFIRAQTIAYEDFIACKGEQGAKEAG
FT                   KMRAEGKEYVVKDGDVMNFLFNV"
FT   misc_feature    269699..269725
FT                   /note="PS00443 Glutamine amidotransferases class-II active
FT                   site."
FT   misc_feature    269723..269746
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    270945..288647
FT                   /note="Low %GC region. Unique relative to pertussis and
FT                   parapertussis. In pertussis it is replaced with another low
FT                   %GC region"
FT   CDS_pept        270987..272198
FT                   /transl_table=11
FT                   /locus_tag="BB0906"
FT                   /product="putative integrase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3120"
FT                   /note="Similar to Escherichia coli integrase Int
FT                   SWALL:Q93SE7 (EMBL:AJ278144) (394 aa) fasta scores: E():
FT                   5.8e-38, 32.23% id in 394 aa, and to Shigella flexneri Int
FT                   SWALL:Q9XCI7 (EMBL:AF141323) (394 aa) fasta scores: E():
FT                   5e-38, 32.48% id in 394 aa"
FT                   /db_xref="GOA:A0A0H3LN99"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LN99"
FT                   /protein_id="CAE31405.1"
FT                   /translation="MPENLLTDLKVRSAQSTDRDWKLSDGGGLFLLVKFTGGRLWRWKY
FT                   RLQGKENLFAIGGFPQVSLAEARAAREKARALVKQGIHPAHERRQVKQRNLEALEERKR
FT                   ARESSFAKVAQAYLAEIKPVFALSSYRTKESRIRKYLSPKFDGMPMSDIGVKQIRPLLE
FT                   ECKAHGAWAAIHVKGDLSAIFEFAVVRGLAEANPIPSLRGLLRVPFSESKAAMTREQIQ
FT                   KFYQELRGYRGYPETSLCLRLIALTACRPGEAADAEWDEFDFADALWRRPAAKMKARRD
FT                   HVSPLPVQAIAVLKDLQCITGGGRYLFPHRSGKGFTTPNRLTYAMRDMNLGRGTTPHCW
FT                   RTTFSTWANENGYRPDAIERQLAHVESNKVRATYNKALLLDQRRTLLQDWADYLSAAEG
FT                   SGAA"
FT   misc_feature    271632..272138
FT                   /note="HMMPfam hit to PF00589, DE Phage integrase family,
FT                   score 2.4e-16"
FT   CDS_pept        272546..273592
FT                   /transl_table=11
FT                   /locus_tag="BB0907"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3118"
FT                   /note="Similar to Methanosarcina mazei hypothetical protein
FT                   Mm2606 SWALL:AAM32302 (EMBL:AE013505) (359 aa) fasta
FT                   scores: E(): 6.3e-09, 22.75% id in 334 aa, and to
FT                   Escherichia coli O157:H7 orf, hypothetical protein z5009 or
FT                   ecs4465 SWALL:Q8XDJ0 (EMBL:AE005585) (431 aa) fasta scores:
FT                   E(): 1.2e-08, 27.64% id in 322 aa"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJJ5"
FT                   /protein_id="CAE31406.1"
FT                   /translation="MHSLTPEYLAALRFDGTQAATLRTLGEYQGKQQLYAAQSPEALKG
FT                   LRQIAVVESTESSNRLEGVVVAPSRLKSLVLRNAMPKNRSEQEIAGYRDALALIHESAT
FT                   HMPFSEGVVLQLHTLLYRYMPQAGGRWKATNNDIIERHSDGTSRLRFQPVAAHLTPMAM
FT                   ADLTGRYASALDQHLADPLVLVPLAMLDFLCIHPFPDGNGRMSRLLTLLLLYHFDYAVG
FT                   RYISLERIFEETKEGYYETLEASSQGWHQGQHDVKPWLDYFWGALLRAYREFEERVGTI
FT                   ERGRGSKGDRVRAEILGRSQPFSISEIEEACPGVSRDMVRLVLRAMKSEGLIESTGKGR
FT                   GAKWIKRA"
FT   CDS_pept        273603..276890
FT                   /transl_table=11
FT                   /locus_tag="BB0908"
FT                   /product="putative helicase"
FT                   /note="Similar to Pasteurella multocida hypothetical
FT                   protein Pm0696 SWALL:Q9CMV8 (EMBL:AE006106) (1089 aa) fasta
FT                   scores: E(): 0, 61.3% id in 1101 aa, and to Listeria
FT                   innocua hypothetical protein Pli0027 pli0027 SWALL:Q926M9
FT                   (EMBL:AL592102) (1001 aa) fasta scores: E(): 4.1e-113,
FT                   50.14% id in 1031 aa"
FT                   /db_xref="GOA:A0A0H3LRK2"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRK2"
FT                   /protein_id="CAE31407.1"
FT                   /translation="MELIDNISRLLGDDLKQTIRPGARLKIAASCFSMYAYEALKSELE
FT                   KIDELDFIFTSPTFVADEVTDKIRKERREFHIPKLDRERSLHGSEFEIQLRNQLTQKAV
FT                   ARECADWMRRKAKFRSNRSKAPMQQFACVEAGGAHSAYVPLHGFTAVDLGYSQGNAVSN
FT                   LVNKVEAPFANTYLSLFDQIWSDPEKLEDVTAQICEYIASVYQENSPESIYFLMLYNIF
FT                   NEFLDDIDEDVLPNDRTGYEDTLIWNKLFNYQRDAATGIINKLETYNGCILADSVGLGK
FT                   TFTALAVVKYYELRNKSVLVLCPKKLADNWLNYNRNLKTNIFARDRFGYDVLCHTDLSR
FT                   TSGESFGTPLNRINWGNYDLVVIDESHNFRNNDAFKDRETRYQKLMNKVIREGVKTKVL
FT                   MLSATPVNNRFTDLRNQLALAYEGDSENLGKKLRTSKSVEEVFRNAQTAFNAWSRLPPE
FT                   ERTPRAILGALDFDFFELLDSVTIARSRKHIQTFYDTKDIGHFPERRKPLSFHCSLTSR
FT                   SDVMGFNEIFEHLSRLKLAVYAPVSYILPSRLRKYEEMYDTQVPGGAGKFRQVDREKSL
FT                   QALMTTNLLKRLESSVQSFRLTLQSLQINHQNTLAKIAVFNQSGIAASVGDLTEVLESI
FT                   DAEEDDPFEGLDQGGDVGGKVKISLADMDLPSWEHHLKVDLANIDALLASMSRITPADD
FT                   AKLQHLKELVQGKITNPINPGNKKVLIFTAFADTADYLYANLAPDLLAHQQLHSGKITG
FT                   SDRPKSTLPKAYDFQELLTLFSPRSKEKAIVLPNESAEIDLLIGTDCISEGQNLQDCDY
FT                   LINYDIHWNPVRIIQRFGRVDRIGSPNSSIQLVNYWPDISLDEYINLKERVENRMMIVD
FT                   VTATGDDNVISAQANDMAYRKEQLRRLQEEVIELEDLKTGVSITDLGLNDFRMDLLNYV
FT                   KTHGELHRSPNGLHAVVPANPDLGLAPGVIFTLRNRSSGVNPPAHLPQHNRLHPYYLIY
FT                   ISQAGEVIHDHTEVKRLLDLARSCCKGQAAPIADACQQFNKTTADGRKMQAYSDLLNQA
FT                   IRSMIEVKEEKDLDSLFTGGKTTALTGTISGLDDFELISFLVIQEVG"
FT   misc_feature    274359..275216
FT                   /note="HMMPfam hit to PF00176, DE SNF2 family N-terminal
FT                   domain, score 0.00014"
FT   misc_feature    275892..276110
FT                   /note="HMMPfam hit to PF00271, DE Helicase conserved
FT                   C-terminal domain, score 1.1e-08"
FT   CDS_pept        276887..277546
FT                   /transl_table=11
FT                   /locus_tag="BB0909"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Pasteurella multocida hypothetical
FT                   protein Pm0697 SWALL:Q9CMV7 (EMBL:AE006106) (220 aa) fasta
FT                   scores: E(): 2.7e-27, 38.63% id in 220 aa, and to
FT                   Chlorobium tepidum TLS hypothetical protein ct0907
FT                   SWALL:AAM72142 (EMBL:AE012856) (252 aa) fasta scores: E():
FT                   0.00094, 29.48% id in 234 aa"
FT                   /db_xref="InterPro:IPR025503"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIA5"
FT                   /protein_id="CAE31408.1"
FT                   /translation="MSALIAYPKQAAFGRVLPKNKIYEHGGANTRLKDLFVKQVEQVIW
FT                   QYKLAPETLHVPARPGVPEIQIFSIQLKTPELHADVLRCIDGAIPFPIVFELTFDGRTQ
FT                   MVAAYKRPNEADASRCVLSGYFASDWLPMDSERTAMPVALHLGGLYEQLLHRLIPLSAR
FT                   PQETLAELVARVEQAQAKQRELDKTTARLAKEKQFNRKVEINAELRKLRTELNGLK"
FT   CDS_pept        277608..278603
FT                   /transl_table=11
FT                   /locus_tag="BB0910"
FT                   /product="putative ATPase"
FT                   /note="Similar to Rhizobium sp. hypothetical 37.6 kDa
FT                   aaa-family ATPase Y4kL y4kL SWALL:Y4KL_RHISN (SWALL:P55530)
FT                   (330 aa) fasta scores: E(): 1.8e-38, 41.41% id in 326 aa,
FT                   and to Salmonella enterica subsp. enterica serovar
FT                   Typhimurium putative ATPase s026 SWALL:Q9ADT7
FT                   (EMBL:AF261825) (329 aa) fasta scores: E(): 2.2e-28, 34.46%
FT                   id in 325 aa"
FT                   /db_xref="GOA:A0A0H3LID9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LID9"
FT                   /protein_id="CAE31409.1"
FT                   /translation="MATAKLLRQLIKTGTEGNQDAFKRVSEQLIHEERTKNHHLLANDL
FT                   ERILYGRRNAGGGANSLLSDRIPKDKERNLPLLQIKEAVRRMEDVVLSDENASLLNELL
FT                   QEHHRAEALQSYGLYPADRLLFCGPPGCGKTLTAEVLASELGLPLAIVRIDSVVSSLLG
FT                   ETAANLRQVFDFIATVPMVVLFDEFDALAKERADTAEHGELKRVVNAFLQMLDAYEGKS
FT                   ILVAATNHERILDAAIWRRFDEVLVFESPNLEQLRRLLSIKLRGLRREFEIEDARITSL
FT                   FKGMSHADVERVLRRAAKDMVLTGKEFLSERHLQSSIRREDARRARIQGS"
FT   misc_feature    277974..278516
FT                   /note="HMMPfam hit to PF00004, DE ATPase family associated
FT                   with various cellular activities (AAA), score 1e-42"
FT   misc_feature    277989..278012
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        278610..280964
FT                   /transl_table=11
FT                   /locus_tag="BB0911"
FT                   /product="putative serine protease"
FT                   /note="Similar to Rhizobium etli hypothetical protein yp094
FT                   SWALL:AAM55046 (EMBL:U80928) (823 aa) fasta scores: E():
FT                   1.7e-08, 24.12% id in 858 aa, and to Agrobacterium
FT                   tumefaciens hypothetical protein atu6083 atu6083 or
FT                   agr_pti_160 SWALL:Q8U652 (EMBL:AE009427) (836 aa) fasta
FT                   scores: E(): 3e-08, 25.19% id in 647 aa"
FT                   /db_xref="GOA:A0A0H3LNA1"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR034074"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNA1"
FT                   /protein_id="CAE31410.1"
FT                   /translation="MEENFPHLNIQREAPVNEKRSGNPPKPFIPDDIPAHGRGLLTKLG
FT                   NAKEEANEDVGGFDERRLFRFTVQKGFNPDDLRKISTEIEFVSQEDETIVIGFATNAAL
FT                   AQFEARLSSMAAGEHVTNKEVIYALQSVDGWSSENRKGWALKQQGFPDRDEFMLDVELW
FT                   PLEDSHQARQQAWQAFEGWLAEQRIEKLDQIKKPELTLYRVRCTAAQAGMLLQHRDVRS
FT                   IDLPPNFALERSVVFQDIQKIPDIQAPSAQAPGVVVLDSGIADGHPLLKVAVGEAKSFL
FT                   PGEGPHDENGHGTHVAGLALYGDFEKHLRAGTFVPTLRLYSGRILDKNNENTTGFVENQ
FT                   IEEAVRYFVREHGCKVFNLSFGDANKPYLGGHLKGLSVTLDTLSRELGVLFVVSSGNHR
FT                   INERSPDGLEWRDQYPTYLSNDDWRLIEPAPALNALTVGSLARHNQTFNSQYHSADPAE
FT                   LPIAQPDQPSPFTRSGHSVDGAIKPELTAYGGNWAINTRANYALLDRTAGLGVVSTNYQ
FT                   FAGGHPFMVDVGTSMAAPQVAHLAASVLHEHPDATANFVRAQLCLNAVLPQASQQLLDQ
FT                   HKALKRACGYGQVDETALHRSLENAVTLITDGKIENKRHHFYEIPVPPEFTSGGKKRLR
FT                   EIAVALAYTPPVRSTRIKYRATRIDFRLVAARDLEHVTTMFNKATRKEDYQSIKELAGA
FT                   SIGQVARSKGTVQADFWWFIQFQKDSALRTKKLFVVVTRNDFPWGENLCDSEESYSLLV
FT                   SLRDKENLLAQLYTQIKARLDARVPPLRVRA"
FT   misc_feature    279315..280385
FT                   /note="HMMPfam hit to PF00082, DE Subtilase family, score
FT                   3.1e-06"
FT   misc_feature    279375..279410
FT                   /note="PS00136 Serine proteases, subtilase family, aspartic
FT                   acid active site."
FT   CDS_pept        281028..282869
FT                   /transl_table=11
FT                   /locus_tag="BB0912"
FT                   /product="type III restriction-modification system
FT                   methyltransferase"
FT                   /EC_number="2.1.1.72"
FT                   /note="Similar to Moraxella catarrhalis type III
FT                   restriction-modification system methyltransferase Mod
FT                   SWALL:Q93LB8 (EMBL:AY049056) (636 aa) fasta scores: E():
FT                   2e-74, 37.9% id in 612 aa, and to Pasteurella multocida
FT                   hypothetical protein Pm0698 pm0698 SWALL:Q9CMV6
FT                   (EMBL:AE006106) (636 aa) fasta scores: E(): 9.5e-69, 50.31%
FT                   id in 644 aa"
FT                   /db_xref="GOA:A0A0H3LJK0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJK0"
FT                   /protein_id="CAE31411.1"
FT                   /translation="MHSPNLTEDNIARIRDLFPGCVTEARGEDGCVKLAVDFDQLRQEL
FT                   SSSIVEGPQERYHLNWPGKREALLTANAPIAKTLRPVREESVDFDTTKNLFIEGDNLDA
FT                   LKLLQETYLGKVKMIYIDPPYNTGNDFIYEDDFAEDARTFLVRSNQVDDSGVRLVANTD
FT                   TNGRFHSDWLSMLYPRIKLARTLLSEDGVIFVSADDSEIANLIRICDEIFGEANFVANF
FT                   IWEKRTNRENRKVVSSRHDYVVCYARNQMPGTRTLKQLPMSAKALANYKNPDNDPRGLW
FT                   KSDPAHAQAGHGTKDQFYVLTAPNGKKHELESGRCWLYTEKVMNKEIADGKIWFGKDGN
FT                   GVPRIKTYLDAKERGLTPESILFAEEVGTNESAKNLLKELFSGRAVFDTPKPVGLIQTL
FT                   IQLSCDEGIILDFFAGSGTTAEAIFELNTMDGRERRFILVQLPEALTADSEAYKAGYRD
FT                   IAHVGMERIRLAGKSFKGDTGFRVLKIDTSNMADVYYSPDALDKANLDLFVDNIKSDRT
FT                   AEDLLFQVMLDWGVDLALPIEKKATQGKDVFFVDGNALVACFDAHGGVDETFVKELATH
FT                   KPLRVVFRDAGFKDSAVKINVEQIFKLLSPSTEVKSI"
FT   misc_feature    281382..281402
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT   misc_feature    281574..282428
FT                   /note="HMMPfam hit to PF01555, DE DNA methylase, score
FT                   3.2e-13"
FT   CDS_pept        282880..285966
FT                   /transl_table=11
FT                   /locus_tag="BB0913"
FT                   /product="type III restriction enzyme"
FT                   /EC_number="3.1.21.5"
FT                   /note="Similar to Salmonella typhimurium type III
FT                   restriction-modification system stylti enzyme res res or
FT                   stm0358 SWALL:T3RE_SALTY (SWALL:P40815) (990 aa) fasta
FT                   scores: E(): 1.2e-21, 26.35% id in 1017 aa, and to
FT                   Pasteurella multocida hypothetical protein Pm0699 pm0699
FT                   SWALL:Q9CMV5 (EMBL:AE006106) (1043 aa) fasta scores: E():
FT                   2.4e-134, 52.32% id in 1055 aa"
FT                   /db_xref="GOA:A0A0H3LRK7"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRK7"
FT                   /protein_id="CAE31412.1"
FT                   /translation="MKLKFKTQAYQTAAVQAVVDCFKGQVPHHGGIRYRLDPGSQKVAP
FT                   ESPQAALALEAASPEAAAEKEAAFRNADFTLSETALLDNIQAVQRGQNLPLSDTLVKTK
FT                   VAKVNLDIEMETGTGKTYCYIKTIFELNKLYGWSKFIIVVPSVAIREGVAKSLEITAEH
FT                   FLETYRKKARFFIYNSKQLHHLESFSSDAGINVMVINVQAFASRGAENRRIYDVLDDFQ
FT                   SRRPIDVISANRPIMILDEPQKMEGAATLKSLEAFKALMVLRYSATHKTTHNKIHRLDA
FT                   LDAYNQKLVKKIAVRGIAVKGLAGTAGYLYLQSIEISSKKPPEARIELEHKLANGDIKR
FT                   VVRKLGKGDNLFDLSGGLDQYRNYVVTDINANTDTLSFTNGVELTVGDATGDVTEAALR
FT                   RIQIREAIKAHFDKEQALFQQGVKVLTLFFIDEVAKYRDYTQADEKGEYARIFEEEYTQ
FT                   YLNEMLDLDETAYVKYLKGIPVDKTHSGYFSIDKKTKRLADPTVAARGENAGLSDDVDA
FT                   YDLILKDKERLLSLAEPVRFIFSHSALREGWDNPNVFVICALKHSDNTISRRQEVGRGL
FT                   RLSVNQTGDRMDHPATVHEVNVLTVVASESYKDFVAALQKDISDSLSERPRVANEEYFT
FT                   GKVLKTATGDVPVTPQLAKQIYRYLVKNDYTDDSDRIAGAYHDAKKAGTLADLPDELKP
FT                   HAAQVYQLIDSVFSASQLPDIGDDRKPKKNPLNANFDKQEFKALWNRINRKAAYSVDFD
FT                   SDELVQKAVKEMDAALRVTPLQYTIQAGEQIDQVTGEALKRGDGFKVAETQTEYNKQSI
FT                   HSAVKYDLIGKLAEGTQLTRRTVAEILKGINLAVFAQFKTNPESFVAEATRLINEQKAT
FT                   VIIEHLAYDPVEDKFDLDIFTAGQTKQDFSKADDKLQRHIYDYVLTDSKVEREFVKELD
FT                   TANEVVVYAKLPRGFLIPTPVGDYNPDWAISFKEGAVKHIYFVAETKGSMSSMDLREIE
FT                   KTKIKCARKFFDEMNRRYAPENVKYDVVDSFGKLMEVVK"
FT   misc_feature    284926..284991
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1076.000, SD 2.85 at aa 683-704, sequence
FT                   GTLADLPDELKPHAAQVYQLID"
FT   CDS_pept        complement(286130..286843)
FT                   /transl_table=11
FT                   /locus_tag="BB0914"
FT                   /product="putative integrase"
FT                   /note="Similar to Salmonella enterica subsp. enterica
FT                   serovar Typhimurium putative integrase s020 SWALL:Q9ADU1
FT                   (EMBL:AF261825) (321 aa) fasta scores: E(): 1.4e-05, 29.43%
FT                   id in 214 aa, and to Francisella novicida hypothetical 33.7
FT                   kDa protein SWALL:Q9Z5W6 (EMBL:AF121418) (292 aa) fasta
FT                   scores: E(): 1.2e-31, 41.94% id in 236 aa"
FT                   /db_xref="GOA:A0A0H3LIA9"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR024456"
FT                   /db_xref="InterPro:IPR024457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIA9"
FT                   /protein_id="CAE31413.1"
FT                   /translation="MDDLTYTLRQLCQRNRDGSHNTQADRMRSLALTARQLREAGFRQM
FT                   KDSSLKGKHVQALLERWQGEGLSSGTIKNRLSHLRWWAEKIGTAGILPADNTQLGVAER
FT                   RYVTNISKARELGASLEQVTDVHVRVNLQLQAAFGLRREEAIKFQPCYADRGDHIALKG
FT                   SWTKGGRKRTVPITTVEQRDMLQAAHRQAATGSLIPPHKTYIQQRHVYDGQCKAAGLNH
FT                   THGLRHQYAQAAMRL"
FT   CDS_pept        complement(287463..288647)
FT                   /transl_table=11
FT                   /locus_tag="BB0915"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Xanthomonas axonopodis hypothetical
FT                   protein Xac2208 xac2208 SWALL:AAM37061 (EMBL:AE011858) (407
FT                   aa) fasta scores: E(): 8.9e-15, 33.06% id in 366 aa, and to
FT                   Xylella fastidiosa hypothetical protein Xf1781 xf1781
FT                   SWALL:Q9PCJ8 (EMBL:AE004000) (418 aa) fasta scores: E():
FT                   5.3e-14, 32.59% id in 359 aa"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIE2"
FT                   /protein_id="CAE31414.1"
FT                   /translation="MQGNGPLWLRPWRTLMADHHTRHNSLGQDALFTTPASLMLDARLT
FT                   PLERNGWQVLRMLRSAEGISPLANLGQLRRYLTSTPLGQRAGYETARRVLIVLRLTGWI
FT                   SLVGQHRDPLTGHVLSELYQVHESALHFQQACALDASLPALLQGSIGNENNQVDRVAVH
FT                   IQATLAQAPEAASIATHDQRHDDDDLPPTPPSQASEAADPLPLFDDSAGTTLVPQQTGH
FT                   ARHMTAEQGSTYKTYMYKKERTYRAREGNGDPASQSVSLPPCLSNAQADQQKDVQAALR
FT                   RLPPQHRQEVLDELQARSQSGTVRNLVAYFFALVKRVFAGEFRLWAGRKETSAAPRAAE
FT                   NRPAGAPRTEDPPVPTAQPASRETALAHIAHIRKMLNASTNAGDIAAQAMQTRG"
FT   CDS_pept        complement(288989..293206)
FT                   /transl_table=11
FT                   /locus_tag="BB0916"
FT                   /product="autotransporter"
FT                   /db_xref="GOA:A0A0H3LNA4"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNA4"
FT                   /protein_id="CAE31415.1"
FT                   /translation="MSIRNGGTAEIHDAARAEHLILGLGTLPSEIGHLIVRSAGSLTVG
FT                   NQTSIGNDRGSSAISTLTIDGGTVTGGYGNFRVWHNGAVLLRGGGTLRTGTQGLALDGG
FT                   RLEIGNAPGTLDSPYVWATPDDNVTGQLIFNHSAGDYEFAPAILQNVAVVHAGVGATTL
FT                   VGENTYTGGTTLDAGVLGISANANLGNPNGALVFNGGTLRTTGFITMNRATALGAGNGA
FT                   FDVASGASLTQQGIVSGSGALTKTGPGSLTLSGVNTYAGGTVIEAGTLRIAQSGNLGTG
FT                   PLTLNGGTLEATAPLTLYADTWIDGGGTISTTSSLTLEGSINGRAGVKISSGPTGTVIL
FT                   NGAHNALPTAFVTGQSTLQVNGTLEAIIDIGGASRLSGSGTVGNTSIQHGSTLSPGQSS
FT                   IGTLTVNGDLTLHDGSILDYQLGGPGTSSDPASGIGSRVNVTGNLTLNGALNLRSSSDT
FT                   AQDGVPGLGYYRLMTYGGTLSGTGLSIGSTPVFSDPAHFEIQAGGGNVDLFIAALGHDT
FT                   LQHWQGGDGAWNSANAQWLNRNGEVAAGWAGNQAVFKNQPGGFGGGTITVAGMQQFKGL
FT                   QFVDDGYRLEGSGQLVIDGSERGDGNAEIRVLANSAEIATEITGSGGITKTDAGTLVLS
FT                   GNNSYQGSTHILSGAVSIASDRNLGATGAGILLSGGTLATTADMAIGRNITLAGNGGFD
FT                   VAAGTTLAATGPIGGTGALVKTGAGTLRLAGANLYAGGTRVRQGVLIGDTASIRGNIAN
FT                   DGEVAFQQATDGVFAGDISGSGLMRKLGAGSLALAGRNTQDWAVDTGPLRSAGSRFAGD
FT                   VAIGANGIFVLDDAQAAAYAGTLSGTGRFHKQGAGSLLLTGDSASFTGHATVSAGTLRV
FT                   GDRHGGGVLGGSLDVQAGATLGGSGTVGSGAGSQVTVASGGTLAPGNSVGTLTVNGDLV
FT                   LDKGSRFEVEVDPQGTRSDQVAVTGNTTIQGGAVAHVGATGQYQLRSTYTLLTTGGALS
FT                   GRFDTVSSDFAFLTPELRYDYGAGTVGLALARNDRSFASMALTDNQYATAQGIDSIGVA
FT                   AGHAVYDAVAQLPDDAPLVRASLDALSGEIHASAKTALIEDSRFVRDAAKDRVRAAFAA
FT                   PGASTAAVSARAADGAPTAVAATHDGPAAWSQAFGSWGSTDSDGNAARLERNVGGVLIG
FT                   ADRLMGNWRVGALAGYSQTDAKARDRASSGRSDNYHLGLYGGTQSGALGVRTGLAYSWH
FT                   DIRTRRSVDIPGLSDSLRADYGGGTFQAFGELGYGIELNDTTRLEPFASLAYVRLHTDG
FT                   YRESGGAAALTTGSANTETTFSTLGLRAEHALGSGAAQGTVRATAGWRHAMGDTTPQAR
FT                   HAFSAGDAFTVAGAPIAQDSAVIELGVDLAVARNTRFGLSYAGQIAGSAQDHGVRADLS
FT                   IRF"
FT   misc_feature    complement(288995..289849)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF03797, DE Autotransporter
FT                   beta-domain, score 8e-46"
FT   CDS_pept        293782..295353
FT                   /transl_table=11
FT                   /locus_tag="BB0917"
FT                   /product="putative regulatory protein"
FT                   /db_xref="GOA:A0A0H3LJK4"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJK4"
FT                   /protein_id="CAE31416.1"
FT                   /translation="MSIPSVRYADLVFQPDLRAATRDDGAKLSLTRQERALILQLTERP
FT                   HQLITRQQLLEGLGDLAGELSERNIDYLVNRLRKRLGDNARTPRFIATQYGEGYIWVAD
FT                   PIAVAPVSAFLLIGPVYGLGENEQAAAVVKRLGGHIGQALHGSRKVLCLPQWRFEPETA
FT                   SHIAHSLEISLWPEDGQLHMALVLKDGRSNTPIRPFRLTVPLAGENAELAAFAQSLADA
FT                   IWAHAALPGGEPPNPTDRPLLLRLHDAAVLVTGDIESWRHNAQRLRAAHADNPDDPALA
FT                   VLLALNRYTELIQGPLSPDTPPLTDVQWRGIEDDIEQLALGALAKARSEPMLLLGIAKV
FT                   LCFIDRGYLKLAATLTEEAFEASTAFAAAFTMKALTLACQGEIDRAVDLYDRAIELAET
FT                   GSQFHIYLLILKGSALLAADRRGEVAQMVAELSALDPASRGWVGLIFLSPKSKRTPPAL
FT                   AMIPKEAGRRMLTYLHRTTARQFERRHHQKNVLHGLAIHLARVHGADVIPSPLREYFPK
FT                   RFADAS"
FT   misc_feature    293857..294075
FT                   /note="HMMPfam hit to PF00486, DE Transcriptional
FT                   regulatory protein, C terminal, score 1.5e-09"
FT   misc_feature    294880..294981
FT                   /note="HMMPfam hit to PF00515, DE TPR Domain, score 0.027"
FT   CDS_pept        complement(295404..296408)
FT                   /transl_table=11
FT                   /locus_tag="BB0918"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRL2"
FT                   /protein_id="CAE31417.1"
FT                   /translation="MYRRILAAAAAAISALLPLHASADSYPSKPISLVVGFAAGGGSDV
FT                   LTRAFAKYLNAEIGVPIVVENRPGADSLLASQAIKNAKPDGYTIYLATSTHAVNPSLFS
FT                   EAKFKVRDDVTPISMIGEAPVAIAIAPMLPTRTLQEFIDYAKAHGGQLNYGTSASNTYL
FT                   ETAYMLRAAGLDMQRIPYKGAAPASVALMSGEIQLLLSTVGHLAPLVQSGKVRALAVTS
FT                   AGRSTLMPDLPTTREAGMPDFMPNLSTANDAGLPNVTSSIWYALLAPPGVPADVVKRLN
FT                   QSTQAVLRNPEFMSQMVTMGVELRPSSPEGLGQFLEAEEAKWQKIVDDIGARQ"
FT   misc_feature    complement(295413..296273)
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 4.6e-62"
FT   misc_feature    complement(296340..296408)
FT                   /note="Signal peptide predicted for BB0918 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.955 between residues 23 and 24"
FT   CDS_pept        complement(296782..297522)
FT                   /transl_table=11
FT                   /locus_tag="BB0919"
FT                   /product="putative TetR-family transcriptional regulator"
FT                   /db_xref="GOA:A0A0H3LIB2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIB2"
FT                   /protein_id="CAE31418.1"
FT                   /translation="MPHSVDDSSLVTRRRAQLVKAAIKLFSRMGYHAATVKDIAQEAGV
FT                   SAGLMYQYVPDKQDLLFLALQHIVQRNKEEVPSALLGVEDPIARLYRAIDAYTRVMAAN
FT                   QQAVLLTYRETKSLKPEYIEQMKQLELDTNRLIEACATDCIRAGYLAPTNVELLVYRII
FT                   IAAHAWPLKHWRLRRIVTLDEYLDQAIHAAWKDLLLPRGSSRYEELRRAGELRPVHLAG
FT                   ESDDGASRAAGTEPKKRARRGRAA"
FT   misc_feature    complement(297331..297471)
FT                   /note="HMMPfam hit to PF00440, DE Bacterial regulatory
FT                   proteins, tetR family, score 7.9e-14"
FT   misc_feature    complement(297343..297435)
FT                   /note="PS01081 Bacterial regulatory proteins, tetR family
FT                   signature."
FT   misc_feature    complement(297358..297423)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1024.000, SD 2.67 at aa 34-55, sequence
FT                   ATVKDIAQEAGVSAGLMYQYVP"
FT   CDS_pept        complement(297749..298696)
FT                   /transl_table=11
FT                   /locus_tag="BB0920"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LIE5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIE5"
FT                   /protein_id="CAE31419.1"
FT                   /translation="MQMDLSKIQFGVDVATSLAILASAITFLINQRLKTRETKRRQLDE
FT                   SVRAVTVDEFQSALGNLSTAYVKEIVRHTVPLQASVSRGLERLEKSLELDPKRANVLMD
FT                   AMANTTQAISDYINAICAYNYQIYPLLDSIEGGESQIQEFRRNLQRLMDSYNNIGRGHE
FT                   SLFKEVRALCDFCAAHPLEQADHEALQRMAMSIVADKDYRQWVDSFVPSGKEEAYWACV
FT                   DKGDFEGEKDLLMRVVSNVIGGFYKAPARMQAQVIYLAYSAIIDARQQCKEFLVGMAAI
FT                   NYWLIRKGGGSESLPDVIQRYRSQAVFAVDSEIR"
FT   misc_feature    complement(298610..298669)
FT                   /note="1 probable transmembrane helix predicted for BB0920
FT                   by TMHMM2.0 at aa 10-29"
FT   CDS_pept        298912..300087
FT                   /transl_table=11
FT                   /locus_tag="BB0921"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A0A0H3LNA6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNA6"
FT                   /protein_id="CAE31420.1"
FT                   /translation="MNRNLWLLSVLQGLFLTNNVTFIAINGLVGFALAPYGWMATLPVM
FT                   GYVVGGALCTGPVAWTQKRYGRKGSFMLGLLVAAGSALLCAFAAYIGNFWLLCAATAIA
FT                   GYYSANGQLYRFASAELAAPGAREKAVSLVMAGGLLGAVVGPNLASFTKELFVTPFLGA
FT                   YLALAVVALLAMAVLARIEFPEVAQRASANGGRPLSVIARQPAFIVATGAGALGYGVMN
FT                   LLMAATPLAMQHHGLPFADAAFVLEWHVIGMFAPGFFTGHLIKRFGVLPIMGWGAALNL
FT                   VCIGVALSGVELHHFTVSLFLLGVGWNFLFTGSTTLSLSTYTAEEKDRAQAAMNFCVFA
FT                   VMAVTSLTSGMLVTTRGWTVLNVGSLVPMLMICVGLAWLAWRKAPSRAAVG"
FT   misc_feature    join(298930..298998,299011..299079,299116..299184,
FT                   299194..299262,299299..299367,299395..299463,
FT                   299524..299592,299620..299688,299707..299775,
FT                   299803..299871,299905..299973,299983..300051)
FT                   /note="12 probable transmembrane helices predicted for
FT                   BB0921 by TMHMM2.0 at aa 7-29, 34-56, 69-91, 95-117,
FT                   130-152, 162-184, 205-227, 237-259, 266-288, 298-320,
FT                   332-354 and 358-380"
FT   CDS_pept        complement(300134..300919)
FT                   /transl_table=11
FT                   /locus_tag="BB0922"
FT                   /product="GntR family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3452"
FT                   /db_xref="GOA:A0A0H3LJK8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJK8"
FT                   /protein_id="CAE31421.1"
FT                   /translation="MRHPRMGAGYTIRSPSWPFLPDRTSMTRQPQSADIEELPLGRTSK
FT                   SLPEQVADRLMQSIQTGVLQPGERLKEETLSDRFAVSRTTVREAISTLERRGVIERVPR
FT                   FGARVREIRADEIEEIFCIRAQLLGLAARRVAEHGDDEILAQLRQQVERLRQLADKPST
FT                   SPASYAKVSIETQQLLIQAVGWKQLGTMYEGLSNQMLWKTSVRGKSLSFQSQQRRRESV
FT                   GDWQRLLEAVCARDAAAAEESAKLLLGASYRAVRGQLAS"
FT   misc_feature    complement(300593..300769)
FT                   /note="HMMPfam hit to PF00392, DE Bacterial regulatory
FT                   proteins, gntR family, score 4.8e-16"
FT   misc_feature    complement(300641..300715)
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT   CDS_pept        complement(300916..302577)
FT                   /transl_table=11
FT                   /locus_tag="BB0923"
FT                   /product="putative acetolactate synthase large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3453"
FT                   /db_xref="GOA:A0A0H3LRL7"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRL7"
FT                   /protein_id="CAE31422.1"
FT                   /translation="MNPTLAARTGGRILVDALKVHGVDQAFCVPGESYLPVLDALRDDA
FT                   QAIRLTVCRQEGGAAFMAEAYGKLTGKPGICFVTRGPGATNASIGVHTAFQDSTPMILF
FT                   VGQVGADVAEREAFQEIDYRRMYGQMAKWVASIDDAQRIPEFVHRAHQVALSGRPGPVV
FT                   LALPEDVLRATAHAADRVPHRIARACATSADMKRLHELLAAARRPLLIVGGGGWNEAAS
FT                   AAITRYAERAGLPVATAFRRQDRFDNRHPCYAGHIGLGIAPSLARHVRQADLLLVVGAR
FT                   LADATTDSYALITPEHPGQTLIHVHPDPQELGRVYPADLPIAADVQAFAAQLDACDNPP
FT                   ARCDAWLRELADDYRTDLAVAPSRRDTDLAQVMHWLNQHLPQNAIVTNGAGNYAGWVHR
FT                   YFQYSPQRRQLAPTNGAMGYGVPAAIAAKLAAPARTVVCFAGDGCFMMNGQELATAIQH
FT                   DAAVVFIVVNNGMFGTIRMHQEMHYPGRVSGTSLRNPDFVALASAYGAHAERVAHHDDF
FT                   PAAFERACASGRAALIEIRTDPAAISARRDLPTLAA"
FT   misc_feature    complement(300973..301494)
FT                   /note="HMMPfam hit to PF02775, DE Thiamine pyrophosphate
FT                   enzyme, C-terminal TPP binding domain, score 2.8e-51"
FT   misc_feature    complement(301246..301305)
FT                   /note="PS00187 Thiamine pyrophosphate enzymes signature."
FT   misc_feature    complement(301528..302007)
FT                   /note="HMMPfam hit to PF00205, DE Thiamine pyrophosphate
FT                   enzyme, central domain, score 1.8e-16"
FT   misc_feature    complement(302041..302562)
FT                   /note="HMMPfam hit to PF02776, DE Thiamine pyrophosphate
FT                   enzyme, N-terminal TPP binding domain, score 5.9e-46"
FT   CDS_pept        complement(302652..303617)
FT                   /transl_table=11
FT                   /locus_tag="BB0924"
FT                   /product="putative lipoprotein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3454"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIB6"
FT                   /protein_id="CAE31423.1"
FT                   /translation="MQRIFEKAALALALVAMPLWAGVACAQQPLRMMVGFPPGGTTDVI
FT                   ARLVAQRLGGELSRSVVVENRAGASGNLAAATVAKADPDGSTLLFAPSSHATNASLYTN
FT                   QSFDTVKSFRAVGMVAVTPYVLVVNPGMQATNLRDFVDYLKRNPGKVEFASASPGTGQH
FT                   LAAELFKDEAGVDIMHVPYKGSAAALPDLIAGRVPMMFDNIAVMLPHIQQGTVRPLAIT
FT                   SKTRSRFLPDTPTMAESGYPDFEVLGWFTLLAPAKTPDATVQAYNDALKKISADPDFVA
FT                   QLAKLGGEAVARTPAQADAYIAEEVDKWGKVIRTAHINLN"
FT   misc_feature    complement(302664..303485)
FT                   /note="HMMPfam hit to PF03401, DE Uncharacterized protein
FT                   family, UPF0065, score 1.2e-107"
FT   misc_feature    complement(303540..303617)
FT                   /note="Signal peptide predicted for BB0924 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.798 between residues 26 and 27"
FT   misc_feature    complement(303543..303575)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT   CDS_pept        complement(303672..304580)
FT                   /transl_table=11
FT                   /locus_tag="BB0925"
FT                   /product="putative taurine dioxygenase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3455"
FT                   /db_xref="GOA:A0A0H3LIF0"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIF0"
FT                   /protein_id="CAE31424.1"
FT                   /translation="MSDITVRPLGYAAGAAVSGIDLRQALQPEQLARLRAAWHEHLVLV
FT                   FPGQDLNAPQLIDFTRHFGDVERNDSVPYYRDPDYPEVLLVTNKPRDGKPSQTRNTGRN
FT                   WHSDLSYTDRPAKGSVLMCKEKPPVGGDTMFANMYQAYESLSAPFKRFVDGLHAVHDIS
FT                   LIKGFDRRDPEQTAALKRRNPPIAHPVVRIHPETGRKCLFVSDRVRTFVGMTEEESRPI
FT                   LDFLNRHATSPEFVYRHRWSVNDIVMWDNRCTLHIALPDFDQSKPRHMMRCSMLGEPSG
FT                   YVIEDAPLDEQAARSAIAAVS"
FT   misc_feature    complement(303726..304571)
FT                   /note="HMMPfam hit to PF02668, DE Taurine catabolism
FT                   dioxygenase TauD, TfdA family, score 3.4e-57"
FT   CDS_pept        complement(304887..307175)
FT                   /transl_table=11
FT                   /gene="maeB"
FT                   /locus_tag="BB0926"
FT                   /product="NADP-dependent malic enzyme"
FT                   /EC_number="1.1.1.40"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3456"
FT                   /db_xref="GOA:A0A0H3LNA8"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNA8"
FT                   /protein_id="CAE31425.1"
FT                   /translation="MKDTDRQAALDYHAYPHPGKISVTATKPLVTQRDLSLAYSPGVAA
FT                   ACEEIVEDPANVFRYTGRGNLVGVITNGTAVLGLGNIGALASKPVMEGKAVLFKKFAGL
FT                   DVFDIEINETDPDKLVEIIAGLEATFGGINLEDIKAPECFTVERKLRERMKIPVFHDDQ
FT                   HGTAITVCAAVVNGLAVAGKRIEDVKLVTSGAGAAALACLDLLVDLGLPLEHIWVTDIE
FT                   GVVYEGRKKLMDADKERFARKTKARTLAEVIEGADVFLGLSAGNVLKPEMVATMAANPL
FT                   ILALANPNPEILPEAAHAVRDDIIMATGRSDYPNQVNNVLCFPYIFRGALDVGATTITR
FT                   EMEKAAVLAIANLAREEQNEVVAAAYGTYDISFGRDYLIPKPFDPRLIVRIAPAVAKAA
FT                   MEGGVATRPIADLDAYAEQLQQFVYHSGAFMKPLFSQAKQIVRDGGRARIVFTEGEDER
FT                   VLRAVQVIVDEKVAKPILVGRPQVLLSRIEKFGLRLRLGQDVEVCNPEYDERFHQYWTT
FT                   YWDMMCRNGITKEMARVEMRRRLTLIGAMMVHLGDADGMICGAVSGFHDHLRFIDQVIG
FT                   RKPGATTYAAMNILLLDERTVALVDTHVNEDPSAEQIAEYTVAAAEEMQRLGLAPKVAL
FT                   LSRSNFGSGSSASGAKMRHALELVNRQAPGLEIDGEMHGDCALDESLRLRLLPDSPLKG
FT                   SANLLVCPNVDSGNIAYNLLKTVAGKNVAVGPILLGANAPVHIVTSSATVRRIINMAAL
FT                   CVLDANRPQ"
FT   misc_feature    complement(304911..305894)
FT                   /note="HMMPfam hit to PF01515, DE Phosphate acetyl/butaryl
FT                   transferase, score 4.7e-104"
FT   misc_feature    complement(305976..306689)
FT                   /note="HMMPfam hit to PF03949, DE Malic enzyme, NAD binding
FT                   domain, score 1e-115"
FT   misc_feature    complement(306693..307124)
FT                   /note="HMMPfam hit to PF00390, DE Malic enzyme, N-terminal
FT                   domain, score 1.3e-73"
FT   CDS_pept        307293..308288
FT                   /transl_table=11
FT                   /locus_tag="BB0927"
FT                   /product="LysR family regulatory protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3457"
FT                   /db_xref="GOA:A0A0H3LJL4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJL4"
FT                   /protein_id="CAE31426.1"
FT                   /translation="MILLRSVPMTGSPSVDAAEIVRRLTSRLKMRHLQLLLHVRQLGSL
FT                   TRVAQQLSTSQPAVTNALAELEDMFGAPLFQRTARGMTPTPLGLVVLARAEAIIHDLRH
FT                   LVDDMGASASGYTARLHLGVTPFVSSRLIAAAIGRAQRADHRLAASVHDGISGKLLAGL
FT                   RDHSLDVVVARAGPALDVEGIVFEPLYVQQPRLIASRRLAARLARRALDWSALAELDWI
FT                   LGVPQTAMRDQVASLFMQAGIRPPAATTECHSAKLIGELIAASDRALSIVPADIADELV
FT                   SVAGVAIVPFSFTWHLPPIAVFMRHESQGSAPHRLFAEALREECRHARAG"
FT   misc_feature    307380..307559
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 2.9e-20"
FT   misc_feature    307419..307484
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1636.000, SD 4.76 at aa 43-64, sequence
FT                   GSLTRVAQQLSTSQPAVTNALA"
FT   misc_feature    307422..307514
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT   misc_feature    307629..308270
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 2.1e-19"
FT   CDS_pept        308540..309481
FT                   /transl_table=11
FT                   /locus_tag="BB0928"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3458"
FT                   /db_xref="GOA:A0A0H3LRM2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRM2"
FT                   /protein_id="CAE31427.1"
FT                   /translation="MLSYTLRRLLMTLPVMLFVALFVFGLLDLAPGDPAALLAGEDATP
FT                   QDIARIRATLGLDQPFLQRFAEWGWNVLHGDLGTSLFTGLPVSHMIGQRLVPTFSLMLM
FT                   TLLVSVVIAIPIGALAAWKHNRLQDRGIMVLAVFSFSVPSFAVGYLLAWIFGLQLRWFP
FT                   VQGYVPLATGFWASVHTLVLPALALGSVYVALITRITRATLLETLSQDYIRTARAKGVG
FT                   NRGLLFRHALKNAAVPIITVIGSGVALLISGTVVTETVFSIPGLGRLVVDAILRRDYPV
FT                   IQGVILLFSFMYVLVNLLVDLLYRAFDPRIKY"
FT   misc_feature    308540..308656
FT                   /note="Signal peptide predicted for BB0928 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.977) with cleavage site
FT                   probability 0.590 between residues 39 and 40"
FT   misc_feature    join(308564..308632,308834..308902,308939..309007,
FT                   309050..309118,309254..309322,309380..309448)
FT                   /note="6 probable transmembrane helices predicted for
FT                   BB0928 by TMHMM2.0 at aa 9-31, 99-121, 134-156, 171-193,
FT                   239-261 and 281-303"
FT   misc_feature    309149..309364
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport systems inner membrane component, score 1.2e-06"
FT   misc_feature    309152..309238
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        309481..310314
FT                   /transl_table=11
FT                   /locus_tag="BB0929"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3459"
FT                   /db_xref="GOA:A0A0H3LIC1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIC1"
FT                   /protein_id="CAE31428.1"
FT                   /translation="MSNIAGFLKRHPTTAVGGGLLLLLFLMAVCAPWLGTVDPTALSPI
FT                   HRTRAPSEQFWFGTDLLGRDVYSRVIYGARVSLIVGFTVAALSTVIGVVIGLAAGFVRW
FT                   VDAVVMRIMDGFMSIPTILLAIALIALTRASLQNVIIAITIAEVPRVVRLVRGLVLSLR
FT                   EQPYVEAAVAAGASRLRIVARHIFPNTLAALMVQATYICGVAILAEASLSFIGAGVPPS
FT                   VPSWGNIMAEGRALWQIKPHLIAFPAVFLSITILAINMLGDGLRDAVDPRMAKRI"
FT   misc_feature    309481..309573
FT                   /note="Signal peptide predicted for BB0929 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.747) with cleavage site
FT                   probability 0.319 between residues 31 and 32"
FT   misc_feature    join(309523..309591,309709..309777,309805..309873,
FT                   310036..310104,310207..310275)
FT                   /note="5 probable transmembrane helices predicted for
FT                   BB0929 by TMHMM2.0 at aa 15-37, 77-99, 109-131, 186-208 and
FT                   243-265"
FT   misc_feature    309955..310185
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport systems inner membrane component, score 2.3e-08"
FT   misc_feature    309958..310044
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT   CDS_pept        310318..312168
FT                   /transl_table=11
FT                   /locus_tag="BB0930"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3460"
FT                   /db_xref="GOA:A0A0H3LIF6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIF6"
FT                   /protein_id="CAE31429.1"
FT                   /translation="MTTTTTQSRRVLELENLSIAFGRGVHTFHAVKSLSLHVDRGETLA
FT                   IVGESGSGKSVTSLAVMRLVEFGGGRIESGRMTFYRGAGEAVDLAAASEDSMRAMRGND
FT                   LGMIFQEPMTSLNPVFTVGAQIVEAIRLHQACDARAAQAAAKRILDQVRIPDSASILGR
FT                   YPHELSGGMRQRVMIAMALSCKPALLIADEPTTALDVTIQAQILQLIRELQREMDMGVI
FT                   FITHDMGVVAEVADRVLVMRKGDVVENNDVHGLFNAPSHPYTKALMAAVPRLGAMQGTT
FT                   APARFALLSDAQARHEAEPPAVAPSDKVVLRVRDLVTRFDVRGGIFARVKKRVHAVEQV
FT                   SFDLHAGETLSLVGESGCGKTSTGRSLLRLAKTTRGQIEFDGKPVRQEDPASLRALRRN
FT                   MQFVFQDPFASLNPRMRVGDCVKEPMLIHNLYSGAQADRRAAELFERVGLDAAMMQRWP
FT                   HEFSGGQRQRICIARALSVDPKVLIADESVSALDVSIQAQIVNLLIDLQRDLGVSYLFI
FT                   SHDMAVVERISHRVAVMYLGQIVEIGPRQAIFENPQHPYTKKLMQAVPIADPGARRSIT
FT                   LELSELPSPARPVGDEPVVKPLEQAGPGHFVARHRIGGAY"
FT   misc_feature    310438..311049
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   1.3e-52"
FT   misc_feature    310459..310482
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    310819..310863
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    311356..311928
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   7e-58"
FT   misc_feature    311377..311400
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   misc_feature    311698..311742
FT                   /note="PS00211 ABC transporters family signature."
FT   CDS_pept        312237..313829
FT                   /transl_table=11
FT                   /locus_tag="BB0931"
FT                   /product="bacterial extracellular solute-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3461"
FT                   /db_xref="GOA:A0A0H3LNB1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNB1"
FT                   /protein_id="CAE31430.1"
FT                   /translation="MDRRSFLLASSATAAAWALPGMSWAAPGKSAFRWVPQADLALLDP
FT                   MFTTVAMTQVHAQLVFDTLFGLDSQYLPSPQMAAGHTSENDGLLWKITLRDGLAFHDGS
FT                   PVRAQDAVASIKRWSKRDLMGRSLMQATESLTALDDKTIQFKLSKPFPLILHALGRQSG
FT                   NMACIMPERLASQPETEAVKEMVGSGPFTFAAAKWVSGSRVVYEKFAGYVPRKDDRKPD
FT                   FAAGPKIAHVDEVHWHIIPDRATAIAALQANEVDGVEMVDSDFLPILTQDPNIKLVKRS
FT                   LPTIGVMRFNHLHAPFNNVEIRRAVLSVVNQTEYMTAMNGADFPEYWSDRCGVFVPGSP
FT                   MDSDAGMEKLTGKRDIEKARAAIKAAGYNGEKVVLLDPVDFPTWHAAALVTADLFKRLG
FT                   FNVDLQTMDWGTAVQRRNNQEPVSAGGWSVAFTGNTGPNNLDPAGHLPMRGNGKQAWFG
FT                   WPTSERLEQLRIDWFNAPDLDAQKKICREIQLQVFEDVPYIPLGATYPVSALRSEWKDF
FT                   QPQMSLFYTLHKA"
FT   misc_feature    312237..312311
FT                   /note="Signal peptide predicted for BB0931 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.994 between residues 25 and 26"
FT   misc_feature    312246..313823
FT                   /note="HMMPfam hit to PF00496, DE Bacterial extracellular
FT                   solute-binding proteins, family 5, score 4.3e-15"
FT   CDS_pept        313848..315386
FT                   /transl_table=11
FT                   /locus_tag="BB0932"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3462"
FT                   /db_xref="GOA:A0A0H3LJL9"
FT                   /db_xref="InterPro:IPR009197"
FT                   /db_xref="InterPro:IPR010799"
FT                   /db_xref="InterPro:IPR015995"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJL9"
FT                   /protein_id="CAE31431.1"
FT                   /translation="MSSNAPKVAILGFHLESNAFSPLSVEADFLAQCWEQGEDITRLAR
FT                   GASRLPSEVPGFYARMDELGAWTPAPLIVIGAPPGGPASAGVWRRFLAEAETRLRAALP
FT                   VDAVYVANHGASSAEGQDDTEGELMGRLRAIVGPGVPIVASHDLHCNVSEQTVQALDGL
FT                   ISYRTNPHVDQRERAADAADMIHEILGGTRMVSAYVRLPLTPPSVTLLTSSGPYADLVA
FT                   LGASLIQKPDEGPIANVSVCSGFVFSDLPKCGLTITVTARGDLQAARRAALRIARAGWA
FT                   DRKRYVANTVEVARAVELARAAGQPLLFADVADNPGGGGGGNTAWLLRAFHEARIPGVV
FT                   LGVFVDPELAAQAAQLGEGAEFDAVFNRIETDYARRYQARARVLRLTDGEGMGRRGILR
FT                   GRKFSLGASCLLELVDSGMRVVVGSLRRQLAEPAMLEMHGIDIARAGHVVVKSRGHYRA
FT                   GFDEFFPDDRIHDVDSLGLTTPNLKQIAFKRLPRPVWPLDDAAAWQEPDWAEGL"
FT   CDS_pept        complement(315480..316421)
FT                   /transl_table=11
FT                   /locus_tag="BB0933"
FT                   /product="LysR family regulatory protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3463"
FT                   /db_xref="GOA:A0A0H3LRM4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRM4"
FT                   /protein_id="CAE31432.1"
FT                   /translation="MLNTALRYFLEVVDAGSLTLAAQKLHVAPSAVSRMVRKLEDEHQA
FT                   QLFERHARGMVLTEAGQLLKAYARRASLDAERARAEIRELSQIGQKLIRVSANQAFGRE
FT                   LLPRVIGEFREIEPTVRFELNILQSSEINRRVREGEDDIGLSYNLAPPQDVHVQYARRM
FT                   PLFAVMAPQHPLAGRDMLSMQDIGDYPVVLMGPGSTNRFFIDLCCMHEKIELNIAMTCN
FT                   NQGAIQTCCQQWGAISFSGDLTVMTPTERGELVSIPMANSELHQRIMHIQTMAGRQLPA
FT                   SVGRFVQALASRIDASYADPAWLAAGRGSGAL"
FT   misc_feature    complement(315537..316166)
FT                   /note="HMMPfam hit to PF03466, DE LysR substrate binding
FT                   domain, score 1.2e-31"
FT   misc_feature    complement(316236..316415)
FT                   /note="HMMPfam hit to PF00126, DE Bacterial regulatory
FT                   helix-turn-helix protein, lysR family, score 3.3e-23"
FT   misc_feature    complement(316311..316376)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1700.000, SD 4.98 at aa 16-37, sequence
FT                   GSLTLAAQKLHVAPSAVSRMVR"
FT   CDS_pept        316491..317330
FT                   /transl_table=11
FT                   /locus_tag="BB0934"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3464"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIC5"
FT                   /protein_id="CAE31433.1"
FT                   /translation="MIAPPLARHARVCRWPRRAISIYIRMIKKRYLATAVVALAVAVAA
FT                   ALYARQDEPEHFDEVVLQCLDDQAMSTVRRTGSVDGILPACQPELAEVLGEDFGAVDEP
FT                   TLRAVLATVAAANFAEYGSSSAVAYEAIEKSQHLNCGNLVFLMGYLYGGLKEKGIRPIG
FT                   VDGGAVGNHAQIMYKSGNNRLLLDPTTGVVAAITFNKLMSGQPVPEEQVRVFRVKAKTI
FT                   DSFRDRVYRAVVGGGYLPSDLMYMHESLWELKTKGSSSVYFTPGGITVRKKLAQAAG"
FT   misc_feature    316491..316637
FT                   /note="Signal peptide predicted for BB0934 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.495 between residues 49 and 50"
FT   misc_feature    316581..316634
FT                   /note="1 probable transmembrane helix predicted for BB0934
FT                   by TMHMM2.0 at aa 31-48"
FT   CDS_pept        complement(317392..317898)
FT                   /transl_table=11
FT                   /locus_tag="BB0935"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3465"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIF9"
FT                   /protein_id="CAE31434.1"
FT                   /translation="MTRQHSTQPDPKLDLVLERTIDVPPALVWQAWTQPEHIKHWLTPA
FT                   PWQTVRCDVDLRPGGRFRFVMRSPEGEEHTHDCCYLEIVEGSRLVWTNALLPGFRPAGG
FT                   GGDVPAFTAVIRIEPHDQGTRYTATAMHGTQAGCRQHSDMGFHDGWGAALDQLVAHARN
FT                   MQQAS"
FT   CDS_pept        complement(317895..318233)
FT                   /transl_table=11
FT                   /locus_tag="BB0936"
FT                   /product="putative ArsR family transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3466"
FT                   /db_xref="GOA:A0A0H3LNB6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNB6"
FT                   /protein_id="CAE31435.1"
FT                   /translation="MPNQAAQLSQVFQALSDPTRRAVLERLCQGSAAMSELARPFNMAL
FT                   PSFSQHLDVLERCGLVRSRKSGRVRIYTLAPQPLGMAEHWMTRQRAIWERRLDQLDLYL
FT                   QDLKEQKR"
FT   misc_feature    complement(317955..318200)
FT                   /note="HMMPfam hit to PF01022, DE Bacterial regulatory
FT                   protein, arsR family, score 1.1e-11"
FT   CDS_pept        318671..321190
FT                   /transl_table=11
FT                   /locus_tag="BB0937"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3467"
FT                   /db_xref="GOA:A0A0H3LJM4"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJM4"
FT                   /protein_id="CAE31436.1"
FT                   /translation="MKTWFKRIVIGLVVLVVVAVVGLAIFLLTFDPNAYKYKLEEAVQA
FT                   RYERTLNIEGEIELSLFPRIGLAVQGVSLSEPNSPDVFASIDSMRLAVAVWPLLSNSLV
FT                   VDHVTINGFKARVIRGKDGHFNFENLVGGSVQSTDVPGNAAEATAGAITGTAQAIVNGT
FT                   VSTPKSMQIDIAGLDLKDGEIQLQDAMSGMAVAITKLNAATGRVTYNQPFDVSLSARVE
FT                   GGNPRLDAGLTGQAQLTLDPLAKRYAAQRLDLRMEGRLPGAQAKSLAARGNVAFNGMTS
FT                   SLDVAGLEILFQGDIVDTATKLTNVEASVAMPKLAVDPHKTELQIDKLAVRAKGAMPGG
FT                   PFELAVDAPALNISPTNASGDALSGRVRTQELDASFGLNGISGNAGELDIKEAKLDSTL
FT                   KQGERVVKSAFASPVTLNLLQRSIGLSALKGDVNITDPGLPKGSLQIPVIGSVNANLLK
FT                   DQANARINAVLEGGKFDLSADIVALSAVPRVTFALAVDTLDLDKLAPPAGASAPPKPAG
FT                   DGKQDESKPPAKPQPAPAPAAADDSINLSGLVGPTASGTIKIGQLVMRGLKAEQVAANI
FT                   KLEKGKLDISTLTAALYGGKLGGVMSVDAVNGNQLVAKMSLAGIAIQPLLSDLAGKDTL
FT                   SGTGSLAFDLKTAGANTYAMKSGLAGTMQVRLRDGAIKGINVAQTLRELKAMFRGEAHD
FT                   PTVQDDQTRQTDFTSLESDLVFNKGVATVKRLDMAAPLLRVNQGNPANIDFVRSELDFV
FT                   ARVRVVNTSTGQDGKDLAELRNLTIPLLITGPFDKPVYTLQWREVAGEALKRGLEKQLK
FT                   EALTGGEGASGSPAKNIDKALKGILGK"
FT   misc_feature    318671..318727
FT                   /note="Signal peptide predicted for BB0937 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.978) with cleavage site
FT                   probability 0.261 between residues 19 and 20"
FT   misc_feature    320732..320803
FT                   /note="PS00179 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 1."
FT   CDS_pept        321187..321573
FT                   /transl_table=11
FT                   /locus_tag="BB0938"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3468"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="PDB:2EXN"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRM9"
FT                   /protein_id="CAE31437.1"
FT                   /translation="MSTTAYQPIAECGATTQSEAAAYQKRWLVANDAGQWLNRDLCPRL
FT                   AEVSVELRMGYLVLKAPGMLRLDIPLDVIEDDDSVRYQMLVGEQTVDVVDEGELAAAWI
FT                   SNHAGVPCRILKVHPDMAEVRWPS"
FT   CDS_pept        complement(321581..322798)
FT                   /transl_table=11
FT                   /locus_tag="BB0939"
FT                   /product="putative transport protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3469"
FT                   /db_xref="GOA:A0A0H3LIC9"
FT                   /db_xref="InterPro:IPR004711"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIC9"
FT                   /protein_id="CAE31438.1"
FT                   /translation="MNGADSASSPLAARRPVTGALSLSAIVAGLVAVLVSFGGTAVLMV
FT                   QAGHAAGLDAARIGSWLGSICLALGVGGALISLRSRMPVVFAWSTPGAALLVTGLVGVP
FT                   FDQAVGAFVLAAALTLACGVFGWIDPIVRRIPAELAAAMLAGVLLNFGMGIFGSIAAQP
FT                   VLVLSMCAAYLLGRRWAPRFAVLAVLVVGLAAASSLDLLRLGHVQWAWTEFVWTTPSFT
FT                   WQAAISLGIPLFVVAMASQNLPGLAILQAAGYRPPASRLVGLTGLAGLLAAPFGAHSVT
FT                   LGAIIAALCAGPEAHADPGRRYVAAATYGLTYVLLSVAAGAVAVFFQALPGALIAALAG
FT                   LALLGAIMGGMTTAMADPQRREAALVTLLATASGISFWGIGSAFWGLAAGLATHGALAW
FT                   RRARSA"
FT   misc_feature    complement(321611..322744)
FT                   /note="HMMPfam hit to PF03594, DE Benzoate membrane
FT                   transport protein, score 5.2e-157"
FT   misc_feature    complement(join(321641..321709,321746..321814,
FT                   321824..321892,321929..321997,322055..322123,
FT                   322184..322252,322316..322384,322418..322477,
FT                   322490..322549,322568..322627,322670..322738))
FT                   /note="11 probable transmembrane helices predicted for
FT                   BB0939 by TMHMM2.0 at aa 21-43, 58-77, 84-103, 108-127,
FT                   139-161, 183-205, 226-248, 268-290, 303-325, 329-351 and
FT                   364-386"
FT   misc_feature    complement(322649..322798)
FT                   /note="Signal peptide predicted for BB0939 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.678) with cleavage site
FT                   probability 0.546 between residues 50 and 51"
FT   CDS_pept        complement(322795..323046)
FT                   /transl_table=11
FT                   /gene="fdx"
FT                   /locus_tag="BB0940"
FT                   /product="ferredoxin"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3470"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIG4"
FT                   /protein_id="CAE31439.1"
FT                   /translation="MALKITEECINCDVCEPQCPNEAISMGADYYVIDPDRCTECVGHH
FT                   DEPQCKVVCPVECIELHPQWQEGQEQLMAKYRRLTGAA"
FT   misc_feature    complement(322867..322956)
FT                   /note="HMMPfam hit to PF00037, DE 4Fe-4S binding domain,
FT                   score 0.13"
FT   misc_feature    complement(322972..323043)
FT                   /note="HMMPfam hit to PF00037, DE 4Fe-4S binding domain,
FT                   score 0.00024"
FT   misc_feature    complement(322987..323022)
FT                   /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
FT                   region signature."
FT   CDS_pept        complement(323101..323610)
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /gene_synonym="kdtB"
FT                   /locus_tag="BB0941"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3471"
FT                   /db_xref="GOA:Q7WNU4"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WNU4"
FT                   /protein_id="CAE31440.1"
FT                   /translation="MIIAVYPGTFDPLTRGHEDLVRRAATLFDKVVVGIAHSRNKKPFF
FT                   TIEERVDIAREVLGHYPNVEVHSFGGLLKDFVRDQNGRVIIRGLRAVSDFEYEFQMAGM
FT                   NRHLLPDVETMFMTPSDQYQFISGTIVREIAQLGGDVSKFVFPSVERWLQAKAKERREQ
FT                   SAQGGA"
FT   misc_feature    complement(323212..323610)
FT                   /note="HMMPfam hit to PF01467, DE Cytidylyltransferase,
FT                   score 1.4e-38"
FT   CDS_pept        complement(323631..324251)
FT                   /transl_table=11
FT                   /locus_tag="BB0942"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3472"
FT                   /db_xref="GOA:A0A0H3LNC0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNC0"
FT                   /protein_id="CAE31441.1"
FT                   /translation="MKPSRPGSKPIRIVGGLYRRTLIPVADAPGLRPTPDRVRETLFNW
FT                   LNHLWGGEFADKRVLDLFAGSGALGFEAASRGAGQVQMVERDRGAAAALRTLRDKLQAG
FT                   AVRIHAGDAMQVIERMDASRFDLVLLDPPFGQGWLERLWPLLPAVLAEDGLVYVESETA
FT                   PAPPAGFELLREGKAGAVHYRLFQFAAMRKSMNNPALEDGASH"
FT   misc_feature    complement(323691..324221)
FT                   /note="HMMPfam hit to PF03602, DE Conserved hypothetical
FT                   protein 95, score 1.4e-56"
FT   misc_feature    complement(323850..323870)
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT   CDS_pept        324459..325526
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="BB0943"
FT                   /product="cell division protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3473"
FT                   /db_xref="GOA:A0A0H3LJM9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJM9"
FT                   /protein_id="CAE31442.1"
FT                   /translation="MPAPQPEPQPEPQPQQPPEPAPPAMASPPVAEPQPPVAEPQPPVA
FT                   AAPEAPRKASWLSRLKQGLSRTGQNIGGLFVGVKVDENLFEELESALIMADAGIEATEK
FT                   LLAALRARVKKERIDDPAQVKTALRQLLADHLRPLERSFDLGRAQPLVVMIAGVNGAGK
FT                   TTSIGKLAHTFQRQGASVLLAAGDTFRAAAREQLVEWGSRNNVTVISQDGGDPAAVAFD
FT                   SVNAGRARNVGVVMVDTAGRLPTQLHLMEELKKIRRVIGKAEASAPHEVLLVVDGNTGQ
FT                   NALAQIRAFDAAITLTGLVVTKLDGTAKGGTLAAVAAGSQGVRPIPVYWIGVGEGLEDL
FT                   QPFVADEFAAALLAD"
FT   misc_feature    324624..324869
FT                   /note="HMMPfam hit to PF02881, DE SRP54-type protein,
FT                   helical bundle domain, score 1.7e-11"
FT   misc_feature    324900..325520
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00448, DE SRP54-type protein,
FT                   GTPase domain, score 7.5e-97"
FT   misc_feature    324927..324950
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(325573..327171)
FT                   /transl_table=11
FT                   /locus_tag="BB0944"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3474"
FT                   /db_xref="GOA:A0A0H3LRN3"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRN3"
FT                   /protein_id="CAE31443.1"
FT                   /translation="MSEQELKLHVPAAARAAVQQQIQQRQAARIRLHAMYFDTPGRELA
FT                   RARIAIRLRQEGRDWVQTLKMPGANAISRVEINHPRPGPVLDLSVYAGTEAQAALTAIK
FT                   GELGLRYETDVQRLFCKVRGRHGTVELAYDTGVLRAGALELPISELEFELVSGRPAAIF
FT                   AMARSWLQRHGLVLDARSKSERGDALAQLAHDLAAAPGEADDAARATRDQQAVAGFWAP
FT                   RNAGAVKLDESMTPMQAMAAVAAECVDHIARNAAVLAEVDTLGVYRAGTPEHVHQLRVG
FT                   VRRLRSAWRLFDGWIADPSETLAQGARTHFSAFGMARDQDVLADTIMPLLARAGMPALP
FT                   AEAAPSNDNAQSLAADRAFQGWLLELLAWSLDVPPPPAPAATAEAAAASPTIIPLAPPA
FT                   EAAPPALRKRLTGRLRRWHLKVIDEGLRFGALELEARHELRKRVKRLRYGLSFAESLLP
FT                   AARLRTYRKQLARVQDLLGEINDLAVARDYYQAALQAHPQAWFAVGWIGARLDGLTPQA
FT                   QEAFDQLAHAKPFWK"
FT   CDS_pept        complement(327412..328233)
FT                   /transl_table=11
FT                   /locus_tag="BB0945"
FT                   /product="binding-protein-dependent transport system
FT                   permease protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3476"
FT                   /db_xref="GOA:A0A0H3LID3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LID3"
FT                   /protein_id="CAE31444.1"
FT                   /translation="MNTSVTSLEPGHPRTWQRYSGGQKALRFMLYLLLVAAIVQAVRSV
FT                   EVIPEFLYDAPEQMADLLRRMWPIDWSYYPEGVHAALVETLHIATLGTILSVGMAVPVG
FT                   LLAANNLTPSRTINMLARLILVSSRSVNSLVWALLFIAIFGPGALAGTLAIAFRSIGFV
FT                   GKLVGEAIEEAQRGPIEALTATGASKAAVLWYGYWPQIRPSFWSIVLLRWDINVRESAV
FT                   LGLVGAGGIGMALDTALNLFQWDRVALVLAAIFIVVVAAEIVITQARKRIL"
FT   misc_feature    complement(join(327436..327495,327508..327576,
FT                   327766..327834,327895..327963,328108..328161))
FT                   /note="5 probable transmembrane helices predicted for
FT                   BB0945 by TMHMM2.0 at aa 25-42, 91-113, 134-156, 220-242
FT                   and 247-266"
FT   misc_feature    complement(327496..327726)
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport systems inner membrane component, score 0.00032"
FT   CDS_pept        complement(328230..329120)
FT                   /transl_table=11
FT                   /locus_tag="BB0946"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3477"
FT                   /db_xref="GOA:A0A0H3LIG9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIG9"
FT                   /protein_id="CAE31445.1"
FT                   /translation="MTVRTANMARRPFSLSWRAKTGVLLVVLYTFYAAAQLDFSWARFE
FT                   TGLGHAATFLARMFPPNFEKPDTLWKGIAESLEIAVLASVLGILLSLPIGLLGARNLMP
FT                   AWASWPARALVALCRALHPVIVAILFVKAVGFGALAGILALTVASIGFIGKLFTEAIEE
FT                   ISLKQVEAVRASGASFGNVIIFGVLPQVFARFVGFATYQFDSNLRNSTMVGIVGAGGIG
FT                   GTLFSAFQRFDYDFVAAILLTLIAIIMLGEILAGFVRKVFLDNMGFERILQRRFTAARG
FT                   LGSTTPLARKGEVDE"
FT   misc_feature    complement(join(328347..328415,328434..328493,
FT                   328521..328589,328650..328718,328728..328787,
FT                   328824..328892,329016..329084))
FT                   /note="7 probable transmembrane helices predicted for
FT                   BB0946 by TMHMM2.0 at aa 13-35, 77-99, 112-131, 135-157,
FT                   178-200, 210-229 and 236-258"
FT   misc_feature    complement(328431..328643)
FT                   /note="HMMPfam hit to PF00528, DE Binding-protein-dependent
FT                   transport systems inner membrane component, score 0.00015"
FT   misc_feature    complement(329016..329120)
FT                   /note="Signal peptide predicted for BB0946 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.950) with cleavage site
FT                   probability 0.849 between residues 35 and 36"
FT   CDS_pept        complement(329117..329887)
FT                   /transl_table=11
FT                   /locus_tag="BB0947"
FT                   /product="putative transport system ATP-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3479"
FT                   /db_xref="GOA:Q7WNT8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WNT8"
FT                   /protein_id="CAE31446.1"
FT                   /translation="MATSLRITGLVKEYRAGKPVLNGIDLDIAGQGLTAIIGPSGTGKS
FT                   TLLRCINRLIEPTSGEIVLKDAEGTVDLARVRGQSLRRARRRIGMVFQEYNLVERLTVM
FT                   ENLLTGRLGYTSALNAWMRRFDPADIERAFQLLDTVGLAGFADQRADALSGGQRQRVGI
FT                   ARALMQRPQLLLADEPTSSLDPKTSVEIMELLTEQGSVNGIPVLVNIHDVELARRYANR
FT                   IVGMSGGHVVYDGDGKGLDATMLKTIYGGESWLE"
FT   misc_feature    complement(329201..329797)
FT                   /note="HMMPfam hit to PF00005, DE ABC transporter, score
FT                   2.9e-55"
FT   misc_feature    complement(329387..329431)
FT                   /note="PS00211 ABC transporters family signature."
FT   misc_feature    complement(329753..329776)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT   CDS_pept        complement(329890..330897)
FT                   /transl_table=11
FT                   /locus_tag="BB0948"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3481"
FT                   /db_xref="GOA:A0A0H3LNC6"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LNC6"
FT                   /protein_id="CAE31447.1"
FT                   /translation="MRAKRLLQAAAVTALIFGSYAAQAADAACSNRGDLDNMYCDANKD
FT                   LVADTPTDKSKLKTPSTLVFTYTPVEDPAVYEDIFKPFTKHLSECTGKRVVFYQVQSNA
FT                   AEIEAMRSGRLHVGGFSTGPTAFAVNIAGAVPFAVKGYADEFQGYNLIVIVKKDSPYQK
FT                   LTDLKGKKLAHTAPSSNSGHMAPVALFPKEGLTPDKDYKVIFSGKHDQSVMGVNSGDYD
FT                   AAAVASDVFKRMAERGQVKEEDFRVIYRSEKFPTSSFAYAHDLEPAFRDKMLKCFYDYR
FT                   FPDEMKKAFDGADRFYPVTYQKDWAIVREVAESGGEKFNRAAYDRETAKSKGKQ"
FT   misc_feature    complement(330826..330897)
FT                   /note="Signal peptide predicted for BB0948 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.923 between residues 24 and 25"
FT   CDS_pept        complement(331046..331873)
FT                   /transl_table=11
FT                   /locus_tag="BB0949"
FT                   /product="putative transcriptional regulator"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3482"
FT                   /db_xref="GOA:A0A0H3LJN4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJN4"
FT                   /protein_id="CAE31448.1"
FT                   /translation="MSAAKSTAKPAAAPGNDGRRSIQSVEVGFPLLAALVDAGRPLTLR
FT                   DLAGAAGMTSAKAHPYLVSFTRVGLVQQDTVTGQYELGPFALQMGLVSLQRLDPVRVAL
FT                   PEVDKLQSEIGHTLGIAVLGSHGPTMIHITEASYPVHVNMRKGTVMSMLHTATGQVFAA
FT                   WLPPKVAEHYIAREDGDAAVIASLTPRKTTRANLDAMLADIRVHGMARALGNPLPGVDA
FT                   LSVPVFDHTGGIVLALTSLGPTGLFDASFTGAIARPLLACAQEISRKLGYRGN"
FT   misc_feature    complement(331067..331636)
FT                   /note="HMMPfam hit to PF01614, DE Bacterial transcriptional
FT                   regulator, score 3.4e-12"
FT   CDS_pept        complement(331879..332658)
FT                   /transl_table=11
FT                   /locus_tag="BB0950"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3483"
FT                   /db_xref="GOA:A0A0H3LRN7"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRN7"
FT                   /protein_id="CAE31449.1"
FT                   /translation="MPAPVAASVRIVLTDIDDTLTTEGRLPAGAYAALERLEQAGIVVV
FT                   PITGRPAGWCDHIARMWPVRAVVGENGAFYYAYDRSARRMNAHYWADAATRAANRQALQ
FT                   AIRERVLREVPGTAVASDQDYRVADLAIDFCEDVPALPDGAVGRIVEIFHEAGAQAKVS
FT                   SIHVNGWFGDYDKLTMTRTLFEREFGLNIDSALQHTLFIGDSPNDEPMFKFFPISVGVA
FT                   NIQSQLHRIQHRPAFVAAARGGDGFVEMAERLLANRG"
FT   misc_feature    complement(331984..332634)
FT                   /note="HMMPfam hit to PF00702, DE haloacid
FT                   dehalogenase-like hydrolase, score 0.011"
FT   CDS_pept        332822..333997
FT                   /transl_table=11
FT                   /gene="ribB"
FT                   /locus_tag="BB0951"
FT                   /product="putative 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3484"
FT                   /db_xref="GOA:A0A0H3LID7"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LID7"
FT                   /protein_id="CAE31450.1"
FT                   /translation="MSAQISSLNAGAAPESFGIASVPEIIAELRAGRIVILVDEEDREN
FT                   EGDLVMAAEFVTPEAINFMVTHGRGLVCLTLTEERCRQLDLPLMASRNGTRYGTNFTQS
FT                   IEAAEGVETGISAADRARTIQVAVARDAQPSDLVQPGHIFPVRAVPGGVLVRAGHTEAG
FT                   CDLTAMGGLTPAAVICEILKPDGTMARLPDLVEFAREHKLKIGTIADLIQYRSEHESII
FT                   ARMGERMMQTPWGDFRCIAYRDDATRSPHLALVHGNIDPERETLVRVHEPASLLDVLDT
FT                   GASPHSWSVGQALHAIAASPAGVLVLMNCQSSTEHLFGQIANWAGPAERAAAQEGDRFG
FT                   LRTYGIGAQILRDLNVGRMKLLARPRKMPSMAGFALTITGYDCAPPNLRND"
FT   misc_feature    332885..333472
FT                   /note="HMMPfam hit to PF00926, DE 3,4-dihydroxy-2-butanone
FT                   4-phosphate synthase, score 4e-111"
FT   misc_feature    333479..333973
FT                   /note="HMMPfam hit to PF00925, DE GTP cyclohydrolase II,
FT                   score 9.2e-08"
FT   CDS_pept        334011..334538
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="BB0952"
FT                   /product="putative 6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3485"
FT                   /db_xref="GOA:Q7WNT3"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WNT3"
FT                   /protein_id="CAE31451.1"
FT                   /translation="MNPYILTPDLNGEGLHIGIVRARFNEEIGQAQLQACLEELGKLGV
FT                   DERDVMVVSVPGALELGVALARMAESYEFDALIALGAVIRGETYHFEVVSNESAAAISR
FT                   IALETGIPVANGVLTVDTDEQAQARAAGKGADCAQVAVEMANLAAALEPEEDDEDEDDE
FT                   DEDFDDEEDDGR"
FT   misc_feature    334044..334463
FT                   /note="HMMPfam hit to PF00885, DE
FT                   6,7-dimethyl-8-ribityllumazine synthase, score 1e-43"
FT   CDS_pept        334546..335010
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /gene_synonym="ssyB"
FT                   /locus_tag="BB0953"
FT                   /product="N utilization substance protein B"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3486"
FT                   /db_xref="GOA:Q7WNT2"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WNT2"
FT                   /protein_id="CAE31452.1"
FT                   /translation="MQARANARSARRRAREFALQGVYAWLLRGGEGTQDAGEIDAHLRD
FT                   AEDFSEADAQWFKTLLHGVLREAPVLRERFLPYIDRPLAELSPVEHGILLIGSFELMHH
FT                   VEVPYKVAINEAVELAKSFGGTDGFKFVNGVLDKLAADVRTAEVQAAPRR"
FT   misc_feature    334579..334974
FT                   /note="HMMPfam hit to PF01029, DE NusB family, score
FT                   7.1e-21"
FT   CDS_pept        335050..336066
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="BB0954"
FT                   /product="putative thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3487"
FT                   /db_xref="GOA:A0A0H3LIH3"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIH3"
FT                   /protein_id="CAE31453.1"
FT                   /translation="MLAGVALASEFDLIARYFTRPAPDGVLGVGDDCALFPVPPGQQVA
FT                   TSTDLLIEGRHFFPDVDPQALGHKALAVNLSDLAAMGARPVGCLLGLALPGVDEAWLAA
FT                   FARGFQALADTHACPLIGGDTTRAPQGLLAISVTVFGAVAPGHALRRAAAQPGDDVWVS
FT                   GELGAADIAYRLLDRQLPADPLRLAATRAALEWPRPRVELGMALAGLARAGIDISDGLL
FT                   QDLGHILAASGVAAELRYDALPVAAALAGLPAETVRRAALGGGDVYELCFTADPAHRQA
FT                   IGQAAHGAGAPVSRIGRILAGQGLRVLDADGAPLGELPGGFDHFSDATDQPAPGRRP"
FT   misc_feature    335512..335979
FT                   /note="HMMPfam hit to PF02769, DE AIR synthase related
FT                   protein, C-terminal domain, score 0.00078"
FT   CDS_pept        336063..336605
FT                   /transl_table=11
FT                   /locus_tag="BB0955"
FT                   /product="putative phosphatidylglycerophosphatase"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3488"
FT                   /db_xref="GOA:A0A0H3LND0"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LND0"
FT                   /protein_id="CAE31454.1"
FT                   /translation="MNPPDANPDPTSMQARTRVSYPSWSWVRARPARLLAFGLGSGLLR
FT                   PASGTWGTLLAWLSWFVFAPLAPDWALGMGIAAAFAYGCLACGQAGRELGVSDHVGMVW
FT                   DEIVAFWLVLWLVPQTVAAQALAFVLFRVFDIAKPPPIKYFDARIKGGFGVMWDDIVAA
FT                   AYTLLVMAILVRMGVFT"
FT   misc_feature    join(336183..336251,336270..336338,336381..336449,
FT                   336516..336584)
FT                   /note="4 probable transmembrane helices predicted for
FT                   BB0955 by TMHMM2.0 at aa 41-63, 70-92, 107-129 and 152-174"
FT   CDS_pept        336602..337168
FT                   /transl_table=11
FT                   /locus_tag="BB0956"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3489"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LJN7"
FT                   /protein_id="CAE31455.1"
FT                   /translation="MSLHDTQGRAGLAPTPLTAAAIQGLAEMVGEALLRRDWMMGTAES
FT                   CTGGLLAGAVTSVAGSSDWFERGFVTYSNAAKVAELGVSGETLDHYGAVSEPVALEMAN
FT                   GVLLATPSAQVGVSTTGIAGPGGATPGKPVGMVCFGFAMRAHGGITSRAITHVFPGDRA
FT                   QVRNASVEFALRGILEFLGEPVNRG"
FT   misc_feature    336665..337144
FT                   /note="HMMPfam hit to PF02464, DE Competence-damaged
FT                   protein, score 2.9e-62"
FT   CDS_pept        complement(337335..338156)
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="BB0957"
FT                   /product="putative orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3490"
FT                   /db_xref="GOA:Q7WNS8"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WNS8"
FT                   /protein_id="CAE31456.1"
FT                   /translation="MTFLKKLEHAWSASQSLLQVGLDPDPKRFPRELEGKPDAIFQFCR
FT                   DIVDATAPYACSFKPQIAYFAAHRAEDQLEALCQHIRAQHPDLPIVLDAKRGDIGSTAE
FT                   NYAREAFERYQAHALTVSPYMGLDSVEPYLAWGDRGVIVLCRTSNPGGSDLQFLKMADG
FT                   QPLYLHVAGLVADKWNANGQCGLVVGATFPNELAAVRQRIGDAVPLLVPGIGAQGGDIN
FT                   ATVQAGANSAGAGMMINSSRAILYASTGEDWRQAAGEAARGLRDAINAVRT"
FT   misc_feature    complement(337389..338111)
FT                   /note="HMMPfam hit to PF00215, DE Orotidine 5'-phosphate
FT                   decarboxylase / HUMPS family, score 1.5e-36"
FT   misc_feature    complement(337848..337889)
FT                   /note="PS00156 Orotidine 5'-phosphate decarboxylase active
FT                   site."
FT   CDS_pept        complement(338164..339483)
FT                   /transl_table=11
FT                   /gene="ndh"
FT                   /locus_tag="BB0958"
FT                   /product="putative NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3491"
FT                   /db_xref="GOA:A0A0H3LRP2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LRP2"
FT                   /protein_id="CAE31457.1"
FT                   /translation="MTQTPNTGSPHRVVIVGGGAGGLELAAKLGRAHGRERVTLVDSRP
FT                   FHIWKPSLHEAAAGTLDIHQEGLSYLMLANMCNFTFAQGELQGIERERRQIQVGPVADP
FT                   SGQQVLPPRELSYDTLVLAMGSTSNFFNTPGAAEHAVTLDTTENAEQFRLTMLKAMVQV
FT                   DLRKVHDPSARLDLVIVGGGATGVELAVELIEASHVVSAYGLPNFRADRDLVITLVEGA
FT                   PRILSALPEKISRAAHARLTELGVRVETDCRVAEVGADHVVTADGRRFEATMCLWAAGI
FT                   EGPPLFRQLGLPLNRLGQLEVNERLESPDPHILALGDCCAAPWKDGRTVPARAQAAHQQ
FT                   ADYLARKLTARLRNAAEPTEAYAYHDHGSLVSLGQGSGVGSLMGKLAGRGLFVSGTLAR
FT                   LMYMSLHLMHHRAVLGISRTATLALARLLMRRTRPRVKLH"
FT   misc_feature    complement(338488..339450)
FT                   /note="HMMPfam hit to PF00070, DE Pyridine
FT                   nucleotide-disulphide oxidoreductase, score 1.3e-38"
FT   CDS_pept        complement(339534..339932)
FT                   /transl_table=11
FT                   /gene="dgkA"
FT                   /locus_tag="BB0959"
FT                   /product="putative diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3492"
FT                   /db_xref="GOA:A0A0H3LIE1"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LIE1"
FT                   /protein_id="CAE31458.1"
FT                   /translation="MAHTPHPSPFKSTGGLRRILNALRYSLQGLKAAIKYEAAFRQELV
FT                   LAILLVPAAFFLGRTTDEVFILIASVILVLVAELLNSAIEALADALSVETHPLLGRAKD
FT                   LGSAAVMLMLLFTLAVWVAVLISRFVLD"
FT   misc_feature    complement(join(339540..339608,339672..339740,
FT                   339759..339818))
FT                   /note="3 probable transmembrane helices predicted for
FT                   BB0959 by TMHMM2.0 at aa 39-58, 65-87 and 109-131"
FT   misc_feature    complement(339552..339887)
FT                   /note="HMMPfam hit to PF01219, DE Prokaryotic
FT                   diacylglycerol kinase, score 2.1e-33"
FT   CDS_pept        complement(340021..340911)
FT                   /transl_table=11
FT                   /gene="brkB"
FT                   /locus_tag="BB0960"
FT                   /product="serum resistance protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3493"
FT                   /db_xref="GOA:A0A0H3LII0"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3LII0"
FT                   /protein_id="CAE31459.1"
FT                   /translation="MRLPRQIRLPHLRDIGALLTDSAREWSRHRASSKGAALSLYMVFS
FT                   LAPMLILVIAVAGAFFGEEAVRSELFSQVRDLTGERGAEVIQTVLASAHESGSGWLAAL
FT                   LSICVLVFSATTAFAELKASLDELWDVKEDKSGLQGLVRSRMLSFGLVLVLALFLLLSL
FT                   TLNAALGAAKGYYGDLWSTSAFAMAADWLSNLFSFAVVTALFAVVYKLLPSKRIPWLDV
FT                   IPGAIVTAALFLAGKWGIGLYLGRGAAVSAYGAAGSLIALLLWIYYSAQIFFFGAVFTR
FT                   QFAERFGSLRRAAPA"
FT   misc_feature    complement(340051..340833)
FT                   /note="HMMPfam hit to PF03631, DE Ribonuclease BN-like
FT                   family, score 7.7e-80"
FT   misc_feature    complement(join(340084..340152,340180..340248,
FT                   340285..340353,340396..340464,340549..340617,
FT                   340732..340800))
FT                   /note="6 probable transmembrane helices predicted for
FT                   BB0960 by TMHMM2.0 at aa 38-60, 99-121, 150-172, 187-209,
FT                   222-244 and 254-276"
FT   CDS_pept        join(341213..341563,341566..344244)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="brkA"
FT                   /locus_tag="BB0961"
FT                   /product="serum resistance protein (pseudogene)"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3494"
FT   misc_feature    341213..341338
FT                   /note="Signal peptide predicted for BB0961 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.649 between residues 42 and 43"
FT   misc_feature    342961..343326
FT                   /note="HMMPfam hit to PF03212, DE Pertactin, score 4.1e-71"
FT   misc_feature    343411..344244
FT                   /note="HMMPfam hit to PF03797, DE Autotransporter
FT                   beta-domain, score 6.7e-77"
FT   CDS_pept        complement(344348..345991)
FT                   /transl_table=11
FT                   /gene="cpn60"
FT                   /gene_synonym="groEL"
FT                   /gene_synonym="mopA"
FT                   /gene_synonym="groL"
FT                   /locus_tag="BB0962"
FT                   /product="60 kDa chaperonin"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3495"
FT                   /db_xref="GOA:Q7WNS4"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WNS4"
FT                   /protein_id="CAE31461.1"
FT                   /translation="MAAKQVLFADEARVRIVRGVNVLANAVKTTLGPKGRNVVLERSFG
FT                   APTVTKDGVSVAKEIELKDKFENIGAQLVKDVASKTSDNAGDGTTTATVLAQAVVQEGL
FT                   KYVAAGFNPIDLKRGIDKAVAAAVEELKKLSKPVTTSKEIAQVGSISANSDASIGQIIA
FT                   DAMDKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINSPEKQVAALDDPYVLI
FT                   YDKKVSNIRDLLPVLEQVAKSSRPLLIIAEDVEGEALATLVVNNIRGILKTTAVKAPGF
FT                   GDRRKAMLEDIAILTGGTVISEETGMSLEKATLQDLGQAKRIEVAKENTTIIDGAGDGK
FT                   SIEARVKQIRAQIEEATSDYDREKLQERVAKLAGGVAVIRVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVPGGGVALLRAKQAITGLKGDTADQNAGIKLILRAVEEPLRTIVTNA
FT                   GDEASVVVNTVLNGKGNYGYNAATGEYGDLVEQGVLDPTKVTRTALQNAASVASLLLTA
FT                   EAAVVELMEDKPAAAPAMPGGMGGMGGMDF"
FT   misc_feature    complement(344417..345925)
FT                   /note="HMMPfam hit to PF00118, DE TCP-1/cpn60 chaperonin
FT                   family, score 4.3e-196"
FT   misc_feature    complement(344744..344779)
FT                   /note="PS00296 Chaperonins cpn60 signature."
FT   CDS_pept        complement(346024..346311)
FT                   /transl_table=11
FT                   /gene="cpn10"
FT                   /gene_synonym="groES"
FT                   /locus_tag="BB0963"
FT                   /product="10 kDa chaperonin"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP3496"
FT                   /db_xref="GOA:P0A340"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A340"
FT                   /protein_id="CAE31462.1"
FT                   /translation="MALRPLHDRVIVKRLDNERKTASGIVIPDSAAEKPDQGEVVAVGP
FT                   GKKTEDGKILPVDLKAGDKVLFGKYAGQTVKVDGEELLVIREDEILAVIQ"
FT   misc_feature    complement(346030..346311)
FT                   /note="This hit extended beyond the end of the feature by 1
FT                   aa and was clipped."
FT                   /note="HMMPfam hit to PF00166, DE Chaperonin 10 Kd subunit,
FT                   score 2.5e-59"
FT   misc_feature    complement(346231..346305)
FT                   /note="PS00681 Chaperonins cpn10 signature."
XX
SQ   Sequence 346362 BP; 52390 A; 116763 C; 122510 G; 54699 T; 0 other;
     atggcccggc gcaagatgcc gggcatcgta taacaacgac gatttctaca aggagagaga        60
     catgaagaaa ccaatcggaa tcctgcgggc cacgctgctg tgcggcgttg ccgtcctggc       120
     caccggcggc cacgcgttcg cccaggacaa ctggccgtcc aagccgatcc ggctgctggt       180
     gggcttcgcc ccgggcgggc cgaccgacaa cgtggcgcgc atcctggccg agaaaatggg       240
     cacggagctg ggccagccgg tcatcgtcga gaacaaggcg ggggcggcgg gcaatatcgc       300
     cgccaccgcg ctgacgcagg ccaccgccga cggctacacg ctgctctaca acacctcgtc       360
     catcgtcatc gcgccctggg tctaccgctc gcccggtttc gaccccttga aggacttcgc       420
     gccggccggc ctgacggcgg ccgtgccgct ggtgctggcg gccaacatgc aggtgccggc       480
     gcagacgccc aaggcgctgg tcgatatggt caaggccggg ccggacaagt acaactatgc       540
     gtcctcgggc gtaggcgcca tcgagcacct gaccgccgcg caactgttga gcacgctggg       600
     cctgaaggcg acccacgtgg cctacaaggg cacggcgccg gcccaggtgg acctgatctc       660
     cggggccacg cagttcacca cgaccacgct gaacacggtg attgcgccgg tgcaggccgg       720
     caagctgcgc gcgctggcga tcaccagccg cgaacgctgg tcgggcatgc ccgacgtgcc       780
     gaccgtggcg gaaacgctga tcccgggctt cgagagcctg gcctggcagg gcatcgtggc       840
     gccggccggc acgcccgagc cggtgctggc gaagatcaac aaggccatca acgacgccct       900
     ggcctcgccc gacgtgcgcc agaagctgga ccagcagggc accatcgtgc tgggcggctc       960
     ggtcgataag taccgcgcct acatcaagtc ggaatacgac cgctggggca aggtggtgga      1020
     gcaggccggc gcgcgcatcg actagccggc ggccgggctg cccctgcggg cgacccggcg      1080
     cccgcatgtt tcaacgccgg cttcggctgg cgacggcgtc ggcgatcgcc cgggcggcgt      1140
     ccttgtgctc gtcggccgtc tgcaccatgc cctgcatgga ggccgtcatc tccagcgtat      1200
     cgtgcagcgt cgcatgcgcg ccgaactgca tcaggcgctt ggtcatgcgg gcgatgcgcg      1260
     ggggatgccg cgcgatgcgc cgggccaggg cgtaggcttc gtcgagcagg gtggagtgcg      1320
     gcaccacccg ggataccagc ccgattcgtt cggcctcgcg cgcgtcgatg aaatcgcaag      1380
     tcagggccat ttccatggcg cgcgacaggc ccaccgcgcg cggcaggaac caggcgccgc      1440
     catcgccggg caacaggccg acccgcagga acgattcggc gaacaccgcc tggtcggacg      1500
     caatccggat gtcgcacatc agggctacgt cgcagccgcc gccgaccgcg tggccgttga      1560
     cggccgcgat ggtgggcatg ggcagcccgt ggatggcccg cgggatggcg tgcacgcgct      1620
     ccaggttcag gtcgcgcgcg gccagcggat cctcgggggc gaaaacgccg cgccgctcca      1680
     gcatgtcgtg cacgttgccg ccggccgaga aggccttgcc ggctccggtg acgatcagca      1740
     cgcgcagttg cggcgtggcg cagatcacgg gatgtatggc ggccagggcg tccatcatcg      1800
     ccaggctcat ggcgttctgg gtggccgggt cgtccagggt cagcaggcct atgcctgctt      1860
     cgtcgaccga gaacctggcg tagcaagggg aagcgggggc gggcgtcgtc atgggcgggc      1920
     tcatgcggtg gcgtgggcgg cggcctggcg gcgcgcggtc gccgccgcca gggtccggtc      1980
     ctggccggac tgttccagcg actgcaggta taggcgccag ttgtgcgggt tgtggggcgc      2040
     gcggaacgag cggcgcgcca ggtacgcaat ggtgtcggga tgggcggggg cggcccggaa      2100
     cagcgcttcg gcggtcaggt attcgtacac atcgcgctga tcgtggctgc cgccggccgc      2160
     gtgcgccacg tcggcgcagg caagcagcgc gtcggcgctt tcccggtagc ggccctggcg      2220
     gaacgccagc agggcgccga cgatcggcac gacggcctgg cggtaggcct gggcgttgtc      2280
     ggtgccgccc tggctgtagc gctccagccg ctcggccagg gcctgggcct gctgccggtg      2340
     ctcggggttc gcgctgctgc acagcgccat cgcgtagtgc acgtcggcga aacccatgac      2400
     ctggtcgtcg atgcgcgcgg cgcttttctg cgccacggct tcccagcgcc ggccgacatc      2460
     gacgccgctc agttccagcc gcatcagcag cgaggcttcg ttgcagacat ccaggtattc      2520
     caccgaatcg gccgcgaaca cggtgcggtc gtaccagtcc agcgcggcct gcgcgtcgcc      2580
     ctgttcgaga tggatcagcg cgcggtgcca gtggatgtgg tggcggaagt tgttggcttc      2640
     gctccagtgc cgctcgtggc gggcgatcca cgccagcgcg tcggccttgc ggtcggtcgg      2700
     ctccagcgcg tgcgcgacgg catgcaccgc ccacggatcg tgcggcgtca gttcgagcgc      2760
     gcgcctgccg ctggcctcgc cccgggccag ctcgccggcc tcgacctggc cgaaggccat      2820
     catgctgagc atgtagggat acagcgcgtc gtcctccgac caggagtcga tggcttgcgc      2880
     gatgccgtcg cggatgcggg cggagcggcc caggtagaag tagccgaaat gcgccatctt      2940
     gaccgccagg atgtcgcgag gatgggcgcg ggcgatgcgc tcccagtgct cggtcgccgc      3000
     ctgcagcgag tcgcgcgacc agcaggccag ggcgtccagg tgccgctgtt cgcgttcggt      3060
     gagcgcggcg cgcccgggct gcaggccggc cgccagctgc gcggccttgt cggccagcgg      3120
     gcgcagtccc atcagcaggt agaagtagcc gcgcaggatc agcgccatcg gcatttgcgc      3180
     gtcgtgcgcg aaggtggcct tgagcgcgcc gccgatgtcg ccgtggaact gcagatagcg      3240
     cttgacggtt tcgtcgaagg cctcgaccgc ctgcgcgttg gcggccgtga attccagccc      3300
     ttcgcgattt cgctgccgtg tcattgcgtg ctcccggagt cgtagaacgc ctggatgccc      3360
     gtgatggcac gcccgacgat cagggcgtgg atgtcgtgcg tgccttcata ggtgttgacg      3420
     gcctcgagat tgatcatgtg ccggatgatg tgatattcgt cggacacgcc gttggcgccc      3480
     agcatgtcgc gcgccacgcg gctgatctcc agggccttgc cgcaattgtt gcgcttgatg      3540
     atggagatcg cctcggtcga gacgcgtccc tggtccatca ggcgcgcgac ctgcaggctg      3600
     gcctgcaggc cgatggcgat ttcagtttcc atgtcggcca gtttcttctg gaccagctgg      3660
     ttcgaggcca gcggccgccc gaactgcgtg cgcgccagca cgtagtcgcg cgcctggtgc      3720
     aggcaggctt cggccgcgcc cagcgcgccc cacgagatgc ccaggcgcgc cttgttcagg      3780
     cacgagaagg ggccgcgcag ccccttgacg tggggcagca tgcggtcctg cggcacgaag      3840
     acctcgtcca tggcgatggt gccggtgatc gaggcgcgca gggagaactt gccgtctatg      3900
     cgttcggtcg acaggccctg catgccgcga tcgaggatga agccgcggat atcgccggcg      3960
     tcgtccttgg cccagatcag gaacacgtcg gcgatcggcg agttggtgat ccagctcttg      4020
     gcgccggaca ggcggtagcc gcccgcgacg ccgcgcgcgc gggtggccat gccgccgggg      4080
     tcggagccat ggtcgggctc ggtcaggccg aagcacccca ccagttcgcc cgaggccagg      4140
     ccgggcaggt aggtctgccg ctgttcttcc gagccgaacg tatggatggg gtacatgacc      4200
     aggctcgatt gcacgctgac cgacgaccgg taggcgctgt ccacgcgctc catttcgcgc      4260
     ccgatcaggc cgtagctgac gtggttgacg cccgcgcagc cgtacccctc gagggtggcg      4320
     cccaggaagc ccagctgccc gagttccagg aagatcttgc ggtcgaaggt ctcggtgcgg      4380
     tgcgcatgca cgatgcgggg aagcagctgc tcctggccgt aggcgtgcgc ggtcgcctgg      4440
     atcatgcgct cgtcttcggt cagctgctca tggagcagga agggatcctc ccagacgaag      4500
     ggctggtagt gctgcttggt gtcgggcgat gaggtctgcg tgtccatggt gtccgtctcg      4560
     ggcgtatcgg tgtggttgcg gcgccatccg gcgtcaggtt ccggagaacc tgggcttgcg      4620
     cttgtcctgg aaggcctgca gcccttcctt gatgtcgttg ctcaggccat agctttccca      4680
     ggccaccact tcgagccgca gcgccgtgtc caggggctgc tcgtagccgt cgttgatcag      4740
     ctgcttgatc aggcgcacgc ccagcggcga attcttggtg atctgggcca gcaaggcctg      4800
     gacggcctcg gtcaactgtt cgtccgggac cacctggttc accaggccgt actcggccag      4860
     ctcccgggcg ggcagcaggt tgccggtgaa cagcaggcgc ttggccaggg ccatggggat      4920
     cttgcgcggc aggcggatcg ccccgccgcc gcccgggatg atgccgaagt tggcgtgccc      4980
     gtcgccgatc ttggccgact cggcggcgat gaccaggtcg caggaaatga tcagttccat      5040
     gccgccggcc accgccacgc cattgacggc cgcgatggtc gggtgcggga agttctcgac      5100
     gcggcggtac atgttctggc agaggttcag gtaggcgcgg aacttgttca tgtcgccgct      5160
     gcccacggtt tccttgaagt acttcaggtc gccgccggcg cagaaggcgc ggccctggcc      5220
     ggtgaacacc agcgcatgga cgtcggcgcg cgcctcgagc agctgcagcg cctggtcgat      5280
     ctcgatgacg gtttcgcgcg ccagggcgtt catggcgtcg gggcggttga tggtgatcca      5340
     cgcgacgtgg tcgcggactt ccaccaggat ggtcttgggc gtgaattcgg acatgggttt      5400
     ctccttcccg tcttatcgat acacttcgaa cagtccggcc gcgcccatgc cgccgcctac      5460
     gcacatgctg acgaccacca ggcgcgcgcc gcggcggcgg ccctcgatca gggcgtggcc      5520
     gaccatgcgc gcgccgctca tcccgtacgg gtgccccacc gagatcgccc cgccgttgac      5580
     gttgagcagt tcgttgggaa tgccgagctg gtcgcggcag tacacggtct ggctggcgaa      5640
     ggcctcgttg agctcccaga ggtcgatgtc ttccatgcgc aggccgaagc gctggaacag      5700
     cgtccggacc gccaggatgg ggccgatgcc catctcgtcc ggttcgcagc cggtggccac      5760
     gaagccgcgg aacgcgccca gcggttcgag gttgcggcgt tcggcttcct tggcttccat      5820
     gaggatgcag gccgacgagc cgtccgagag ctgcgaggca ttgccggcgg tgatggaggt      5880
     gtccggctcc atcaccggct gcagggtcgc caggccttcg cgcgtggtgt cgggacggtt      5940
     gccctcgtcg cgcagcaagg tcacttcttc ttcgtaggtg gcgccggttt ccttgttctt      6000
     gctcagcttg acggtcgtca tcgggacgat ctcgtcgtcg aaccggccgt cgcgctgcgc      6060
     cgcggccgtg cgcatctggc tctggaaggc gtaatcgtcc tgcgcgtcgc ggctgacgcc      6120
     gtagcgttgc gccaccactt cggccgtgcg cagcatggcg tcgtaggtgt gcggtttgtg      6180
     ggcctcgatc caggggcttt tcttgacgcc gttgtggtgc tcgtcctgga cgatgctgat      6240
     gcactccagg ccaccggcgg ccatgacggg cacccggtcc accatgatgc gctgggcggc      6300
     gatggcgatg gcctgcaggc ccgaggcgca caggcggttg acggtggtgc cgcccgtttc      6360
     gatcggcagg ccgccgcata tggcgatctg ccggccgatg ttgtagccgg tggcgccctg      6420
     cggcatgccg cagccgatga tgacgtcctc gatctcggcc gggtcgacct tggaccgggc      6480
     gatggcgtgc cgcagcgaat ggccgcccag ttcggcgccg tgcgtctggt tgaaggcgcc      6540
     gcggtaggcc ttgcctatcg gggtgcgggc ggttgaaacg attacggctt ctctcatcgc      6600
     tgtctccttg ttgtgcctgg gatgtgagga tggagacgac tatatcgacg gccgaaatcg      6660
     ggcggcaacc gactatttcg cagcggtggc tcagtttttc tcagccaggt ttcttctggt      6720
     tgagtttttg taggccagcg ggaaaaaaag tcgtttgccg gccgggatgg cgctcgccga      6780
     acatgtgtgc gccggccaag ctgccaccgc gagaccttcc gacgggaagc ccgcaatcca      6840
     taaaacagtg acaggagaca accatgatcc gctcgttact tgtcgggctg ctgcttacgc      6900
     tcggacccgc ggccgctcag gccgccgaaa gcccggaccg ctatccgtcc aaacccatca      6960
     ccatcatcgt gccgttttcc gccggcggtc cggccgacaa tgtcacgcgc tatatcgcca      7020
     accagctggg caagacctgg aaccagcagg tcgtggtcga gaaccgcacc ggcgcgggcg      7080
     ggatgatagg ggccgaggcg gtggcccgcg ccgcgccgga cggctatcac ctggtgctgc      7140
     tggtgaccgg ccacaccatc atgcccggca tgcaggcgag catgccttac cggatgccgc      7200
     aggacttcac cggcatcacc gtggtcaacc gcgcgcccaa gctggtggtc gtgcacccct      7260
     cggttccggt ggcctcgttc gccgagctga tcgagaaggt caagcaggaa ccgggcaagt      7320
     acggcagcta cgggacgtcg ggcgtgggct cgatggcgca cctttccatg gaactggtca      7380
     acaagctggc cggcaccaag ttcgtgcaca ttccctacaa gggcggcggc gccacgcagg      7440
     cggacctggt ggccggacgg ctgcccatcg gggtgctgga cctgggctcg gtgctgccgc      7500
     acgtgcaggc aggcagcctg aaggtgctgg cggtgaccag cgacacccgt tcgccgctgt      7560
     ttcccgacgt gcccaccatc gccgaggtga ttccgaactt ccaggccacc gagtggttcg      7620
     gcatcgccgg gccgaagggc gtgccgccgg cgatcgccga caagctgcag gccgccatca      7680
     aggcggcgct cagcaccccg gaggcccgta cgcgctacat cgagggactg ggctgggagc      7740
     tgccggcgtc cacgcccaag gagatggacg aagtcctggc ttcgcagacc gtgaagtggg      7800
     gcgccctggt caaggaactc ggattgaagg ctcaatgaga tggacgccgt ggcaatgaaa      7860
     tccgtgacgc agcttacggt caacgccgat cacctgcagg gcgccatcgg cgcgctgttc      7920
     aaggccagga ccgtcgccgt ggtcggcatc tcggccgacc acgcgaagct gggcaacgtc      7980
     attctgcgca acgtcgtcaa gaatggcttt gccggcaata tctacggcgt gtgccgggct      8040
     ccggtggagc ccggcgtctt cgaggccggc tacgagcgcg tgcggttcgt gcaggcgttc      8100
     tcggagatcg aggaaccggt cgatgtggcg ctgttcgccg tgccggccga catggtcgtg      8160
     acggcgctgg cgtccgtgcc gctgggcagg ctgcgcctgg ccgtcatcct ggcctcgggc      8220
     tttaccgaaa ccggcgagcg cggggcgtcg ctggagaccg cgctgcgcca gtactgcctg      8280
     gagacccagt tgccggtcgt cggccccaac tgccagggcg tggtggtgcc gggcgtcaag      8340
     ctgcagatga ccttcagccc gatgtacaac cagatgctgg agggcaaggt cgcgatcgtg      8400
     tcgcagtccg gcgcgatggc gggctacatg gccaacaacc tgatgcgccg cggcgtcggc      8460
     ctgtgctgcg tcgtcagctc gggcaacgaa gccgtcctga ccgccgcgga ctatatccat      8520
     gcgctggccg acaagccgga gtgccgggtc gtgctgtgct atatcgagca gatcaagaac      8580
     ggccggcatt tcgcccgcag cgtgcagcgg ctgggccccc agcagcggat cgtggtggtc      8640
     aagagcgggc gttccaccgc cggcgtggcc gcggccagca gccataccgg cgccatggcg      8700
     tcggacgacc gcgtcatcga cggggtgttc cgccagctcg gggtggtgcg ggcgcgcgac      8760
     agcgcgacgg ccatcgatgt tgccatggcc ctggccaacg gcaggcggat gaagggcggc      8820
     gcggtcggca tcctgtcggt ggccggcggc ctggccgtgg agctgtcgga tctgctggag      8880
     atggacggtt ttaccgtgcc gccgttcgat ccggacacgc tcgagcgcct caaggcgaag      8940
     gtgcccgagt tcggcgccag ccgcaatccc atcgacctgt ccggcgcgat cctgacgcag      9000
     gagtcgctgt tcgaggaggt gctgaacctg ttcgcgcgcg ccaggaacct cgacgggttc      9060
     gcgatcatct cgacgttcat ccgcaatccg gcgttcgcgc acgccatcgt ccgcatgtac      9120
     cgcagcaccg acaaacccgt ggtggtctgc tggaccggca cgccggagca gacgccggag      9180
     tcgctggaga tactgacccg cagcggcatt ccgatctatg gcgacaccgg ccgggtggcc      9240
     ctggcattgc gggccatacg tggcgacacg gacatctcct gaggaacagg cgtagacatg      9300
     agcacagcga tttccatggc aggggcgggt acgaaactgg acgagatcga tttgctgctg      9360
     cagcaatgga tcgatgccgg acggcaggtg gtgcacgagg cggacagcaa gcgcatcctg      9420
     gccatggcgg ggttccccgt gccgggcgag gcccgcggcg ggccggccgt cgtcaagctg      9480
     tgcgccgatg aggccttgca caagtcggaa ctggggttgg tggcgctcga cgtggcgccg      9540
     ggcgacgtgg agcgcacgcg gcgcgagctg caggagcgat cgcggcgggc cggcgtggcc      9600
     ggcggggaag tgctggtcga atccatggtg ggcgacgtcc tgatggaatg gttcgtcggc      9660
     tgccgcaccg accatacctt cggccccgtc gtcgtggtgg gcgcgggcgg catctatgcc      9720
     gagctgctgg gagcgcccga gatccgcatg gcgccgctgt cagcgcgcga tgccgagcgc      9780
     gcgctgcgcc atcacaaggc gtttccgatc atcgacggcg cccggggcag ggagcccgcc      9840
     gatatcggcg cgttcgccag gctgatcgcg gacgtctcgg agttctacta ccggcgcagc      9900
     cacctgatcg ccgagctgga cctcaacccg gtcatggtgc gcggccgcca cctggacccg      9960
     ggcatggttg tcgccgacgc atcgatcatt ctgcaaaagc cgactttctg agcgcggcgg     10020
     cggtgtcggt ggcgcgcgtc ttgttgcgct cctggaccat ccagcggcgg atctgctcga     10080
     tgcgcgggac acgcgccgcc cgctgggcgt tgaaatagat gttgaacccc atgtggcttt     10140
     tgcgtacctg gggaaacggc gccaccagcc tgcccgatgc aatgtcgtcg gcgatgaagg     10200
     cgtggatgcc gatggccatg cccgcgcccg acatcgccgc gttgtaggcc agggtcaggc     10260
     tctcgaacac cagcgcgggc gcctggcgca aggcgggctg ccccaccgac tggagccagc     10320
     ggttccagtc ctgcgggcgc agctgcgcgt ggatgagcgg atagcgctcg atatcgtcga     10380
     gccccagttc gccgccatgc cgttgcagga aggccgacga acagatcggg aacgtctcga     10440
     catccagcac gcgttcggcg gccacgccgc cgctgcaggc ctgctcggcg gcgggatcgg     10500
     ggcccagctt gacgacgaag tcgtagtcgt ccgtgctttc gagttcgggc gccagggtgg     10560
     tcttgacgtt tatctgcgtg ctgggcagcg ccgcctggac ctgcgcccag cgcggggtca     10620
     gccagtgcgc ggcgaaggtc ggatggcagc agatgctcag cccgcggtcg ccgggatgct     10680
     gctggacgcg gtccgtggcg atgccgatct tgttgaacgc ttcgagaatg tcttcggcga     10740
     acgccttgcc ttgcggcgtg atggccacgc cgcggtgcga acgcatgaac agttcgacgc     10800
     ccaggtagct ttccagcgat ttgaccaggc ggctgacggc tcctggcgtg acgtgcagct     10860
     ccgcggcggc cttcaggaaa ctctcgtgcc gcgccgcgct ttcaaaactt cgcaatgcgt     10920
     tcagcggcgg catgcgctgc atacgggtcg tattcatgta cgtcaattcg cctaacgagc     10980
     actggctggg cgaccactga aggtgattcg caggaatgat acgtacggca acggaaagcc     11040
     gcgatacagc tcgaaaacat ggtagcaaca tcgcgctttt gcgtcgatgc gcgctgaata     11100
     gtggaaaccc ttagcagggc cgcaatgcgc tcgcgcagcg gtttgcgcgc gagcgccgcg     11160
     atcacgcgcc ggccggcgcg tgcggcttca ggaaccggca gacgtggcga gcgaatgccg     11220
     ccggctggtc gtcgtggatg tagtggcccg cgtcggcgat ctccaccgct tcgatgcgcg     11280
     ggttgagggc gcgcatgcgt tcgaccatgg ccggttgcag gtagtcggag cggccgccgc     11340
     gcagcagcag ggtcggacag ccgatgcgcg cgacgtaggc ggccaggtcc accacgcgcg     11400
     cggggtcggg gtgcaggcgc gtgcgggcga tgccggcatg gtcgtagcgc cagacgtacc     11460
     cgccttcggg cgcgggcttg agcatgcttt cgaggcgctg ctgccgagcc tgctcggaca     11520
     cgctggggcg cagtgaccgc atgaagtcgc tggcggcgtc ccaggaggcg aagccggccg     11580
     gggtctcggc cagttcgcgg cggatgcggc gcgcgccgtc gctgtcctcg aaggcgcccg     11640
     gtccggcgtc ctcgaccacc agccggccga cgcgccccgg atggcgtgcg gcgtagacga     11700
     tggcgttgat gccgcccatg gagtggccca gcaggtcgaa gcgcgccagc gacagctggt     11760
     cggccaccgc ggccaggtca gccacatagg tatcggtgta gtaattgcag tccgcgtccc     11820
     agtcggtccg cccgcgcccg cgctggtcga aggcgatgac gcggtattcc ggctggagcg     11880
     cggccgcgat gcccgcgaag gtctccgcgt agccgcggat gccgtgcagc atcacgaccg     11940
     gcaggccttg cgggctgccc cattccgtga cgtggaagtc cagcccggcg tgggcgaggc     12000
     ggtaatcgcg gcgttgcatg gcgggcgggt tccggcgagc gtgttcagtt gaggccgtca     12060
     tggccctgga cgtcgcaggc ggcgagtccg cccaggcggg cgttcaggcg gccgcgcgtg     12120
     gcgaaggccc agatcaggac gacctcgtcg cggttggggc cgtcgttgaa ctgggcgctg     12180
     accgtatcgt agtgggaccg cacgtagagc gcatccttgt gggccagcgg gatgtcgatg     12240
     atggtgccgg ggccgccgcg cttgccggtg gagggcaccc acgatttcgc gccgcccagc     12300
     gcgtcgcgca cggggttcgc ggcggggttg gtgagcaggg cgttgccgtg ctcgtattcg     12360
     ccgtcggcgc cgaccaggca ggccttgccg tagctggcga tggcctggcc ttgcgcggcc     12420
     tcgcgcacgc gccggccgaa ctcggcgccc agcccgggcg aggcgtcgat ccacagcgta     12480
     aggtcttcca cgtatttgcc ggcgtacgga ttgtggatgc acgcggccag gacgattttg     12540
     cgcagcggct cgccgtctgc gggcgcgccg gtctcgccgg ccagggtgtc ctcgacctgc     12600
     agataccatt tgcggatgtg gtagacgctg aagttgggcg ttttcattgc tgctctgatg     12660
     aaagtggaag ggggcgtggc cgcccggtca gatcgattgg ggatgggcat gcaccggggc     12720
     gacgtggggc gtccacgcga ccgaggtgat ctcgctgaaa tcgcgccatt ccttgtacca     12780
     actgcgtccg ccgtcggtgg agcgcagcag gtggccgtac ttggtgccgg cgaacaccag     12840
     cgcgggatcg ctgggatggg cgccgaacgc ccatacggtc gagttgggcg cggtgtgcag     12900
     cagcgcgggc gcccagctcc ggccgcgatc ctcggatcgg tagatgcggg tgcgcgtgcc     12960
     gggcgtgccg tcgcctaccg ccagcagcaa ggtctggccg gcggcatcga gcggatagac     13020
     cgcgcgcgtg tagtacaggc cgtcgaagcg ctccctggat gcctggcagt cgaagctgcg     13080
     cgcctcgtcg acgctttggc agaccgaatt caccgtcacc acgatctgcg tggccggctg     13140
     gcccgaggcg gcgggcagca gggtgatgct gtggatgtcc gagttgttga tgccgcgccc     13200
     gggcgcatcg atgcgctccc aggtgtcgcc ggcatcggtg ctgcgccagg cgccgccttc     13260
     ctccacgccg aaccagactt cctcggcccg ttcggggtgg gcgcagacgg tcaggatgcg     13320
     cggccggtgc acgccgctgc agaactccgg cagttcgggg ctgagctgct cccagctctg     13380
     gccgccgtcg cgcgagcggt acatgcgggc gcgcgagggc gcgccggagc ccgcgaacac     13440
     caggcgcgga tcgcgcgggc tgaaggcgac ggaccagatc gtctggccgt tggcgggcga     13500
     gtcgacgagg ctgaaatgcg cgccgccgtc ggtgctcagg cagatgcccg cgtcggcccc     13560
     ggccagcacg cgggcgggat tggcggggtc gaccgccagg ctgcgcacgg tgccgtcgaa     13620
     ttcgatggct tccttcaggc ccaggcggtg ccagctggcg ccattgtcat tgctgcgcaa     13680
     tatgccctgg ccggccgtgc ctaccagaat ggttccctgc atatcggtct cctgtcgatg     13740
     cggtcgtgtt catgaaggcg ccgtgcgcgg cgcctcgggc gtgacgtgat ggatgcgcct     13800
     gggcgtggcg gcagggccgc gcgcccaggt ttcccctagt aggacaaatc gtgcatcgct     13860
     gacagaattg tagtactgaa tttgtttaaa gtgaatatat cgtactacca aagcggattt     13920
     ttcatcgttc gggtggacgc agggcttttc caacactctt gaggatgcac gggcatgaag     13980
     ttctatcacg aggtgcgcgg ctgctcgctg gccgtcgata tcgtcgcgcg cgagctgggg     14040
     ctggcgctgg acctgcagtg ggtcgacatg gccaataagc ggctggccga cgggtccgat     14100
     tacctgaagg tcaattcgaa gggcacggtg ccgacgctgg agctgtccga tgggcagttc     14160
     ctcagcgaag gcgcggtgat catgcagtac ctggcggacc agcggccgca gcaaggcatg     14220
     ctgccggccg ccggcacgct ggcgcgctac cgggtgctgg agtggatgag cttcatcgcc     14280
     gccgacctgc acaagggcgg cttcatgccg ctgttcaagg cgatcacgcc gcccgagtac     14340
     cggcgcatcg cccgccagta cctggacggc cgcctgcagt ggctgaacga tcagctggcg     14400
     ggccgcgaat tcctcatggg cgagacgttc accatcgccg acgcgcattg ctacacgatc     14460
     gccatgtgga cccgcgcgca cgacatcgac acgagcgcat ggccgcacct ggaagcctac     14520
     ctggcgcgcg tgggcgcccg gcccagcgtg cgcgccgccg agcaggccgc gcgcgacgaa     14580
     ggcgagcgcc agcgcgcggc cgccgcccga tgaggccatt tttcaaaccc tggatgacat     14640
     gaggtagcgc atgaactgga ccaaacgcat tgccattgtg ctggccggcc tggcggccgc     14700
     gccgctggcc ctggcggccg atcccgccgc gccgttgaag ctggtcgtcg gctttccgcc     14760
     tggcggcggc accgacgggg cggcccgtat cgtggccgag cacttgccgc agcagctcgg     14820
     ccgcccggtg gtggtcgaga accgcgccgg cgcggccggc acgctgggcg cgcaggtggt     14880
     gcggcgcgcg ccgccggacg gcaatacgct gttcttcggc accagcgccg aactgctgat     14940
     caacccgatc acgcgcaaga ccgcgcccta cgatgtgcag aaggacttca tgccggtcac     15000
     cgaagtcggc agcgtggcgt tcgtgctggt ggcgccggcc tcctcgaccg tgcgcagcgt     15060
     gccggacctg atcgccgcgg ccaaggcgcg gccgggcaag ctgaatttct cgtcgttcgg     15120
     catgggctcg accaatcacc tgatcggcga actgttcctg tcgaccacgg gcatctcggc     15180
     ctcgcacatc ccgtaccagg gcagcgccca ggccatgacc gcgctgctgg ccggggacgt     15240
     gaatttcacc ttcgacacgg tggcggtggc ccagccgcac atccagtcgg gcaagctgat     15300
     cgcgctggcc acgccgtcgc cggcgcggct ggccgagctg cccgaggtgc cgacgctgcg     15360
     cgagctgggc tacgcggacc tgaccgccga aggctggatg gggatcttcg cgccggtggg     15420
     cacgccgccg caggacatcg ccagcctgaa cgcggcgttc gccaaggtat tggcgttgcc     15480
     cgatgtgcgg gccaagctgg cggcgcgcgg cgtgggcatc gtgggcggct cgcccgagca     15540
     gtaccgcgac aagctggcga ccgagagccg caagtggcgc caggtggcgc aggactccgg     15600
     catctcgctg gaatagcggc gtgccgcatg ggccgcgcag gcgcggccca tggacgtgcg     15660
     ctcagccgcc caggccgtcg ggccgggtgg cgagcacctt ctggtagata cccagggtgt     15720
     ccagcagcga atcctgcagc gcctgcggcg acgagccgac ccagtcgtag ccctgcccgg     15780
     tcatgcgctg gctggcggcg gcatccttgc ccaggctggc ggcaagcgcc gcgatggcct     15840
     cgcgccgcgg ggccggcgtg ccggccggcg cgaacagccc gaaccagccg ctgaagtcca     15900
     gttgcgccac gcgctgctct tcgaaggtcc tggcgtcggg gaacacgcgc gtgcgcgtct     15960
     tgccggtgac gcccagcacc cggaccttgc cttcgcgcgc cagcccttcc agcgcgctgc     16020
     tggtgagaaa caccgcgtcg atatggccgc ccagcagatc ggtggcggcc tggctggaac     16080
     ccttgtaggg cacgtgcgag agcctggcgc cggtcgattg cgccagcagc aagccataca     16140
     ggtgcgccga ggaaccggtg ccgaaggtgc cgtaggtcag ggcctgcccg cgcgcgtcgg     16200
     cgacgaaatc atcgagcgtt ttccagcgcg acgtgctggc gaccgccagc acattggccg     16260
     tggtggccag cagcgtgacg gggctgaatt ccttgacgat gagggccgga tcggccttgg     16320
     cgatgagcgg gccgagcgcg tgggtgctgg aggtgcccag cagaagggtc gcgccgtcgg     16380
     gctgctggcg cgcgacgtgg cgcgcggcga tggcgccatt ggcgccgggt ttgttctcga     16440
     ccacgaaggt cgtgccgggc gcgcgcgact gggcgaagtg ggcgaattcg cgggccagct     16500
     ggtcggcgcc gccgcccggg gcgaacggcg ccaccagggt gaccagggac ggcagcgcgg     16560
     cgtcctgcgc catggcgggc cgggtgcgca ccagggcgcc gcttgccatc aggcccaaca     16620
     gcccgatgtt gaatgttctt cgcttcatga ccgcaatgct ccttgggcag ggtggcggcc     16680
     cgagcgggat gcgcccgcgc gctggccgcc aagaatgttg cttggcggcc aaatcgtact     16740
     acgaaattaa taaaaaaatc tatttggtac tacgatttaa gttgccagcc tcaggattgg     16800
     cggctgcgca gcacctgcaa ggcggtgcgc gaagcctggc gcacgtggtg cagcgcggcc     16860
     ttgccggcgg cgatttcgtc gcgggctttc agggcctcga agatctgggt cagttcgtag     16920
     agcgtctcgg gcaggcggct gggctcggac agcgacgtgc ggcgcagcag cacgatgcgg     16980
     ttgtgcagct ggcgcagcat gttgcccagc aggcggttgc cgcagccggc ggcgatggtg     17040
     tcgtagaacg tatcgctgag cgccagcgtg cgcgggatgt cgccctggcg cgccgcctcg     17100
     ctgagcgcgt cgaaggcggc ggccagcgtt ttcatgtggc cactgccggc gcgcagcgcg     17160
     aagccggtgc aggtctgcgc ttccaggatg ccgcgcacct cgtagatttc ctcggcctct     17220
     tcgtagctga gcaccgccac caccggtccg cggttgggca cgatctcgat caggccctcg     17280
     gcctcgacct ggcgcagcgc ttcgcgcacc agggtacggc tggcgttgag caattccatg     17340
     agctcgcgtt ccttcagccg ttctcccggc atgaagcgcc cggaaagaat cgtcttgcgc     17400
     aacgcgtcct cggcctggcg ccgcaggggc atcgaggcct tgtcgtcggt cgcgccgtcg     17460
     tggggcacgt cgggttccat cattctcatc tactcgcatc aagggggcag cccggcagat     17520
     agtagtgcaa cgggtccgcg cccgtctcgt gcgccggtgt tgtgccgaag ccgatttttc     17580
     atttatcata tttttggaat tgaattccat aaaatagaaa actggcggtc cggcagccat     17640
     ctgccggagg cgcggcccgc gccgctcgcc gcttgcgacc atcacctgaa aggatccaga     17700
     tcatgacgac agtgcatagc gcgactcccg aggaaaccag gcgcctgttg cagcagctgg     17760
     gcgtagaccc ggcgcggtac gacggcggca cgctggaggt gcgctcgccg atcgacgggc     17820
     aggcgatcgc gcgcctgccc gagctgacgg ccgaacaggc gcgcgcccgc gtggccgatg     17880
     cgcgccaggc tttcctggcc tggcgcaagg tgccggcgcc gcggcgcggc gagctggtgc     17940
     gcctgctggg cgaggagctg cgcgccgcca aggccgagct gggccggctg gtcagcatcg     18000
     agaccggcaa gatcctctcc gaaggcgaag gcgaggtgca ggaaatgatc gacatctgcg     18060
     acttcgccac cggcctgtcg cgccagctgt acggcctgac catcgccacc gagcgcgccg     18120
     agcaccgcat gatggaaacc tggcatccgg ccggcccggt ggccattatt tcggccttca     18180
     acttcccggt ggccgtctgg gcctggaacg cggccatcgc gctggtgtgc ggcgactcgc     18240
     tgctgtggaa gccttcggag aaggcgccgc tgacggcgct ggcgacccag gcgctgctgg     18300
     agcgggccct ggctcggttc ggcgacgcgc cggcccatct ttcgcaggtg ctgatcggcg     18360
     ggcgcgaggt cggcgaggcg ctggtcgacg acccccgcat tcccatcgtg tcggcgaccg     18420
     gctcgacggc catgggccgc aaggtggggc cgaaggtggc cgaacgcttc ggccgctcca     18480
     tcctggagct gggcggcaac aatgccgcca tcatctgccc gtcggccaac ctggacctgg     18540
     cgctgcgcgg catcgccttc tcggccatgg gcacggccgg ccagcgctgc acttcgctgc     18600
     gccgcatttt cgtgcacgag cagatcgccg atgacctggt ggcgcgcctg aagcaggtct     18660
     acgaatcggt cgccatcggc gatccgcgcg acagcggcac cctgatcggt ccgctgcgcg     18720
     accaggccgc cttcgacgcc atgcagcgtt cgctggccga tgcgcgcgcg gcgggcggcc     18780
     gggtgaccgg cggcgcgcgc gagccggtcg ggggccacga ccaggcctat tacgcgcggc     18840
     cggccctggt cgagatgccg gcccagagcg aggtggtcga gcgcgagacc ttcgcgccca     18900
     tcctgtacgt gatgcgctac cgcgacctgg acgaggccat cgcgctgcag aacgacgtgc     18960
     cgcaggggct gtcgtcgtcg atcttcacca acgacctgcg cgaggccgag cgtttcgtgt     19020
     cggccgaggg ctcggattgc ggcatcgcca acgtcaacat cgggccttcg ggcgcggaga     19080
     tcggcggcgc attcggcggc gagaaggaga ctggcggcgg gcgcgaggcc ggctccgaca     19140
     gctggaaggc ctacatgcgc cgcaccacca atacggtgaa ctatggcaat gcgctgccgc     19200
     tggcgcaggg cgtgaagttc gacgtggcct gaccgggaag cccgcgccat gaaacccgat     19260
     acccggttgg tgcacctggg ccgcgatccc gagcggttcg aggggctggt gaacattccg     19320
     ccgtgcagga cctcgacctt cctgcacgcg tcggtggcgg attaccaggc ggcggcgtcg     19380
     cgcaagcagg acagcctgta ctacggccgc ttcggcagcc agaccagccg ggcgctggag     19440
     gccgcctgca ccgagctcga cggcggccat ggcgccatgc tgttcccgtg cgggctggcg     19500
     gccatcacgc gcgtgctggg cagcctgctc gaaccgggcc agcatctgct gatggccgac     19560
     acggtgtatg ggccggcacg ggcgttctgc gaacaggagc tggcccggct gggcgtcgag     19620
     accacctggt acgcgccgga cgcggacctc gacgcgctgg tgcggcccgc cacgcgcgtg     19680
     atctacggcg aggcgcccgg ttcgctgacc ttcgaaatgc aggacctgcg cgcgctggcc     19740
     gaggtggcgc gccgccacgg cctggtctcg gtggtggaca acacctgggc cacgtcgtgg     19800
     ttctgccagc cgctggcgct gggcatagac atcagcatcc agtcggcctc caagtacatc     19860
     gtgggccatt cggacgcgat gctgggcgtg gcggtggcca acgaggcaca gtttccggcg     19920
     ctgcggcgcg cggccgcgca gtatggcaac gccgtcagcc cggacgattg ctatatggcg     19980
     ctgcgcgggc tgcgcacgct gggggtgcgg ctggagcgcc accaggccag cgcgctgcgc     20040
     gtggcgcagt ggctgcgcac gcgcgccgag gtcgagcagg tgctgcatcc ggcgctgccc     20100
     gacagccccg gccacgcctt gtggcggcgc gatttctccg gggccagcgg cctgttcggc     20160
     gtggcgtttc gcgccggcga cgacgccgcg ctggcgcgct tcgtggacga tctgcggctc     20220
     tttggcatcg gcgtgagctg gggcgggttc gaaagccttg ccttgcccag ccatccggtg     20280
     cgcaatacgt cggcggcggc cctgggcggc cggccgctgg tgcgcctgca catcggcctg     20340
     gaagacccgg acgacctgat tgccgacctg gctcgcgcgc tggaccgcca tatggcggcg     20400
     gcgcgcggct gactatcaat aacgatgagg ggaatgcagc aaatgagcga tatccagtat     20460
     gtcgagacca gcccgcgcta cagcaaggcg gtcatccacg gcgacacggt gtacctggcc     20520
     ggccaggtgg ccgacgaccc gggcggtacg gtgcaggacc agatgcggca gatcctggcg     20580
     cagatcgacg cgctgctggc gcgttgcggc acggacaagt cgcgcctgct gtcggccatg     20640
     gtgctgctca aggacatgcg cgatctcgag gcgatcaatc cgctgtggga cgcctgggtg     20700
     gtgccgggcc gggcgccgac gcgcacgccc agcgaggcgc ggctggcctt gccgggctac     20760
     ctggtggaag tgcaggtgac cgccgcgcgc tgagcgccgc ctcttgcggc ctgctttttc     20820
     cagccgccca gcgcggcttt cggcgctgcg catcgcgtgc gccgcgccgc gcggaaagtc     20880
     gtggaaaccg cgtcttgaca gcggcaaaaa ccggctcgta tcatctcgca tcgatcgatt     20940
     aatttggaat ttgattccat aaaatagaat tatcgaggcg gccgacaacc gtcccgcagc     21000
     agcacccgca gcaaccactc ccgtgcacgc aaggccaggt ccatcgtcga gcgcgccggc     21060
     acgcaaagat catcgaaaga ccaggaggtg gtggtatgaa gaagctgatt gtggcggcgc     21120
     tgttcgccgt tctgcccagc atggtgggcg cgcagcaggc gcccagggga accatgacta     21180
     tcgtcaatcc attcacggta agcggactga ccgacctggt cgcccgcatg gtggccgaga     21240
     aagcgcatgc caagtttccc gacggcgtgg cggtggttag caggcccggc gggggcgggt     21300
     cgatcggcat cgcgtcggtg gtcaatgcgc ggcccgacgg cagcagcatc ggcttcacgc     21360
     ccaccggcgc cgtggtcgat gcgccgcaga tgatgaaggg cctggcgtac aagacgcccg     21420
     atgacatcga tcccatcatc aatgtgttct cgtcgtacca gatgctggcg gtgcgcggcg     21480
     acgcggactg gaagacggcg caggatttca tcaaggccgt gcgccagtcg cccggcaagt     21540
     acagcctggg ccacacgggc aacggcaccg cctcgcacct gaacatggcg cagctggtgc     21600
     aggccgccaa gctgaacgtg ctggaagtgc cgtacaaggg ctgggcgcaa agcagcgtgg     21660
     cgctgctggg cgggcatgtc gacgccatcg tcatcaatgc cggcgagggc cgcgcgctgg     21720
     tcgacgaggg ccgcctgcgc atcctgggcg tgttccaggc ccagcgcgtg ccctaccacc     21780
     ccgacgtgcc caccttcaag gagatcggct acgacgtggg cgtgggcctg aagttcttct     21840
     tcttcggccc caggaacatg gacgccggcg tgaagcaata catccacgac gccttcaagc     21900
     aggccatgca gaacgacgat ttcaagaagt tcatcgcctc gcgcgaagtg gaagtggatt     21960
     acatggacgg cgcccagacc aaggccatgc tgtggtcgga gtacaagcag cacaccaagc     22020
     tgctggactc gctgggtttg ctggcaaagc agtgatgcac ggttacctgg aggatattca     22080
     tggctagcat caaggggttg cgggaagtgg cgtatttcga ttgcgccggc ggggggcagg     22140
     tctacgtgca gggcaactac gcctacatcg cgcacatgga cgccccggcg ggcacgacga     22200
     tcgtggacat cagcgatccg cggcatccgc ggcaggtggc gcacattccc attccggacg     22260
     gcgtgcacac gcacaaggtg cgcgtcgaga acgacctgat gctggtcaac tgggagtgtc     22320
     cgccgccgta catcctgggc gagaacttcc agggcggcct ggccatctat gatgtgtcgg     22380
     atcccaccaa tccgcgccag atctgtttct ggaagaccgc cggcaccggc gtgcaccgct     22440
     tcgacttcga cggccgccac gcctatatca cgcccgaggt cgagggctat cacctgaaca     22500
     tcgcgatgat cctggacctg gagaatccgg ccaagccgcg cgaggtgggg cgctggtgga     22560
     tgccgggcca gtgggtcgcg ggcggcgaga cgcccgacga aggctatcgc atgacgtggt     22620
     gccaccaggt gctgcgacgc ggcaaccgcc tgtacgtggc gtactggcac ggcgggatgg     22680
     tcatcctcga tatcgaggac atgagcaagc ccaagctggt gtcgaagttc gcgtacagcc     22740
     cgaccttcgc gcaccccacg cataccgtgc tgccgctgcc gttcgagctg gccggccgca     22800
     agatcgccat cgtggccgac gaggacgtgc gcaaggtgcg cccgtcgccg ccgccgttca     22860
     tgtggctgtt cgacattacc gacgaaaccc agccggtgcc gatctccacc taccagatcg     22920
     aagagctgat ggacaagaac atgcccgagt tcacgggctg ccaccagccg gccgagcagg     22980
     tgtacggcac cgagatcccg gtggcgtggt tcgccaaggg cctgcgcgtg gtcgacgtga     23040
     agaacccgca cgcgccgcgc gaggtggcgc acttcgagcc ggacatcccg ggcttcgacc     23100
     gggcgcagac caacgacgtc ttcctgacca aggaggggct gatgtacatc atcgaccgca     23160
     accgcggcat gcacattctc gagcgcatct gaggaggagg gcagtcatgt cggaagccac     23220
     gcgcaaggtg ccggtgacgg tgttgacggg acacctgggg gccggcaaga cgaccctgct     23280
     caaccgcatc ctgaccggcc agcacgggcg caagtatgcc gtgatcgtca acgagttcgg     23340
     cgagatcggc atcgacaacg atctgatcgt ggaatccgac gaggaaatct acgagatgaa     23400
     caacggctgc atctgctgca ccgtgcgcgg cgacctgatc ggcatcctgc acaagctgct     23460
     gcgccggccc ggccgcttcg acgccatcgt ggtggaaacc accggcgtgg ccgatccggc     23520
     gccggtggtg cagaccttca tgatggacga ggaggtgcgc gagaagaccg agctggacgc     23580
     ggtcatcacc atggtcgacg ccaagcattt tccgctgcgg ctggccgaca gccaggaggc     23640
     cgaggaccag atcgtctacg ccgacgtggt gctcatcaac aaggtggacc tggtgtcggc     23700
     cggcgaggcg gaccaggtcc agcgccgggt ggcggcgatc aatccgtacg cggcctgcca     23760
     ccgcgtgcag cgcgccgaga tcgacctggc gcgcatcctg tccatcggcg cgttcgacct     23820
     gcagcgctgc gtcgagctgg aggcgcgggc cgcgccggcc ggctgcggcc atgagcacga     23880
     gcacgacgcg cattgccagg gcgggaccga ccaccaccac catcatcacg agatctcggt     23940
     gatgtcggtg tcgctgcagg ccggcgccct ggatgggcgg cgcttctttc cctggataca     24000
     cagcctggtg gaaaagcagg ggccggacat cctgcgcatg aagggcatcc tggcgctcga     24060
     tgacgacgcg cgccgctaca tcatccaggg cgtgcacatg atcgtcgagg gcgagcacca     24120
     gcgcgcctgg cgcgacgacg aaccgcgcgc cagcaagctg gtcttcatcg gccgtggcct     24180
     ggacgcccag gcgctgcgcg ccggattcga ggcgtgcaga tcgcaatgaa gatgctcaac     24240
     cgcctggacc tcggcgtgcc gtgcctgcgg gccgggttcg ccggcgaaca ggcgtttttc     24300
     ctggcgatgg acggccgcct gcacgtgcag caaggcgacc agcgccgcgt cgtcgcgctg     24360
     catgacggcg atgtgctgtc ggcgtgcgcg gcgccgggcc aggccgatgc ggccgcctgg     24420
     ctgctgagcg cgggcgagga cgggcgcgtg atgcgggccg gcgcgggcga gccggactgc     24480
     gtggccagcg tgccgaacaa atgggtgacg gcgctggccg tggccgccga tggcgccctg     24540
     gcctacgcca gcggacgcac cgtgtggctg gccgggggcg gcggggaggc ggcggccctg     24600
     ccgcaggagc ggcccgtgca ggcgctgcga ttcagccatg gcggacgctg gctggccgtt     24660
     gccggctacg acggcctggc gttgtacgac cgccaggccg gcggcgagcc gcagcgcctg     24720
     gactggaaag gcatgcccac gcgggtggcg ttctcgccgg acgaccgttt cgtgctggtg     24780
     gccacgcgcg atgccgtgct gcatggctgg cggctggata ccttgcggca tttccgcatg     24840
     gtcggctatc cgcgcgcggt gggcagctgg tcgtggctgg ccggcgggca atggctggcc     24900
     accgacggct cggccggggc ggtcctgtgg ccgttcgagg gagaggaagg acccatcggc     24960
     agtacgccgc tggccctggg cgagcggccc gacggcgagg tgagcgcggt ggcctgccat     25020
     ccggcacggc cctgggtcgc ggtcggctac gccgacgggc tgatggtgct ggagagcacc     25080
     gacggcgcgc tgcggcgcat actggggcag gccgggcgcg accgtgtcgc ctgcctggcc     25140
     tgggatcggg ccggcgcgcg gctggcctat ggcacgccat cgggggcgtg cggcgtgatc     25200
     caggccgata cgggcgagga gggctgaaca tgtgcgcgga agtggactat gaagaccgcg     25260
     gcacctatcg caaggtgccg ccgccatcgg aggcgctggt cgagcgcacc cgccaggtgg     25320
     aggccggcat gcccggcgag cgcgtgcccg agcaggcctg gggcacgttc ttcgcggtgt     25380
     cgtgcggcgt gatggacatg ggcagcttcc agcgcatgtt cgaggcgcgc cgcatcgcct     25440
     tgtcgtacct ggcgatgcag cgcgcccgct atgcgcgccg gcacggcggc ggcaccgggc     25500
     tgcgctgcat cggcgattga cgggccgaag tgggagacga ttccatcttg tagaatccgc     25560
     tatccggaca ctgagcatcg gcgcgcggca tggcgcgctg cgggatctta tgggaaagac     25620
     actggtcaag ggtttgcatt tgctcgagcg gctggccgcc agccccgagc ccatgggtat     25680
     tacggaactg gccgccgatc tcgatctggt gcagagcaac gtgcatcgcc tgctgcagac     25740
     gctgatggaa agcggctatg tgcagcagga cgcgctgacg cgccgctacc gctgcaccat     25800
     gcgcttatgg gagatgggca cgcagatcgc cgaccgcatg gacctgtcgc gcatcgcccg     25860
     cccgcacatg caggcgctgg tcaagcagag ccaggaaacc gtgcatctgg ccatcctgga     25920
     cggcgccgac gtgctgtaca tcgacaagat cgacagcccc cagccggtac gctcgtatac     25980
     ccgcgtgggc gggcgtgcgc cggcttattg caccggcacc ggcaagatgc tgctggccta     26040
     ttgcgacgac ctggcggccg cgctgccggc caagctggtc aagcataccg cccgcagcat     26100
     cgccagccac gcggccctga aggccgagct gcggcgcgtg cgcgaggagg gattctccga     26160
     gaacgcaggc gaatggcgcg aggacgtcta cggcatgggc gcgccgctgt tcgacgccac     26220
     cggcaaggtg tcggcggcca tcggcatttc cggcccgctg gcgcgcatgg acgccgccgt     26280
     ggtggcgcgc gtgcggccca tgctgcagga gaccgcccgc atcatctcgc gcgagctggg     26340
     ctaccggggg tagggcatgc catccggtgc ctgtccccgc gggacagata ccgtcttggc     26400
     cgtcaagcgc cgatggcgta cggcagtgtg cctgtcccag cggggacagg cacacgcact     26460
     gacagacgcc atgaaatctt gcaggcgcca ggccccaagc aggggccggc tccagaagcg     26520
     aatccttgcg tgaaggcggg cgtgcccgat gcgcccgtcg tccatgcggc acgcgcgcga     26580
     tcccctcatg aacaagcacc cgacgcggga atgcgccatg gcgcgtccgc gcgccggctc     26640
     gcgcccacga aaagggaaaa cccgcattga ggcgggttat ttcaatcatc tatcattata     26700
     ttgtgattca tataaattgc aatgcaattc attgataggt ggaagatgtt gatcagtgcc     26760
     aggactttgc gcggcatcat cacggccacg cccaccccgt ttacgcggga aggcggcgtg     26820
     gatcgtgagg tgctgcgatc gcatatcgag ttcctcatcg gccggggcgc ggccgggctg     26880
     gcgccgctgg gcggcaccgg cgagtatccc gccctctgcg cgcgggagcg cgccgacgtg     26940
     gtgcgctgga cggtggaggc ggcccggggc cgcgtgccgg tcgtcgccgg cgtgctggcc     27000
     accggctacg aggacgccgt gcaggcgggc ctggcggcca gggaggccgg cgccgacgcg     27060
     ctgatggtgg tcacgccgta ttacgcgctg gccggcgacg caggcgtgcg cgcctatttc     27120
     gagcgctacc gcgcggccgt ggacctgccc atcgtgctgt acgagattcc gcgccgcacg     27180
     aacgtggagc tgcgcgccga aaccatcgcg gcgatggccg gcgacgggac catcgtcggc     27240
     atcaagtaca gcggttccga tttcgccaag ctgacccgcc tgatccacct ggccggcgac     27300
     acgctggccg tgctgtcggg cgaagagccg ttgtttcccg ccgcggtggc gctgggcgcg     27360
     gtcggcggcg tgctggcgat gtccaacctg gatccggcgc cctgggcgcg catccagtcg     27420
     ctggtcgagt ccggcgaaat ggcgcaggcc ttgcagttgc atcaccgcca gggcgcgctg     27480
     gccgatgcgg tctattccga aatgaacccc gtgggcctga aggccgccct gcaactgaag     27540
     ggcttcgcgt tcggcgaggc gcggctgccg ttgcagccgg ccggcccgca aaccctgctg     27600
     cgcctgcagc aggcattcga agcactggag tcctgaatga atacgatcta cgacagcgcg     27660
     gccgttgccg ccgggcggcg tgtcgccgcg cgcatggcgc gggtgaccac atccaagatc     27720
     tacctggcca tcgccaaggt ggccgatatg caggcccagg gaatgcaggt ggcatcgttg     27780
     accgccggcg aacccgattt cgacacgccg gcgcacgtca tcgaagccgc cgtgcaggcc     27840
     atgcgcggcg gcgatacgca ttacacgccg gtgcgcggtt cgcttgccat gcgggaggcg     27900
     gtgcgccaga agttccagcg cgagaatggc ctggcgtttc gcgacgaaga ggtgatggtc     27960
     gggaccggct ccaagcaggt catcgccaac gccctggccg tgacgctgga gaccggcgac     28020
     gaagtgctgc tgccggtgcc gtactgggcg gcctataccg gcatggtcta cgccgccggc     28080
     ggcgtgccca cgttcgtggg cacccgtgcc gaggacggct acaagctgac gccgcaggcc     28140
     ctgcgcgcgg cgctcggtcc acgtacccgc tgggtgatcc tgaatacgcc gagcaatcct     28200
     tcggggctgg tctacggcag cgacgagctg cgcgcgctgg gcgaggtgct gcgcgagcgg     28260
     cccgatgtgc tgatcctgac cgacgaaatc tacgagcatc tcaactacac ggccgagccg     28320
     ccggcgtcgc tgcgcaagct gtgcccggac ctggccgagc ggatcgtggt ggtcaacggc     28380
     gtctccaagg cctatgcgat gacgggctgg cgcctgggtt tcgcgggcgg cccggccgac     28440
     atcatcgagg ccatggccaa cctgcaggcg cagacgacgc tggcgccatg ctcgatcagc     28500
     caggctgccg cggtggccgc gctcaatggc ccgcgcgaat cgatcgatgc gatggcggcg     28560
     gcctaccgcc gccgccgcga cctggtcatg cagatcgccg gcggccagcc cggcgtgcgg     28620
     ctgcagcgcc cggacggcgc gttctacgcc atgctggacc tgtccgaggc gctggccggc     28680
     ggcgagcgct ttcgcggcga tcccgagccc gaccaggcct tctgcgaatg gctgctggag     28740
     acgcgccacg tggcggcggt gccggggtcg gtgttcggcg cgccgggttc ggtgcggatt     28800
     tccttcgcga ccgacgagca gaccatagaa cggggcctga ccggccttct ggacgcggcg     28860
     gcgcattgct agccgcgctt ttcatcgtgc agcgactgtg attgaaaaca cgggcggccg     28920
     cataccaggc cgtccatcca acggggagtt acagacatga atgcagtgat ccgcaagatg     28980
     cccgccatgc tcaagtggct gatggccgtt ccgctcgcgc tgggcctggc ccacgcccat     29040
     gccgagaccg tgctggagaa ggcccgggcc aagaacgaga tccggatcgc cacgtccgac     29100
     tcgctcaagc cctggggcta catggacgac accaacaagc ccatcggctt caatctggat     29160
     gtctcgcgcg agatgggcaa gcgcatgggg ttcgggaagg tgacgttcgt gaccgactcg     29220
     tacaagaact tcatctccgg gctcaacgcc gaccgctacg acatggtggt ggccatcctc     29280
     acgcccaccg aggagcgccg caagtccgcc gatttttcca atccgtacat ggtcgtgtcg     29340
     aagaatatct tcgtgcgcga cgacaacacc tccatccgtt cgctggaaga cctggccggc     29400
     aagcgcctgg gcgtggccgc cggcaccacc gacgaggcgt gggcgcgcca gcatgtcaag     29460
     gacgcgcaga tccgcgtgta cgacaacttc ttcctggctc tgcaagatct ggccatcggc     29520
     cgcgtggatg cgcgcatcac cgaccgcgtg accggcatga cggcggccaa ggaagggcgc     29580
     ttcccggtca agatcgccgg cccggacctg tcgcaggaca tcggggctat cgcctacaag     29640
     aaggggcagg acgatctggc ggccatcgtc aacaaggtca tccaggaaat ggtggatgat     29700
     ggctcgctga acgagatctc ccgcaagtgg ctggccggca tcgagatggg cgaggagctc     29760
     aagaagctgc ccaaggacgc gcgatgatcg aattgctgca caaggcggcg cccatcatcc     29820
     agggcgcctt gctgatgacg ctgctgctcg gcctcagttc cgcggtgctg ggtaccgcgc     29880
     tggggctggt gctggcgttg ttccggctgt cgccggtcgc gcccttgcgc tggctggcgt     29940
     tctggtatgt gtccatcttt cgcggcacgc cgctgttgct gcaattgctg ctgatctatt     30000
     tcggcctgcc gcactacggc atcgagctcg agccggtgcc gacggcaatc ctggccttgt     30060
     cgctgtgctc ggccgcctac ctgagcgaga atttccgctc gggcatcctg ggcgtggacc     30120
     gtggccagat cgaggcggcg cagtcgctgg gcatgggggc ggcgcgcagc ctgttccgca     30180
     tcatcctgcc gcaggcgatc cggatcgccg cgcccaccat gggcacgcgc tacatcgcgc     30240
     tgatgaagga cacgtcgctg gcctcgacca tcaccgtggt cgaactgacc aagatggccg     30300
     agcaggtcgg ctccaatacg ttccgctaca tggagatgtt catcatcgcc ggcgcgctgt     30360
     actgggtgat caaccagatg ctgacgttca tccaggtctg ggtggagagc aagctgggca     30420
     agggggtggc atgatgcaac acgaccaagc agccggggcg ccggtggtcc aggtcgaagg     30480
     gctgcgcaag tcctttggcg ccaacgcggt cctcaagggc gtggatctga cgatccggcg     30540
     cggcgaggtg gtggtggtga tggggccgtc gggttccggc aagacgacct tcatccgcag     30600
     cctgaatttc ctcgaagtgc cggacgaggg cgcgatcacg atctgcggca cgcaggtggc     30660
     ggtgcaggcc cgcgccggcc tcaagcgcga gcagcgccgc cgggtgcgcg agatccgcca     30720
     gaagacggcg atggtgttcc agtcgttcaa cctgttctcg cacatgacgg tgatcaagaa     30780
     catcatcgag ggcccggtac aggtcaaggg cgcagccagg gaccaggcca tcgagcaggc     30840
     gcgcgcgctg ctgcgccagg tgggactggc cgagaaggag aacgaatacc ccagccgcct     30900
     gtccggcggc cagaagcagc gggtcgccat tgcgcgcgcg ctggccatga agcccgaagt     30960
     gatcttcttc gacgagccga cctcggcgct ggatccggag ttgcgcgacg aagtgctcag     31020
     cgtcatgcgc aagctggccg acgagggcat gaccatggtc gtggtgacgc acgaagtgcg     31080
     tttcgcgcgc gacgtggccg accgggtgat cttcatggag ggcggcgtgg tgctcgagga     31140
     tgcgccctcg gccagcttct tcgatgcgcc ggccagcgag cgcatccggc aattcctgcg     31200
     gagggtgcaa tgacggccgg cgcgcggccc ggctgggccg ccgatccgct ggtcgaggcg     31260
     gtcgggcgcg agacgggcga gctcatgcgc ggcatccgcc atgacctgca cgcccacccc     31320
     gaactcagct tcgaggagca tcgcacggcc ggccgggtgc gcgcctgcct gcaggagtgg     31380
     ggcataccgg tgctcgacgg gctgggcgag acggccgtgg tcggggtgct gcgcgccggg     31440
     ggcggcgggc aggcgatcgg cctgcgcgcc gacatggacg ccttgccgat tcacgagacc     31500
     aatacgttcg ggcatgcgtc gcgccatgcg ggccgcatgc atgcctgcgg gcatgacggc     31560
     cacacggcca tgctgctggg cgcggcgcgg tacctgcagc gccatcccga cttcgacggc     31620
     acgatctacc tgatcttcca gccggccgag gagaacggcc gcggggcgcg cgccatgatc     31680
     gaggccgggc ttttccgcga ccatcccatg caggcggtat tcggcctgca caactggcct     31740
     ggcctggcgg cgggcaaatt cgcgctgacg gccgggccca tcatggcgtc gtcctcgcgc     31800
     gtgaaggtga catataccgg caagggcggc cacgccgccc tgcccgagca ggccatcgat     31860
     ccggtggccg cggtggcggc gctgcaccag gcgctgcaga cggtggtgac gcgcaatacc     31920
     gccgcgcacg acagcgtcgt gctgtcgata acgcagctgg gcggcagcga caatcattgc     31980
     gtcattcccg accaggcctg gctggcgggt tcgttgcgca ccctgtcgcc agcggtgctg     32040
     gaacggacct gcgcgcgcat acgggacatc gcccagggcg tggcggcggc gttttcctgc     32100
     gcggcgcgga tcgagatcga acacgcggtg ccggccacca tcaacgacgc cggcgccacg     32160
     gcgctgtgcc gcgacgcgat cgtgcaatgg ctgggggcga aatggttaaa tgacgggttc     32220
     atcccgacca tgggggcgga ggatttcgcc ttcatgctgc aggcattgcc cggctgctac     32280
     ctgatgctgg gcaatggcgg cgggcgcgag ggtgaaacgg cgacggtatg cgggttgcac     32340
     aaccccggct atgacttcaa tgacgagatc gccgccgtcg gcgccgccta ttgggtcagg     32400
     ctggccggcc attgcctgcc ccgcggcggg gcgggcccgc tggcatagcg ccggctaccc     32460
     ggcctgcgga acacactgcc gcgcctggac agggcggcat tcggaatttt ggagggatct     32520
     atggcgtcca agaaggccgc tggcgaggcg gacaaggatc atctgttcgt caatagcgtg     32580
     gccaaagcct ttcggttgct cgaggcgttc gacaaatcca ggcccatgag cggcttttcg     32640
     caggccgcgc gcgagatcgg catggaaaag agcgccgccc agcgcgccgc acacacgctg     32700
     tggcggctgg gctacctgga caaggtgggc cgcgacggcg agtaccgcct gtcgcgccgc     32760
     tgcctggaca tcggccagcg ttatctcgag accaatcgtc tcgtcgtgtg caccaacccg     32820
     tacctgaagt tcctgcgccg caagaccaac gcctcggtca acctggccat gctcgatggc     32880
     acggacacgg tctttccggt gcgctatacc agccaggaaa tgctcaacaa cgacctgggc     32940
     gaacgggcgc gcattcccgc ctactgcacg gccaccggga tagccatctt ctcggccatg     33000
     cccgacgagg cggtgcgcga ggtgctggag cgctcggatc tcaagccgct gatgcccaac     33060
     tccatctggc agatggaccg catcatggag cgcgtcgaat cggcgcgccg cgacggctac     33120
     gtgctgggcg tggaagagga tttcgccagc gacatcacca ttgcctgccc gatcagcgac     33180
     cccgccacgg gcgacgtggc cgccatcggc gtgtcgtatt ccagcgaagt gacggcggtc     33240
     gaacaggtgg tgcaggactg gtgcccgctg gtcatgtcga ccgcgcgcga ggtcaccgcc     33300
     cggctggccg aaagctgatg gccgcccctg tcccaaccct ttccggagat ccgccatgac     33360
     cgctgctttc gcatccctgg gccagaccat cgtcgagcag gccgcccggc ttgccagcca     33420
     ctccgacatg gaaggcggcc tgacctgtgc ctacctgacg ccggcgcacc gcgcgacgca     33480
     ggcgcagctg gcgcaatgga tggaggccgc cggcatggcg gtgcgcatcg acgccatcgg     33540
     caacgtgatc ggccgctacg ccgccgaccc cgccgtgcct gcgccgcgcg tgctgatgac     33600
     cggctcgcac ttcgacacgg tgcgcgatgg cggccgctat gacggccggc tgggcatcct     33660
     gctgccggtg gcggtggccg gcgcgctgcg cgatgccggc gtgcggctgc cataccacct     33720
     ggacgtggtc gccttcgccg aagaggaggg cctgcgcttc aagaccagtt tcctggccag     33780
     cggcgtgctg gccggcagct tcgatccggc gctgctggcg cgccaggatg ccgatggcgt     33840
     gacgctggcg caggccttgg ccgcaagcgg cctgcccggc gccggcgacc ccgcggcgct     33900
     gcgggccgcc gcgctggatc cggccacgct gctgggtttc gtcgaagtgc acatcgagca     33960
     gggcccggtc ttgctgcacc acgggctgcc gctgggcgtg gtgacgcaga tcgccggcag     34020
     cagccggttc atggcccgcg tcgagggcat ggccggccat gccggcacca cgcccatgaa     34080
     cctgcgccag gacgcgggcg cggccgccgc cgagatggtg ctgctggtcg agtcgcgctg     34140
     cagccaggtt ccgacgctgg tgggcacggt gggccagttg caggtgccca atggctcggg     34200
     caatgtgatc ccgggcgtct gccagttttc catcgatatc cgtgccgccg aagatccggt     34260
     gcgcgaggcg gcggtggccg acgtgcgcgc gggcatcgag cagatcgccc gccgccgcgg     34320
     cgtgcgggtg agcctggacg cggtgccgcc ggtgggtagc gtgccgtgcg cgcgctggct     34380
     gatggaccag ttcggcgccg cgctgtccga ggcgggcctg gcggtccatg agctgccgtc     34440
     cggcgccggc cacgacgcca tggtgatgca gcggatcgcc gacgtggcca tgctgttcgt     34500
     gcgctgcggc aatggcggcg tcagccacaa tccgctggag acgctgtccg ccgaggacgc     34560
     gcagcaggcc gccgaggtgt ttgccgcttt cctgcgccgc ttcgcgccgc gcggctcagg     34620
     ccgctaggcg gcggcttcga tccagcgcgc ccagcccagc agggcggcgt cgccgccatg     34680
     gctgcccgcc agctgcatgg ccaggggcag gccgcgcggg tcggcgccgt tgggcaggct     34740
     cagggtgggc acgcccagca gcgaccagtt gcggttcaac agcgaatcgc ccgaggacgc     34800
     gatgccggcg ggcgcggcgc ccagcgcggc cggggtgacg atcagatcgt agtcggccca     34860
     cagctcggcg taggcgcggc gcgcccgccg ggtgcgctgc caggcggccc gcagggcgtc     34920
     cggcgagcag gcctggccgg cctccagggc ggcgcgcagc gccgggctca gttgctcgcg     34980
     atgctgccgg tactcatgca gcagggcgcg cgaggcctgc tggttcatga tgtcgcgctg     35040
     gtcctggtac agcggatgca gcgccggcag gtcgggcacc tcggctacgc gcgcgccgtg     35100
     ccgttcgagg cggcgcaggc gcgccagcag ggcgtcgcgg ctgcgcgcgt cgatgcgctc     35160
     ccagtgcggg gtgcgataca ggccgatgcg cggcgcggcc gacccgggcg gcgcggccgg     35220
     cacgccggcc agcacgccgg ccagcagctg gatgtcggcc acggcgcggg ccatcaggcc     35280
     gaccgtgtcg agcgattcgg ccatcggctt gacgcccgtg cggtcgatca ggccgaggct     35340
     gggcttgtag ccgacgacgc cgcagaacgc cgcgggccgg atggtggaac cgccggtctg     35400
     ggtggccagc gccgccggcg ccatgaagtc ggccacgcag gcggccgagc cgccggacga     35460
     gccgcccggc gtgtgttgcg gcgcgtgcgg gttgcgggtg gcgggcgggg ccgagtgggc     35520
     gaattcggag gtggcggtct tgcccaggat gatgccgccg gcggcttcga tggccgccac     35580
     gcaataggcg ctccaggccg ggcggtgccc cgcgtagatg ggcgaaccat aggcggtggg     35640
     catgtcggcg gtgtcgatga tgtccttgac cgcgatcggc aggccggcca gcgggcgccg     35700
     cgggtcgggc cgggcgccgg ccatggcgcg cgccttgcgc agcgcgcccg cggcgtcgac     35760
     ccaggcccag gcgcggatct gctcctcgcg cgcggcgatg cggtccaggc aggcctggac     35820
     caggtcgacg ctgtcgcagg cgcccgccat caggcgttcg cgcgcctcgt gcaggccaag     35880
     caggtgcagg ggctgcatgg cgcggatcag cgcgccgcgg gccggtgcag gccgtgccag     35940
     tgccgggcga tatccaggcg gcggcacacc cagacccgct cgtgcgccgc gacgtggtcg     36000
     agaaagcgcg ccaggccggc ggcccgcccc gggtggccga ccagccgcat gtgcaggccg     36060
     acggacatca tcttcggctg ggtggcgcct tcggcgtaca gcatgtcgaa cgagtcgcgc     36120
     aggaaggcga agaaatcgtc ggcggtggcg atgccgctgc gcacgaactt ggcgtcgttg     36180
     tgcgcctggg tgtacgggat gaccaggtgg tggcggtcgc cggcgtccac ccagtagggc     36240
     agctcgtcgt tgtagctgtc ggagtcgtac aggaagctgc cctgctcgag caccagcttg     36300
     cgcgtattca cggtgggcgc gtagcggcag taccagccgg ccggcgcctg gccggtggtg     36360
     cgttcgatcg acgcgacggc gcgctgcatt tcctcgcgct cctgcgcttc ggacagggcc     36420
     tgcagcggcg tccagcgcca gccgtggcag cagacgtcgt agccgcctgc gcggatggcc     36480
     tgggccaccg cgggattgcg ctccagcgcc tgggcgcagg cgaagaaggt ggcggtcatg     36540
     ccgcgctcgc gcagcaggcg cagcacgcgc cagataccga cccggctgcc gtactcgaac     36600
     atggattcgg ccgccaggtc gcggccctgg aagctgctgc cggtgacttc ggtgaggccg     36660
     agctcgctgc ggccgtcgcc gtcctcgaac gaggcttcgg agccttcttc gtagttgacg     36720
     acgatattga gggccaggcg ggcctggccc ggccattgcg ggtcgggcgg cgtgctgccg     36780
     tagccgacga agtcgcggcg ggtgagtagc gagcggtcgg tctgcatcgt cattcctcgt     36840
     ggaagacaac cagggcgtcc tggtcgagtt cggtgtattc ggtgtcgtcg tcccggccgg     36900
     tcttgcccag gatcacggcg acctgcgaat ccgtgtcgat ggcggtgaag gcatagtgcc     36960
     agacgccggt ccggtacgac acgccctggc ggccgttggt gacgaaggcc cgcagcgtcg     37020
     gcagcgccag ggcgccgtcc ggtccggaca ggcccaccac gaccacgtgg cgcgacggca     37080
     ccagcgggat gaaggtttgc gccgagtgcg gatgccgctc cagcgtgcgc acccggatgc     37140
     catcgagcgg ctggcggtgc aggcggttga cggtaaagcc cagcgtcacg ccctggcgcg     37200
     ccgagccgaa gggcgtggac agcggccgct tggccgtgtc cccgcggttt tcgaccactt     37260
     cgccatactg cgagaaggcg tcggcgctca gtgtgctggc ggatagatac atggaagaca     37320
     tacgtcgggg atgggcgtca gaagagtcgg ttgggcagcc acagcgcgat ctgcgggaag     37380
     tagatcagca gcgtgacgaa aaccatcatg gcgaaggcga acggcagcac gccgatgtag     37440
     acgtcgctga tgccgccgcg cgacaggcgg atgttctgcg ccacgaacag gttcaggccg     37500
     accggcgggg tgatcagcgc cagctccatc atcatggtca tgaagatgcc gaaccacagc     37560
     gggtcgaaac ccagcgagac gatcagcggc accaccacgc ccacggtggt gaccatcatg     37620
     gcgatggcct ccaggaagca gcccagtatc aggtagaacg ccaccagcac ccagatggtg     37680
     gcggtgggcg accagccgag ctggccgatg tactcggaca gcgcctgcgg gatgccggcc     37740
     aggctgagcg agaagttcag cacgaaggcg gtggtcacca ccagcaccac catggcggtg     37800
     gtgcgcagcg ccgacaggaa ggccgcgtgc agcatggcga ccgaaagcgt gcggttggcc     37860
     gcggcgatgg cgatggcgcc caccacgccg agcgcggcgg cttcggtcgg cgtcgcgatg     37920
     ccgaggtaga tgccgcccat caccaggccg aagatgaaca ccaccggcag cacgtcgatc     37980
     agcagcttga gccgcatcgc cagggggatg atcagttttt cgttgtccgg ggcgaccttg     38040
     cccagcaggg ccatgatcac gatcaccgcc atcattagga gcagcacgat gatgccggga     38100
     acgatgccgg cggcgaacag cttgcccacc gacacttcgg ccagggcgcc gtacaccacc     38160
     atgttgatgc tgggcggaat caggatgccc agcgtgccgc cggcggcgat cgaaccgagc     38220
     accagccgtt cccggtagcc caggcgctgc agcgtgggca gggccacggt gccgaccgtg     38280
     gccgaagtgg ccacgctgga gccggaggtg gcggcaaaca gcgcgcaggt ggcgatgttg     38340
     gtgtgcagca ggccgccggg cagccactgc agccaggccg ccagcgcctt gtacatgcgg     38400
     tcggccacgc cgctgcgcgt caggatctcg cccagcagga tgaacagcgg gatggccacc     38460
     agcaggaact cgttcatcgt gctccacatg gtgttgccta tcatgctggg cagcacctgc     38520
     atgctcatcc agtcgctgac caccgcggtc atgaagatcg cgctggccac gtggatgccg     38580
     gccatcagga acaggaccag gccgccgaaa taaagggctc cgagcagcat cagtgcgctc     38640
     cttcgagctt gccggccatg cgctcgttgg ccgaacgcaa ttcctcggcg acctcttcgt     38700
     cgacgctggg attgccgtag ttgcggttga tgccgcccca gtcgcggcgc gccagcagca     38760
     gcagggagtg cagcagctgc gtggccagca ccaggccgaa ccagcacagc gcggcggccc     38820
     acatggcttg ggggatcgcc agcggcgtgc gcagcgcgct ggtggccagc gcctgcatcg     38880
     agtacgagtc gtacgccacc ccggtggcct tgaccgccag ggtgagcgcg accgaggtca     38940
     agagcgccag cgcgaacaca tcgctgcagg cgcgcaggcg ctgcggcagc aggtcggtca     39000
     gcaccgagat gcggatgtgc gcgcggtcgt aggcggcctg cgagaagccg atggaggcgc     39060
     agatggccag gcagtagccg ccatactcgt ccacgccctg cagcgagaag ctgaagatct     39120
     tgcgggccag cacgttcagc gctatgacca ccgacagggc gatcagcgcc cacccggccg     39180
     ccaggcaggc ccggttggtg atggcccgca ggccgccgca cagcagttcc agaagtctag     39240
     tcacgatcgg ttcctggtga atgcggcgcg ccgcccggcc ggggcggcgc gccagggcag     39300
     gttgcgctag cgcgcgatgc cggccgccgc gccgatggtg cggaaccagt cgtcgccgca     39360
     ggtcttggag aacttcgagc aatcctcgat ccacatcggc acgatcgagg tcttgagcag     39420
     ttgcttgact tcgcgcacgt cggcctcggt gggctcgacc agctgcatct tgccgggctt     39480
     gccggtgcag ggctgcttgc cgacgttgca gttgatgccg tcctcgtggc ccttgcggct     39540
     gatgtcccac agcgcggttt cgagctgctt catttcggcc gacagggcgg cctgctggtc     39600
     ggccgacagc ttgtcccaga aggcgttgcg cgccacctgc agcaccacgc cggcgccgcc     39660
     cagcgggatg gggctgagcg agtgcgcgac ctcgaaccag tcgttgctgt tgccatactg     39720
     gctgccggtg atggcgcagt ccaccacgcc ctgcatcagg ccctggtaga cctcggggcc     39780
     ggccagcgtg gcgccggcgg cgttcaggtc ggccaccatc ttggcggtgt aggtgccgct     39840
     gacgcgcacc ttcttgcctt tgagatcgtc cagcgtcttg atgtcgccct tgcagtacag     39900
     gatctggaac gggaacgacc acgccgtcag cagcttggcc ttgaagcggt cgttgagctc     39960
     cttttcgagg atggggcggt aggcgtccag gttcttctgc agctggtcga agtcgaacgc     40020
     cgcgccgggc aggtcggcgc ccatcagcac cggcgcgtcg ccgcccacga agctgatctg     40080
     gaacgacacc acgtcgaacg cgccgctttg cagcgtgcgc agcgattcga agcccttcag     40140
     gcccagctcg tcgatggtgc ggaagttggc cgagaacgcg ccgttgctgc gcttgggcag     40200
     gtccttccag aagggccgtt cgacctgctg cgattgcggc tggttgccgt accagcccag     40260
     cacgcgcatc ttgacctcgt cggcgcacgc gaccgacgac atccccgcgg ccaaggcgag     40320
     cagcgcgatg gaccgttgca gtattgcctt catgatgaat ctccccctgg gtggctgtat     40380
     aggtgtcatg gaggcccgag gtcctgccgc ctccttgttg cagttgaatt atgaatagtc     40440
     cgatgaaata atcaattatt aaattttgga tcatttctat aaacaggact tatagtgaat     40500
     ctgcggctga tcgagatatt ccgggcggtg atgcaaagcc acaccacggt cggcgcggcc     40560
     cgcgccctgc agatttcgca gccggcggtc agcagcgcga tacgccagct ggaatcgcaa     40620
     gtggggttca cgctgttcga tcgcgtgggc aatcgcctga gcgcgaccga agaggccaag     40680
     atcctgttcc gcgactcgga gtcgatcttc ctgttgtcca aggccctcaa ccacacggtc     40740
     gaggaactca agaacgagcg gctgggccag ttgcgcatcg tcgccacgcc gcagctgggg     40800
     cattcggtgc tgccggcggc catcaatgac ctgctcaagc agcggcccaa ggtgaaggtg     40860
     ttcttcgacg tgcgccgttc gtacaacgtg gtcgagatca tcgagtcgcg cgcggccgac     40920
     atcggctttg ccatcgcgct ggagcccgag ctggagcaga agctgcacat gctgccggtg     40980
     gcgcgcgtcc agatggtgtg cctggcgccg gccgaccatc cgctggcccg gcgcaagtcc     41040
     gtcacgccgc aggacatctc gccgtatccg ttgatcgggc tggagctggg ctcgcggctc     41100
     agtccgctgg tgctcaatgc cttcaagcag gccggcacgc cttaccgcac cgcggtggag     41160
     gtgcgctatt ccgagacggc ctgcctgctg gcgcaggccg gcgtcggcgt gaccgtggtc     41220
     gacctgttct cggccatggc ccaggccagg cacggcggcg ggctgaagat catcccgttc     41280
     aagccggcca tcgaggtcga ggcgttcgcc gtctcggcca agaaccgcgt gccgtcgcgt     41340
     ctggcgctgc tgctggtcga ggaaacgcag aaatccatcc ggcgcttcca gccggcctga     41400
     tcattgcctc gcgccgccgc gaggggggat cgtggcgcgc atcggcgaca atgaaggccg     41460
     gcgcgccatc cggcgccgcc ctgtcgccga gagcccgccc catgagattg ttgccggcca     41520
     tgggcgcgct tgcgctgctg ctgcatgcgc ccgccgcgcc cgcccaggac ttcgaccgcc     41580
     acggccacgc gctggtgcgc gacgcgcagg gctgggtcta catcgaccgc gcgcaccgcc     41640
     cggtgctgcg gcctttcatc tacgacaatg gccccgacta ctacgaggag gggctggcgc     41700
     gcttcgtcga gcacggcagg atggggttcc acgatgaggc gctcaacatc gtcatcccgg     41760
     ccgaatacga tttcgtgttt ccgttccagg gcggcaaggc cagggcgggc atggactgcc     41820
     gcgtgcagcg ccacggcgag cacggctcgg tgagctgccg gcgctggacg acgctgacca     41880
     ggccctagcg cgactccatc cagtcgatga ccagccgcat ggtccgcagc acatgctcga     41940
     tcatcgcttc gcgcgcggcg gcgccgtcgc gccgcgtcag cgcggcaatg atggcttcgt     42000
     gctgctggat gttctcttcc atcagccgcg gcggcatttt cgaggcaaag cccagcacgt     42060
     ccgagacgct gctgctttgc agttcgctga ccatgtccag cagccgctcg ttgtggctca     42120
     gttcggtgat gaggtggtgg aagtcgaagt tgtgctgcag ccactccgac ccgcgctcgt     42180
     tgcgcacccg cgagcgtagc gtgctggcgt agtgcttctg gtgctgggcg agcagcttga     42240
     gatgcttgtc ctcgatccag tcgaccgcca gccgcgcggc cagcccctcc agctcggccc     42300
     gcacttcgaa ggcctcgcgg atggcgcgca ccgagggaat ggcgaccatg gcccgcccgg     42360
     tgtcggtcag cgagatggcg cgccgcgctt ccaggaagcg cagggcttcg cggatcgggg     42420
     tgcggctggt tccgaactcg ctggccagtt cgtactggct caagctgtcc ccgggcagat     42480
     agcggccgga ctggatgcgc cgcaggatct cttccgagat ttccgtcgac gatcgggtct     42540
     ggctcttggg ggcggatctt gcgctcatcg gtctcgttgt ctatgcggga cagccgggcc     42600
     ggcatgcctg ccggtcgcgt ccgcgcgggt tcaaggcggg gcggcgcgcg gcaaagcgcg     42660
     ccggcacagg cactgattgt agtgaggatg ctccccggtc cggaaatgga tgcgccggcg     42720
     tccggctgcc gccttgcggg taatcccgga tgccggtccg cggccgcgtt atgtaggatc     42780
     cgtttttatc taaatgggat cccattttag acatacggaa ttcttacacg gagagccaca     42840
     tgagcgatat cgaccccatc acttcagcca ggatcctcaa cccgggcggg cgcggcggcc     42900
     cgctgaccga ggcccaccag cccatgcggg ccatgcatcg cgacgatatc gaatgggaga     42960
     acctgcgcta cgaggggcag ttctcgaaga tgatgttcca cccggtgcag gacgaccgca     43020
     ccattccgaa cgccggcatc gtccgctacg agaagggctc gggccatccc ctgcacaacc     43080
     attacttcgc ccagatctgg tacgtgctga gcggcaagtt cgagatcgaa ggcaaggtct     43140
     atggcgaggg atcgatgatg ttccatcccg acccgcacta cgagtacgcg ctgaacaccc     43200
     tggaggacgg ggagatcctg tacgtccagt acatggggcc gaccacgcgc cagcccgcga     43260
     tctacgaagg ccgcttcaac atggagacgc gccgtccgct ggaggatgaa tcgacggcag     43320
     cctgagcgcg cgcggcggat cgccgggcgc atacgcggcc gccagccggc ggccgctcac     43380
     ggggcggccg gcgcggcgcc acgcaatgaa tcgggagaac ggtaatggaa aggctgatcc     43440
     aggtcctgga cctgttcagc gacaggatgg gccggctggc cagcatggtg atgctgcccg     43500
     tcctgctcgt cactttcgcg gtggtcgtcc tgcgctatgt attcgggatc ggcctgatct     43560
     ggctgcagga cagctatgtg tggctgacca gtgttttctt catctgcatg gccggcaata     43620
     cgttcctgca tgaccgccac gtgcgcgtcg agctgttcta ttcgcgcatg accgccagga     43680
     agcgggcgct ggtcaacgcg ctgggcgtgc tgttgctgct gtggccgacg ctgttcgtga     43740
     ccgtgcagca gagctggcgg ccgatcgccc ggtcgtggcg cttcctggaa gcctcgccca     43800
     acgccggcgg gctgtcgttc gcctatgtgc acaagagcct ggtgtacgtc ttctgcctgg     43860
     tgctgttcct gcaggggttg tcgctgctgc tgaagtcggc gcgcacgctg gccggcgcgc     43920
     gcggcgttgc gccggaggcc tcgccatgag cctgagcgac gtgctttgcc tgctgatgtt     43980
     cgccaccgtg atgggcacca tgatgttcgg tttcccggtg gcgttcacgc tgtcgggcgt     44040
     gggagtggcg ttcgccctgc tgggttcggc gctggacgtg ttcgagtggc gcaccatggg     44100
     cggggtgatg gggcggctgt acggcatcat gagcaacgag atgctggtgg ccatcccgct     44160
     gttcgtcttc atgggcatca tgctggagaa gtccaaggcg gccgagcgcc tgctggtgac     44220
     cacgtccagc ctgttcggct cgctcagcgg cggcctggct ttcacggtgg tgatggtcgg     44280
     caccctgctg tcggcggcca ccggcatggt cgccgcgacg gtggccacgc tggccttgat     44340
     cagcgtgccg gcgatgcggc gcgccggcta ccagccgtcg tacatggccg gttcgatctg     44400
     cgcgtcgggc acgctgtcgc agctcatccc gccgtccacc gtgctgatcc tgatcggcga     44460
     catgctgcgc ggcgtcacgc cgccggaccg ccccggcggg ccggtgaccg tcagcgacct     44520
     gttcgccggc gcggtgctgc ccagcgtgct gctggtggtg ctgttcctgg gctatgtgct     44580
     gtaccgggcg ctgttgcggc cggatacctg tccgccgctg ccccgcagcg ccggacagcg     44640
     cgtcggcctg cggcaactgc tggtggacgc ggtggccccg ctggccctca tcatcgccgt     44700
     gctgggctcg atcctggccg gcatcgccac gccgaccgag tcggcggcgg tgggggcgat     44760
     gggcgccgtg ctgatcgcgc tgctgtacaa ggcgctgtcc tggccggtgc tcaagcaggt     44820
     ctgcatggcg accgggcacc tggtggcgat ggtgttcacg atcatgatcg gcgcggcgat     44880
     cttctcgctg gtgttcaagg ggctgggcgg cgagcacctg gcgcgcgaac tgctgtccag     44940
     cgtgccgggc gacctctatg gcgccttgct gctggtgctg ctgatcgcct tcgtgctggg     45000
     cttcttcctg gattcgttcg agatcatttt cgtcgtcatt ccgatcttcg gcccgccgct     45060
     gctgtcgctg ggcgtggacc cgctgctgtt cggcgtgctg ctggccgtca cgctgcagac     45120
     cagctatctc acgccgccgt tcgggttcgc gattttctac ctgcagggcg tctacaagga     45180
     tatcggcgcc gagaccgcgt accgcggcgt gttgccctac atcgccctgc aggtgggcgc     45240
     ggtggcggcc ttgctgagct ttcccgccct ggcgacctgg ttgcccaccg ttctttactg     45300
     agcgcgcgtg cgcgccttcc cataacgcac aaggagacaa catgaacccg aattcggaca     45360
     acaagcgccg caccctgctg cgggccgcga ccgtgggcgg actgggcgcc gtgctggccg     45420
     gcgccgcgcc gccggcgctg gccaagccgc gcgtgcgctg gcgcatgggc atggcctgga     45480
     cccgctcggc gcccggctac acgacgccgg tcgtcgcgct ggccgatttc ctcgacaagg     45540
     cgaccggcgg ggcgttccag atcgaggtgt tcggcgccgg cgacctcgtg ccggccatgc     45600
     agaccttcga cgcggtgctc gacggcaccc tcgactgcgg ccacggctat gccagctact     45660
     ggtcgggcaa gtcgatcgcc atgaacctgg tgatgagcat gccgttcggc accacggccc     45720
     aggagaagaa tgcctggctg cagtacggcg gcggacaggc gctggcggac aaggtgtacg     45780
     agcggctggg cgccaagttc ttcccgctgg gcaattgcgg cgtgcagccc atggggtggt     45840
     tccgcaagga gatcaactcg atcgacgact tcaaggggct gaagttccgc gtcagcggcc     45900
     tgcccggcga agtgctgcgc gagtgcggcg tggcggtggt cggcatgccg ctgggcgaag     45960
     tgctgcaggc catgcagtcg ggggcggtgg acgcctgcga gctgaccggg ccgtacatcg     46020
     acaccacgct gggcatccag cgcatcgcca agaactatta ttttccgggc tggcacgagc     46080
     cggaagggca gttcgacctg ttcatcaacc tggacgcctg gaacaagctg agccccgagt     46140
     acaaggagct ggtgcgggtg ggcgcctact atgccaacgg cgtgatgctc aacgaactgg     46200
     tcgccaagaa cggcaaggcc ttcgaggacc tgcgcaccga gcacggggtg acggcgcgcc     46260
     tgctgcccga cgacgtgctc aagcgcatgc acgagatcac caacgacctg ctggccggcg     46320
     cctacgagcg cgacccgctg gcgcgcgagc tgcgcgacag cctgcgcgcc ttcctgggcg     46380
     cggccgcgcc ctattcggag tactcggaac tgctgttcat gcaggcccgg gcgaacctgt     46440
     cggggcggcc gcgcctggga ggctgagcgg ccgggcctag aatggcgggc tgacagacag     46500
     ggattcgagg gcttatggca gaccgcgtga ccaaggcttt ccagcttgcg acgctgaaga     46560
     tccggctcaa cagcgcggac ctcgaacgcc tcgacctgca ccagcgcatc cagcgcgccc     46620
     tgcgcgcgct gatcctcgac ggcgcgctcg ggccgggcgt gcgcctgccg gcgacccgcg     46680
     cgctggcggg ctcgctcggc gtggcgcgcg acacggtcga gaatgcctat gtgcaactgc     46740
     accgcgacgg cttcatcgtg cgtcgccagg gctcgggcag ctatgtctcg gagacggtgg     46800
     gcgcgcgcct gctgggcgcg gcgcgccggc gtagcatggc ggcgggcgag ccgcgcgccg     46860
     agccggctcc cgaggcgggc ctgagccggc gcggccggca gatccacgac agcggcgggg     46920
     tgcccgacca gcggcaggtc cgggcgttcg ccaccggcct gcccgaaacc cgcacctttc     46980
     ccgtcgacgt ctgggagcgg ctacagcgcc aggccctgaa agaccatcgc gccggcgtgc     47040
     tcctgcatgg cgatccgcaa ggcgcgcagc cgttgcgccg cgcgattgcc gcctacctga     47100
     acctggagcg cggcgcccag gtggacgccg agcagatact ggtgctcagc agcacgcggc     47160
     aggcgctgtt cctgtgcgcc cagttgctgg tggacgccgg caagccgatc ctgatggaga     47220
     accccggcta cttcggcgcg cgcaaggcgt tcgaggcggc cgaggcccgg atcgtgccca     47280
     tcgacgtcga cgcgcacggc ctgcgcaccg acttgctcaa ggccgaccgc agcggcgcga     47340
     actgcgtcta cgtgacgccc tcgcaccaat atcccaccgg cgcgaccctg tcgctggagc     47400
     ggcggctcga cctgacggcg tgggcgggcg cgcaagggcg gtggatcatc gaggacgact     47460
     acgatagcga gttccactac gacggcctgc cgacggcctg cgtgcagggc ctggaccgcc     47520
     accagcgcac gatctacctg ggcacgttcg ccaagacgct gtacccgggc ctgcgcctgg     47580
     gctacatggc gctgccgcgc cagctggtgc cggccttcac gcgggcgcgc gccatcatgg     47640
     acgggcatac gccgcagatc acgcagctga ccctggcccg cttcatggac gacgggcact     47700
     acaactcgca tgtgcgcgcc atgcgcaagc tgtatgcggg gcgtcgcgac gcgctgctgg     47760
     actcgcttgg ccagtcgctg cggggcatcg ccaccgcggt gcgcccgccc ggcggcctgc     47820
     aggtgccgtg cctgctcgag cgcggctggt ccgaggccag gaccatcgcc caggcggccg     47880
     ccgccggcat gcgcctggcc ggcctgagcg ggctgtacgc gggcgaggac ggccggcagg     47940
     gatggattct cggctacgcc tgcctggccg cgcacgagat cgaggcggcc gtgctgcggc     48000
     tgcggcgcgc cctgaaggcc tgaacgcgcc gctgccgtca gtacggcagc ggaaagcgcc     48060
     ggctcagctc ggccgcccgc gcgggcacgg cgtcgcggcc gccggcctgg ccgccatcgc     48120
     gcaggccgcc cagcacggcc aggaccaggt cgccgatctg ccggaactcg gccggcccca     48180
     tgccgcggct ggtgcaggcc gcgctgccta cccggatgcc ggaggtgacg gcggggctgg     48240
     cggcgtcgcc cgggacggcg ttcttgttca cggtgatgcc ggcttcttcc agcgcccgtt     48300
     cggcggcgtt gccggccagc ccccacggcc gcaggtcgac cacgccgagg tggcagtcgg     48360
     tgccccccga gacgatggac aggccgcctt cggccaggcg cgcgcacagc gcacgggcgt     48420
     tgtcgatcac ggcgcgcgcg taggcgcgga agccgggctg cagcgcctcg cccagggcca     48480
     cggccttggc ggcgatgaca tgcatcagcg ggccgccctg caggccgggg aacaccgcgg     48540
     cgtcgatgcg ccgggcgatg tcggcgtcgt cggtgagaat catgccgccg cgcggtccgc     48600
     gcagggtctt gtgggtggtg gtcgtggtca cgtgggcgaa cggcaccggc gaggggaacg     48660
     cgccgccggc caccaggccg gcatagtggg ccatgtcggc cacgaacagg gcgccggtcg     48720
     cgtcggcgat ggcgcgaaag cgcgcgaaat ccggcacgcg cgcataggcc gagccgccgg     48780
     cgatgatgag ccgcggccgc tcgcgccggg ccgtgcgctc gacctcgtcc atgtcgatgc     48840
     ggtgcgacac ggggtcgacg ccgtagctca gcgcctcgaa ccacttgccc gacaggttga     48900
     cgtgcgcgcc atgggtgagg tgcccgcccg ccttgaggtc caggccgagg atgcggtcgc     48960
     cgggcgcgag cagggcgagg tatacggcct ggttggcctg gctgccggag tgcggctgca     49020
     cgttcgcgta ttcgcagccg aacaggcgcc gggcgcgctc gatggcggcc cgctcggcaa     49080
     cgtcgacgtg gcggcagccg ccatagtagc ggcggcccgg atagccctcg gcgtacttgt     49140
     tcgtcatgac cgagccctgc gcgtcgagca cggcctggct gacgaagttc tcggaggcga     49200
     tcagttcgat cgagtgcatt tgccgctggc gctcggcgtc gacggcgcgc cagatttcgg     49260
     ggtcggcatg ccgcaggggc agcgcgcgcg cgccggcggg cgcggcggcg gcgggaagca     49320
     ggtcgttcat cgggtgtcct gggacgtagg ggaaagcagg gcaggccggg ccgcggcggg     49380
     ctcgggctgg cggaaatgga tcagtccatg cgcggccagc ccggccacca gcccccagaa     49440
     ggcgccgccc acgcccagca gcgtgacatt ggccgccgtg gccaggaagg tgatgagcgc     49500
     ggtctcgcgg gtgcgcgcgt cagccatggc gctggccagg ctgccgccta tggtgcccag     49560
     cagggccagc cccgccaggg tggtgatgaa ggtcttgggc agcaccatga acagcgtggc     49620
     cagcgtgacg ccgaacaggc ccaccaggat gtagaacacg ccgcaggcca ggccggcgat     49680
     atagcgcttg cgcggatcct cgtgcgcgtc gcggccggtg cagatggccg cggtgatcgc     49740
     ggcgacgttg aaggtatggg cgccgaacgg cgccatgacc agcgagccca gcccggtcgc     49800
     caccaggatg gggttggcgc tggtcttgaa gccgtcgttg cgcagcacca gcatgccggg     49860
     catgtactgg ccggtcaggg tgatgacgaa aagcggcagg gccacgccca gcatcgcgtg     49920
     cagcgagaag cgcggcatct cgaacaccgg cgcggccagg ctgaggtgca gcgcggcgaa     49980
     gtccacccgc tgctgggccg ccagcaggcc caggccgatg accaggatgc ccaccacggc     50040
     aaagcgcgag gtgtagcgct tgagcagcgc gtacgagacc agcagcgcga tgaccagcag     50100
     cgggtcggcc gaggcgccgc cgaaggcatt gatgccgaac tgcagcagga tgccggccag     50160
     caggccggct gcgatgccgg cggggatcat gcgcaccagc ttctcgaatg cgccggacag     50220
     gcccagcacg acaaagccca gcgccgccgc caggtaggcg ccgatgacct cgccgtacgg     50280
     cgtgaaaggc atgacggtgg ccaggaaggc cacccccggg gtggaccagg ccgtgatgat     50340
     gggctcgcgg tagcgccagc tgagcgcgat gccggtcacg cccacgccga tggacaccgc     50400
     ccagacccac gaggtggtct gggccgccga cagcccggcc agttcggcgg cctggaagac     50460
     caggacgaag gtgccgccgt agttcaccag caccgaaatc agcgcggcga cgatgggggc     50520
     aaggaaatcg gcgggccgaa ggactgccgt gggcgtgtgc atcgatgact cctgctatca     50580
     gccatgccgg gccggacggc cgcggcaggt gtccgattct aggagcgatg tggcaggttg     50640
     attcatgcca cattgttgga tcgtggcaga ccactttgcg gcccgccggg gcgcggcgcg     50700
     gggccggggt ggtggcgcgg gcgcgcctgc gctagtatgg cctgacgccg cgccgtgcga     50760
     tgcgccgcgc ggatccgcct tccccacgca aggagtccgc atggccacac tgacgatcaa     50820
     tggcaaatcc caggatgtcg acgcacccga cgacatgccg ctgttgtggg tcatccgcga     50880
     ccggctcggc atgaccggca ccaagttcgg ctgcggcatg gcgctgtgcg gcgcctgtac     50940
     ggtgcacctg gacggccagc cggtgcgctc ctgtatcacg ccggtcgccg cggcggccgg     51000
     caagcgcatc gtcaccatcg aggcggtggg cgaggacgag gtcggccgcg ccgtgcagca     51060
     ggcctggacc gagatcggcg tgccgcaatg cggctattgc cagtcgggcc agatcatgtc     51120
     ggccaccgcg ctcatcaaga gcaatcccaa acccagcgac gaggatatcg atgcggcgat     51180
     gagcggcaat atctgccgct gcggcaccta tccgcgcatc cgcgccgcca tcaagcaggt     51240
     ggccgtcaag ggggtggcca aatgaacgcg ttcgatcgtt ttgcgccgtc gcatgccgcc     51300
     ctggcggacg aaccttgcgg cctggcgccc gcttcgccgg cgcggcgcga gtggctcagg     51360
     actgccgccg ccctgaccgg cctggtgctg gtggtggggg ccggcggggt ggtgcgcgcc     51420
     gccggcgagg cggccaagga agcaaagaag tatggcggcg acggcatgcc gcacggcacg     51480
     gtggacgatc ccctggtgtt cgtgtccatt gccgccgacg gcctggtgac catcgtggcg     51540
     caccgcgccg agatgggaac cggcgtgcgc accagcctgc ccatggtggt ggccgacgag     51600
     ctggaggccg actggaaccg cgtgcgcgtg atccaggcgc ccggcgacga gcctcgctac     51660
     ggcaaccagg ataccgacgg ctcgcgcagc acccggcact tcttcctgcc catgcggcgg     51720
     gtcggcgcgg cggcgcgcgc catgctggag gccgccgccg cgcgccagtg gggcgtgccg     51780
     gtggccgagg tggccgcgcg ccagcacgag gtcgtgcacg agaagtccgg ccgcaagctg     51840
     ggctacggcg agctggcgac ggccgccgcg gcgctgccgg tgccggccga ggccgccctg     51900
     cgcctgaagc agccggcgca gttccgctac atcggcaagc cgggcgcgcg cagcgtggac     51960
     atcgaggaca tcgtcaccgg caagacccac ttcggcatcg acacgcgcct ggacggcatg     52020
     ctgtacgcgt cggtggcgcg tccggcggtg ctgggcggca aggtcaaggc ctacaaggcc     52080
     gaggcggcgc tcaaggtgcc cggcgtggtc aaggtggtgg agctgcccgc cgggcccacg     52140
     ccgccggtgt tcgcgccgct gggcggggtg gcggtgatcg cctcggatac ctgggccgcg     52200
     ctcaagggcc gccaggcgct ggagatcgaa tgggacgacg gcccgcacgc gtcctatgac     52260
     tccgaggcgt ttcgcaagac cctgagcgag ggcgccggca agccggccaa gccggtgcgc     52320
     aatgacggcg acgcgatgca ggcgctggcg ggcgcggccc gccgcatcga ggccgagtat     52380
     tacctgccgc acctggcgca cgccaccatg gagccgccgg cggcgaccgc gcgcctggcc     52440
     gacggcaagt gcgaagtctg ggcctgcgtg caatcgccct acggcacgcg cgagaacgtg     52500
     gcgcgccacc tgggcctgga catcggcgcg gtcacggtgc accagacgct gctgggcggc     52560
     ggcttcgggc gcaagtcgaa gtcggacttc gtggtcgagg cggccctgct gtccaaggcc     52620
     atggacggca agccggtcaa ggtgacctgg tcgcgcgagg acgacctggc caatgactac     52680
     ttccataccg tgtcggtcga gcggctggag gccggcgtgg acgcgcaggg caaggcggtg     52740
     gcctggctgc accgcacggc ggcgccgacc atcggctcga ccttcgcggc cggcgccgag     52800
     ggccagcagc cgttcgagct gggcatgtcg gcgatcaaca tcccgttcga cattcccaat     52860
     ttccgcgtcg agtcggtgcc ggtgccggcg catacgcgca tcggctggtt ccgctcggtg     52920
     tcgaacatcc cgcacgcctt cgcggtgcag agcttcgtgg cggaaatggc gcatgcgctg     52980
     ggccgcgatc cgcgcgacta cctgctggag ctgatcgggc cgccgcggcg catcgcgccg     53040
     gcggcgatgt ccgatggctg gaactacggc gaatcgcccg agctgtaccc gctcgacacg     53100
     ggccgcatgc gccatgtcat cgaggtggcc accggcgcag cgggctgggg gcgcaagctg     53160
     gaggcgggca gggggctggg cgtggcggtg agctacagct tcgtgaccta catcgccacc     53220
     gtggtcgagg tggaagtggg ccaggacggc gcgatcgcgg tgccgcgcgt gcacgtggcg     53280
     gtcgattgcg ggccgcaggt gcatccggac cgcgtgcgcg cccaggtgga aggcgcctgc     53340
     atcatgggcc tgagcctggc cacgcgcagc gagatctcgt ttgcccaggg gcgcgccacc     53400
     cagaccaact tccaccagta cgaggtggcg cgcatgcccg aggcgccgcg cgagatcgtg     53460
     gtgcacctgg tcgagcatgg tttcgacgtg ccgctgggcg gcgtgggcga acccgcggtg     53520
     ccgcctttcg cgccggcgct gtgcaacgcg atcttcgccg ccaccggcaa gcgcatccgc     53580
     gcgctgccga tacgcgacca gctcaaggcc tgagcgggaa ggcggcgccg gccggcgccg     53640
     ccttcctggc gtggcgcggg cgttttggct acgatgctgc gatgcccagc ccgtcccgtt     53700
     ctcccgccac ggcctacaag aaggcgcctt cgctcaaggg cctgccgtcg atccggcaat     53760
     tgcgcgcctt tgtcgccgtc tactacaccg gcaccctgtc ggccgccgcc gaagccttgt     53820
     cgctgaccca gcccgcggtg accatcctgc tcaaggagct ggaggaaaaa ctgggcgtgc     53880
     gcctgttcga ccgcaccacg cgcgcgctgc ggcgcaccac cgccgcgctc gaagccatcg     53940
     cctacgccga gcgcgtgctg ggcgagctgg acgcgctgag cgccagcatg acggacctgg     54000
     ccgacgtgcg gcgcggccgc ctgcgggtgg cggccacttc cacggtggcg cagacgctgc     54060
     tgcccaaggt ggtgcgccgc ttcctggacc tgcaccccgg ggtgaagctg agcgtggacg     54120
     attgcgcgcc cgccatgttc gccgagcatg tcctgagcga gcaggtggac ctgggcgtgg     54180
     gcacgctgga gagcgccgtg ccggggctgg agcagcatca gttcctgggc gatcacctgt     54240
     gcgcggtggc caccgacgcg gcgttcgggc acggccggcc gatgacctgg aagcagctgt     54300
     cgggcctgcc ggtcatcgtg gtgcaggccg gctacggcgt gcgccgcagc atcgagcgcg     54360
     ccgcccagca ggccggcgta gagctgcagg tggccttcga ggtatcgctg ctgaccacgg     54420
     cgctggccat ggcggccagc ggcctgggcg tggcggtggt gccgcagtcc atcctggccc     54480
     atacccacta caccaacctg gtggcgcgcc gcctggtgcg cccggtggtg ctgcgcagca     54540
     cctcggtggt gttcaaggaa gcgcgcgccc tgtcgccctc ggcgcaggcg ttcgccgaat     54600
     tgctcaggcg cgagttttcc tcgccggcct aggcgcccag cgccgcgctc aggcgcgcgg     54660
     ccgcttcgcg cagcaccggg atgtgggcat ccttgtagcg atgcaccggc atggtcagcg     54720
     tcaatgcgcc ggccagcatg ccttgcgcgt cgaaaaccgg cgcggaaatc cccgccagtt     54780
     cgggcgagcg gtcgctcacc ggcgaggcca tgtacccgcg caggcgcagc gcctcgtaga     54840
     actcgcccgg cgtatcgctg aaagccatca ggacatggcc gccggtgccg cgatcgagcg     54900
     gcagcaggtc gcccgcgtgg ctctggtccg ataggggctg cggcgagctg acgcggtaca     54960
     gcaccagccg gtgggcgccc tggcgcacat ggaacgaggc gctttcccgg gtttgcccga     55020
     ccagctcctg cagggccggc agcaccacat cctgcaggtt gaacgaggcg gcgtagacgc     55080
     ggttcaggcg cgcggccgcc ggccccaatg cgtagcgacc gtcggggcgc cgcaacacga     55140
     atccgaaatg catcagcgaa gccagcagcc gcagcacggt gctgggcacc aggctggcgc     55200
     gctcgctcag ctcgctgagc gacagcgtct ggtcggtgac gcgaaacgcg gtcagcagcg     55260
     tcagcgcgcg gtcgaccgcg gtgacgccgc cttcggcgct ttgcgcgtgg tctgccggac     55320
     ggacgggata tcggggcatg ggcgggcgac gccggtcttg acacggcaag aacacggcat     55380
     ttattctatt aagcagaagt taattttatc agatagaaat aacgagcaca agtggaaaaa     55440
     atcctgatca gcgaagtcgg cccccgcgac ggtttgcaga acgtccaggc ggtcatgccc     55500
     accgaggcca agttgcaatg gatcggcgcg ctcgcggcgg ccggcctgcg cgaggtggaa     55560
     gtcggttcgt tcgtgcaccc caagtggctg ccgcagatgg cggacgccga tgcggtggtg     55620
     ccccgggcgc gcgccatcgc ggggctgacc gtgctggcgc tggtgcccaa cctcaagggc     55680
     gcgcagcggg cgctggcggc cggcgcccac aagatcaccg tgccggtctc ggcgtcgcag     55740
     acgcacaaca tggccaatgt gcgcatgacc tgcgagcagt cgatcgaggc catcgccgcc     55800
     atctgcgcgt accgcgacga gatggccggc gcgggcccgc gcgtcgaggt cgaggcgggc     55860
     attgcctcgg ccttcggctg ctcgcgcgaa ggcgcggtgc cggagcgctg ggtcatggag     55920
     atggccgagc ggctggcgcg ggccggcgtg gactccatcg gcctgtccga ctccgtcggc     55980
     gtcgcccatc cgcgccaggt caagcgcatg ttcggcgaac tgctgcgcct gctcggcgag     56040
     cgcgcgggcg gcgcgcatct gcacaacacg cgcgggcagg ggctggccaa cgcggtggcg     56100
     gcgctggaag ccggcgtgac cacgctggac gcgtcgcaag gcggcctggg cggctgcccg     56160
     tatgcgccgg gggcaaccgg caacatcgtg accgaagacc tggtctacct gctcgagtcc     56220
     atgggcgtgg acaccggcat cgacctggag cggctgttgc aggcgcgcgc catcctggcc     56280
     gccgcgctgc ctggcgaacc cctgtacggc catctggccg acgccggcgt gcaccgggga     56340
     ttccgctatg ccgatccggc ccgcgccgcg ctggccgcgc ccgagggggc gttctgcccg     56400
     ggcggcgcgc aacccacgga ggcggcatga acacggccga tgccatgctg cccctgcaag     56460
     gcctgcgcgt catcgaaatg acgcacatgg tgatgggacc cacctgcggg ctggtgctgg     56520
     cggacctggg cgccgaggtc atcaaggtcg agccgcccgg cgcggccgag cggccgggcg     56580
     agcacacccg ctacctgaag ggcgcgggcg ccggattctt cgccgcctgc aaccgcaaca     56640
     agcaaagcgt catcctggac ctggacacgg ccagcggccg cgaaacgctg tacgagctgg     56700
     cggccggcgc cgacgtcttt ctggagaatt tccggcccgg cgcgctggcg gagcgcgggc     56760
     tgggctacga ggccttgtcg gcgcgcaatc ccggcctggt ctattgctcg ctcaagggct     56820
     tcctggacgg accctatgcc gagcgcacgg cgctggacga ggtcgcgcag atgatgagcg     56880
     ggctggccta catgaccggc ccggtcggcc agcccctgcg cgccggcgcg ccggtcaacg     56940
     acatgatggg cggcatgttc ggcgccatcg ccgtcatggc ggcgctgcgc cagcgcgagc     57000
     gctcgggccg cggccagcac gtggtcagcg gcctgttcga gaacgcggcc tggctggtat     57060
     cgacccacat gctgcagcag gccatcaccg gcgtggagcc gccgcccatg tcggccggca     57120
     ggcgcgcctg gggcgtctac gacgtgttcc agtcctcgga cggcaagcag atattcatcg     57180
     gcgtggtgac cgagcggcag tggcagcggt ttaccgaagc gctgggcgag cccgaactgc     57240
     gcgatcccgc ctacggcgac aacaacgcgc gcgcccaggc gcgcccgacg ctgattcccc     57300
     tggtgggccg gctgctggcg cggcgcacgc tcgacgagct gcaggatctc tgcacgcggg     57360
     ccgggctgcc gttcgcgccc atcgcgcggc cctgggacct gttcgacgac ccgcacctga     57420
     acgccgccca gggcttgcta cccatcaccc tgaccgatgg acgcccggcg aaggtgcccg     57480
     gcctgcccat ccagttcgat ggccggcggc tgggcgtgcg gcgcgacgtg ccgcgcccgg     57540
     gcgaacacaa cgaagcagtc ctgagcaccc tgaccggcac ggccggacgc aaccaagagg     57600
     aaaagcaatg aagctgatca acggcgtcga agtccgcgac acgctggaag aactgattgc     57660
     ccccgcccat accgccctgg tggtggtgga tgtgcagaac gatttctgcc accccgacgg     57720
     ccacttcgcg cgccatggca agaacatcga cacgatcgcc ggcatgctgc cggcgctggt     57780
     gccgttcgtc aacgccgcgc aggacatggg catcttcacc gtgttcgtgc agcagctcac     57840
     gctgccgcac gggcgcagcg attcgcccgc ctggctgcgc ctgaagtgcc gcgacggcaa     57900
     atccccggaa tacaccatgg tgggtagctg gggcgcgcaa ctggtcgacg gcctgcagcc     57960
     gcgcgccggc gacgtcatgg tgcagaagtt ccgccccgac gccttcgtgc gcacgccgct     58020
     ggacggcatc ctgcgcgcgc agggcatcga gtcgctggtc atcgtgggca cgaccaccga     58080
     agggtgcgtc gagtccaccg tgcgcggcgc gtcctaccac gattactacg tgatcccggt     58140
     caccgacctg atcaccggcc ccattgcgca gctgcacgcc aattcgctgg cgttcatgcg     58200
     cgcccgctat ccggcggccg aatcggccca ggtgctgcaa acctggcgcg cggcccgcgg     58260
     cgccgcggcc gcctgacggg agacgcatca tgaccgtgtc gcatgtattg cgcgtggccg     58320
     gccgcgcgct gctggccgcc tgcctgctgg ccgcgccggc cgtccaggcc gccggctatc     58380
     ccgaccgccc ggtgcgcctg ctggtgggtt tcgcgcccgg cggtccgacc gacctggccg     58440
     cccggctggt ggccaagcac ctgggcgccg acctgggcca ggcgttcatc gtcgagaacc     58500
     gtgccggcgc gggcggcaac atcgccacca aggacgcggc cggggccacc cccgacggct     58560
     ataccggcct ggtcgccggc atcaacatca ccatcaatcc ctggatgacc gccgacatgc     58620
     acgtcgacag ccgcaaggac ctgctgccgg tgcgcatcgt ggcgatcgcg ccgaccatcc     58680
     tggtggtgcg caacgatttt ccggcgcgcg actttcagga attcctgcgg gaagtgcgca     58740
     agcatcccga cacctacaac tccgccgcgc ccggctcgtc gccgttgctg gcgaccgagc     58800
     tgttctcgca gcagacgggc acccgcatca cgcccgtgcc ctacaaggga gcgtcgccgg     58860
     ccatgatcga cctgatcgcc ggccacgtgg acctgtcctt cgcgacgctc ggctcggtgc     58920
     tgccgcacat caagagcggc aaggtgcggg cgctggcgtt ggcggccccc gagcgcgacg     58980
     cgcagctgcc ggacgtgccc accttcgccg agctgggcat gcaggatttc cgtttcgatg     59040
     cctgggcggg cgtattgatg ccggccggca cgccgccggc ggtgatcgac acgctggcgc     59100
     gctcgctgga caagctggcc gggtccgccg agttcgaggc ccaggtgctg gaactgggca     59160
     tgaaacccgt cgtgcaggat tcgccgtccg cgttcgcccg caccatcgat accgagctgg     59220
     gcctgtacaa gacgctggcc caatccgtgc gcggcaagat cgcgcaatga cccgtgtcgc     59280
     ggccggcatg cgcgccgcga cgatccacca gaaatatgga gttctcttga tcacttccgc     59340
     acatggaaaa gactatcccc tggggctgcg ccaggcccag gggcgcaacg cggcgctgcg     59400
     ccgcctgctg gccgcgcccg agctgctggt ggccccgggc gcctacgact gcgtgggggc     59460
     gcggctggtc gagcaggcag gctttgcggc gatctacctg accgggtcgg gcatgtccat     59520
     gtccgccctg ggcgcgcccg acgtcggcct gatgtcgttc tccgagatcc tcgaccgcgc     59580
     cgcgcgcgtg gccgacatgg tgtcggtgcc cgtcatcgtc gacgccgaca cgggctacgg     59640
     ggggccgctg aacctgatcc gcaccgtgcg ggccttcgag cgggccggcc tgtcgggcat     59700
     ccagatcgaa gaccaggcct ggccgaagaa gtgcggccac gagggcgggc gcaatctggt     59760
     ctccagcgcc gagatgcaag ggcgcatcaa ggccgcggtc gacgcccgga tcgatcccga     59820
     tctggtgatc atcgcgcgca ccgacgcgcg tagcgaccac gggctggatg ccgcgctgga     59880
     gcgcgcggcg cgctatgccg aggcgggcgc cgacgtgatc ttcgtcgaaa gccccgagaa     59940
     cgaacaggag ctggcggcca tcgccgcggc ggtaaaggcc cccgtgctgg ccaatatggt     60000
     cgagggcggg cgcaccccca tcctgccggc cagccggctt gcgcaactgg gctttgccat     60060
     ggcgatctat ccgaacgccc tgacccgctg cttcgcgcat gccgggctgg aaatgctgcg     60120
     cgggctggcc gccgacggca gcacggcggg ctcggccgcg cgcatgcttt cgcaccggca     60180
     gctgtggtcg ctgttcgagt acgaaaagtg gatcgccacc gagcagcgcc tgggcggagc     60240
     ctgagccggc cccggccggc gcgcctgacg cagcacccta cataccaaca tacacagcag     60300
     ggcagacccc aagggagaaa tcatgaaaaa gcaactcatc ggcgccgtcg tcgcgacggc     60360
     catgttcgcc gcgccgctgg cggccacggc ggccacgtgg atggcctata ccttcggacc     60420
     ctccgagaac ctggccaacg tgcagggcat gaagcgcgtc atggaggaca tcgagaagaa     60480
     caccggcggg gaggtgaaat tccgcctgcg gctggccggt tcgctgccga tccaggccac     60540
     cgacatcacc caggccgtgg gcaacggcac cgtccgcttc gccgacgacg gcttctacct     60600
     gggcaatgtg cgcatcgccg gcatcctgcg cctgcccatg ctgctgcgct cgcaggagga     60660
     cttcgacaag gcgtacgcca tcatgaaacc ctatgtcgag cgcgacttcg gcaagcaggg     60720
     cgtggtggtg ctggggcatt tcagcttccc gcaccaggtc atcttctcgg cccgcaagct     60780
     ggagagcctg gccgacatca aggggcagaa gctgcgtgtt tcgtcgcccg agcaggcggc     60840
     cttcgtgcag cgcgccggcg gcattccggt gaccctgggc ggggccgaag tgccttccgc     60900
     gctgtcggcc ggcacgatcg acggcgcgct gacggccagc gccggcggcg gaaagatctg     60960
     gggcgacatg ctcaagtaca acctgcgtct gccggtcaac tatttcgacg gcttttacct     61020
     cgtcaacaag aaggcgtttg aggcgctcag ccccgagatg caggcgaaga tgcgcgagtc     61080
     cgtggcgcgc caggcgcccg gcacgacggc gcagatcgcc aaggaagagg gcgaggtgac     61140
     cgacgccctg cggcaaaagg gcatggtgat cgtgccgtcc acgcccgcca tggagcaggc     61200
     cgccaccgat ctggtgagcg ggtactggga agactgggcg cgcgagcagg gccccgaggc     61260
     cgtgcaggcc ctggcggaag tccgcaaggc cctgggccgc tgaagcgtcg ggaggcatcg     61320
     catgaacaag cctcaatcgc cggcccggcc aggcggcctg ccgctggtat ccggcctgat     61380
     gcgcctgcag cgcctgttgt ccgaactgat cgtgctggcc atgacgctgc tgatcgccgc     61440
     ggaagtcatc tgccgcgccc tgttcgggtt ttctctcatg atcgtcgagg aggtgggcgg     61500
     ctatctgctg gtcgccctgg ttttcctggg catgggggtg gccctgcacg acggcgtgct     61560
     gtttcgcgcc gaattcgtga tcaacgcgct gggcgagcgc gcgcgcctga ttctgcagtg     61620
     cgtgttcgac gcggtctgcc tggccggcat ggcgatgctg tcctggcagc ttggcgtgca     61680
     ggtctacgag tcctatgtgc gtggcgtgcg cgccgccacg acgctggcca cgccccttta     61740
     cctgccgcag cttttcatgg tggcgggtgc gctgtcgacg gcgctggtgc tgctgtcgca     61800
     gctgctcgag ggcatgaccc gtctcaggag cccgcatcat gagtgaaatg acccagttcg     61860
     tgctggtgat cgcagtgttc ctggtcctgc tgctggcggg catgtggatt ccgttcgcga     61920
     tctttctgtc cgccagcctc tatatcgtgc tgtacgccgg ctgggatggc ctgagcggct     61980
     tcgggctgag ctcgtggggc agcatgaaca gctttacgct taccgccatt ccgctgttca     62040
     tcctgatggc cgagatcatg ctcgaaagcg ggctgagcca gcgcgtgtac cgcgggctgg     62100
     cgcgcatcgt gcgccggctg cccggcgggc tgctgcagac caatatcgcc gggtgcgcgg     62160
     cgttctcggc catcagcggc tcgtcggtcg cgacggcggc ggccatcggt tcggtggcgc     62220
     tgccgcagct cgaggcgcgc ggctattgcc tcaagctgtc gaccggcacg ctggccgcgg     62280
     gcggcacgct gggcatcctg atcccgccca gcatcgccat gatcatctac ggcaccttca     62340
     ccgagacgtc gatcgccaag ctgttcatgg cgggcgtcgt gccggggctg gcgctggtgg     62400
     tcctgttcat gtgctatgtg gcggtgcgct gcctggtcaa tccgcggctg gcgccgccgc     62460
     ccgagcagga cacgccgccg ccgctgcgcc agacgctggc cgacctgctg ccgttcggcg     62520
     cgctgatcgt cggcgtgatg ggcagcctgt acgccggcct ggccacgccc accgaggcgg     62580
     cgggcgtggg cgcatgcctg gcggcgctga tcgcgcgcat ctggggcgat tgctcgatcg     62640
     ccacgctgcg ccggtcgctg gccaagacgg tcaaggcctg cggcgccatc ctgttcatcg     62700
     tgtatgccgc gttcctgttc tcgtacgcga tcgccatgac gggcctgacc gacagcctca     62760
     ccgacctgct cgacgcctgg cagctgagcc gcctggagct gctgctggcc gtcgtgctgc     62820
     tgtacacggt gctgggcttc ctgatggaca gcatcggcat gatggtgatc accgtgccca     62880
     tcctgcaccc catcctggcc agctacggcg tcgacccgat atggttcggc gtgctgctgg     62940
     tcgtgctgat cgagctgggg cagatcacgc cgccggtcgg catgaacctg ttcgtcgtca     63000
     agagcgtgtc gccgtcggcc cgcctcaagg acgtcgtggt gggttcgctg ccgttctgcc     63060
     tgctgatgta tgtcctgatc gcctggctga tctactcccc ccaattggcc ctgtggttcc     63120
     cgggccggat gaccggataa gcgcatgttc aatcctcctt ccctcatcgc cgccgaggtg     63180
     ttctgcagcg tgcccgagcg gtatcgcaag cgggaccaga gcgccgaatg gctgcgcgtg     63240
     caaaagcgcg gcgccacggc ccacagcttc ctggaaggtc cggccttcga ccgggccggc     63300
     aacctgtacg tcaccgacat cccgtacgga cgcgtgttcc ggatcagccc ggcgggcgac     63360
     ttcgagctgg ttgccgaata cgacggcgag cccaacggcc tgaaggtgca tcgcgacggc     63420
     cgcatcttca tcgccgacca caagcacggc atcatgctgc tggacccggc cagcggcgcc     63480
     gtcgtcccgt acctggaccg tccccgcctg gagcgcttca agggcgtcaa cgacctgttc     63540
     ttcgcgccca acggcgacct gtacttcacc gaccagggac agtccggact gcaggacccc     63600
     agcggccgcg tctatcgcta cagcgcgcag ggccagctga gctgcctgat ggacaatatt     63660
     cccagcccca acggcatcgt gctcgcgccc gacggaggca gcctgctgat cgccgtgacc     63720
     cgcgccaatt ccgtctggcg cgcgccgctg ctggccgatg gcggcgtgtc caaggtggcg     63780
     gcgtttctca acctgtcggg cggcttcggt cccgatggcc tggcgctgga ccaggccggc     63840
     ggcctggccg tctgccatcc gggcctgggc tcggtgtggc tgttcgacgc cgacggcgag     63900
     ccgctggcgc gcatccgctc gcagaccggc aaggtcatca ccaactgcgc ctttggcggg     63960
     ccgcagcgcc aatggctgta catgaccgag gccgattccg gcctggtgct gcgcgcccgc     64020
     atgccggcgc caggcatcga cctgctggag ggccagccat gaaaccgtcc acgcccaccc     64080
     ggctcgtcga cgtggccaag gtcatacgca gcaagaatgc cggcccgctg caaaccacgc     64140
     tggacctgat gttcgccacg gccgaacact atcgcctggc gcgcgacagc gaggcgctga     64200
     gcgcggccag cgtggcgcgc ctgtatggcg tcgcgcccga ttgggtgcgc gtcattccgt     64260
     acgaggccgc gcacgccatc aagatcgtgc tggaccgccc gctgccggcc ggccagccgg     64320
     gcgaccgcga cgtgtacggc gcccagcaac attaccctct cctggatctc acactatgac     64380
     gacggctgtg caatccctgc tggcggccgg gctgaagcct ggccaaccct tgcgcgcgct     64440
     ggcggcgtcc ggccagctgg gctatggcat tcccacgccc gccttccatg ccggcatggc     64500
     gcgcgacccg catttcgtcg gctgcgacat ggggtcgatc gacgtcgggc cgtactacct     64560
     ggggtcgggc cggctggcca cctccgaggc cattacgcgg cgcgacctga cgctggtgct     64620
     gcgcggcgcg cgcgagcgca acgtcccgct gctcatcggc accgccggca cctcgggcgc     64680
     ggcgccgcac ctgtcccgga ccctggagat gctgcgcgac atcgcgcgcg ccgagcgtct     64740
     ggatttcaag atggcggtca tcggcgccga tatgccgcgc gacctggtgg cgcggcagct     64800
     gcaggccggg cgggtgcatc cgctgggccg catcccgccc ctggacgagg cggcggtgcg     64860
     cgatgccgcg cacatcgtcg ggcagatggg caacgaggcc ttcatccgcg cgctggcctg     64920
     cgagccggac gtgatcgtcg ccgggcgggc ctgcgacacc gcggtgttcg cctccatacc     64980
     ggtcatgctg ggctacgaca ccgcgctggc cgtgcacatg gccaagatca tcgaatgcac     65040
     ctcgatctgc tgcgatccgg gcggccgcga cgccatcctg ggcacgctgg agcgcgacag     65100
     cttcacgctg gagagcatga atccggagcg cgccgccacg ccggtctcgg tggccgccca     65160
     cagcctgtac gagcaggccg acccgatgac ggtgcaggag cccgacggca cgctggacgt     65220
     cggccaggcg cgcttcgagg cggtggacgc gcgccgcacg cgcgtcagcg gcgccacctg     65280
     gcgcgaggcc agccagaaaa ccgtcaagat cgagggcgcg cagtgggtgg ccgagcgcgc     65340
     cgtggtgtgc gccggatcct gcgatccgcg cgtgatcgcc aacctggccg ccatcgaggc     65400
     cggcgtgcgc aagaacgtgg ccgccgtcct ggaaggcagc gtggcggatt acgagctggt     65460
     cttccgggtc tatggcgcgg gggccaccca ggtctacccg ggcgcgcgca tcgccgccgg     65520
     cgccgaggtg ttcttcctgc tggaatgcct ggcggccacc gccgacgcgg cgctggccgc     65580
     cgctacggtg gccaagcagt atctgctgca ccatggtttt ccgggccggc tttcgaccgg     65640
     cggcaacatc gcctttccgt tcacgccgcc cgagctgcgc gccggcacgg cgtaccgcta     65700
     cagcgtctac cacgtcatgg agtgcgacga cctgccggga ctgttcccgg tcgaggtcga     65760
     gcaggtgcgc ggcggcgtcc aggtggcggg cggctagcgc ccgccatcgc gtccatgggg     65820
     gcggacgcta gccgcccagc gcctgcgaca gcttgcgggc cagcgcgacc acgcgcgggc     65880
     ccagcgccgc cacggcggct tcgtccaggc gcgtggccgg gccgaacagg ccgatcgagc     65940
     cggccacccg gtcgccgttg aagaacggcg cggccaccgc cgccgcgccg acgatgagtt     66000
     cgtcgcggct ggtcgcatag ccgagctggc gtgtctgctt cagctcgcgc cggaatcgcg     66060
     ccggatcgag cggcagcccg cgcgtgtact gctccaggtg gtcgagcgcg tcttccttga     66120
     aagccaggat ggcgcgcccg gtggcgccca tggcgatgcg ctcggtgtag cccacgccgc     66180
     gcttgaaact caagggttgc gggctgggca gctcggccag gcagagccgc atttcgccct     66240
     gttcgacgaa gatggccacc gtttcctggg tttcgttcca cagttcgcgc agcagcggct     66300
     cggccagcgc ggccaggtcc tgggtttcgg tccagatgtg cgacaggcgc gcgaccgccg     66360
     gccccagccg gaagcgctgc gggtcgccgc tggcggtgat gaagcccttg gcttccaggg     66420
     tgtacagcag ccggtagagc gtgggacggc tcaggcccac ccgctgcagc agctggctgg     66480
     cggtgagctc cgcgtcctgg cgcgagaacg ccagcaggat gtccagcgcc cggttcaccg     66540
     cgcgcacgct gtcgccgcct ttttccggct tttcttcgag ttcggcgctg tcgctgtctt     66600
     tcacttccaa agtcctctcc atgtcgtagg ccgcgcagcc ctgcccaagt ctaccgcgtg     66660
     gcgcgccggc gaccgggcgc gccggtccgg gttattgcgt tcgatcaagt tgtccgtata     66720
     atgagaatgc agtacgcagt acggacaacg aaacgggaga caggacgatg aggaaatcat     66780
     tcttgagtgg ggcggccgcg ctgctggcgc tggcctgtgc gctgggcgcg ccgggcgcgc     66840
     gcgccgcgta tccggagcgg ccggtcagcg tggtggtggg gttcgcgccc ggcggcacca     66900
     acgacatcct ggcgcggctg atctcggcca agctgcaggc ccggctgaaa cagcctttcg     66960
     tggtggagaa ccgcgccggc gccaactcga tcatcgcggc cgagtacgtg gcgcgcgccc     67020
     agcccgacgg ctacacgatc ttcgtggcct ccagcggcgc gctgacgatc aacccggcga     67080
     tctacaccaa gctgggctac gacccccagc aggcgttcaa gccggtggcc atgctgggcg     67140
     tgttcccgct ggtggtggtg accaacgccg agtccaaggc cgagcgcctg gccgacctga     67200
     agaccctggc ggcgcagcgt tccgaccaca cgctcaacca tggggtgggt tcgtcgacgt     67260
     tccagctggc ggccgagtac tacgcgcgcc agaccgggct gtcgctgatg cacatcagct     67320
     accgcggcac ggggcctttg ctgtcggcgc tgctggccaa cgaggtggac gtgggtttcg     67380
     ccgacgtggc ggcggtggtg tcgcagatcg gcgcgggcaa actcaagccg ctggcggtga     67440
     ccacggccga gcgttccagc gtgctgcccg acgtgcccac catcgccgag gccggcgtgc     67500
     ccggctacga cgtgccggtc tggaccggcc tggtcgtgcc caaggacacg ccggacgagg     67560
     tcgtgcgggc gctgcagggc gcgctgaagg aaatcctggc cgatcccgac accctcgcgc     67620
     agtaccgccc gctgggcatg gagcccggca acgtggacgg cgccgcgctg caacagcgca     67680
     ttggcgacga catcgcgcgc tggaccaagg tggcgcggga agcggacatc aaggcgaatt     67740
     gagatcgtag cggagcagat gccatggaca cggtgcccat cactctattg ttttccgatg     67800
     gcgcggcgcg ccgtatcgac gcccgctgcg gcgccagcat cgtgcaggcg gccggcgacg     67860
     ccggcctggg cctgttgacc gattgcagca acggccagtg cggtacctgc acggccacgc     67920
     tggtgtcggg cgccatcgag ctgggcgatt acgaccgcgc cgtgctgccc gatggcgacc     67980
     gggccgatgg cgccatcctg acctgtgtgt cgcgcatcac cgggccctgc gtggtcgagc     68040
     tgccgtacga ggtcgacgag gcgcaggcgc agcccttgcc gcccatggcg ggcacggtgg     68100
     tcgcgctgga gcagatcgcg caggaaacca tgctgctgga ggtggaggtg gccgaggcgg     68160
     tcggcttcca gcccggccag tacgtgcgca tccggcccga ggggctggac gcgtggcgct     68220
     cgtattcgat ggcctgcggc tcgggcgagc ggcggctgcg cttctatgtc cggctggtcg     68280
     aaggcggggt gttctcgacc tggctgaccc aggcggccag ggtgggcgcg tccgtggcgc     68340
     tgagcgagcc gcacggcagt ttcttcctgc gcagcgaagc gcgtccgcgc ctgttcatcg     68400
     ccggcggcac cgggctggcg ccgttcctgt cgatgctgca ggccatcgcc gcggaccccg     68460
     cgcagcagga gattcccacc actttgctgg tgggcgcgcg ctcgggcgcc cacttgttcg     68520
     cgctggacca gctggccgcc ttgcgcgagc gctggccggc gctgcgggtg cgcctggccg     68580
     ccgagtccga gccgcgcggc gaatgccata ccggctacgc caccgacctg ctggccggac     68640
     tgggactgga ccccgccacg cgcgtgtacc tgtgcgggcc gccggccatg gtggaagccg     68700
     gccgcggcgc cgccgaggcc gtcgggctgg cgcgccggga catgctttgc gaacgcttca     68760
     attaatcgat ttcaccagga tgccgaacat gcaacccacg cactacgacc gcatggtcga     68820
     tctcaagcag ggcacgatca gccgcgaaat cttctccagc aaggagatct tcgaggaaga     68880
     gctggaaaag atcttcaccc gcgcctggct gtttgtcggg catgaaagcc agattcccaa     68940
     tccgggcgat ttctacacct cgcgcatggg cgcggagtcg gtgatcctga cgcgcgacaa     69000
     gaagggcaag gtgcacgtgt tcctcaactc gtgccgccac cgcggcatga aggtgtgcca     69060
     gtacgaccat ggcaatacgc agctgttcac ctgcccctat cacagctgga gctacaccac     69120
     cgagggcaag ctgttcggcg tgccgcagta caaggccatc tacgacggca acctgtgcaa     69180
     ggaagactgg tcgctgatcg aagtgcccaa gctggaaacc tacaagggca ccgtgtgggc     69240
     cagctgggac aagaacgcgc ccgatttcct gacctacctg ggcgacgcca ggacgcacct     69300
     ggacctggcg ctggaccacc gcgacggccg cgagggcggc tcggaggtgc tggtgggcgt     69360
     gcacaagtgg atcatcccgt gcaactggaa gttcgccgcc gagaacttcc tgggcgatac     69420
     ctatcacaac gtcagccacc ggtcggtgga cctgatcggc atcggcccga gcgccgaggt     69480
     gggcgtcaag gggcggcgcg acaacgagct ggaatacgcg cgccacctgt gggtcaactt     69540
     ccccgccggc catggcgtgc acagcgccat cgtgcccgag aacgcgccgt tcgtggatac     69600
     gttccagaac aaccccatca tcgccgagta cttccgccac tgccatgaag agcgcaagcg     69660
     ccggctgggc gaggagcgca gccgcctggt gccgttcgtc ggaacgatct atcccaacgt     69720
     gtcgttccat ggcaagcagc cgcgcaacct gtgcatctgg cacccgcacg gcccggaggc     69780
     gaccgaggcc tggcgcttct tcctggtcga cgccgacgcg ccgcaggaag tgaaggactt     69840
     cctgcgtacc tactacatgc gctattcggg gccggccggc atgaccgaac aggacgacat     69900
     ggagaactgg aactacgcca ccgccggcag ccgcggcgtg atcgccaagc gctatccgta     69960
     caactatcag caatcgctgg gcgcggtgac caacgcgggg ccggtgcccg gcaacgtgag     70020
     cctgcaggtc agcgaggaga acccgcgcca gtactaccgg cgctggcgcg actacatgaa     70080
     cggcgccgac tgggacacgc tgctgggcag gaacgacagc ggcccggcga gtttcgcgca     70140
     atgagcgcgc agggcaacgg cccggtcacc atcgtgaccg gcggaacctt cgggctgggg     70200
     caggccatca cgctgtcgct ggcgcggcgc ggccatcggg tgctggcctt cggcctggag     70260
     tcggcccagg cgtccagcac ggcggccggc ttcgacggcc tgcgcgcggc gctggccgag     70320
     gcgggcctgc aggagcgggt ggccgtcatg gcggcggacg tcgccgacga agccgatacc     70380
     ggccgcgtcg tggacgaggc cctgcggcgc tacggccgcg tggacgggct ggtgaacaac     70440
     gcagccatcg ggccgctggg cacggtgctg agcaccgagc ccgccatggc ggaccgcatc     70500
     ctggcggtca acgtcaaggg cgtctacctg atgagccgcg cggtcatccc gcacatgcgc     70560
     gcccagggcg gcggcgccat cgtcaacatc ggttcgggcg ccggctacgg caagccggac     70620
     atggcgatct acgcggccag caagggcgcc gtgctggcgc tctccagcgc catggcgtac     70680
     gaccatttcc acgaccgcat ccgcgtcaat gtggccattc ccggcggggg cggcatcgtc     70740
     tccggcatga gcgtgggccg ggtgggcggc gacgaggcgc tgttccggcg gcgccaggcg     70800
     gcgggcagcg cggcgggccg tccggccagc ggcgaggacc tggccaatgc ggtcgccttc     70860
     ctgctttccg gcgaggccga ggccatatcc ggcacggtgg tcgacgtcgg atgttttgcc     70920
     aaccagggcg ggccggtgcc ggcgcgcccg agcacgaatc gaggacacag ccatgactga     70980
     aaccctggcc tgcgcggaca gcccggccat tgcgccgctg gcgcgcgacg cgcgctacta     71040
     cgaactcaag cgcgagatcg aagagcatat gtacgacgaa tgcgagctgc tggacacgcg     71100
     ccagttctcg cgctggctgg ataccctggc cgaagacctg gtctatttca tgccgatgaa     71160
     cttcaacgtc aagttcggcc ggcacgcgca ggacgagcat acgcgcgtgg agaaggacat     71220
     gagctggttc aacgagggca agtggacgct gaccaagcgc gccgagcaga tcatgaccgg     71280
     cgtgcattgg gccgaggagc cgctgtcgcg cctgtgccgg gtggtcagca acgtgcagct     71340
     gaccgccatc gccgaaggcg ccgacggcgc gctggaggtc gatgcgcgca gccgcttcgt     71400
     catgtaccag aaccgttgcg agtacgaaga gtattacttc accggccggc gttacgaccg     71460
     cctgcgccgc gtcggcgacg gctggcagct ggtgcggcgt gaaatccacc tgccgcagaa     71520
     cgtgctgctg gccaagaacc tgacgatgtt tttctaggag gacgctgtgc tcaatctcat     71580
     gcagttgcaa cccggccagc tgctggcgct gcgcgacggc cgcaagggcg aggtcgtgga     71640
     aaacatgggc gacggcatct gggtgcaggt gcgctggctc gaccaggagg gccggccgct     71700
     ggacggcggc gaggacgaat tggtgcactg cgaggaggtg gccggcctgg cctgaggcgg     71760
     cggcgtggtc tccggatata tatgggaatt ttataaatgg ataaaaaagc ctcgtttgtc     71820
     ctgcccatgg gtggtcaata cactgggttc actacgaact gattgatacg ggtcaaacca     71880
     tgggcagtac agaaaaacat cctgtcatcg tcgtcggcgc gggtccggtg gggcttaccg     71940
     tggcgatgga catggcgtcg cgcggggtct ccgtgctggt gctggagcgc cgtcaccgcg     72000
     gcgaggctcc gagcgtgaag tgcaaccacg tctcggcccg ctcgatggag gtgttccgcc     72060
     gcctgggcgt ggcgcaggcc gtgcgcgccg cgggcctgcc cgacgagtat ccgcatgacg     72120
     tggcctaccg caccagcgcc accggcatcg agctgacccg cattcccatt ccggggcgcg     72180
     ccggacgcca gcgcaaggat acggggccgg ataccaactg gcccaccatg gagccgccgc     72240
     accgcatcaa ccagatctac ctggagccta tcctgttcga gcacgcggcc gggatggagc     72300
     gcatcgccat ccgcaaccgt gtcgaagtga cggagataga gcaggacgac gaaggcgtga     72360
     ccgtgcacgc ccgcgacctc gacagcggcg agtcgctgcg catgcgcgcc gactacctgg     72420
     tcggctgcga cggcgggcgt tccgccatcc gcacggccat cggcgccaag ctggtcggcg     72480
     acgcggtgat ccagcgggtg cagtccagct acatccgcgc gccccagctg cgccagctgt     72540
     tcaagcacga gccggcctgg gcgaccttca cgctcaaccc ggcgcgttgc ggcaacatgt     72600
     acgccatcga cggcaaggag ctgtggctgg tgcacaacta cctgcgcgac gaagagccgg     72660
     atttcgagtc ggtcgaccgc gacctctgta tccgccgcat cctgggcgtg ggcgaggatt     72720
     tcgagtacga actgatcagc aaggaggact ggtatggccg ccgcctggtg gccgaccgct     72780
     tccgcgaccg ccgcgtcttc atctgcggcg acgccgcgca cctgtgggtg ccgtacgcgg     72840
     gctacggcat gaacgccggc atcgccgacg cggccaacct ggcctggctg ctggccgcca     72900
     ccgtcaacgg ctgggccgac gcgcgcatcc tcgacgccta tgtgagcgag cgccatccca     72960
     ttacctcgca ggtgtcgtac ttcgtgatgg accatgcgca cgccatggcg accgagcggc     73020
     gcatcgtgcc cgagaacatc gaggcgcagg acgaggccgg cgccgcggtg cgcgcgcagg     73080
     tcggcgagcg cgcctacgcc ctgaacgtgc agcaatactg ctgcgccggg ctgaatttcg     73140
     gctatttcta tgaccagtcg ccgctgatcg cctatgacgg cgaatcccag ccggcctaca     73200
     ccatgggcga tttcacgccg tccacggtgc ccggctgccg cacgccgcat ttccagctgg     73260
     ccgacggcgc gtcgctgtac gacgccatgg gcgacggtta caccgtgctg cgcctgaagg     73320
     cgggcgtgga cgtgcaaccg ctggtcgagg ccgcggcgcg gcgcggcatg cccctgcgcg     73380
     tgctggacct ggagggcgaa gacgcgccgc ccgcgtaccg ccacgcactg gtgatttccc     73440
     gccccgacca gcacgtcgcc tggcgcggcg acacgctgcc ggccgatccg caggcgctgg     73500
     tggaccagct gcgcggcgcg gcctgagcga cgcccggcaa gcacaaccat aatggagaca     73560
     gcaaccatga aacttctttc ccacttcttc aaggccgccg ccatcctggc ggtatccggc     73620
     gcggcctgcg ccgccgacgc gcccatgacg ctggtggtgc cgtacgcccc gggcggggcg     73680
     accgatatcc tggcgcgcac cgtggcgcag cacatgggcg acgaactgaa gcgctcgatc     73740
     gtggtggaga accggcccgg cggcggcacc atcatcggcg cacagctggt ctcgcgcgcc     73800
     gcgcccgaca gcggcatgct gctgatggcc accagcacca cgctggccat caaccgcacg     73860
     atgtacaagt cgttgccgta tgacccgcag gcgttcgcgc cggtcggcct ggtggccgaa     73920
     gtgccgctgg tcgtggtggt caacccctcg gtcaaggccg acagcctggc cgacctggtg     73980
     gcgctggcca aggccaaccc cggcaccctg accttcggct cggccggcag cggcagcccg     74040
     cagcacctgt cggcggaaat gttccgcgcc gccaccggcg cctccatgac gcacgtgccc     74100
     tacaagggca cgtcggcggc gctgaacgac ctgctgggcg ggcagatttc catgatgttc     74160
     gccgacctgg cgccggtgct ggcccacatc cgctcgggca agctgcgcgc gctggccgtg     74220
     acctcggccc agcgccagcc caatctgccc gacacgccca ccgtgcgcga aagccaggtg     74280
     ccgggcacgg cggattacga ggcggtggcc tggcaaagcc tggtggcgcc gccgggcacg     74340
     ccggccgaga ccgtgcaggc ctataacgcc gcgctggtga aggtgctggg cgaggccgac     74400
     gtcaaggcgc gcttcgaggc caatggcgtg tcggtacgca ccagcacgcc gcaggaactg     74460
     gcggactaca tccgcaccga aggcgaccgc tgggccaagg tggtcaaggc ctccggcgcg     74520
     tcggccgact gagcggcccg cgcgcgcaac ctacgcaacg ttcgaggatt atcacgatgt     74580
     ccgatccgct ttcgcagctt tacgacgatc cgccctatcg gctttccggc gtcgtgtacg     74640
     gcgcgctgct gaaccagcgc gaagcgctcg accgcctggg agaggcggtc aaccagccgc     74700
     cctacaaggc cccgcccaag gggccggtgc tgtatatgaa gccgcgcaac acgctggcgc     74760
     gcgatggcca ggccatcgcg ctggcggccg acgtgccggc catgcggctg ggcgcgaccc     74820
     tgggcctggt gctcggacgc accgcctgcc gcgtcgacgc cgccgaggcg ctggactacg     74880
     tcgccggggt ggtgctcgtg gccgatctga cggtgccgca cgacagcttc taccggcctt     74940
     cggcgcgctt cgtcgcgcgc gaccgctcgt gcttcatcgg cccgcgcatc gtgccgctgg     75000
     ccgaggcggg cgacccggac gcgatggtga tccacgtcac ggtcgacggc aagccggccc     75060
     aggccgcctc gatgggcggc cgggtgcgtc cggcggcccg gctgctggcc gacgtgaccg     75120
     atttcatgac cctgtcgccc ggcgacatcc tgttgctggg cacctgcgtg gaccagccgc     75180
     aggtgggccg cggccaggcc ttcgcgctgg ccgccgaggg catgggtgaa ctgcatggag     75240
     aaacgcaatg aagcgcgcac gcgttgccta cggcggggcc atacacagcg ccacgccgca     75300
     tgaacagggc ctgctgctgg ccgatggccg ggtggtggcc gaggatgcgg tggtgtggct     75360
     gccgccggtc gaagtcggca ccctcatcgt gctcggcctg aactacgcgg accacgtcaa     75420
     ggagctgtcc aaggagctga ccgtcaccac gcgcgacgag ccgctggtgt ttttcaaggg     75480
     gccgggcgcg gtggtggggc atcgcgccca gacgcgccgc ccgcgcgacg ccacctacat     75540
     gcactacgag tgcgaactgg cggtggtgat cggcaagccg gccaaggacg tcaaggcggc     75600
     cgacgccatg gcccacgtgg ccggctacac cgtgtgcaac gactacgcca tccgcgacta     75660
     cctggagaac tggtaccggc ccaacctgcg cgtgaagaac cgcgacacct gcacggtgat     75720
     gggcccctgg ctggtcgacg cggccgacgt cgccgacccg cacgcgctgg cgctgcgcac     75780
     gctggtcaac ggcaaggtca cgcagcaggg cagcacggcc gacatgatca acgacattgc     75840
     ggcgctgatc gaatacctca gcggtttcat gaccctgatg ccgggcgacg tcatcctgac     75900
     cggcacgccg gacggggtgg tcaacgtcga ggagggcgac gaggtggtct gcgagatcga     75960
     aggcatcggc gcgctggcca acaccatcgt cggcgacgcc gtatttggac gataaggaac     76020
     gaacatgcgg attgaacatc tgatcgacgg caaggccgtc gccggcaagc agtacttcga     76080
     gaccatcaac ccggccacgc aggagacgct ggcggaggtt gccgccgggg gcgaggccga     76140
     ggtgcacgcc gcggtcgcgg cggccaaggc ggcgtttccg aagtgggccg gcctgccggc     76200
     cgccgagcgc gcgcgcctgg tgcgcaagct gggcgacctg atcgccgccc acgtgcccga     76260
     gatctcgcgc accgagacca acgattgcgg ccagaccatc gcgcagaccg gcaagcagct     76320
     ggtgccgcgc gcggccgaca atttctatta tttcgccgag atgtgcacgc gggtcgatgg     76380
     ccatacctat cccacgccca cgcacctgaa ctacacgctg taccacccgg tgggcgtgtg     76440
     cgcgctgatc agcccctgga acgtgccgtt catgaccgcg acctggaagg tcgcgccgtg     76500
     cctggcgttc ggcaacaccg ccgtgctgaa gatgagcgag ctttcgccgc tgaccgcggc     76560
     gcgcctgggc gagctggcgc tggaggcggg catcccgccg ggcgtgctca acctggtgca     76620
     cggctacggc cgcgacgccg gcgagccgct ggtggcgcac ccggacgtgc gcgccgtgtc     76680
     cttcacgggc tcgacggcca ccggcaaccg catcgtgcag gcggccgggc tgaagaagtt     76740
     cagcatggaa ctgggcggca agagcccgtt cgtgatcttc gacgacgccg acctggaccg     76800
     ggcgctcgac gcggcgatct tcatgatctt ctccaacaac ggccagcgct gcacggccgg     76860
     cagccgcatc ctggtgcagc aaagcatcta cgccgatttc acccagaagt tcgtcgagcg     76920
     cgcgcgccgc atccgcgtcg gcgacccgct ggacgagggc accatcgtcg ggccgctgat     76980
     cagcccggcc cacctggcca aggtgcgcgg ctatatcgag ctgggcagca aggaaggcgc     77040
     caccatgctg tgcggcgggc tggaccgccc gtcgtacgca cccgagctgg atgcgcgcgt     77100
     gcgcgacggc aacttcgtct ggcccacggt gttcgccgac gtcgacaacc gcatgaagat     77160
     cgcccaggac gagatcttcg ggccggtcgc ctgcctgatt ccgtttcgcg acgaggccca     77220
     cgccatcgag ctggccaacg acatcgagta cggcctgtcg agctatgtct ggaccgagag     77280
     cgtcggccgc gcgcaccgcg tggcggccgc catcgaggcc ggcatgtgct ttgtcaacag     77340
     ccagaacgtg cgcgacctgc gccagccgtt cggcggcacc aaggcctcgg gcaccggccg     77400
     cgagggtggc acctggagct acgaagtgtt ctgcgagccg aagaacgtcg cggtgtcgct     77460
     gggcaatcat cacattccgc actggggagc atgaccatgg gcaagctggc cttggccgcc     77520
     aagatcacgc acgtgccgtc gatgtacctg agcgaactgg acgggcctaa caagggttgc     77580
     cgccaggccg ccatcgacgg gcacaaggag atcagccggc gctgccgcga gctgggcgtg     77640
     gacaccatcg tggtgttcga cgtgcactgg ctggtgaaca gcgactacca catcaattgc     77700
     gccccgcgct tctcgggctg ctacaccagc aacgagctgc cgcacttcat caagaacatg     77760
     gactacgagt acccgggcaa cccggcgctc ggccatctga tcgccgacgt ggccaacgag     77820
     atgggcgtgg ccacgcgcgc gcacagcgaa acctcgctgg gcatggagta cggcacgctg     77880
     gtgcccatgc gctacatgaa cgaagaccag catttcaagg tggtcagcgt gtcgggctgg     77940
     tgcgtctggc atgacctggc caccagcgtg cgcttcggcc aggcggtgcg caaggccatc     78000
     gaagagcgtt acgacggcac ggtggcggtg ctggccagcg gatcgctcag ccatcacttc     78060
     gccgagaacg gcaccgcgcc cgaatacatg cacaaggtct gggatccgtt cctggagcag     78120
     gtggaccggc gcgtggtcga gctgtgggag cagggcgatt ggcagacctt ctgccccatg     78180
     ctcaagctgt acgccgagca atgctggggc gagggcggca tgcacgacac cgccatgctg     78240
     ctgggcgcgc tgggctggac cgactacgac cagccggtcg aggtggtcac gccgtatttc     78300
     ggcagctcgg gcaccggcca gatcaacgcg attttccccg tctcgccgct gaaggtgtga     78360
     tatgccgcat ctcgtcattc tctactcggg caacctggac cgcgacctgg acatgggcgc     78420
     ggtgtgccgc gggctggccg acgccatgct gacggtgcgc gatgacgagg gccgccaggt     78480
     gttccccacc ggcggcacgc gcgtgctggc ctatccggcg ccgcactacg ccatcgccga     78540
     cggcggccag gccggccggg acgccggcga atcgggcgac tatggcttcg cctacctgaa     78600
     cctgcgcatg gggcgcggac gcagcgaggc cgtgcagcgg cgcgccggag aaaccatcgc     78660
     gcaggcggcc cgggccttgc tcgcgccgct tttgcagcag cgccgcgtcg gcctgacctt     78720
     ccagatcgac gtgggcgccg aggtttacga tgccaagttc ggcaacctgc atgccttgtt     78780
     ccagaaaggg gaaaaataat gctgagcgaa gcgctgatcg gcgagctggc cgcgcaactg     78840
     tatgagtcgg agaggacgcg cgtgcaggtg gagcacttct ccaagcgcca tcccgaaatc     78900
     accatcgagg acggctaccg catcagccgc gcctgggtcg ccatgcagcg ggccgacggc     78960
     cgccgggtga tcggccacaa gatcggcctg acttcgcgcg ccatgcagca ggccagccag     79020
     atcgacgagc cggactacgg cacgctgctg gaccacatgc tgtacacctg ccagcccggc     79080
     caggagctgg cgattccgtt cgagcgcttc atcgcgccgc gcgtggaggt cgagctggcg     79140
     ttcgtgttga aggcgccgct gcgcggcccc gaggtgacgg tcgagcaggt gctggcggcc     79200
     accgaatacg tcacgccggc catcgagatc atcgactcgc gcatcgagca gttcgaccgc     79260
     catacccggg ccatgcgcaa ggtattcgac acgatcagcg ataatgcagc caacgccggc     79320
     gtggtgaccg gcgcacagcg cgtgtcgccg caggcgctgg atttgccgtg gtgcggcgcc     79380
     gtcctgcgcc agaacggtgt cgtggaagag accggcctgg ccgctggcgt gcaggggcac     79440
     ccggccatcg gcgtggcgtg gctggccaac aagctggcgc cctggggcga aaccctcgaa     79500
     cccgggcagc ttgtgctggc cggctccttc acccgcccgg tggcggcgcg caagggagat     79560
     gcgttcgagg cggactacgg tccgctcggc gcgatgaggt ttcgcttcgt ataaggatgg     79620
     tcatggatat tcctcgcaat acgttcaagg ccgcgctcag gcaaggccag gtgcagatcg     79680
     gtctgtgggt cggcctggcc gacccctacg cggccgaagc cgtggccggc gccggctatg     79740
     actggctgct gatcgacggc gagcacgcgc ccaacgacgt gcgccagatg ctgtcgcagc     79800
     tgcaggcggt ggcgccgtat ccggtgcatc cggtggtgcg gccggtcatc ggcgacgtgc     79860
     cgctgatcaa gcagatcctc gacatcggcg cgcagacgct gctggtgccg gtggtcgaat     79920
     cggccgagga agcggccacc atggtggccg ccacccgtta tccgccgcgc ggcatacgcg     79980
     gcgtgggcag cgcgctggcg cgttcgtcgc gctggaacca gatcccggac tacctgcaca     80040
     aggccgacga ggaaatgtgc gtgttggtgc aggtggaaac ccgcgccggc atggagcagc     80100
     tcgacgcgat cacgcaggtc gagggcgtgg acggcgtgtt cttcggcccg gccgacctgt     80160
     cggcctcgat gggacacctg ggcaaccccg gccaccccga cgtgcaggcg gccattctgg     80220
     acgcgatccg gcgcgtgcgc gccgccggca aggcgcccgg catcctgacg gccgacgtca     80280
     agctggcgcg gcagtacatc gaggccggcg cgctgttcgt ggccgtgggc gtggacacca     80340
     ccttgctggt gcgcggcgcc cgcgacctgg tgcgccagtt caaggacgag ccggccgcgc     80400
     agccgtccgg cccgtcggtg tactgaagcc gccgccgcac ggcggcgggc cgttccggac     80460
     agccggcctg ccatgacgat ccagcagctt cgcgccttga tggcggtggt gtcgcatggc     80520
     ggctttcgcg ccgccgcgcg cgcgctcgac gtgtcgcaag gcgggctgac caagagcatc     80580
     gccgcgctcg aacaggaata tggcgtggac ctgatcgagc gcagcgccaa gggcgtgctg     80640
     ctcacgccca agggcgcggc cttcgtgccg ctggcgcgcg ccatcgtcga ggaggccgag     80700
     cgcgccgagg gctggctgcg cgcgcaatcc ggggagctgt cgaccagcgt gtcgctgggc     80760
     gtgtcgatcg aaccgtcgat tcgcctggcg ccggcggtgt tgcgcgattt ccgcaaggcg     80820
     ctgcccgata ccagcgtgca cctgacccag ggcgtggccc tggacctgct gggcgcgctg     80880
     cgcgagaacc ggatcgagct ggccgtcatc cggctgccgc gcaacttcga ttccagcgac     80940
     ctgaaggtcc agcgcctgta ccagtccgag ccggtcattg tcgggcgcgc gggccatccc     81000
     ggcgcgggcg cggcgtcgct gcgcgagctg gtcaagtatg actgggtggt ggtgggcgac     81060
     acctcgcgcc agggggcgat gaacgacgac agcatctggg agctgttcga tcgcgaaggc     81120
     ctgggccggc cgcgcttcgc ggcggtgtgc aattcgctgc tgagcatcgt cgccatgctg     81180
     atggagtccg acgcgctggc gcgcgtgccg cgcgcgctgc tcgatcattc gctggcgcgc     81240
     cgcaacctga ttcccatccc ggtggccgag ccgccggtgc cgtactggat cgccacggtg     81300
     cacaaggcgt cgcgccgcct ctcgcccgaa gcgcagaccc tcaacgccat gctgtcttcc     81360
     tacgcgcgca tttccggcgc gctgtcgccc gaacgccgcc ccggcgagcc ctgaggcccg     81420
     cgcgccgtcg cgcgcgcggc gccgctgatc gccgcgagga atcgcgagca ccgcaaacgc     81480
     atggccttgg tcccgttccc gcgcccacaa tagcgccgcc gcagcaatgc gcgataacga     81540
     cacgggagac acaaccatgc aagccatttt caagggcctg atcatcgccg ccacggcgct     81600
     gtccgctggc gctgccacgg ccgcgcccgc ctatccgtcc aagccggtca cgctgatcgt     81660
     gccgttcgcg cccggcgcct cggccgacgg ggtggcgcgc ctgctgggcc gcaagctggc     81720
     cgatggcctg ggccagccgg tggtggtcga gaaccgcccc ggcgcgggcg gcaccaccgg     81780
     cctgatggcg ctggcgcacg cggcgcccga cggctatacg ctggccatcg gcgccaccgg     81840
     cgccatcgcg gtgaaccatc acctgcccga tgccgcgccg ctggacgcgg ccaagcaact     81900
     tgcgccggtg gccaaggtgg ccgacattcc gctggtgttc atcgccagcc ggcagtcgca     81960
     gctgcgcagc atgcaggaca tcgccgcgca ggcggccagg accaagggcg gcctgagcta     82020
     tggcacctcg ggccagttca cctcgcaaca cctggcgggc gagctgtacg ccgacatggc     82080
     caagaccgcg ctggtcgccg tgccgtatcg cggcagcagc ccggccctga ccgacgtgat     82140
     cgccggccag gtgccgctgg cggtggtgga cctgacctcg gcctttccgc agatcaaggc     82200
     gggcaaggtg accggcctgg cggtcaccgg cacgcggcgc gcgatcgccg cgccggatat     82260
     tcccaccgtg gccgaactgg ggttcccggg ctacgcggcc agcggctggc tgggcatgtt     82320
     cgcgccggcc ggcacgccgg cgcccgtcgt ggcccaggtc tcggcgcagc tcgagaccat     82380
     cctggccgac ccgcaggtcg gcgccgagct gctgaccctg gcggtcgagc cggcctatct     82440
     cgacccggcc gaattcgccg cttacgcccg ggccgaatcg gacaagtggg gcaaagtcat     82500
     cggtgcgatg ggccaggcca agagccagcc ctgagcagca acgcagttgg agagaaacag     82560
     catgaaggca gcaatgaccg gcggtgaagt attcgtggaa gggctggtgc gcaatggggt     82620
     gaaggatctg ttcttcatcc cgggcatcca gctggactgg gcggtggagg cgctgcgcaa     82680
     gcgcgccggc gagatcaacc tgtacgtgcc gcgccacgag cagaccacga cctatatggc     82740
     cgatggctac tatcgcgtca ccggcaagcc cggcaccgcc atggtggtgc cgggccccgg     82800
     ggcgctgaac gccggcgccg ggctggcgac cgcctacgcg tccggttcgc gcatggtgtt     82860
     cgtgacgccg cagatccatg ccgacggcgt gggcaagggc tacggcctgc tgcacgaaat     82920
     caaggaccag agcggcttcg tccagggcct gaccaaatgg catcgcttcg tcggcgcgcc     82980
     ggccgatatc ggtgcctcgg tggatgccgc ctatgcgcag gccggccagg gccgcgcgcg     83040
     gccggtgggc ctggagattc cgcacaatta cttccaggcc gaggtggcgg gccaggacga     83100
     ggccgtgccg ccggcgcggc cggccgagcc gcccatgctc gacgagcagg ccatcgccgc     83160
     ggcggcggcg ctgatcggcc aggcccgcct gccggtgctg tacgtgggcg gcggcgtgtt     83220
     cccgaccggc gcgcacgaag cggtgcggcg ggtggccgag cgcatcggcg cgccggtggt     83280
     gatgagcgac aacggccgcg gcgcgctgcc cgaccatcat ccgctggcca tgaattcgct     83340
     ggccgggcgc gcggtattcc agcacgccga cgtggtggtc gtggtcggca gccgcttcat     83400
     cgacgccctg atgccggcgg cgtcgtggcc ggccggccgc gcccgtttcg tctacatcaa     83460
     catcgacgcc gccgacatga cggcgccgcg cgcgcccgac gtggccatcg ccgccgacgc     83520
     ggcgcacgcg ctggcagcgc tggaggaacg gctgcgcagc cgcaccgcct tcacgcacga     83580
     gcaggcggcg cgggtcaagg cctgggcgca ggcgcagatc gaccggatcg agccgcaggc     83640
     cgcctatatc cgcgccatgc gcgatgcgct gcccgaggac ggcatcttcg tcaacgagct     83700
     gacgcaggtc ggctatctgt cgcgcatcgc ctttccggtc cacgcgccgc gcacctatat     83760
     cgggccgggc taccagggca cgctgggcta tggctttccg gtggcgctgg gcgcggccgt     83820
     gggcggcgcg gggcgccgcg tgctgtcgat caccggcgac ggcggcttcg gctggaacct     83880
     gcaggaactg gccaccgccc ggcgctacaa cctgccggtg acgctggtgg tgttcaacga     83940
     cggccattac ggcaatgtgc gcgccatcca gaagcgcgag ttcggcgccg aggtggcggt     84000
     ggacctgtgc aaccccgatt tccagctgct ggcgcgcgcg ttcggcattc cgtccgaaca     84060
     ggtggacagc ccggcggcgc tgggcgcggc catcaaggcg tcgctgtcgg gcgggccggc     84120
     gctgatcgaa gtgaagatgg gcgaagtgcc cagcccctgg cacctgctgc gcctgcagcc     84180
     catggccggc atggccgggc cacaggccgc cgccaatccg ctcgatggag actattgatg     84240
     gattacgccg agttctatgc cgacggggca ttccatccat gcggcggcgc cgccgtcctg     84300
     ccggtgtaca accccgccac cgagcaggcc gaagcatcgg tgcgcgcctg ctcggcggac     84360
     gacctggagc gggccgtgcg cgccgcggcc gcggccggcc cgggctgggg cgccgcgccg     84420
     ccggcgcagc gccgcgacgc gctggaccgg ctggccaagg ccttgcggca gcgcgccccg     84480
     gacatcgtgg cgggcctggc gcgcgagatc ggctgcccgg tctggctggg cgaactgatg     84540
     caggtgccca tggcgatgaa aggcatggcg cacgcgcgcg acggcatgga cgccatcgcc     84600
     tggcgcgagc gcatcggcaa cggcctggtc gaacgcgtgc cggtgggcgt gatcgcggcc     84660
     atcacgccct ggaacttccc cctgcaccag atcgtcgcca aggtggcggc ggccctggcc     84720
     gccggctgca ccgtggtgct caagcccagc gagctggccc ccggcgcggc ctggcaattc     84780
     atccaggcct gccacgacgc ggccttgccg cccggcgtgg tcaacctggt ctggggcgac     84840
     gccgccatcg gccaggcgct ggtcgcgcat gaggcggtgg accaggtcag cttcaccggc     84900
     agcaccgagg tggggcgcag catcatggcc gaggcgggcc gccacctgaa gcggaccacg     84960
     ctggagctgg gcggcaagtc ggccgcggtg ctgttgcccg acgccgagct cgaacgcgcg     85020
     ctgccggtgg tgctgcgcat ggcggtggcc aacagcggtc aggcctgcgt gagccagtcg     85080
     cgcctgatcg tgccgcgcca gcggctggcc gaggccgagc aggcgctggc cgcgctggcg     85140
     caggcctggc cgcagggcga tcccctcgac gccgcgaccc ggctggggcc gctggccaac     85200
     gcgcgccagt tcgaacgcgt caacgccatg gtgagccggg cgctgcagca gggcgcgcgc     85260
     ctggtggccg gcggccccgg ccgtcccgcg ggccaggcgc gcggctggca cgtgccggtg     85320
     acgattctgt ccgacgtgac gccggacatg gagctggcgc aggaggaagt gttcggcccg     85380
     gtgctggccc tcatgccgta cgaggacggc ggccaggatg gcggcgaggc gcaggcgctg     85440
     gcgctggcca acgccacccg ctatggcctg tcgggcgcgg tgtggtcggc cgacgccgcg     85500
     cgcgccgccg ccttcgcgcg gcgcatgaag accggccagg tcatcatcaa cggcgccgac     85560
     cagaacctgg ccacgccgtt cggcggacgc ggcgcgtccg gcgtgggccg cgaaaacggg     85620
     cgcttcggca tcgaggagtg cctgacctgg cagtcgctgc acggggcgcc gtagcgcggc     85680
     aacgtatgcc tggcgcgttc gccgatgaaa ttttctatat aaagaaaaat tccggtatag     85740
     tcgattcgtt gcgtcataac ctcggacagg caagcgacga tggcatacga cccgggcatt     85800
     caggcatatg tggagcgcgc gcgccgcgca ttgggcgaca tggcggggct gaaggccctg     85860
     agcctggcgc agcggcgcgt gcgggccgac cgctacgcgg cgctggtgcg cgagccttat     85920
     cccgagtcgc tggaggtcag cgatacctac atcgtccagc ccggccacga gattcccgtg     85980
     cgggtgtacc ggccgcgcgc cgaggggccg ctgccgacca tcgtctacct gcatggcggc     86040
     agtttcgtgg cgggcagccc gcaaggccac gatttcatca ccaccagcct ggcgtgcaac     86100
     accggcgcgc aggtattgag cgtgcactac cggcgcgcgc ccgagaaccc ctatcccgcg     86160
     cccaccgacg acgcctacgc ggccctgtgc tgggcgcagc gcgaggccga actgctgggg     86220
     gtcgacccgg agcgcatcgc cgtggccggc gacagcgccg gcggcaacct ggccgcggcc     86280
     tgcgcgctga tggcgcgcga tcgcggcggg ccggcgttgc gcatgcaggc cctgatctat     86340
     ccgacgctgg atgccgacct ggatacgccc agctacctga acaacaccgc agacgccttc     86400
     ctgacccgcg aggcgatggc gttcgcggtc aacgccttcc tgccgcaggg gctggatacg     86460
     cgcgacggct atgcgctgcc gctgcgcgcg gccgatcacg ccgggctgcc gccggcctac     86520
     ctgctgctgg ccgaccacga tccgctgctc gacgacggca cgcgctacgc cgccaggctg     86580
     cgcgaggccg gcaatgcggt gcagctgcgc atcggcgcgg gcatgatcca cggtttcctg     86640
     cgcgcgcgcc gcctgagcgc gacggccgac gccgagttcc atctgctgtg cgcggcgctg     86700
     cggcaggcgc tcggcctgcc cgagccggcg gcgcgctggt agcgcgcgcg gcctagaagt     86760
     gccgctgggc ggccggctcg tgggcgatga tccagaggat gctggccggc tcgtcgtaag     86820
     ggttgcgaaa gacgtgcggc gtggcgccgt cgaactggaa gctgtcgccg cgttgcagct     86880
     gcagcgtctg gccgtccagc tccagttcga aggcgccttg cagcaccatg ccgccctttt     86940
     cggcggcgta gctcagcggc ggcgcgccgg aggtgccgcc gggctggatg ttcagcacca     87000
     tgaattgcag ccgctggccg gccggcggcg tgagcatttc cttggtcatg agcggcgtgc     87060
     cgaactgcat gacgcggcgc gtgccgttgc gccgcacgtg ggcggccagg tcgccggcgc     87120
     cggccgcgtc ggcggctgtc tcgtcatcgg cctcgaacag ggcgctcagc ggcacgtcga     87180
     gagcctggcg gatgcgcgcc agcgtcttca gcgaggggtt gcccaggtcg cgctcgatct     87240
     ggctgagcat gccggtggcc acgcccgagc gggccgccag cgtctgcagc gatattttct     87300
     tttccttgcg gatgcgccga atggcctgtc cgacgaggcg ggtgtcgtct gcttgcatga     87360
     aggggaaagg gcgagcgctc agcgcggtgt cttcaggccc atgccgtcga ggatgggaat     87420
     ccacttggcg tagtctactt cgaacagctg cttggcatcg gccagcgagc cgctcatggg     87480
     caccagcccc atctgcgtca ggcgctgctg cagcgcgggg tcggccatgg ccttgccgag     87540
     cgcgtcgtgg atgcgcgcct cgacctcggg cggcgtgccg gccggcacga acagggcctg     87600
     ccagggctgc atcttttcct tgatgacctc gcccaggccc gcctcggcca cggtgggcac     87660
     ctcgggcagg tcggccagcc gcgtttcggt gaacgaggcc agggcgcgga tcttgccgct     87720
     cttgaccagt tccttgatga ccggcggggt gtcgaccagg taggcgttgc ggccttcgac     87780
     caggtcgacc agggcgggcg agctgccgcg gtacggcacg tgcacgacct tggcgccgat     87840
     ggcgtcggcg aagtattggg cggtgacgtg gccggaagtg cccgcgccgg ccgagctgaa     87900
     gttgtaggcg cccggcttct gcctgaggta ctcggcgaag gacttgaggt cttgcgcggg     87960
     cgaggaggcc ggcaccacca gcaccagcgg caccttggag atgagcgcca cggcggagaa     88020
     atccttgacc gggtcgtacg gcagctgcgg cgcggtgccg gccagcagga tctgcgtgga     88080
     catgccgccc agcagcagcg tgtagccgtc gggcttggcc cgcgccacgg cctggttgcc     88140
     caccaggccg cccgcgccgg cgcggttctc gacgatgacg gtctggccca gcgcctggcc     88200
     catgcgttcg gcgatcaggc gcgccacgat gtccgagttg ccgccggtgg caaagggcac     88260
     gaccagcgtg accgggcgtt cgggataggc ggcctgcgcg gtggcggcgc cggccagcag     88320
     cgcgacgccg gcggcgcggc gggtcagtct ggccaggcgg gaaagcaggg acttggacat     88380
     gcgggacctc gacgcaagaa agtacggcgg ttgagtggtt tgctgtttgt ggaaaattat     88440
     aggcaggcta ttggaaaatt ttctatataa aagaaaattt tcggggaaaa ccctggcagg     88500
     gcgcacgggt gggcgcggcg aagaatcatt cagtaacgtt tgtatcgatt tgcgttattc     88560
     gtgcgggcgg gatggcctat catgccgcgc gctctcgcgg gcgtgcgccc ggcgcatcgt     88620
     gcaaggcgct ttgtgtcatt gaaccgataa ccactagaac gagagaaacc gatgattcgc     88680
     cgactgctgt tgatcctgat gctgtgcgcg cccctggcgg cgtgcgagac gctgcaaagc     88740
     gggcaggggg gcgccgacaa gtacagcccg accgccttgc gcgagaacct gaagaaaggc     88800
     gtgacgacgg tcgaggacgt gcgccgcatc tacggcgagc cgcgcagcat caatcagggc     88860
     ccggaaggcg tcacgatgat ggtctacgac cccgacacca gccgcaacga catgttgtcc     88920
     accgccatga gcgcggtcgg gctgggttcg gtcggcggcg cggccaggcc cgagagccgt     88980
     tcgctgtatg tccatttcga gcgcaaccgc gttgaaagct acagtctgtc gagcagcaag     89040
     aattgacgcc ggccgcgccc gccgggcgcg gcgccactac gcaggagtcc cgaacatgtt     89100
     gaaaacgcta tgcaagacgg ccctggccgc cggggccgcg ctgggcctgg ccggcgcgtg     89160
     cgccgcccag ggcgccgaga cccacctggc catggccgag atggggggca cgatgcacgc     89220
     cgccgcgcag gcctgcggcg actacaagcc agccgagctg agcgacatga aggcgcgcca     89280
     gcagcaggcc atggccggca tgggcgtgtc cgccgagcag ttcgagaccg cgttcgcggc     89340
     cggcctggaa aagggccggc agcagatcgc cggcgccagc gcccagcaga agcagcagat     89400
     gtgcgagcag ctgcgcgcca tgccccggca gtagcccggg gtttcagccc cgccgcgccg     89460
     cgcggctgaa atccggccgc cgcttctcga tgaaggcggt gaccgcctcg cggtgctcgg     89520
     gcgtcttgtg ggcgatggcc tgggcggacg ccgactgctc cagcaggctg tccagcccca     89580
     gctcctggcc ttcgcgcagc aggcgcttgg tcagccgcag cgtggccccg gggttggcgg     89640
     cgatgcgctc ggccagctgg cgcgcctgcg ccagcaactg gtcgtgcggc acgacgcgcg     89700
     agaccaggcc gcaggccagc gcctcggccg ccgccatggc atcgcccgtg aacgacattt     89760
     ccagcgcgcg cgacatgccg accacgcgcg gcagcagcca tgcgccgccg tcgcccggca     89820
     cgatgccgac cttgatgaag ctctcggcga agctggcctg ctcggaggcg atgcggatat     89880
     cgcacatgca ggcgaggtcg cagcccgcgc cgatggccgc gccgttgacg gcggcgatgg     89940
     tgggcacatc gatgttgtag agggcgcgcg tgagccgctg gatgccgtgg cggtattcct     90000
     ggcggatgtc ggcggcgctg atgctgtcgt cgaaaaagcg ccgcatgtcc ttgacgttgc     90060
     cgcccgagct gaagacggga tcggcgccgg tgaggatgat cacgcgcacg gaatcgtcgc     90120
     gcgcgacttc ctcgcacagg tcgacgattt cctgcacggc ggtattgccg gtcagggcgt     90180
     tgcgcgtttc cggctggtcg agggtgacgg tccagatggc gccgtcgcgg tcgtggcgca     90240
     ggaatttgct catggtgttc gtttccgggt gagagacagg ggttgggttc aggccgccag     90300
     catgtgcagg ccgctgccca ggtgggccgc gccgtcgatc tggatcagtt gcccggtcat     90360
     caggtgggcg gccggcgtgg ccaggaaggc taccagttcg gcgacttcct cgacccgcgt     90420
     gggccggccc atgggcgtgg cctcgaccag gcggtcgagc atggcgcgcg cggcttcgcc     90480
     ggccaggcct tcggtgatca ccgcgccggg gccgatgcag ttgagcgcga tgtcgtcgcg     90540
     cgcccattcc agcgccaggg tgcgcgtcag gcccagcacg ccggcgcgcg cggcgatgga     90600
     gtgcgcgatg cccatcgagc cgcggtccac gcccgacagc gagatgttga ccaccgcgcc     90660
     cttgcgcgcc ttcaggaacg ggtaggcggc cttggtgacc acgaatacgg cgttgaggtt     90720
     gacgtcgatg acggcatccc agcccttgcg gctgatctcg gcggcgggcg cgaagaactg     90780
     gccgccggcg ttgttgacca gcaggtccat gccctggcgc tggccgactt cggccaccag     90840
     cgcctcgatg gcggcggtct cgcgcacgtt gcacggcgcg tggtcgaaac gcccggacag     90900
     gccttgcgcc aggctggcgg tctcggccag cggctcggcg cggcggccgg tgccgaacac     90960
     attcatgccc agcgacagca ggcgcagcgc gatgccgcgg ccgatgccgg agccggcgcc     91020
     gctgacgaag gcgctgcggc cggccagcgc gtcggcgcgc agcacgcgca agtcatcgat     91080
     ggggggagcg gaggatgagg tcatggacgg ctttcctgaa aaagggtttc ctgaaagagt     91140
     cgaacgggcg tcagccggcg cgccggccgc cgcccacgtg cggggtggcg gtgcgcggca     91200
     gccgctggcc gtcgaacagc gccgggaagg ccggcacgtg ttcgcccgag ggcagcggcc     91260
     gcgacaccgc gccgggacgc aggccgcgga tcatggccag cgcttcctcg ggcgggcgga     91320
     cgttgccggc cgggatctgc aattcgtgca tgcgcgccag caccgcctcg cgccgctgcg     91380
     gcagggtcca ggcctcgacc tgcgcgtcga aatgggcggc gcgccgcagg cgttccgtga     91440
     agggcgcgtc ctcggcgccg atcagcgggc gcagccgcgc ccagtaggtg tccacgccgc     91500
     cgaggatgta gacgtggccg tcggcgcagc ggtaaatgct cgacggcgcc gaggcgcggt     91560
     cgcggttgcc catgggcggg cccagcgcgt cgccttcgct gacggccagc gccgccggcc     91620
     cgatcagcat ggcggcggcc acctccatca tcgacaggtc gatcaggcag ccctggccgg     91680
     ccgggtccag catggccatg gcgcagctca tgccggtgta catgccgctg aacatgtcca     91740
     ccggccagct ggtcgacagg cgcggcgaac cgtcttcatc gccgttgagc agcgcgaagc     91800
     cggactcgca ctgggcgatg gtgtccatgc agacgcgctc gtcctgctgg ccatagcccg     91860
     acaccagcgc gatgaccagg cgcggaaagc gcgcgcgcag cgccggcccc cgcaggtcca     91920
     gctttgccag cgaggacggc gccaggttgc agatgaaggc gtcggccgtc tcgagcaggg     91980
     cgtcgagcgc ggcgcggtcg gccgccacgc gcaggtccag cacctggctg cgcttgccgg     92040
     tgttgaagct gcgcgcgtaa tagctgccgt acgcgttgcc ctgcagcgtg cgcaccccat     92100
     cgccttgcgg cgattcgatc ttgacgacat cggcgccgaa gtcggccagg tactgggccg     92160
     cggtggggcc ggcgatgaat tgcgagaggt cgaccacccg gcggcccgcc agcggccggg     92220
     gcaggtgcgc ggcgggctca ggcatggatc acccgcttgg ccttgtgcac ggtgcgcggc     92280
     agcgtgccgg actcgaccac ctcgacctgg aagcgcacct gcagtttttc gcgcaggcgc     92340
     tgcgacagcc gctcgcccac gtcggcggcc gcgccgctct cgcgctcgac ccgcagcttc     92400
     acgccggtca ggaatccggt gttcggatcc ttgaggctgt cgtcgagcac gatgacgtat     92460
     tcgttggtca ggccggggaa ggcgcgcacc acgtcctcga tggccgaggg aaacaggttc     92520
     acgccgcgca cgatcagcat gtcgtcgctg cggcccagca cgccgccggt cagccgcgcg     92580
     tgggtgcggc cgtcgggagc ggggcggctg tcgcgcacca cgatgtcgcc ggtccaccag     92640
     cgcaccagcg ggcaggcctg cttgtccagg tgggtcagca ccagcacgcc gcgctcgccg     92700
     tcggccaccg gctcgtgggt ctcggggtgc aggatctcga cgtagatgaa gtcctcggcc     92760
     agcgtgggtc ccagctgcgc ggcggtatcc cagccgatgg gctggcattc cagcgcgccg     92820
     tagcagtcgt acatcctggc gccccactgg cgctcgatgc gttcgcgggt gccggggatg     92880
     ctggcgccgg gctcgccgcc cacgcacacc atgcgcaccg gcgaggtggc caggtcgcgg     92940
     cccatggcct gcgcggcctc ggccatgtgg gccatgaagg agggcgtgcc gatcacgcat     93000
     tgcgtgccgt actggtagat ggtttcgatc tgccgctgcg tgtcgccgga ggaggcgggg     93060
     atgaccagcg cgccgacgtg ctgggccgcc agcgtggccc ccaggccgcc gacgaaccag     93120
     gcgtagttga acatgcactg gaagacgtcg ccgcggcgca gtccctggcc gtacaggtag     93180
     cgcgcgtaca ggtcggccca gcgctcgatg tcggcctggg tccacagcac cggcgcgggg     93240
     cgcgcggtgg tgcccgagga aaaatgcacc cggaccgctt cgcccggcgc gacggcggcc     93300
     aggctgccga aggggggctc ggcctgcagt ccggccaggt agtcgcgctt gtgcgtaaag     93360
     ggcaggcggc gcaggtcgtc caggcttttc aggtcgccgg gctcgaagcc ggcggccgcg     93420
     aagacctggc gatagtgatt gctggtgcgc gccacgcgct gcagctggcg ccgcagcgcg     93480
     tcgagctgga actgttcgat gcggtcgcgc gaccaggtct cggcctcatc ccagatcgta     93540
     tcggaataag gctgtctctc ttgctgcttc atcgttggag tccttgagta ggccccgcag     93600
     cgcgtaggcc gccagggcat gcgcgatatc gtctatcgcc tcttcgcttt gcaggcggcg     93660
     ctggctgtac cagacggtgg cccagttcag cgcgccgaag aacggtttgc tcaacaggcg     93720
     cggcggcagg tccacgaacg agccctcgcg gatgccgtcg tcgatgactt ccacgaacat     93780
     ctgctcgtag tcgtcgcgca tcttgaccac cgcgcgcagc cgcttggccg ccgaggaggc     93840
     ttccagcagg tggcgctcca gcccttgtac cgcgactttc tgcatcggca tctccttgag     93900
     caggatctgc gtgtgccgca gcgccatggc tgccagccgg ccgacggcgc cgccgccctc     93960
     cctggccagc ggctcgacct gggcggtcag gcggttcatg gcggtgacct gtacgtcgaa     94020
     gaacaggtca gccttgctgc ggtagtggtg atagatgcgg cccttggtgg agcccagccg     94080
     ctgggcgacg gcgtcgatgg aggtggccgc gtagccgaac tccatgaaca gttccgcggc     94140
     cgcccgcagg atttcgtctc gcgactcgcc gccgttggcg tcggcgggcg tctggtgtgc     94200
     actggccatt gatacctctt ctgcattgcc ggattcagtt cgccgcttct tccgcctcct     94260
     tgcgcaccgc gcgcgacagc accagccgct ggatctcgga agagccttcg tagatctcga     94320
     ggatgcgctg gtcgcggtag agacgctccg ccacggtggg cttgcaatag cccaggccgc     94380
     cccagatctg taccgtattg tccaccaccc ggtgcgatac ctccgaggag aacagcttgg     94440
     ccatggcgcc caggttggat acgtcctggc cggcgtcgta ggcgcgcgcc gcctcgtaga     94500
     gcatcatgcg cgcggccgag atctcggtgg ccatgtcggc caggcgaaag ccgatggcct     94560
     ggttctcgcc gatgggctgg ccgaaggccc ggcgggcgac ggcgcggccg gcggcctcgc     94620
     ggtaggcgcc cagcgccacc ccgagggact gggccgccac catgatgcgg cccacgttca     94680
     gggtctgcag cgccagccgc agggcgcggt tgagttcgcc cacgcgggcg ctgtcgggca     94740
     ccaccaggtc cagcttgagg ttggaggtct gggtgccgcg gatgcccatc ttgtccgaca     94800
     gttcgtcgat ctcggcgccc ggctgctcct tgtcgaccat gaaggccgac acgccgcgtc     94860
     cgccggcggc cggatcggtc ttggcgaaca ccacgtagta gcgcgacgcg ccgccgttgc     94920
     cgatccagta tttctcgccg cgcagccgcc agccgtcgcc ctcgcgggtg gcggtggcct     94980
     cgatggcggc ggcgtccgag ccggcgatgc gctcggacag cgcgaagctg gtggcgcggc     95040
     ccagggtcat ctcgcgcagg tagaagtcct tctgcgcgtc ggtgccggcc agcaggatgg     95100
     gaaaggcgcc cagctggtag gcgcacatga tggccgaggt cgaggcgcag tgcgtgccca     95160
     gggcctcgac cgccgccacc gtggtggtca ggttcgcgcc ctgcccgccc cactgggtgg     95220
     gcaggaacag cccggcgaac ttgtgctcga ccagcgcttc gatggtttcc cagggatagc     95280
     gctggtcgcg gtccagttcg ggggccagcg ggccgaagcg ctcgcggccc aggcgttcgg     95340
     ccagggtttg ccagcgcgtg gcggcgtcgt ccaatgcggg tttccagatg acagtcactt     95400
     tgggttctcc agggtagtcg cgacaggggt ggcgggctgg cggcggcgcg ccaggcgggc     95460
     cagcggccgg accaggccca tcagcccctg cggaaagaaa gccagtacca gcaccagcag     95520
     gctgccgagc acgatcttgt cgacatagcc gccgaacgaa aagaatttct cctggatcag     95580
     caccagcgcg gtggccagca gcgggccgag cagctggcgc cgccccacca gcaccacggc     95640
     ggtcagcatc aggatcagga agtaggtttc caggatgtcg gcgctgacgt aggcgcgctg     95700
     gtaggcgtac agccagccgg ccgccgcgct gatgggcgcc gagaacagga acacctgcag     95760
     ccgcacgcgc gccgggtcga tgccgctcat ggtggccagc cgcgggttct ggtgcaccat     95820
     gatggcggcg gtgcccagcc gcgagtggcg gaagcggtcg atcaggtaga tgaccacgac     95880
     cagcaggccg aaggcgtagg gccacagttc ctcgtcgttg ccggcggtca gcgacaggcc     95940
     ggccaccgac aggtccaggg tgggcaggcc gcgcaggccg tccgagccgc ccaggaaagc     96000
     ccagttggcc gccaccgtga ccgccaccac cgccacggcg taggtgacca gcgagaagac     96060
     gaactcgcgc agccgcagcg tgaccagccc gaccaccgcc gagacgccca gcgcggccac     96120
     gatggtggcc gccagcgtgg tccaggcgcc cgcgccggtg cgggtcgaga gcagggcggt     96180
     gacgtaggcg ccggtggcga agaacacggt gtggcccagg ctgacttcgc ccaggtccga     96240
     gaccaccacg tccagtccgt aggacatgac ggcgaggatg gcgatcagca cggccgcact     96300
     gtagatggcg gggctgccgc ccagccaggc cggcaggtaa aggacgatga cggccagcgg     96360
     caggagcgcg gcgcggcgca gcggcaggcg gatcatcagt gcaccccccg cgccgcgccg     96420
     gcgctcaggc cgcccgggcg caagaccagc acgccgatca gcaccaggaa ggcggccgcc     96480
     gtggcgtagg ccggcgagac cagggcgctg aacagggcgg tgaacacgcc cagcgccacg     96540
     ccggcggcat agctgccggt gacgctgccg atgccgccca gcaccaccac gacgaaggtg     96600
     atgatgactt cctcgaagcc catcgaggtg aggatgggcg tgcgcggcgc caccatgccg     96660
     gcggcaaacg ccaccgcggc gccctcgaag gcgaatacgc catagtagat gcggcgcacg     96720
     tcgacgccgg ccagctgcgc cagcttcggg tcttcggcca ccatgcgcac caggcgtccg     96780
     gcgcgcgagc cttccagcag ccacttcagg ccggcgaaca cggcgatcgc ggcgaccacg     96840
     atggcggcgt cctgccaggt gacccacagt tcgccgacct cgatatcgcg ctgcgaccag     96900
     gcggtgtcca ggatctgccc ggtcgagccg aagatcagcg aggccgcgcc ctggatgacg     96960
     tagccgaagc ccagcgtcat gatcatgatg gacaccaggt tctgctcgaa ggtggcgcgc     97020
     agcatgatgc gctgcatggc caggccgatc agcgcgccca gcgccatggc ggtgggcagc     97080
     gccagcaggt agggcatgcc ggccgaggtg gtggcccacc aggtgacgaa ggcgcccacc     97140
     atgtacatct ggccatggcc gaagttcacc agccgggcca cgcccagcag cagggtccag     97200
     ccgatggcga tcagcgcgta ggcatggccc agcacgatgc cgttgatgag ctgttgcagt     97260
     agattcatgc ggcgtgcgct ccgagatagg cctgggcgat gcgcggatcg gcgccgacgc     97320
     tggcggccgg gccttccagc accagccggc cgcgctcgag cagcagcagg cggtcgacca     97380
     cttccatggc ggcgcgcacg ttctgctcca ccagcaggat ggacaggccc gagcgcgcca     97440
     gggtttgcag cgtttgcagc acctgcgaga ccagcatggg cgccaggccg atggacggct     97500
     cgtccagcag cagcacgcgc ggacccatca tcagcgcgcg gccgatgccc agcatctggc     97560
     gttcgccgcc ggacagctgc gcgcccaggt ggcggcgccg ttcggccagg cgcgggaaca     97620
     gctggaagac ttcgtcgcgg gtatagaagc ggcggccgtc cgtgctgccc gcgtcgaagg     97680
     cggcgctgag gttctcctcg acgttcatgc tggcgaagat cagccgtccc tcgggcacca     97740
     gcagcaggcc ggcgcgcacc cgctggtggg tgggcgtggc gtcgatgcgc cggccgtcga     97800
     ggcggatttc gccgcgcacc gtggggcggc cgcgcgacca gccgagcagg gcgttgacca     97860
     gggtggactt gccggcgccg ttggcgccga tcacgccgac gatttcgccg cgccccaccg     97920
     acagcgcgtc caggccgagc gcgcggttgc cggcgtagcc gacttccagt tgccgtgcgc     97980
     tcagcacggc ctggtcgctg ggcggggcgt tcattgcgcg ctcccgagat aggcttccag     98040
     cacgcgcggg tcgttctgga tggcggccgg ggcgccgcag gccagcggac ggcccaggtt     98100
     gagcacgcag atccggtcgg ccacggccat gatcagttcc atatggtgtt cgatgacgac     98160
     cagcgccacg ccttcgcttt tcagttcgcc cagcagccgc accagcgcgg ccatgtcggc     98220
     gccgcccagg ccggccgccg gttcgtccag cagcagcacg gtggcgctgc ggccgtaggc     98280
     cagcgcgatc gacagcatgc gctgcatgcc ataggagatc tccttgggat gcaggtcgtg     98340
     gcaggcggcc ggcacgccga agcgctccag ctggccggcc gcccaggcgc gcgcctgggc     98400
     gcggcggcgc gccgcgccca gcgggttgag cgcgctggcc agcagccccg cctgcgcctg     98460
     ttcgcccagc accgccatca tgttctccag cacgctcagg tcgtcgaaga acgcgttctg     98520
     ctggaaggcc cgcttgatgc ccagcgcggc caggccgtgc gcgggcacgg cgctgatgtc     98580
     gcgcccgtgc aggcacaccg tgccggtgcg cggtatcagc gccgacaccg cgtcatagca     98640
     cgagctcttg cccgcgccgt tggggccgat gatgcccagc agctcgccgg cccgcacttc     98700
     ccagctgacg tcctccagcg cgaccagggc gccgtagcgc acgcccagcg cctgcacgct     98760
     gagcgcgggc gcgggggcgg cggcctcggg ctgcgcgatc atggctggac cacgatcttg     98820
     cggccgtcga cgcggaacag gtagtagttc gacttcagct ggccgttggg ttcgaactgc     98880
     aggtcgccca tggcggtgcc cttgaacgcg ccgccgcgga tgcgcttggc gatggcctcg     98940
     cggtccagcg tcttgagctc gttggcagcc atggcccaca cctgcagcga ggtggcgccc     99000
     agcgccatga acttgtcggg cgtgtacttg aacatctcct gcgtcttggc cacgaagcgc     99060
     tggttggccg ggttggacgc gaacggctcc acgtcgggga agtagatgtc ggcgccgatc     99120
     aggccgtcgg cggcgtcgcc cgccacgttg atgacgctgg gggccacggt gcccaccgcg     99180
     ctgaccagct tgcccggcag gcgcgactgc ctggcctggc ggatgatggc cggcatgccc     99240
     aggccttcgt tggcgttgat ggccacggtg acgtcgggct tggccgcgcg cacgttggtc     99300
     atggcgaccc ggaagtcggc ctgcgtgaac gggaatttct cttcggccac tttttcgtag     99360
     gcatagccca gcttcttgag cgaggtctcg atggactcct gcgcgccgtt gccataggcg     99420
     tcgttctcgg tcaggaaggc cacgcgcttg gcgcccaccg atttgatgta gtcggcgatc     99480
     accgcgccgt cctgcgagtt ggagctgttc aggcggatcg ccagcgggtt gccttcgccc     99540
     gaaagaatcg ggtcggcctt ggagatcgcc gtgatgtcca gcacgccggc gcgcgcgatg     99600
     accggctgca tggccagcgt gaccgggctg ttccagcctt cgatgatgac cgacacgccg     99660
     gcgctgatca gttcggtggc gcgcgagacg ccgaccgcgg gcgtggactc gtcgtcgcgc     99720
     gacacgatct cgatctggcg gcccatcacg ccgccgcttt cgttgatgac cgccgccatg     99780
     gcctggatgg cctgcgtgac gtgctggccc tgcggcccgg ccccgcccga aaggggaaag     99840
     atcacgccga ctttgatggg ggtctgttgc gcctgtgccg ccgcgcccag gctcaatgcc     99900
     agcagccccg cggtgaacag tctgtgtatc cgcttcatgc ctgtctcctg atcgttatgc     99960
     gagcggcgcg gtgcgccgtc gctttctgta cggcgcccgg ggacgccgtt cttcacggtg    100020
     aaacgttgct agcgatgaaa gccggccgct ccgccgcgcg cctctgcggg cggtccggcg    100080
     ggtcggtgca actaacatac catcaggtat tttttgaagt caatgaagtt catcgaattc    100140
     gatcattggc gatttcccta ataaaaacaa aggatttttc ggctgcactt aatttttttg    100200
     aaaaaatacc atccggtatg tattatggcc ggactgccat tccatccgcg aggttgcctg    100260
     ccatggatac acaaggaatc agcgcgcttg tcaccggcgg cgcatcgggc ttggggctgg    100320
     ccgcggcgcg ccgcctgctg gcggccggcg cgcgcgtggt catcgccgac ctgcccggct    100380
     cgccgggcga ggaggtcgcg cgcgagctgg ggccggatgc gcgtttcgcg ccggccgacg    100440
     tcacccgcga agacgacatg aatgccgcct gcgacctggc cgagtcgctc ggcccgctgc    100500
     gcgcgctggt gcattgcgcc ggccgcggcg gaccggtgcg cctgctcgac aaggaaggca    100560
     accccgggcc catggatacc tacgccgaca tcgtgcgcgt caacctgctg ggcacgttca    100620
     acacgctgcg gctggtggcg gcgcgcatgg cgcgcaatcc gctcacgccc gaaggcgagc    100680
     gcggcgtgtg cgtgctgacg gcgtcggtgg cggcctacga gggtcagatc ggccagatcg    100740
     gctatgcctc gtccaaggcc ggcgtggtgg gcatgaccat cgtggccgcg cgcgacctgg    100800
     ccagcaaggc gatccgggtc tgcaccatcg cgcccggtat cttcgacacg cccatgctgg    100860
     cgcgcgtgtc ggccgaggcg cgcaagacgc tcgccgcatc ggtgccccat ccggcaaggc    100920
     tgggcagccc cgacgagtac gcgcaactgg cccagcacat catcggcaac gccatgctca    100980
     acggcgaaac catccgcctg gatggcgcgc tgcgcatggc gccgcgctga cccatccgac    101040
     cgaccccgaa ggagacgcca ccatgagcgt gcaagccccc gatgccgcgg aagtcctcgt    101100
     cgaccgtgcc gacggcattc tcaccatcac catcaaccgg ccgcaggccc gcaacgcgat    101160
     caacccggcg gtggcgcgcg gcatcgccgc ggcggtcgac gagctcgacg ccagcgacga    101220
     gctgcgcatc ggcatcctga ccggcgccgg cggttcgttc tgcgccggca tggatctcaa    101280
     gggcttcctg cgcggcgagc tgcccagcat cgaggggcgc ggcttcggcg ggctgaccgc    101340
     ccggccgccg cgcaagccgc tgatcgcggc ggtggagggc tatgcgctgg ccggcggctt    101400
     cgaactggtg ctggcctgcg acctggtggt ggcggccgac aatgcgcagt tcggcgtgcc    101460
     cgaggtcaag cgcgggctgg cggccacggc cggcggcctg gtgcgcctgc cgcgccagct    101520
     gccctaccgc atcgcgctgg agctggcgct gaccggcgac atgttcccgg cccggcgcgc    101580
     ccacggctat ggcctgatca accagctgac cgaacccggc caggcgctgg acgcggcgcg    101640
     cgaactggcg cggcgcatcg tcgccaacgg gccgctggcc gtggccgcca gcaagcgcgt    101700
     ggtggtcgag tcgcaggact ggccggccga cgaggtgtgg gagcgccagg cggcgctgac    101760
     cgagcatgtg ttcgagtcgg ccgacgcgcg cgagggctcg gcggccttcg cggaaaagcg    101820
     ccagcccgtc tggcagggga agtaggccat ggccaccgat acgcgtttcg acggccccgg    101880
     gcccgatgcc tgctatcacg cggcgctggc cgagggccgg ctgctgctgc agcattgcga    101940
     ggactgcgcg gcggtgcgct tcccgcccgc gctggtgtgc cgcgcctgcg gcggcgcgcg    102000
     gctggcctgg cgcgagtcgt ccggccgggg cagcgtgtac gccgccacca cggtgcgcga    102060
     ccgcgccggc gactacaacg tgtcgctggt cgagctggag ggcggcgccc gcatgatgag    102120
     ccgcgtcgag ggcatcgagg ctgcgcgggt gcgcatcggc cagccggtgc gcgcgcgcat    102180
     cgtggcgggc gaggaaccct atgtggtgtt cgcgccgcac gacggaggcg ccgcatgagc    102240
     cgcgcgctgc gaggccgcgc cgtcatcgcc ggcatcggca atacccaccg ctggcaggcg    102300
     cccgggcgca cgccgttcga ccagctgcag gaggcggccg tgctggcgct ggaagactgc    102360
     ggcctggcca tggcgcaggt cgacggcctg ttctgcgcca tgtccacctc gggcctgccg    102420
     gtgctcaacg tggccgagcg gctcggcatc cggccgcgcc atgccgacgg caccatggtg    102480
     ggcggcgcgt cgttcctgtt ccacctgcag gcggccatcg cggcgctgga gaccgggctg    102540
     tgcgaggtgg cgctgatctg ctatggctcc aaccagctta ccgccggcgg caagctggcc    102600
     tcgatgccgg acccgcagcc gtacgaggcg ccgttccggc cgcgctatcc catgtccagc    102660
     tatgcgctgg ccgcggcgcg ccatatgcac cagtacggca ccacgcgcga acagctggcc    102720
     gacgtggcgg tggccgcgcg cctgtgggcg cggcgcaatc cgcacgccta cgcgcgcgac    102780
     ccgctggccc gcgcggatgt gctgggcgcg cgcatgatca gcgacccgct gaccaaggcc    102840
     gacagctgcc tggtgaccga cggcggcgcc gcgctggtgc tggtgcgcgc cgaacgcgcg    102900
     gccgatctgc cgcgtccgcc ggtctatgtg ctgggcaccg gcgtggccgt gagccaccgg    102960
     cagatttcgg ccatgcccga cctgaccgtc acctgcgcgg tggagtcggg ccggcgcgcg    103020
     tgcgagatgg ccggcgtggc gccgcgcgac atggaccacg tgatgctgta cgacgccttc    103080
     accatcaaca cgctgctgtt cctggaggac ctgggcttct gcgccaaggg cgaggccggc    103140
     gcgttcgtcg agagcggcgc gatcgcgccg ggcggcagcc tgccggtcaa caccaatggc    103200
     ggcggcctgt cgtgcaacca tccgggcatg tacgggctgt tcaccgtcat cgagtcggtg    103260
     gcgcagctgc gcggcgagtg cggcgagcgc caggtcgagg gcgcgcgcct gtcgatggcg    103320
     catgccaacg gcggcgtgct gtcgagccag gccaccgtta tcctcggcac ggccgagacg    103380
     ctgtgagggc ggccatggcg atcgatcccg accgactgct ggccgccgag atcccggcgg    103440
     tggagcagca atacgactgg cgccagtgcg tgctgtacgc gctgggcatc ggcgcggggc    103500
     tggacccgga agacgggctg gacctgccgt tcgtcgacga gacccgcctg aaggtcgcgc    103560
     ctaccttcgc ctgcgtgctg gccgatccgg ggttctggat gcgcgacctg ccgctgggcc    103620
     tggactggct gcgcaccgtg cacggcgagc agtcgatgcg cgtgcatcgg ccgctggccg    103680
     gccgcgcctc ggtgcgcggg gtgacgcgca tcgtcgatgt ggccgacaag gggcgcgaca    103740
     agggggcgtt gatctacgcc gagcgcgagc tcatcgacct ggccgacggc gcgccgctgg    103800
     ccacactgag ccagacggtg ttctgccgcg gcgacggcgg cttcggcggc aagccttcgg    103860
     cgcgtccgcc gccgccgccg gtgccggcgc gcgcgcccga cgcgagcgtc catgcgcgca    103920
     cgtcgctgca gtcggcgctg atctatcgcc tgtcggccga tctcaatccg ttgcatatcg    103980
     acccggccgt ggcgcgccgg gccggctttc cccgccccat cctgcacggc atggccagct    104040
     tcggcgcggt cggtcaggcg ctggtcaagg cctgctgcgg cggcgagccg gcggcggtgc    104100
     gcggcatggg cgggcgcttt tcggcgccgg tgttcccggg cgaaaccgtg cgcgtggaca    104160
     tctggcgcgc cggcccgggc cgcgcggcct tccaggcccg cgtggcggcg cgcgacgtgg    104220
     tggtgatgga caacggcacg ttcgactacg aggcctgagt ccgccgcatt ccaacccgac    104280
     tcaaggaggc agcatgaccg gctcgacggc aggcaaggta ttggtggtgg gcgcgctggg    104340
     cgtggtgggg cgcgctgcgc tggaacactt cggccagcgg ccggggctgg cgcgggtggg    104400
     gctgtcgcgc cgcgcgcccg atttcgcgcc cgaggcgacc tggatttcgg ccgacctgcg    104460
     cgacgcgcag gccacgcgcg cggcgctggc ggcccatggc gacgccacgc atgtggtgta    104520
     cgccgcgctc aacgagcagc ccgacctgct caaggggtgg cgcgacagcg gcaacgtcga    104580
     tctcaatacg cgcatgctgc gcaatacgct ggacgcgttg cgcgaggcgc cgctgcgcca    104640
     cgtgacgctg ctgcagggca ccaaggccta cggcgtgcac accggccgcc ccatgccggt    104700
     gcccgcccgc gaaaccgacg cggtgcgcga tcacgccaat ttctatttcg accagcagga    104760
     cctgctggcc gaacgcgccg ccgcgcaggg ctttgcctgg accatcttcc ggccgcagat    104820
     cgtgctgggc gtggcgctgg gcagcgccat gaacccggtg gccacgctgg gcgcctacgc    104880
     ggcgctgtcg cgcgaggccg gccagccgct gcgctatccg ggccatccgc acctgctgac    104940
     agagtgcacc gatgcgcgcc tgatcgcccg cgccatcgcc tgggcctggg acgagccgcg    105000
     cgcgcacggc gaggcgttca atatcgccaa cggcgacgtg gtgctgtggc agccggtgtt    105060
     cgagcgcctg gccgcgctgt tcggcatgcc gctgggagag ccggtcgaca cgcgcatgcg    105120
     cgaggccatg cccgagcagg ccgagcgctg gcgggccatc gccgaacgcg agcgcctggc    105180
     cgtgccgcaa ttgcgcgacc tcatcggcct gtcgtggcag tatgccgacg ccacctgggc    105240
     ggcgcgccac ccgctgccgg tgccgccgct ggtgtcgacc atcaagctgc gccaggccgg    105300
     ctttggcgac tgcatcgata cgcaggagtg catcgtcgag cacttgcgcg agatgcagcg    105360
     cctgcgctat ttgccgcgct gagcgcgggg ccgggcggcg gcccggccct tgtccctact    105420
     gcaccggcgg gatgcccgcc tgcttgatca gttcccccca gcgctggctt tcgcgctggg    105480
     tgatccgggt cagctcggcc ggtgtgctgg tgcgcgcctc gttgcccagc ttgcgcatgg    105540
     cctcggcaaa gcgcgtcgag ccggtgattt cgcgcagcgc cgcgttcagc ttttccacca    105600
     cgggcgccgg cgtgccggcc ggcgcgaaca cggcgtacca ggtctcgccc acgatggacg    105660
     ggtagcccag ctcgcggaac gtcggcacat cgggcatcag gggctggcgt tcggcgctga    105720
     gcaccgccag cgcgcggtac tggccggcct gcacgttggg cagcgcgctg gtcagcgcct    105780
     cgacgttgga gtcgacgatg ccgcctatca tgtccatggt ggccggcgcc gcgcccttgt    105840
     agtgcacctg ggtcacctgg gcccgcaggc cggtggccac cagttcgccc agcaggtgca    105900
     ccatgctgcc ctggccgttg gtggcgttgt tgattttgcc gggatgggtc tgggcgtagg    105960
     ccacgtattc ggccacgctg cgggccggga aatccttctt caccacgaag gcgaacggca    106020
     ccgtcgcgat cgcggctacc ggcgcgaaat cctccagcgt gtacggcatc tgccgcatca    106080
     ggtgcggcgt gacggtgaac gtgctgcccg aggaaagcag cagcgtgtag ccgtccttgg    106140
     gcgcgcgcgc cacgtaggtg gcgccgatca gggtcgaggc gccggccttg ttgttgacca    106200
     cgaacgagcc gcccagggtt tcgcccagtt gctgggccag ctggcggccc actacgtcgc    106260
     tggtgccgcc gggcggaaac gggatgacca gggtcacggg cttgtcggga tagcgggcgg    106320
     ccgggtcttg cgcgagggcg gcggcgggca gggcgagcgc ggcggccagc gccagcgcct    106380
     tgattcgtac ggacatggcg agtctcctgt cgttgtcttg cgcggcgcgc cgcggtggcg    106440
     ggacgccgcg aggtgcggca gtgatgcgtg tcgcggcggc ggcgccgcgc gggcgggtca    106500
     gaccgtggcg atgggcgtgg ccggcgagcc gaccgcgccg ggcaggcgca gcggcggggc    106560
     ggtcagcagg aagctggagc ggtcgtgctg gcgcagccat tgcgccagtt cggcgaagta    106620
     ccagagttcg cccaggttca ggcccagctt gaacagacag tgcgcgtgca gcggcaggcc    106680
     cgggtagtgt tcgcccttgc cggggccggc cggataggct tcgacggcga agttgtcggc    106740
     gcagatggcg acgatgcccg agtcggtgat ccactgcagc agcttctcgt cgcggccgtc    106800
     gagcaccgcg caggagcgcg ccagcacttc gccgtcgggc tgcttgttca tctccagcac    106860
     gagatcggcg aagccggtgt acaggcacag gaagtcgccg ggctcgacgc tggcgcgctg    106920
     cgcgtccagc gcggccatca ggccgtcgta gccgaccagc gcgcgctcgc gcccgtgccg    106980
     gcgctccagg tccaccagca cgccgcgccc ctgcacgccg gcggtggcca gccgttcgat    107040
     gccgatggcc ttggcgccca ggttgtcggg cgcgtcgtcg ggacccacca cgtccacgcc    107100
     gccgcgatag ccgttgtaat agaccttctc gggtatgccg tcgtcgttgg cgtcgaacat    107160
     ctggccgacg tggcccagcc cgtcccattg ggtggagtac tgcgtgtaca tcagcaccgc    107220
     gtcgtcggac accacgtcgc tgaagcagcc gcacacgttg gacaggcgga agttgtagtt    107280
     gtggctgggg ccgcgctttt cgtagaagaa gcgcggcgcc ttgcggtgct ggaacagggt    107340
     gttgccgccc gggtagtcca gcggcaggct gaggcagaag gcgatgccgt gctcgacctc    107400
     gcggatggcg cgcaggcgcg cctgcggcgt gagcaggttc atgcggccta tctgatcgtc    107460
     gggaccgaag tcgccccagt tcgatccttc cggacgcttt ttccaacggg gggaatccat    107520
     ggcgatgact tccttgctga gagttggagg ggaaggcatg cgggggtcgc cgccagccgg    107580
     ttcctgcgac cggattcgca tgacgaagtc aacataccat ttggtatgtc atgggtcaat    107640
     tggtgaaacg ccgcgatcga atatatgagt atttagctag taaatactca tactttcctt    107700
     gtggattgga tttctatcga tagataccga ttggtattta tttgggggcg gaagtcggcg    107760
     cgatggaagc ggcgcggcgg cgccgcgccg cccggaaagg attacagggc gttcttgctg    107820
     atcgcccgcg cggcgcgcac cgccagcggg ccgagatcct cgcgggcgcg ttcgagcgac    107880
     cagcgcggct tgggcaccga gatgttgacc gcggccaccg gcgcgccggt ttcgtcgacg    107940
     atggtggccg ccacgttgat gtcgccctgg tagaactctt cgtcggcgta ggcgtagcgg    108000
     tgctcgcgcg cttcgtcgat gaggtggcgc agcacggcca gatcggtggt ggtgcgcgag    108060
     gtatggcgcg gcacggccat gcgggccagg cgcgcctcca gctgttcggg cggcaggtgg    108120
     gccagcagcg cgcggcccga cgccgaggac agcatgggaa tgcgcgtgcc ggccggcatg    108180
     tagaccggga tgtgcttgga cgtggggatg cgcatcacga agaccatgtt gtcctcgccg    108240
     tcgggcaccg acaggttgac gatctcgccg cactcctggt tgagctggtg cagcacggcg    108300
     tgcgcgtgct ggaacaccgg ctcgcgcgcc aggaagctgt agcccaggcc caccgccttg    108360
     acggtgaccc ggtagcgccg cgagactggg tccttcctca ggtagccggc gcgctccagc    108420
     gtataggcca cgcgctgggc cgaaccgctg gtaatgccgc aggcccgcgc gatttcctgc    108480
     aggttcatgg tttcgctgtt gcgaaacgcc tccaggacgg ccaggccttt ttccagcgat    108540
     tgaatgagca atgccgattc cgccatgggt gtgcttgcct tgcgatggcg cgcggccatc    108600
     ggatgtgatc ggggttattg acaggcgata gtaccttgcg gcgcccggcc gccggatgtc    108660
     atccgtcacc aggaaaacgt cgttgacacc cgccggaaac aatgactaaa tatcgaataa    108720
     cagattcatg ttatcgctat tcgataagat aatgcaggat tccaagcccg tcaacgaggc    108780
     gcttccccgg cgcgtggacg tcgccatcat cggcggcggc atcatcggcg tcagcaccgc    108840
     gtacgccctg gcccgggccg gcgtgtcggt ggcgctgttc gagaaaggcc gcctggccgg    108900
     cgagcaatcg tcgcgcaact ggggctgggt ccgcacgctg tgccgcgatg ccgccgagat    108960
     cccgctggcc ttgcgcgccc acgcgctgtg gaccgagatc caggccgagg tggacgtggg    109020
     ctatcgccgc accggcatgc tgtacctgca ggaagacgag cgcgacgccg ccgcgcacca    109080
     gcgctggatc gagcaggcgc gcgcctatgg cgtggacgcc gccctgctgg gccgcgcggc    109140
     ggcgctgcgc tgcctgccgg cctcgtgccg cccctggagc ggcgccatgt acagcgcctc    109200
     ggacggcgtg gccgagcccg agctcgccac ccacggcatc gccacgctgg cgcgccggca    109260
     cggcgcggcc ctgttcgagc agtgcgcagt gcgcggcctg gacacggcgg ccgggcgggt    109320
     cgacggcgtg gtgaccgagc gcggccgggt ggccgcagaa gcggtggtca tggccgcggg    109380
     cgcgtggtcg cggttgctgt gcggcaattc gggcgccgac ttcccgcagc tgaaggtgcg    109440
     cggttcggtg ctgcgcaccg cgccgtgcga cctgccgctg gccgccaccg tcaacggcaa    109500
     ggacttcacc tgccgcaagc gcgccgacgg cggctatacc gtgtcgcagt tcggcgcgtc    109560
     gatggcggac atcgtgcccg acagtttccg cctgctgggc aagttctatc gcgcctggct    109620
     ggccaacaat gccttcgtca agctgcgcct gggcaaacgc tttttcgaag agctggcgat    109680
     tccgcgccgc ttcgcgctgg accgcgccac gccgttcgag cagtgccggg tgctcgaccc    109740
     ggcgccctcg gccagtgcgg tggcgcgcgc ctggcagcgg ctggtgcagg cgtttccgga    109800
     tttccgcgcc acgagcgtgg cggcgtcgtg gggcgggtat atcgatgtca cgcccgatgc    109860
     gctgcccgtg atctcgccgg tgccggcgct cgatggggcc tatctggcct cgggcttttc    109920
     cggccatggc tttggaatcg ggccggcggt cggcgagctg gtggcggaca tgatccgggg    109980
     ccgggccgcg cagtcggcgg tccagccatt ccggtttacg aggttttccg aatgatttcg    110040
     tcgggccgcg aggccgattc acactttgtg caaggggaaa tgcaaatggc tttggcagca    110100
     gacctgcacc gggatgccgt cgtggtcgac ggcctggtgt tcttcagcga cggcagcacc    110160
     cgcgacatgc tggccggcgg cgtcagcgcg atcaacctga ccgtgaccga gatgagcgcc    110220
     gacttcgaac aggcgctcaa ggacgtcatg gcgtggcgcc agcgctgcca ggatccggcc    110280
     tcgggctgga cgctggtcga gcgcgcggcc gacatcgcgc gcgccaagcg cgagggcaag    110340
     ctgggcctga tcatgggctg gcagaacgcc cgcccgctgg gcgaccggct cgagcgcatt    110400
     gcgctgttcc acacgctggg catgcgcgtc atccagctga cgtacaacga ggccaacctg    110460
     atcggcgacg gctgcctgga aaagcgcaac gccggcctgt ccaacctggg cattgagatg    110520
     gtgcgcgaga tgaaccgggt gggcatcgcc atcgacctga gccattgcgc cgagcagacc    110580
     tgcctggacg cggcgcgcca cagcacgcgg ccggtgctgc tcacgcacgc caacgccaac    110640
     gccgtgatcg cgcggccgcg caacaagtcc gatgccgtga tcaaggcggt ggccgccacc    110700
     ggcggggtca tcggctgcag tatccatgcc tacctgaact ggcgcggcca ggccggccag    110760
     cagcccacgc tggatgactt cgtggccaac atccgctaca tcggcgacct ggtgggctac    110820
     gagcacgtgg gcataggcac ggactttccg gcggtcgaca cctacgaggc ggtgcgccac    110880
     gtgatggtga tgtcgcgcac caagtacgcg gcctcgggcg gcgacttctc caatgccttc    110940
     ggcgacgtga tggaagcgcg ctatccggtg gaaacgccga cccccgccca attcggcggc    111000
     ctgaccgagg cgctggcgcg cggcgggctg agcgatgcgc agatcagggg cgtgctgggc    111060
     gggaacttcg tccgcgcttt cgacgcttgc tggcaaccag cctagaacca aggaaacaac    111120
     catgaacctc catcgcaaat tcggcgccgc gctggcggcg ctggccggcg cggcctgcgt    111180
     ggccggggcc gcccaggcgg ccgacttccc caaccgcacg ctgcgcatca tcgtgccgta    111240
     ccagcccggc ggctcgaccg acatcgtggt gcgcaagttc gccgagctgg ccgcgcccga    111300
     gctggggcaa tccatcatca tcgagaacaa gggcggcgcg ggcgccacca tgggagcgcg    111360
     cacgctggcc acggccacgc cggacggcta cacgctggcc atcctgccca gcccggtgtt    111420
     tcgcatgccg cacatccaga acgtcggcta tgacccgacc cgcgacttca cctacgtgat    111480
     gatgctcagc ggctacacgc tgggcgtggc ggtggcggcc gatgcgccgt acaggaactg    111540
     gggcgagttc atcgcccatg ccaaggcgca tcctggcgac gtggcctatg gcaccgccag    111600
     cgtgggcagc gcctccaacg tcatgatgga ggacatcgcg gcgcgcaacg gcgtgagctg    111660
     gcgccacgtg ccgtacaagg gcgagtccga tgtgatccag ggcgtgatgg gcggccagct    111720
     gaccgcctac gcaggctcga ccacggtgct gcccatggtg cagtcgggca agatgcgcat    111780
     gctggtgacc tggggcgggc accgcagcgc gcagtttccc gatgtgccct cgctcaacga    111840
     gctggacggc acgccggcgg tctatgcgcc gttcggcatc gcggcgccca agaacctgcc    111900
     ggccgacgtg cgcaagaccc tgcatgacac cttcaagcgg gtggcgcaat ccgacgcctt    111960
     caaggaagtg ctgacgcaat acggccagga gctggtctat atggacggcg agacctacgc    112020
     ggcctatgcc gccgagcagt tcgaggcgga aaaggccatc gtcaagaagc tggggctggc    112080
     gggcaactga gcgcgggcat tcggttgcct gttgtcctgg cagtcaaccg atcatggcgt    112140
     agaacggtgt gcctgtccca gtggggacag gcacacgctg ccgcaggtgt ccatcccacg    112200
     tggtgcggcc cctcactgtc ccgtctccac cagctggttg gcgtccaggc ggcgttgcgc    112260
     ccagcgcgcg tattgcagcg cggccagccg gttggcgtgg ccgatggcct ggcgccatgc    112320
     ggcgcaggcc tgctccagat cgcccagcag cagcagcgcg tcgccgcgca ggcacagggt    112380
     ctcgggcatc atcccggcga tgcggaaacg cgcgcacagc aggtcggcgc ggtccagcgc    112440
     cagcagcgcg cggtccggcc tgcccagggc gttgagggcg caggccagca ggcactggcc    112500
     ggccacttcg gcggtgggca gggcgcgccg tatcgtttcc agcgccggtt cgaaattgtc    112560
     gagcaccgac gcatcgccct gcagcgcggc ggccaggtcc acatagcagc tggtcagggc    112620
     gtagaggaat tgcgggcgca gcggatgcgc atccatcgat tgcttgagcg cgccggccac    112680
     catgcccatt tgggcccaat cctcgtacag atagctgaac ttgaccagca tcatgctgct    112740
     ggtggccagc atcaaggggt tgttgtcctg ctgcgcgtag gccatggcgg tctgcacgct    112800
     ttgcatggcc tcgtcgccgc gcccctgggt ggcgacggtc agcgccagca tggcgtggat    112860
     cagcgcgccg gcgttctcgc ccaggatggg cgccgggccg atatcggtat gcgggaacac    112920
     cagcccgtgc agcgcctggc gcagcaggcg ttcggattcg atgacatcgc ctttccagag    112980
     ttcgcagatg gccatcgcgt acagcgccca ggtgcgccag ccgctcttgc cgtgctcgtt    113040
     ggccatgttc agcaactggt gcgagaggct gacggcctcg tcgtagtcgc cgctgtgctg    113100
     gcaggtgttc catagcgccc agagcgcggt gaagcggctc tgcgggtcgc cgggactgac    113160
     gcgcaccgcc agcgtgtagg cctgggcggc cgccatcgac ccggggccgt ccaggttgcc    113220
     ggccagttcg ccgcggacca tgtggcaggc gaactcgaat tcgtcgcgct cggcatcgga    113280
     ttcgatctgc tgccgcagcg ccagggcatt gtccagatag cggtgcgcct gcgcatagtc    113340
     gccgcgcctg acgacctccc agacggcggt gcgccaccat tgcgcggcct gcgggtcgcc    113400
     cgcctgctgc aggtggcggg cgatctcgtg cggcgcgccg gcgttttgct gcaggtgctg    113460
     ggcgatgcgc tggtgcagcg cgccgcgctg ttcgcgcagc atgtagcggc gcaccgcctg    113520
     cgcgatgggc ggcgggcagc gccagccctg gttcgcgtcg ccgtccagca ggccatggcg    113580
     gcccagggtt tcgaggcgcg tggccagggc ggcggcggcg gtctgcagca cttcggccag    113640
     ccggccggcg tcggccgggg catcgccgca cagcaggcac agcatctgca gcgcgtggcg    113700
     ctcgggctcg gccagcaggt tcagctgcag cgccacgcgg tcggccaggc tgggcacgcc    113760
     ttgcggcagt gccagttgcg cggcgcatcg ggccagctcg ccggcataca gcgggttgcc    113820
     catgctctcc tgctgcacct gggcgcgctg gccctggctg aggcggtagg tgcgcgccag    113880
     cgaggcggcc agctgcgcgg tggcctcgcg gtccagcggc ggcacggtga tggcctggtg    113940
     gtcccagacc ggcgcgtaga cgtcgcgcgc cgtggccagc agcagggtgg ggccggagac    114000
     gacgcggccg gccaggtgtt cgatcaggcc caggctggcc ggatccatcc agtgcaggtt    114060
     ttcccagacg atgagctgcg gccggccggc cggcgtgcgc tgcaacagga tggaggtgag    114120
     gatttcggtc aggtcgatat cgtgcggcgc ctcgccgcgc ccgccgtcgt cggcgccatg    114180
     cagccattgc cacaggcgtt cggccgcggc ggcgcgcagg cccgtgtgcg cgcgcaggcg    114240
     ctcgaccaga tgggcgtgcg cggcgcggcc ggcgccaggc tcggtctcgg cgatgccgct    114300
     gtgggcgcgc agccatgcct tgaccgggtg ccagggcgcg gcggccatgt gttcctggcc    114360
     ggccagcagg taggcctcgc cgccggattg gcgcgcatat tcgatcagcg cctgcgccag    114420
     ggcggtcttg ccgatgccgg ccacgccgcg cagcagcacg gtctggggcc gctcgcggcc    114480
     cttgagctgg ttccacaggg ccgtcaggcg ttcgaactca tggttgcggc cgaacatgcg    114540
     gcgcgccggc gcgtgggccg tgggcgcgcc cagcgcctgg tggtcgtcgc tgcgccggcc    114600
     ggtctgcacc agctgccatt cggacaggcg caccgcgcat gcctgcgtca ccagggtctc    114660
     gcggtcgcgc gcctgccagg ccagccggac ggcctgccgc gcggccaggc cgccggcgtc    114720
     gggctggcca tccggctcgg tcagggcgac gccggcatgc aggcccatgc ccagcgtcac    114780
     gccgtcgggc aggtcggccg cggccagccg gtcggccagg cgcgcggccg gatgggcagg    114840
     acgctcggac agcgccgggt agccgaaata ggccagcacg gtactggtgg cgcgcggcgc    114900
     cagccagccg cccagcgcca gcgcgtggcg ctcgatgagc agcatggcgc gttgctggat    114960
     gtcgatggcg cgctcggcgt cgtcgtggca ggtggccgcg tcgatgtcga cgttgatggc    115020
     cagcaccgcc agcggccggt acaggccagg ccggatgcgg gccggcttgg cggcgatggc    115080
     cggcatggcg tgctggccgg gctccagcag cgcccaggtc tcgttgctgg gcgccgcgcc    115140
     caggcggtcg gccagcacct gggtgcaatg gtcgaaggcg cgcatggcgg cctcgcggtc    115200
     gtccagggcc accagcaggc gtatcaggtg gcggtggcag gcttcgtcct cgggccagcg    115260
     gctgacccag cgcttggcga gcaccagcgc ttcctgttcg cggccctggc cgatatggaa    115320
     gtcggtcagc tggctgcgcg ccagcgccag ttcgatttcg atgcgcgcct ggctgccatc    115380
     gcgccagccg cgcatggact cgccatcggg caggccgatg ccggccagca gggcgccctg    115440
     gtaggcggcc agcttgtcgg cggcgctgta gtccagccgc ggatgcaggc ccagcacggc    115500
     cagcgcgtcg atatccagca gcgccgcgtc cagcgagaga ctgtccttct cgatgcgcag    115560
     catttcgggc gcctgggcga acaccttgcg caaggcatgc aaggcatggc gcaggcgcgc    115620
     ccgggcatcg ttgtcgggca gctcgggcca tagccaggcc gccagctcgc ggcggctgat    115680
     gcgctcgccc ggcgccagcg ccagcacggc cagcaacaac ttggcttttt cgtatggaaa    115740
     ggcgccggtg cgatccaccc cccgcaccac gagttcgaag ccccccagca gccgcaggcg    115800
     cgaaaagggc agcgccccgg tgtctgcgta cggctgcgcc gccggtgttt cccccactac    115860
     ttggacattc acgactgttt tcttgtttgc gtttaattta cgtttgttta cggttcaact    115920
     atagcaagaa tgtgttgaat taattcaaca cgctttaaac cgttgggttc ctagaatgcc    115980
     tacgcttcgg tgtcataccg gtgtccaagg tttccatgaa cgcgttttcc ctgccccgtc    116040
     cgcttcactt cgtgcccctg cctggcgttc ccgcgccgtg gctggccggc gcccgcgcgc    116100
     cgctgccggc ggcgcgcggc cggaccgatg gcgccggcgc ggcggccaac gatgccctgg    116160
     ccggcgcggc gttcgacagc gccgcctacg cgaggccgga cgatgccctg gccgaactgg    116220
     gcgcgtgcgg cctgctgtcc ttgcgcgcgc accgcgccgg cggcgcgcgg cgcgcgcgca    116280
     tccacggaca gaccgggcct ggcgccgcgg cgctggactg ccaggcgggc ggcttcagcg    116340
     tggcgcgcga ggccgccgcc atcgcccgcg atgcccgccg gggcgcgctg gccgtggtgc    116400
     tgcgcgcggg cgacgtgcgc ctggcgcagg acggcggcga acgggccgcg gccgcggcgg    116460
     gcgattgcct cctgctggat ctggcgcgtc cctggcgcct ggacctgtcc gacgatttcg    116520
     ccggctacct ggcctggacc gagggcgcgg ggcagcccgc ctcggcgggc acggtggccc    116580
     ctggcgccag cgtgacggcg caccggctgg ccggcatgct gccggcgctg gtggccggcc    116640
     ccttgtccgc gacgcagctg cgcggcctgc acgatacggt cgccgccgcc ctggcccgcg    116700
     ccgatggcgc cgccctggga gacggccatt gccacccgct ggcgcagatc cgcgcctata    116760
     tcgacgcatg cctgcacgac cagggcttcg gctacgaggc ggtgtgccag cgtttcgccc    116820
     tgtcgcgctc gaccctgttc cgcctgttca aggcgcacgg cgggttcgcc cgctacctga    116880
     agatgcgccg catgcaacag tgtttcgatc tgctgacctc ggaacggatg cggcatgaca    116940
     acgtgaaggc ggtctacctg tcgtgcggct tcgacaacgc ccagcagttc agccgcgtct    117000
     tcagcggcgt gtacggcgtg gcgcccagcg tgctgcgcca attgacgcgc cagcgcttcc    117060
     acgccggcta gggcatcaac agataacccg tcatggtggc tgcctggccg ttgtccaggt    117120
     tggcttcggt cttgctccag ggcgcgccgt cctgggtcag gtcgccggcg cggctgtcct    117180
     cgcgcagccg cccgaagcgc gcgtcgatct ggttgtcgac ctggcgatcc agcatggcgg    117240
     ccagttccgg cgtcaggcgg cgcagctcca tgacattgcg cgtcacggcc tggtaggtgg    117300
     tgggcgtggt ggcggcttcg gaccagttgg ccgcgcgcag gcacacctgc agctcctgcg    117360
     gcaggccctg gctgtcctgg tacacatagc ggtcttccag gccggggccg cgcccttgcg    117420
     gcgggcgtat gcccgcgcgc agcatcaagg tgctgagctc gggattggtg tcggtattgc    117480
     acagaggccg gtccagcgcg gcgttgacgc ggccggtggg attggccgga tcgtcgccgg    117540
     gcggcaggcc ggtggcggcc acgtactggc tgtaggccat ggcccaaggc tgcacgaaat    117600
     cgctgatcat gcgctggttg acggcgttgc ggtagacatc gcgccccacc gtcaccgcgc    117660
     cgatgatgag cgcgatgatg accaggacca cggagatttc caccagggtg aagccttgct    117720
     gggcgcgtgc gcgccgggcg gtattgcggt tttgcatgga tgggccaggg cggacgcgcc    117780
     gcctcaatat aggaagacgc cggagcgcgc ggccgccagg ctgtgcgcct gcacgttctc    117840
     gttgagggtg atcagctcgt cggccaggtt ctcggtggcg tccttgatgc gggccagctg    117900
     atcgaccagg tcggcggctt cgatggccac cgcggcggac ttggcggcat tggcgatggc    117960
     gtgcgcctcg gcggcgatgt aaagcgggat caggtatgac tgcacgccga acgaccagag    118020
     ggtctgcgag gtggaattga gcacgccggc cgtgccggtc agcacgccca cgccggcctc    118080
     gaccgccttg gcgtcggaca gcttcttgga cgccaccgcc agctggtgca gcacatcgag    118140
     ctggtagtag tagtcgcggg tggactgggt cagcatgtgc gcggccagcg aggcgttggc    118200
     gtgggcgcgg gcgctggccg acatggcgtc gccgcagcgc aggcggtccc acagttcgcg    118260
     cgggctggcg ctcaggccgg ccggctggtc gctgaccgcc gaggcgccgc gcgccggcgc    118320
     gaaggccggc ccgcgcgaga tgcggccgtc gccggcggcg ccggcgccgt gtcccgcgcc    118380
     cggcgcgacg ggcagcgcca gggcataggc ctgcaggcgc tgtccgcccg cgccggcggc    118440
     gccgccatcg atgtgcaggc ggtcggcgtg gtcggccgat ttcatggcgg cgttcaggcg    118500
     caggcacagg tcctggccgc gcggtccggg gctgttgacc ggatcgccgt cgaaactgtc    118560
     gagcatgcgc agcggctgct ggtgcgcggc catgccggtg cgcagggtgg tcaggatggg    118620
     agtgtcggcg ctcaggtcga tggccgcggc gccgcgcagg acgccgtagc ggatctggcc    118680
     ggcgcgcggc tcgggcagcc ccagcgtggc gtagggcagg tagccgctgg cctcgcccgc    118740
     gccgcagttt tccatgccgg cggtgctgct ggccgggcag ggcaggcggg cgtgcgccag    118800
     cgcgtagccg atcagcgcgc ggtcggcccg cgccagcagg tcgtcgacct ggccggcctg    118860
     ggtgttgcgg ccgctgaagt cgatgaagcg ccacagcgcc acggtgatga tgcccaggat    118920
     gaccagcgag atggcggcct cgaccagcga gaagccgcgc tggcggcgcg cccggcgcga    118980
     aacgtgcatg ctcatggttg caggcccctg cccagcacca gctgggcgtt gtcgatttcg    119040
     ttgcgcgcgt agtcttcgac ccgcgcctgg tagacatggg tcgcggcgcg gaacaccatg    119100
     gcccggtcca gcgccttgtc cttctcgtcg cgcgtatccg aggccgactt gagcgagtag    119160
     ccggcggcgg ccagcaccgc ggtggacttg cccatgctga tgacggccga ggcggtgccg    119220
     atggtcatgc cggcgatcat ggcggccgca tgcgccatct ggtaggtggc gagcatgacg    119280
     gtgagctggg ccatgctgac ctggtaatcg gcgtagtcgc gctcggccac tcggatgtcg    119340
     tagtggcgtt cgctgtaggt ggcgtagagc gcggcgatgg cgcgcaggtc ctgcgcggcg    119400
     aaggcgctgt gcgcggcgcc ggcggcgcgc gccagatagg cggggcagtg cagctgggcg    119460
     gccagttcgc ccactccggt ttcctgccgc agcggcgcgg cgccctggcc gtcgccttgc    119520
     gccgacacgg cgaacgcgtg cggcggcgtc gcggccgcgc cgtcggcgcg ctgcagccgc    119580
     accaggtcgg cgcagaaatc caggtcgttg cgctgcgtgc gggccagctc ggtggcgggc    119640
     agcgccgggt tggcgggcgt gaagctgacc gcggccgggc tggccagcgc gccgcgcacc    119700
     tggtagccca gccgcggatc ggccgccagg cccagcgttt tccagggcag cagcgcctgc    119760
     gcgccgccgg ccgccgcggc gttctccagc ccgtcgttcg agccgggcgg cgccggccag    119820
     ggcaggcggc cgtggctttg cacgaaaccg gtcagcgcct ggcgcgcctg ctccagcgcc    119880
     gcctgctgcg cgggcgcgcc gccggcctgg cgcagcaccg gcagcagatt ccacagcatg    119940
     accccgaaca ggccggccac ggccagcagg gtggcggctt ccagcaggct ccagccgcct    120000
     tggcggcgca tggcgaggcg gtcagtcatt gcgcagctcc accggcgcgg tgctgccgta    120060
     gtgcatcgag gcgttcatca gtttctgcgc ctgctgccag gggttgtaga gattgccgtc    120120
     gtagtcgtcg gcgtgctggc cgtcgcgggc cgcttcgcac acggcgcgcg cattggcctt    120180
     gtccttctcg agatcgcgta tctgctggtc cttgtcggcg atgtcggcct ccagcgccgg    120240
     ttcggcgtcg gcgatgtgct tgtagtcgcg gctggcgttg taatacctgg cgatcagcag    120300
     gccgcacatg ttcaggaacg ccgaggtctt ctggccggtg cagtaggcga agtagacgat    120360
     aggcggcggc gacggatccg cgtcggtggg cggctgcggc ttggagatct ccaccgagtc    120420
     cgcgcgcgat tgcagcgccg agaaggcctg ccgcgcgctt ttgcgctgcg tgtcgcgctg    120480
     cttgagcagt tcctgcttgt cgcgcttttc ctgctccagg tcgcgctgct tctgttcttc    120540
     cttggccagc tgctcgacca gccgcgcgcg cacgtcccgc cagtattcct tgctcatttc    120600
     gaattgctcg gccgaggcgc catccggctt gatcaccgcc ttgtcctggt cgatgtcgtc    120660
     gatctgcttg cgcatggagt ccatgccctt cttgctgtcc ttgatgcgct ggtcgatgct    120720
     gtcgatctcg ctcttgacgg cgtcgtaggc ctgctcggcg acgatgcgcg cggcggtgat    120780
     gcgggcgatt tcctggcggt gggtttcgct gctgccctgg cgcggctcgt tgcggaactc    120840
     cttctcggcg tcctcgatga tcttgcgcag ccgcgccatt tcctcgcggt tcttggccag    120900
     ttcggcgcgg ttctcgtcgg cctcccggcg gatctcgtcc tgctgctcgg cgatggcgtc    120960
     gaccatggag cagatggccg gatcctcgga gtcgggcgcg ccgtacttgc cgtccagctt    121020
     ggaggtggct tccttgacct gggcgtcggc cagcgcgatg ggcgcataca tcgaggcgtg    121080
     catggccagc gcggcgctgg cctgcaccag cgcgaccttg gcggtggtga gcgcggcggt    121140
     gtggatgggg atctgccagc agaagccggg cgccaggatg atgctggcgc agccggccac    121200
     cgcgttgccc aggaacaccg agctgaccgt gatgttgctg acggcggtct tgatggccgc    121260
     cgcgtcgccc agcaggccgg ccgtgttcag ggcataggcc agcagcacgc tggtgcgcgc    121320
     gctgctggcc gaggccacgt tctcgacccg ctgcgccacc acctgctcca tcgcggcgcg    121380
     gctggcggcc atggcgtcca gcgaggccat gaccggagcg cattgcagcg tgcgcgccag    121440
     ctgggcggcg ccggccacgc gcacgcggtc gccgtattgc gcgtcgtgcg cgcgcgccgg    121500
     ccattccagc gtgttggcgg cggtggcgtt ggcgccgccg aacaggccgg cgccgctgcc    121560
     cttgccggcg atcgccagcc cgtaggccac gttgaccacg cgtccgccgg ggtcgcgcac    121620
     gtgcgcggcg gcggtcgtgc cggcgcgcgc gtcgggggca ttgaattgcc aggtgtcgga    121680
     tgtggcggcc ggcagctgca gcggcgagat ggcatgcagg gcctggcaca ggtcggcggt    121740
     gctgctctgg tcgccgtcgc gcacgtagta gtcgccggcc gcgggggccg agggcttgta    121800
     ctcggggcgc ttggcgcggt agcggctgtc ggcgccgggc gcgccctggc gcgccaggtc    121860
     caggccgctg gccgcgtcgc ggtagaccag gtagcggatg gccggcgcgg tcccttcggg    121920
     gcggctggcc tgcagatcgg ggcgcagcgc cagggcgccg tgctgctcca gggtgcgcat    121980
     cggcagccag cccttgccgt tggggttggc gccgcaatcc tcgaggccgt cggcggtgct    122040
     ggccgggcag ggcaggcggc cgaaggccga cgcgtagccg tcgagcagct ggccggccca    122100
     ggccagggcg gcgtcctgct ggcgcgcctg gcgcgactcg gcgccggcct ggatgagcag    122160
     gtagccggcc gtcatggcca ggccgatcac ggtgatgagg acggcggtcc agaccaggct    122220
     gatgccgcgc tgggcggccg gccggccggg cggcggggaa aggcgtgggg cggacatggg    122280
     cgggctcaca tcggacgggc ggccatcgat tggcgcacca ggtcgtagac cggcagcagc    122340
     agggccacga tcaacagggt gaacatggcg ccggcgatca ggatcaccag cggcttgatc    122400
     acttcggaca gcatggcgat gacgcgcgcc agccgggtgc cgtattcctt ggccaggtag    122460
     ctgagctggc ggtccagcgt gccggtctcc tcgccgacgg cgatcatgcg catcatgatg    122520
     ggcggaaagc cgccgacgtg gcgcatggcg gtggagatgc cttcgccgcg ttccatgatc    122580
     tggcggatcg ccacgatgcg gtcgcggtag tagtcgtcgc cgatggcgcg gcccaggatg    122640
     gacaggctct tgaccacgtc cagtccggcg tggatgagga tggccatgta ctcggcgaag    122700
     aaggccaggc ccgacgaggt gacgatcacc cggctcaccg gcagccggtg cagcaggtag    122760
     aagccggcgc ggcgcatcgg cctgaagtag cgccacgcca gccacagcga aacgaacagc    122820
     accgccatgc ccagggtgac cttgccgaaa tggcgcgtca gccaggccgc gccgtcgagc    122880
     acggcgatgg tcagcgccgg cagcttggcg ttcatctgct ggaacaggcc gacgaggttg    122940
     gggatgacat agtggatcca gaacccggcg gcgccgaaga tggccaggaa cacgaaggcc    123000
     gggtagatca gcgcctggcg cgtatcggcc ttcatggcgg cgatgcgttc caggtgctcg    123060
     gccgattcca gcagcatgcg gtccatcgag ccggtctcgt cgccgatcag gatgaggttg    123120
     cgcaccgtct cgggaaagat gtcgggctgg cggcccaccg cttcgctgat cggcgcgccg    123180
     gcgtccaggt cttccagcag gcgccggccc acgcgcgcga cgttgctgcg cttgctggcg    123240
     ttttcctccg agaccgtgcg cactgcttcc agcagcggga tgccgctgcc ggtcatcacg    123300
     gccaggtcgc gcagcatgcc cgacagttcc ttggggcgga tgccggggcg aaacacatcc    123360
     gaaatgctgc ggtgcgcctc ggcggcccag cgcggcatgc gccgcagccg caccacggtg    123420
     gcgccgtatt gccgctccag ccacagccgc gccgaggcgt cgcgctcgac gctcagcttg    123480
     accaggccgc tgcgcagctt gccgttgggc agcagcaggc ggtagtagta caggttcatg    123540
     acgccggccc gtccccgacc acgcgcagca cttcctcggc ggtggtctgg ccgcgccgca    123600
     cgcgctcgcg cgccagctcg gccatgccgc gaaagccgcg cgcatgcgcc agcgagcgga    123660
     tggcttcgcg gccggcggtg tcggcgatgg cgttggccag cgtttcgtcg atttccagga    123720
     tttcgtaggc cggcaggcgg cccaggtagc cggtctggcg gcagcggccg cagcccgcgc    123780
     cgcgccggcc ggtggcgtgc tcgtccacgc cgagccaggc gcgctcggcc gccgtgaagg    123840
     ccacttcggc ggcgcagaac gggcagttct gccgcaccag ccgctggttg accaccacca    123900
     gcaggttctc ggcgatcgac tgcgagtcca gccccagcgg ctgcaggcgc ggcaccacgc    123960
     cgaacacgct ggtgacgtgc agcgtggaca gcaccaggtg gccggtggcc gcggcctcga    124020
     ccgcggcctg cgcggtctcg gcgtcgcgca tttcgcccag caggatcacg tccggatcgt    124080
     gccgcaggaa gtggcgcagc gccgtggtga agtcgtagcc ggcgcgccgg ttgacctcgg    124140
     tctgcccggc gccgggcacg cggtactcga gcgggtcttc caccgtgagc acgttgcgct    124200
     cgatcagcga ctgcatgcgc agcgcggcgt gcagcgagct gctcttgccc gagccggtgg    124260
     gcccggtgat cagcaccagg ccgttgggct tggcgaacag ccgttcgagc cgctccacgt    124320
     cttcggcgaa aaagcccagg tcggccaggc cggacaggtt gttgtgctcg ggcagcaggc    124380
     gcatgaccat gcgctcgcca tgctcggtga cgatggtcga cacgcggatg gtcagcgcgg    124440
     cgtcgaggat gtgggcgcgg aagctgccgt cctgcggacg gcgctggtcc gagatgtcca    124500
     tctccgccgt cagcttgatg tagcccagca ggcgctgcag gctgggcggc agcgccatca    124560
     tcgggcgcag cacgccatcg acgcggaaca gcacgtgcag gctgctggcc tcggcggtga    124620
     tgtggatgtc ggtggtgcgc tcgcgcaccg ccaggtgcag caggtagtcc agcaccttgt    124680
     cggggctgaa gacgtggtcg ggatcgtccg agaggcggcg cacttcgcgc gccagcaggc    124740
     tttccagcgg gttctgcgcg aagtaatagc tgtggcggat caggcgggtg accagcgaga    124800
     actcggcctg catgaagcgg cagcgcaggc tggtgcgctg caggaccagc gccgccacgc    124860
     gcgccggcac cgcttcgccc agcagcactt gcagctcgcc gtcctggcgg cgcaggggca    124920
     ggaaattgtg ggtcaggcac agttcgcggt tgaacatggc cagcacctgc gggtcggcct    124980
     cgggcagcac gtcgccggcg acgaactcga tgccttgcag ttcggccagc gtggccacca    125040
     ccacgcgttc ctcggccagg ccgttctgga tcagcaggcg gctcagcggc agcggttcga    125100
     ccgtgtgttt ctgttcggcg tatagcagtt gcaccggcgt gagcagcccg cgttcgacca    125160
     tcaggccgcc cagcgtcgtg ctggcgggct ggccggtttc ggcggcgggc gccgggctca    125220
     gggtagtttc agtcatgcgt aacgggttcc tcgatgaggg cgggcgcctc ggcgggcagc    125280
     gccagcgcgg ccagcaacag ggtggccggg tcggggctgc cggtggcggg caaggcgtgg    125340
     tcgcgctgga agctggccag cgcctggcgc gtctgcgcgc cgtagatgcc gtcggcgcgc    125400
     gtggccagca ggccggccgc gcccaggcgt tgctgcaggg cctgcaccga ggggtgcggg    125460
     ccgccgctgg cgaagtcttc cgggcgccag ggggcgcgcc aggccaggtc ggtgcggccg    125520
     tcgcgctcgc gcgcgcacag gccggggcgg ccttgcgcca gcgccgccac gccggccggc    125580
     gcatcggaca cccacagcag gccggcggca tcggcgcctg cggcggccag cgcggccagg    125640
     caggcgtcga aggcgtgcgc cggggccggc gcggcctggg cggcagccgc cgcgggggcg    125700
     gtgggcgcgg cgcgccatgg cccggccgcg tagagcgcgc cggtgcccag cacgccggcg    125760
     gccagcacgg ccgccgccat gggcaggcgc gcgcggcgcg tggcgcgcgg cgccgtggcg    125820
     tgcgccatgc cggcctcggc ggcggcgcgg cgcaccagcg cggcgtcgat gcgtccgtgg    125880
     ccctgttgca gcacgccgta cagcgcgcgg tcgaggatct ggtggatgcg gcgcgcattg    125940
     ccgcggctgc gccggtacag cgccgcgacc gcgcgcggcg acaggtcgat gcgtccggcc    126000
     gcgccgctga ccgccaggcg gaacgcggca tagcggccgg tctcggcgcg gtccagcgtg    126060
     tgcaggcgga tgtgctcgcc gatgcggctg gtcagctggc ggatctcggg acgggccagc    126120
     cgctcggcca gctcgggctg gccgcacagt acgatctgca gcagtttctc ctggccgctt    126180
     tccaggttcg acagcagccg cagcagctcc aggctttcca ggctcaggtt ctgcgcgtcg    126240
     tcgatgcaca ggacgcacag cgcgccggcg cgccattgct ccagcaggaa ggcgttcagg    126300
     cgttcgacgt gatcggccgc cgagccgtgc gcgggcaggc cgaagtcctt gaggatggcc    126360
     gccagcagcg cctcgccctg caggaaggta ttgaagacca ggctggtcct gagcgcctgg    126420
     cgttcggcca gcgcggccag cagctggcgc aggaaggtgc tcttgccggt gccgatctcg    126480
     ccggtcagca ggatgaagcc cttgccgctg gccaggcagt gcgcggcctc ggcctggcgc    126540
     gcctgcagcc attcggtatg gaagtagtgt tcggcgtcgg gcgtgggcgg aaagggcggc    126600
     gtgtgcatgc ccaggcgccg gtgcgccgga tcggcgaggg cgtcagcgtt gctcatggcc    126660
     gatctgctcc tgcagggcgc gcacgccgcg cgaatcggga tgctgctggc gcagccgctc    126720
     gagcagcgcg cgcgcgtcgg ccacccggcc ctggcgcgct tcgatgatgg ccaggttcag    126780
     gccggcgttc tcgtcgttgg gcaggcgtgc cagcagggcg cgatagctct cggcggcggc    126840
     gcggtcgttg ccgccgtaca tgtgcagcca ggcctggcgc cgcagcaggg tcaggctttc    126900
     gccgggcaag gcggcgcgca ggctgtcgag ctggcgccgc gccgtgccca ggtcgccggc    126960
     cgcggcggcg cggtcgaaag cctcggccat ggccgccacc gcattggcgt tggccgcgcc    127020
     ggcgcgcgct ggcttgtcct gcacgatgaa ggcgccggcc ggcacgctgg gcggctccat    127080
     gcgcgcggcc ggcgcttcgt acgaggccgc cgccagcgcc gcgcccggca tgcccgcggc    127140
     gggcaaggga aagccgaccg ccggcgccgc gggcggcgcc atggcggcca gctcggcctg    127200
     cattctttcc aggcgttcct ggttggccat catctggcgc agcagcgcat tgagctgctg    127260
     cgcatcggag gcggggccgc gcgcggcctg cgcgggcagg ccgtccggcg ccgccggcgg    127320
     cggcagcggg cgcgccgggc cggcgccgtc ggccaggccg tcggcggcca ggatccagcc    127380
     ggccatgccc aggctggcgc cgaacacgac cgccacggcc aggctcctgg cgaactggcc    127440
     gccgcgcgcg ggccgcgccg gcgcgccggc aaagccgcgg cccaccggag cgcccggacc    127500
     cgtggcggac gggccattgc gcaatgcgtc gtagatcagg ctcatatcac gcgtaccctc    127560
     aggatgatga ccagctcgcg gctcttgtgg ctgtcgctgc ggttgtcgaa cagcacgccc    127620
     gcgccgggga tgtccgacag cccgggcagc cccttgttgg cgttggtgaa ttgctggtcg    127680
     atcagcccgc ccagcacgac ggtgtcgccg ttgttcaggt tgagcgtggt ggtgatgctc    127740
     ttggtgttga tgatgggcag cgtcacgctg ttgccgttgc ccacgtccac caacgccagg    127800
     ctctgcggct gtacctgggt ctgcatggga tgcacgaaca gctcgacccg gccgtcctcg    127860
     tggatgaagg gcgccacgcc caccaccacg ccggagaaca gcgaatcggt ctgcacgtcg    127920
     gaggacgagt tcgacgagcc gccgccgatg ttgttgaagg tggtgctgat ttcggtgacg    127980
     tagcgcacgt tggcgcccac gctgagatag gcgggcacgc cgttgcgcac gcgcacggtc    128040
     gggttggaca gcaccttgac cgatccgaac gagcgcaggg cgttcaaggc caccgagaag    128100
     ctgtcgttgg cgaagccgat gccgccgccc acgccggcgg cgctgccgat gacctgggcc    128160
     gggatgttga tcgagcgcgg cagcagtccg ctgcccggct gcgtgccggc cggcgtgttg    128220
     gccgtgatgg cgcccgagcc gtagcggccc gacaggtggt tggtcagcag gttccagtcc    128280
     acgccgaact cgaagccgtc gttcagctcg atgtcgatca gctgcgcctc gacctggatc    128340
     tggcgccgta tggtggcctg gttgcggcgg atcagctcct cgaccgcgcg caccttggcc    128400
     gggcgcgcgc gcacgtacag cgagccggtg gtgcggtcca ggctgtagcg gcttttctcg    128460
     gccggcgcgc cgcccggcac gcccgacgag gtgtcttcca gcaccttgcc gatggcttcg    128520
     gccagctgct tgtaggcgtc ggcatcgtcg ccgaccttgc cgctgagctt gaggtcgccg    128580
     cgcagcgtgc tgctgccgcc gctgctgccg ctgccgccga acacgtcgcc gccggtctgg    128640
     atgtccagcg cggtgttgcc gcccagcatc tcgatggtga acacgcgctc ctgcatcagc    128700
     gacacggtca gcacgttgcc gtgcaccgcg ccgtgcaggt cgaatacctg caggatgcgg    128760
     tcgaacacct cgcgggccga tacgcgctgc aggtacaggc tggcgcgctg cggcatgtcc    128820
     agcacctgcg gatcgaccac caggttcatg cgcaactggt cggacagcgc ccacagcaac    128880
     tggccgacct tggcgtcatg catgttgacg ctgatgatct tgtcttccag cgggtcgtat    128940
     tgcggtgcga tcgggtctag tttcggcacg gtgggctgga tgcgctgcac gcgctggagc    129000
     atttcgtcgt tatgggccag cagcttggcc gattcctcgg ccacggcgtt cgaggtggtc    129060
     tgcaaggccg cgtgatcggt cttggggaag ttctgcacgc tgcggggcgt gtcggcgcag    129120
     ccggccaggg ccagcacgag cgcgaggggg gcgaggggag cgaaggatcg ggatttcatc    129180
     tgggcaactg tgtcaatgcg cgcgggcggc aagccagccc agcagttccg ctgtgccgac    129240
     tgccgcgacc gcgtcgctgt tctggttggc gcgcccgccg gccggggcga tggcgcacag    129300
     cgccgcgccg cgtgccagcg cggcatgcgc ggcggagaaa accggtagcg cgccgccggc    129360
     ggccggcgtg gcgggcgcaa tcacgacgaa cgccggattg acctgcgtgg cgccggcgca    129420
     cgggtcggcc acgccctggc gggcggtggc caggcgcagc gccgcgccgt cgtagggcat    129480
     ctggccggcg cggcgcagcg tctcgtacaa ggccgcttcg ccgccggggc tgtagtccac    129540
     cggcgcggcg ccggcgctcg gacggaacag atcggggccg ccgggcacgc gcaacgccgc    129600
     gtaggccagc cggcggccgt tggtgcccgg cgcggcggcg ccggccaggc ccagggtttc    129660
     gtagggcagc cagcccgagg cctggctgca ctggccgtcg gcatggctgg cccagccgtt    129720
     gccggtggtg tccgggcagg gcaggcgctg catgcgcagc gcgtaggcca gcaccgcctg    129780
     gcgcgcccgc tcggcctcgg cctgggcctg gccctggctg ccatggctgt acagcgcctg    129840
     ctgggcgcca tacaggcccg cgcccagcag cccgacgacc gccagcgcga tggcgacctc    129900
     cagcagggtg tagccctgct ggcggccggc cgccgagggg cgggcgcggc gcgtcatggg    129960
     cgcgccgccg gggtgtcgat gacgtaatcg gtacgcagct gcttttgcag cgccgcgact    130020
     tcatcgccga tcctgcgcat cgcttcggcg cggcccggtt cgctggccgg ctgctgctgc    130080
     agcgcctgca attgctggcc cagcaccgac aggcgctcgg ccacgcgcag gttggcgcgc    130140
     agcacgtcca ggcgcacgcc gcccacttcg ggcgaaccgt gggcctgctc cagatcgcgc    130200
     agcgcgcggt ccagctcggc caggtccggg gcgggcgagg cgctcaggcg ttgcagcctg    130260
     gcgtgcgcct cggccatggc ctgttcgcgc gccgaggggg ctggcgcggc cgcgggcgcg    130320
     gggcgagcgg ccggcgccgg ccgggcgcgg ttgccggccg cccagggcgg cggcgcgctg    130380
     gcggccgccg gctcgggcag cacgggcggc gccggcggtt gcggccgttc ggcgctcaaa    130440
     ggcggttcga gcggcgcggc gtgctcgggg ggcggcgcga actggcgata ggccagcagg    130500
     ccggccgcgg cgatggccag gacggccagg gtggcgtaga cgcggattct catgtcgtca    130560
     tccgggcgcg ggggcgggtc atgggttgtc cttgaaggcg tggcgcaggg ggtaggtgcg    130620
     ctgcaggccg atggcgtctt ccagcgtcac ggcggccatg tcgatgcgcg cgacgcgcgt    130680
     gccgtcggcc agccgctgtc cttcgcgcac gtactcgcca tcgacgatgg ccagccgcgc    130740
     gccgcgtccg ccggccatga tcatggtgac cacgcgggcc gattcgccgc tgccggcgcg    130800
     ccccggcgcg gcgcccgcgc gcggcaggcc gggctgggcg tcggtggcca gcgccacgtt    130860
     gcgcgccggc gccgcgccgg ccgcgtcggc ctgcgccatc gattgcaggg tggcggccag    130920
     cttgtcggcc gcctcgatat cgcgcagcag cgcgggcggc accgccgcgg ccggcgcgcg    130980
     catggcgtac aggcgcaccg atggctgcgt ggcgtagttg taggcggccc agccgcccag    131040
     cagcagccag gccgccagcg cgctcagcgc atagtggcgc ggcttcatgg ttgcttcctc    131100
     gcaagcgcca ccggcggcgc ctgcctcagg tgataggaga agaatccggc cggcggctgc    131160
     gacgaggcgc tggcggcgtt ggggtcgacc gaggtggcca cgtagccgtt ctcgcgcagc    131220
     acgccgacaa agcgcgccag cagcgcgccc ggcgtgctgc cctggctgcc gtcgagcacg    131280
     ccgtcgaccg ccagcagccg ttcgcccgcc gcgcccgcct gctgcgggcg cgtggtcgtg    131340
     acatgcacgc gcaggatgcg gatgccgccg gcgctggccg agcgcagcgc gttgagcacc    131400
     tcgaccggat cggtctgttc gcgcagggcg tcggcgcgtt cgagaaaggc gcgctgcgcc    131460
     gggtaggcct cgggcatggc gcgggtggcg gccagccggc cgatctcggc gcgcaggggt    131520
     tcgctgtcgc gggtttcctg caaggcctgc tgctgcgcct tgccggcttt cagggcccag    131580
     ctgccggcct gcaccgacag caccgcggcc agcgtcaacg aggccacgct ggcccagggc    131640
     agggcgcgct cggccaggta catcagcttg gacgcgttgt cgttgacggc cacccgcacc    131700
     ggggcggcgg ccaccagcgc cggcaaggcg ctgtagacgg cgcgcccggc ctcgtcgcgc    131760
     aaggcctcgg ccggcgccag ccgcgtcgcc aggccgcttt gctcggcgaa gcggcgcgcc    131820
     aggcgctcgt ccatctccag gctgtcggcg gccaggctga cggtccagga gatgagcagg    131880
     cgctcgacgt cctccgggtt gtcgcccact tcgtcgcgga tgctggcggc caggttcagc    131940
     accgccgtgt ccaggtcttc ctcctggtcg ctgaatgtga tggcgctggc gtacagcatg    132000
     cggtgcttgg cctgcgccat gaagatcagc tggcggccca gccgcagcat cacgccgcgt    132060
     ccgctgccca ccgccgacca cagcagcgcc gccagcggca ccagcgggca atggtcggcc    132120
     tggttgccgc tccaggtggt caggttctgc cagtcggcca gcgtcaccgc ggtgtacagc    132180
     gcctggtagc ccttgccgaa atgcttgacg tggtgcacca ggatgcgcga ttcctggtcg    132240
     atcatgccgt cggcgcgcag cttcttctcg atgacggcgg cggcatgctg cgggctgcct    132300
     tcgagcagcg tcatgcccag ggtggcctgg ccgaaatcgg acaccgccac caccggccgg    132360
     gccagggtcg ggtagccggc ctgcgcggtc agctggccgt cggccagcag gcgccaggcg    132420
     ccctcgtggt gcagcagaat ggattggata tgcatggcgc tacctgtcca ggcggaacag    132480
     cagggtgccg cgcagggtca gcacgacgtc cgggttgttg cccgaggtgg catggaacag    132540
     gccatcctcg gggcgcgtga ccgacaggtc gaactgctcg gcgccgaaca gccggccggt    132600
     gccggtggag gcttccctga gcaggtcgtt gaccgcatgg cgcgtcatgg ccgattgctg    132660
     gatgctgatg cggcgctcgc tccagccgcc ggcggcaaag ccggtggcct cggcgctggc    132720
     caggatgcgg cgcgccgcgt cggcgcgctc ggcttccttg cgcgccacgg tcagttcctg    132780
     cgtggtctgc acgcgctggc gctcgctcag cgacagggcg gcgtaggcgt ggtccaggtc    132840
     ctggcgcgcg ccatggaagc cgtaggcggc cacggccagc accagcagcg acagcgcgaa    132900
     caactgcagc gagcgcttgc gcgacagctg ccagcgtcgc ccggagagtc ggggaaatcg    132960
     cggcatggcg gcctactggt tcatcttgta gtgggcgatc agcgtcagga cctggccttc    133020
     ggcgttgccg gtctcgacct tctcggcgtc gcccgtgctg ccgtacgtct gcgtgttgtt    133080
     gcccttccat tcgacgccgg gctgcgagcc cgcgcccgag gccaccgagt tctggcggaa    133140
     gctgccgccg ctggcgtcgc cgttgccgtc gatggccgac gacagcgagc gcgccaggtc    133200
     cggcgtcagg ccggtgagaa tcatcacgtt gcccgagccc gaatgcgtgc cgggcgggtt    133260
     ccactggaag cagacctgga tttcctgcgg gttgccgttg gtgtccaggt agacgtagcg    133320
     gtcttcgtag ccctggccgc gtccctgcgg cagggtgatg ccggcgcgca gcatgacttc    133380
     gcgcagctgc acgtcgccat cgaccggacg gtcgatgccg ggcgccgtgc cgccattgca    133440
     gatggccgag ggcaggttgg agatgcggct catgtcgccg cccgacagcg atccgttgga    133500
     accggtgaac ttggcgccgt tgaccatcag gcgcggcgcg cgctggtcgt cgccgggcgg    133560
     cacgccggtg cgctgcacgt agttgttgta ggccagcgcc cactggttga cgaagttctg    133620
     gcggatgcgc gtgtactcgg cgttgcgttg cgcgtcgcgg cctatcatga cggcgcccag    133680
     gatgatgccg atgatgacca ggaccacggc catttccacc agcgtgaagc cggcctggag    133740
     ctggcgggag cgttgcggtg cgttcatagg aagagctctg cgtaaaaggg aaatgggggg    133800
     ctcacaggcc cagcgaacgc cggtccctgg cgtaggccag ggcctgctcg gcggaaatca    133860
     gtttcttgcg cagcaggtcc tgcagcgcct ggtccagcgt ctgcatgccg tgggcctgcc    133920
     cggtctggat gctggagacc atctgcgcga tcttgtcttc gcggatcagg ttgcggatgg    133980
     ccggcgtgcc gaccatgatt tcccaggcgg cgcagcgtcc gccgccttcc tgcttgagca    134040
     ggacttgcgc gatgaccgcg cgcagcgatt ccgacagcat cgagcggatc atgcttttct    134100
     cgccggccgg aaacacgtcg atgatgcggt ccaccgtctt ggcggccgag ttggtgtgca    134160
     aggtggcgaa caccaggtgg ccggtctcgg cggcggtcat ggccaggcgc atggtttcca    134220
     ggtcgcgcag ctcgcccacc aggatgatgt ccgggtcttc gcgcagcgcc gagcgcagcg    134280
     cggccgagaa gctgtgggtg tcgcgcccga cctcgcgctg gttgaccagg ctgcggcgcg    134340
     atgggtgcac gaactcgatc ggatcctcga tggtgaggat gtgatgctcg ccttcgcggt    134400
     tgaggtggtc gatcatcgcc gccagcgtgg tcgacttgcc cgagccggtc gggccggtca    134460
     ccaggatcag cccctgcggc tggcgcacca gctccttgaa cgaggccggg cagcccagtt    134520
     cgtccagcgt gcggatggcc gacggaatgg tgcgcagcac cgcggccggg ccgcgctgct    134580
     ggttgaaggc attgacgcga aagcgcgcca ggccttcgac gtcgatcgag aaatccagct    134640
     cctggcgcgt ctcgtattct tcgcgctggg ccggctgcat cagctggtgg atcatggcgc    134700
     gcagggcgtc gggcgtgagc gccgcgacgt cctggcgcac cacgtcgccg ttgatgcgca    134760
     gcatgggcgg cagccccgcc gacagatgca ggtcggaggc gccgcgcgcc acggtcaagg    134820
     ccagtagttc atcgatggtc atggtggttc ggctgccgtg ccggcgcgcc gtggcgcgcc    134880
     cggatgtgtc ttgcgacaag gaggtcgacg cagtggaaat ctgtgtcaga atgcggcgct    134940
     cttcatgcgt atcccgccca ctgccaagtc gtactgaatt ctaggaattt cgtaatgtga    135000
     cgacttgtca gcgcgtgcca acttgttggc atggcgtccc aattgttggc atggcgtctc    135060
     aaccaaggag gcgagggtgc aaacctggat ggaaatccgc ctgcccggcc tggacggggc    135120
     gggctggctg gccggcgcgg ccgtgctcgg actggcgctg ggcagttttc tcaatgtggt    135180
     gctggcgcgc ctgccggcca tgctcgaata ccgctggcgc ctggacgtcc agccggacgg    135240
     cgctgccgcg tgcgcgccgc cgcccggcct ggcgcatccg ccgtcgcgct gcccgcattg    135300
     cgcgaccgcg ctgcgctggc gccacaacgt gccggtgctg tcgtggctat ggctgcgcgg    135360
     gcgctgcgca ttctgcgcgg cgcccatcgc cgcgcgctat ccgctcgtcg aggccgccac    135420
     cggcgcgctg tgcgccggca tcgccgttct gtacggcccc acgctgctgg cgctggccct    135480
     gatggggctg gccgccatgc tgctggtgct ggcctgcttc gacctggagc atctgctgct    135540
     gcccgattgc ctgaccctgc ctctgctgtg ggccggcctg ctggccaacg ccgccggcat    135600
     gggcctggcc acgccggccc aggcgatcgc cggcgcggcc gcgggctatg cgctgctggc    135660
     tggcgtggcc tgggcgtttc gccgccgcac cggccgcgac ggcctgggcc tgggcgatgc    135720
     caagctgctg gcggcgctgg gcgcgtggct gggctggcag gcgctgccgg ccttgctgct    135780
     ggcggccggc ctgtggggcg tggcggcggg gctgctggcg cgctggcgcc ggcgcgcggc    135840
     cttgcagccg ctggggccgg ggctggcgtt cggcgccgcc ctgatcgtgg ccggggccgg    135900
     gctgatggcg cgctgagccg cgcgaatttg tgtgcggcgg caacttgtgt aacgtcgtcc    135960
     cggggaggga tgttacgaag ccgccagggt gaagcttggg cgtcatgctg gcttcctagg    136020
     atcgtgccca accgttcgcg gccctgtcgg ccccgggcgt acccatggag acgatcctcg    136080
     caatggccga acgcatcgta cgcgccctga ccccgctgcc cccgcaagcc ctgcagtttc    136140
     gcagcatgca cggccacgaa ggcctgtcgg cgctgtacga attcgaggtg gacctgctgg    136200
     cggccaccca tacgctggaa ctgaaatcgc tgctgggcaa gccggtttcg ctggaaatcg    136260
     aaacaggcgg cgcgccgcgc tacctgtcgg gccaggcgac ccgctgcgcc ctggtggggc    136320
     gcgaaggcga cagcgcgcgc cagtatgtgt accgggtgac catgcggccc tggctgtggt    136380
     acctgacgca gacctcggac agcaagatct tccagcagat gtcggtggtg gacgtgctgc    136440
     gccaggtgct ggccgactac ccgtttccgg tcgagtaccg gctggccggc agctaccgcc    136500
     gctgggaata ctgcgtgcag taccaggaaa ccgatttcgc cttcgtcagc cgcctgatgg    136560
     agcacgaggg catctactac tggttccgcc acgagtcggg caggcacacg ctggtgctga    136620
     ccgacgacat cacccagcac gacgagtgtc cgggcgcggc gcagctgccg tattacggcc    136680
     cggatcgcgc cacggtgcct caggagcaat acgtatcgca gtggcaggtg gccgaggaga    136740
     tcacgcccga tggcttcgcc accgtggact acgacttcaa gaagccggcc gccagcctgg    136800
     acgcgcaatc gagcaacccg ggcgcctacg agccgggcgg gctgcaggtg tacgagtggc    136860
     tgggcggcta taccgagccg gaccagggcg agcgctattc gcgcatccgc ctggaggccc    136920
     tgcaggcgca cggcgaaagc gtgaccggcg cgtgcaacgt gcgcgccttc gcgccgggtt    136980
     acctgttcac gttgcgcaac catccgcgcc cggccgagaa ccgccaatac ctgatcgcgc    137040
     aggcgcatta ccgcatccag gaaggcggct acgccagcgg cgccgaggat gccgtcttcg    137100
     atatcgactt ccgcgtcctg ccggccacgg tgccgtttcg cgtggcgcgc gccacgccgg    137160
     tgccgcgcac gcacgggccg cagaccgcca cggtggtggg ccaggccggc gaagagatct    137220
     ggaccgacga gtacggccgc gtcaaggtgc acttccactg ggaccgctac ggcaagaaga    137280
     acgagaacag ctcgtgctgg gtgcgcgtgt ccagcccctg ggccggcggc ggcttcggcg    137340
     gcatccagct gccgcgcgtg ggcgacgaag tgatcgtgga cttcatcggc ggctatcccg    137400
     accggcccat tgtcatcggc cgcgtctaca acgccagcaa catgccgccc tgggacctgc    137460
     ccggcaacgc cacgcaaagc gggtttctca gccgctccaa gaacggcgac cggggcaccg    137520
     ccaacgcgct gatgttcgag gacagcgcgg gcgccgaacg catctggctg cacgccgagc    137580
     gcgacatgga ctgcgaggtc gaggccaacg agtcgcacac ggtcgacggc aaccgcacca    137640
     ccctgatcgg cggcaacgat acgctgacgg tgcggggcac gcgcaccacc accattgacg    137700
     ggctggacac cgaaaccttc aacgccggcg ccacgcgcac cgtcaccggc gaggtgtcgg    137760
     agaccaccac cggcaacgag acgcgcacct tcaacggcga cgtgaccgaa accgtcaacg    137820
     gcgtggagac gcgcacggtc aacggcgact ggaaggaaac catcaccggc gagatgaccg    137880
     aaacgcgcac gggcgacgaa acccgcacgg tgaccggcgc cgtcacggag accattaccg    137940
     gcgacgtgac gcagaccatc accggcgcgg tcacgcaaac acagaccggc gcgcacgaca    138000
     tcaccatcac cggcgaccag acctccagca tcaccggcgc ggtgtcgcac acggtcaccg    138060
     gcgcgtatac ccagacggtc accgatccgg tcacggtcaa cgccaacacc agcatgaccg    138120
     tggtcacgcc gtcgtggacc gtctcgtcgg cgtcgcagca ggcgttctgg accgccaaca    138180
     ccttgcgcgg cacgccggcg cgcctgacgg tggtcggcgc cgcggccgac ttctggggcg    138240
     tgcgccagca ggtctacggc ggcatcaact cgcagtggtc caccgtgaag atcgacctgg    138300
     ccgcgttcaa gaacggctcc aacggcttcg agagcggtca ggccggcgcg cagatcaagg    138360
     ccatcggcgc gcagatcaag accggcgggg cggcggtgat ctcgcgcgtc atcaatctct    138420
     tcacctagcg ggcggcgcga cggcatgggc agcacggcat ggtggatagc gggtacgttg    138480
     gcgacgctgg cggcggtggg cttggtggcc ttgctggtgc gcggcggcgc gcggccctac    138540
     gagaccgagc gcgcgctggc cgcgcagctg gcgcgaacgg gccggccggc ccaggccgaa    138600
     gtgctggcgc tggaccgcca gcccggcggc gagctgtacg ccgcgccgat gaagctggcg    138660
     ctgcgctacg ccgacgccat gggccgcgcg cggcaggccg aactgcacgt ctacatcgac    138720
     agcgagctgc tggtcaactt catgcccggg caggccatcc atgtgcgctt cgacccgaac    138780
     gacgcggcgc gcatcgcggt ggaccgcgag cgctcgccca ccgaaatctc cgccgcctgg    138840
     cgccgccgcc atccatgaag atcgtcaagc ccttgcgcct aggcctgctc agccggccct    138900
     accgcatgcg cggccgccag cgcctgggcc tggccgtgtt cgccctggcc acgctcgacg    138960
     agcaggcgct gctgcagccc gaggccgacc tgtggagcct ggctggcgag gcgctcggcg    139020
     aggacggcgt gctcgacctg gcagtgccca agccgtgcgc cgaattcctg gtcagcggcg    139080
     ccgcctacac ggcccaccag caggaccgca cggcctgcat ggcgcgcgtg cgcgtgggcg    139140
     aactggagaa aaccctggcg gtgttcggcg accgctattg gctggacggc aagcccaccc    139200
     cgcctgcgcc gttcgaggcc atgccgctgg actgggccca tgccttcggc ggccccgaat    139260
     acgccgacaa cccgcacggc cgcggcgccg gggacgaacg tatcgccggg gtgcgcacgc    139320
     gccgcctgcc caatgtcgag ccggcgcggg gccgcatgca gcggcccgac cagcgtcccg    139380
     agccggccgg cttcgggccg gtttcgcccc tgtggccgcg ccgtttcgcg cgcgccgggc    139440
     agtaccacga aagctggctg gatgaggggt ttcccggctt tctggatacg ctggacccgc    139500
     atttcttcaa tgccgccgcg cccgaccaat ggtggccggg ccagcccgga ctggccgcgg    139560
     gcacgccgta tgccctgtgg aacctgcacc cgcgcctgcc ctgccagcaa ggcgcgttgc    139620
     cgcgctggcg cgcgcgctgc ctgttgcgcc gcgccggcga aaccgcgctg gaggacgtgg    139680
     cgctgcgcct gaccacggcc tggttctttc ccgaccgcga gcggctgctg ctgatctacc    139740
     acggcgcgac cgacatcgcg caggacgacg gggccgacat cgagctggcc atgccggcgc    139800
     tggatgccgc cgatgcgccg cgtccgctgg cgcactacga agccgtgctg gcgcagcggc    139860
     tggatgcgca ggacggggcc ttgcacgcgc tgcgcgacaa agacttgttg ccggcgcagg    139920
     cgctggggcc gtgggacgcc ctgcaggcgg ccaatccgat ggagcagccc ttcgccgtca    139980
     accagcgcgc gcgcggcgcg gcgatccgcg cgcagctggg cgagcaggcg cgggcgcacg    140040
     gcgtcgaccc gcgcgcctac gagccgccgc cggcgcccat gccggccgcg ccgcaactgg    140100
     acgacctgcc ggatatcgcc cggcacatgc gccaggccgc gcaggaggcg cgcatcgacg    140160
     ccttgcatgc gcggcggcgc atggccgagg ccttgcaggc gcgcggcgca gagctgccgc    140220
     cggccatggg cgcggccgcg ctcgccgccg ccgccgatgg cgcggggcgg ggcggtccgc    140280
     cctcgctgca cagtcacccc gcgctggcca cgctgcagga actggcccgc gcccagccgc    140340
     tgggtagcgg cgccgaccgg ctcgacgccg gctcggtcgg cgcgcgcctg cgcgaggcgc    140400
     agcaacaact gggccgcctg tacctgcatg ccgcccatca ccagccgccg gccgaagcgg    140460
     cgcggcccgc ccgcgcggcg cgactgcggc gccgcgtgca ggcgctgatg gcgggcagcc    140520
     gcgacctggc gggcctggac ctgaccggcg ccgacctgtc cgggctggac ctgcgcgggg    140580
     cgcgttgcgt gggcacgtgg atggagggcg ccgacctgtc gggcgcgttg ctggacgacg    140640
     cggacctgtc gcaggccgtg ctggcgcgcg cgcacgccga aggcggctcg tggcggcgcg    140700
     ccgtgctggc cggcgccaac ctgggccagg cggcgctcga cggcgtggac ctggccggcg    140760
     cgcgcctgtc ctcgcccgtg ctcgacggca tcgtcctggt cgattgcgcc ttgtccgcca    140820
     gccgctggaa cgattgccac ctggccggcg cgcggctcga gcgctgccgc ttcgaccagg    140880
     ccgagctgga taccgtgacg ttctggcagg gcacgctgct gcgcgagacc ggcttcgcgg    140940
     ccgcccggct ggcgcgcgtg acctggctgg actgcgaact ggatggcctg gatttcgccg    141000
     gcgcgcgctt gcgccgctgc gcctgggtgc agtcgcaatg cggcgcggcg cccaattggg    141060
     ccggcgccga attgcagaca tgctgcgtgg tcgagaccga tatgccgcat gccgtgttcg    141120
     ccggcgccac gctgcgcgaa tgcagcctgc gcgatacggt gctcgaccac gccgatttca    141180
     ccggggcggc gttgtggcgc tgcgacctgt cgcaagccag cctgggcggc gccagcctgg    141240
     cgcgggcgcg cgcgccggac agcctgttca ttcgcgccga cctgggcggg gccagcctgg    141300
     ccgaggccga cctgcccggc gcgctgctgc agaaggccac gctcacccat gccgacctgc    141360
     gcggcgccaa cctgtttcgc gccgacctgg ggctggccgt gctggacgat accagcgaca    141420
     cgcgcggcgc ctatacccac ctggccaaca cgcggccgcg agcccgtcat ggacgctgag    141480
     acgctgcgcg actgggtccg gcaggggcgg ccgctggtcg gcctggactt gcgcgcggcg    141540
     gcgttgcaag gcgcggacct ggccggcgcc ctgctgcagg actgcgacct gcgcggcgcg    141600
     gcgctggccg gcagccgctg gcgcgacagc cgcttcagcg gctgccgcat ggagcagacc    141660
     gattggcgcg gcgccgatgt ggcgcagtgc gcgttcttcc gctgcgaact ggccgaggcg    141720
     gtgttcgccg cggccgagtg cgccggcgcc tcctgggtgg agtgccgcgc cgccggcgcc    141780
     gatttccgcg ccacgccgct gcatggcagc catttcgtgc aatgcgcgct ggacggcgcg    141840
     cgcctggacc gggccgagat gcgcgagggg ggctttgccg agtgcacgct ggagcaggcc    141900
     agcctggccg gcgcggcatt gcgccagacg ctgttctttc gcgccgacct gcgcaccgcc    141960
     gatctggccg gggcgcggct ggagcgcgtg gtgttcgtgg agtgcgactt gagcggccag    142020
     cgcctggccg ggcagttcct gggcggcagc cagttcgtcg aggcgcgcat ggatggctgc    142080
     gacctgcgcg aggccagcat ggcgcaatgc aatttcaagg gcgcgtcgct gcgccgggcc    142140
     tgcctggccg gcgccagcgg cgcgcgcgcc atgttcgcgc aggccgacct cggcggggcc    142200
     gattgcagcg gcgcgcgcat gccgcaaagc ctgtgggccg acgccattct cgacggcgcc    142260
     gtcttcagcg gcgccgacct cgcccaggcc atgctgcacc gcgcgcgcgc ggccggggcg    142320
     cgctttgacg gcgcggggct gcactacgcc gatttttcgt atgccgacct gcgcgacgcc    142380
     gacctgcgcg gcgcccgctg cctgcgcacc cagctgcatc gcgccctgca ggagggcgcg    142440
     cgctgggatt cgcgcatcgg cgtgctggag aacgaccctg cgctgtacga ggccgagctc    142500
     tggtcggcgc gccggcgcgc cggcccgtaa ggcgcggacc gccagactac aaggagccac    142560
     atgttcgccg attgccagtt gatgggaatg gacctggcct ttcccgatat ctgcaagacg    142620
     ccgccggcgc tgctgccgat tccctatccg aacttcgcgc tcggtccgat gggcatcccc    142680
     aatgtgtgga acgtgctgct gatggccatg cccgcgcaca atctgctgac caccatcgcc    142740
     ctgtccaacg gcgacaaccc cggcatcggc atgggcctga tatcgcagac cgtgatggcg    142800
     caggcgcgcc gcatcacctg cgtgcccaac gtgctgttcg gctgcatccc cgccacccgc    142860
     ctgaccggcc tgacggtcca gaacaccatc aacacggtcg gcatgcgggt ggtgcccagc    142920
     cagttgaagg tcgtgctgct gggcggcggc ggcgggggcg gcggcgcggc cagggcggcg    142980
     aagtccgcca aggccggcaa ggggccgggc gcgcgcgccg gcgccaccgc gcggcgcggc    143040
     gccggcggca agggcggcgc ggcaggcaag ggcgggcagg gcggcggcaa ggcggccggc    143100
     tcgggcaagt ccggcggcgg caagggcgcc aagccccgca agccgggcga cgatccgcgc    143160
     taccgccgcg gcaagttccg caagggggtg cgcgacaagg cctgggacca ggaggccagg    143220
     cgcagcaagg atggcgtggt gcgcgacccg gtctcgggca agaagatgaa aaaggacgag    143280
     ccctgggaca tgggccacaa gcccgggtac gaacaccgca agcacgtacg cagcgccaag    143340
     gaacgcgata tcgatcgcaa acagttcctg gatgaataca atgacccttc gcactatcgt    143400
     cccgagttgc ccaagtcgaa ccgtgggcac cagggcgagc tgaaaacgga tgactacttt    143460
     ggcccctgaa tcgaaagcct ccgcccagcc ctcgccgcgt cacaaggccg tggcgcgcca    143520
     cgcgctcaag gtattcggcg gcaccccggt cgtgcatgcc taccgccacg accagatcga    143580
     caccctgtcg atcgacatgc tggccgtcga cgacagcccc gacgacgggc tggtgtcgta    143640
     cagcacgctg gggctgttcg acctcgagct gcgccacgac gacggccagc ccatggccac    143700
     gcgggtggag ctgtgcgccg acatgcccga ggacctgcag tcgtgggcca acgtgctggc    143760
     caccgccgcg ttcggcctga tgcgcagcgg ccaggcggtc atgccgggct cggtgctgcc    143820
     cgattgcgtg gccgaatact atcccgacgc caccgtgccg cacctctacc tgtgcgtgcc    143880
     gttttcgtgg caggacggcg aattcccgcg ctgcgacgcc gatggcttgc tggtgaactg    143940
     gctgcaggcc gtgcccatca gcgaaaccga gcgccagttc atcgaaaccg ccggccccga    144000
     cgccttcgag gacgaactgc tcgaagccga ccccgacatc tacgacctct cccggccagc    144060
     ggtacgctga ccgcgccggg tcccaggctc ccggcctgcg cccgggtgcc tcgcctgggt    144120
     gcctggcacc catgcaggca ccgtctcttc cacgccaaca accacgacct cagcggaccc    144180
     gggtgcctgg caccttgccg ccacccacgt gcctggcacc cgccgcatac accgcgctgc    144240
     tcgcagcggc catcgcagcg ggtgccaggc acccatggcc ggcaccgtct ctcccacacc    144300
     aacatgacac caccgcgtca acacgccgga agaagtgttt gaatctctac gcaggtgtta    144360
     atggaacgta agaagaagca gcacttgtta gttgtcataa aggggcgccg gatgcgctgc    144420
     ctagaatgcc gtcgacgcat agggacgccc atcggcgccc ggcacaggat gcttgccgcg    144480
     catgacgacg aacatggaat ttgccgacct gttgaagacg ctgacgccca gcctgccctg    144540
     cggggaggac ctggagtacg acgctgattt cctgcagttg cagcaggccg ccgtgggccg    144600
     cagcgagcag cagttcggcg ccaccatcat ccccgcgcag gcgcccgact ggcgcgcggt    144660
     ggagcggctg gcgctggggc tgctggagcg cacgcgcgac ctgcgcatca tcgcctacct    144720
     gacgcgcgcc tggaccgaga tgcgcggcct gcccggctat gccgagggcg tgacgctggc    144780
     cgccggcacg ctggagcaat actgggacgc ggtgcatccg atgctggcca gcggcggcga    144840
     ggaagacccg atgccgcgcg tcaatgcgct ggcctcgctg ggcgacccgc agggctgcgt    144900
     gcgcggcatg cgctcggcct gcctgctcga cgatgtgcat ggccgcctgt cgctgcgcga    144960
     tgccgaggcc ctgctcgacg gcggcaggag cgaggccgac tatccgggcg ggcgcacgcg    145020
     cctgatcgag aacctgcgcc aggcgcgcct gcggcgcgac gacgcggcgc tggccgtggg    145080
     cgcggccgcc ggcgcgctgc gccgcatcca gcagcaggcc acccagcgcc tgggctcggc    145140
     ctggtgtccg gactatgcgc aggcgctgcg cgcgctggat gccttgctgc gcacctggag    145200
     cgacctggac gaaaccgcgg cggcgcccgc cgcggccatg ccggccgaag cgcatcacgc    145260
     ggccccggcg cctgaacccc aacccgcgcc cgccagctgg cacgacgcgc gcatcgccac    145320
     gcgcgaagac gcgatggcca tgctggccaa ggtcagcgcc tacttcgaaa cccatgagcc    145380
     cagccatccg gcgccctatc tgatccgccg ggtgcagcag ctcattcccc tggatttcca    145440
     cgacatcctg cgcaacctgg ccccgcaggg cctggcgcag ttcgaggcgt ggaccgcgcg    145500
     cgaggccgcc agccagtcct aggaccggtt caggccccag tcccttcatc aggagataac    145560
     aaccatggca accacgctca aaggcagcgg ccagaaattc atcgccagga atcgcgcgcc    145620
     gcgcgtgcag atcgagtacg acgtggagat ctacggcgcc gagcgcaaga tccagctgcc    145680
     cttcgtcatg ggcgtgctgg ccgacctggc cggcaagtcg aacacgccgc agcccgaagt    145740
     gggcgagcgc aagttcctcg acgtagatat cgacaatttc gacgagcgca tgaagtcggt    145800
     cgccccgcgg gccgcgttcc aggtggccaa tacgctgacc ggcgccggcc atctgaacgt    145860
     ggacatcacc ttcgagagca tcgacgattt ttccccggcc accgtggcgc gcaaggtggg    145920
     cgcgctcaac gagatgctgg aggcccgcac gcagctggcc aacctgctga cctacatgga    145980
     cggcaagacc ggcgccgagg agctgatcgg ccaggtgctg cagaacccgg ccctgctggg    146040
     cgcgctggcg gccgcgccca agcccgccga cgccgggccg gccgatgccg acgccgagag    146100
     cgcgcagccc ggcccgcaag cccgataagc catcgatacg gagaacgcca tgaccgcagt    146160
     ggcccggcgc gaacgcgcgc aagccgaatc cagcctggcg gcggacgacc tgtccgccct    146220
     gctgaagaaa gagttcaagc ccaagaccga gcaggcgcgc gaggccgtgg agcacgcggt    146280
     gcgcacgctg gcgcatcagg ccctggaaaa cagcgggctg ggcctgtcct cggacgccta    146340
     ccggaccatc caggccatca tcgccgagat cgaccgcaag ctgtccgagc agatcaacct    146400
     ggtgatgcac catcccgact tccagcagct cgaaggcgcc tggcgcggac tgcactacct    146460
     ggtcaccaac accgagaccg acgagctgct gaagatccgc ttcatgtgcc tgtccaagaa    146520
     cgagctgggg cgtacgctca agcgctacaa gggggtcggc tgggaccaga gcccgatctt    146580
     caagcgcgtc tacgaggaag agtacggcca gttcggcggc gagcccatcg gctgcctggt    146640
     gggcgactac agcttcgacc acagtccgcc cgatgtcgag ctgctgggcg agatcgcccg    146700
     catcagcgcc gccgcccact gccccttcat cgccggcgcc tcgcccaacg tgatgcagat    146760
     ggattcctgg caggagcttt ccaacccgcg cgacctgacc aagatcttca ccaataccga    146820
     gtacgccgcc tggcgcagcc tgcgcgaatc ggaagacgcg cgctatgtcg gcctggccat    146880
     gccgcgcttc ctggcgcgcc tgccctacgg cgcgcgcacc aatccggtcg atgagttcga    146940
     tttcgaggaa gaaaccgacg gcgccaacca cgaccggtac acctgggcca attcggccta    147000
     cgcgatggcc gccaacatca accgttcgtt caagctgtac ggctggtgca cctcgatccg    147060
     cggcgtggaa tccggcggcg cggtcgagaa cctgccatgc cacaccttcc cgaccgacga    147120
     cggcggagtg gacatgaagt gtcccaccga gatcgccatc agcgaccggc gcgaggccga    147180
     gctggccaag aacggcttca tgccgctggt gcatcgcaag aactccgatt tcgccgcctt    147240
     catcggcgcg cagtcgctgc agcgtccgca ggaataccac gacgccgacg ccagcgccaa    147300
     cgccaagctg gccgcgcgcc tgccctacct gttcgcctgc tgccgcttcg cgcactacct    147360
     gaagtgcatc gtgcgcgaca agatcggttc gtttcgcgag cgcagcgaca tggagcgctg    147420
     gctcaacgac tggatcatga actacgtcga cggcgacccg gccaactctt cgcaggaaac    147480
     caaggcgcgc aagccgctgg ccgccgccga ggtgcaggtc accgagatcg aggacaaccc    147540
     gggctattac gccgccaagt ttttcctgcg gccgcactat cagctcgagg ggctgacggt    147600
     gtcgctgcgg ctcgtgtcca agctgccttc gctcaagcag aacgaaggct gacgggcatc    147660
     catccgcgcc ggctcgcgcc ggccccgcga ctattgaggg agaaagcaag tggctgttga    147720
     tatgttcatg aagatcgaag gcgccaatgg cgaatccaag gacgccaacc acaaggactg    147780
     gaccgatatc gtgtcctttt cgtggggcgc cacccagccg gccagcctgg cgaccggcgg    147840
     cggccagggc gcgggcaagg ccagcttcaa cgatctgcac gtggtggccc gcatcgacaa    147900
     ggcggcgccg gcggtcatga agcactgcgc cagcggcaag cacctgggca agatcgaact    147960
     gtcggtgtgc aaggcgggcg gcgcgcaggt cgagtacagc aaggtcacgc tggaagacgt    148020
     gctggtcacc tcggtgcaga tcgccgcgga caacggttcg gaggcggtgc tggtcaacta    148080
     tgccttccag gccgccaagg tgcgccagca gtactgggag cagaccgagt cgggcggcaa    148140
     gggcgccgag agcctggtcg cgtgggacat caagcagaac aaggaaatcg gctgaacggc    148200
     gccggggccg cccggccccg gcacgccttg ccgaacacgt attcatgcag acatccgtgc    148260
     ttgcgatgcc cccgcgcgac ggcggcctgg ccggtcaggc cgcggccgtg caggcgcgca    148320
     tccggcgcgc gccggccgac gccgatttgc gcgcgcaact tttccagctg gctgccgtgc    148380
     agggcgactg gcgccgcgcc gccgagcaat tgcaactgtg cgcccggctg aacccgctgg    148440
     cccagccgat ggccaatctc tacctggcgg ccatccatgg cgagctgcgg cgcgaagccg    148500
     tgctggcggg ccaggccgaa cccggcttcc tggccgagcg gccctgctgg tgcgagccgt    148560
     tgctgcaggc gctgcgcgcc caggcgagcg accccgagcg ggccgccatg ctgcgcgccc    148620
     aggcgttcga tgcggcgcag gccagcgccg gcacgctgga ggacgcggcc gccggccagg    148680
     ccggctatgc ctggatctgc gacggcgaca gccgcctggg gccggtctgc gaactgattc    148740
     tcgacggcag ctatgcgtgg ctgccgttcg cgcaggtggc cgccgtgcat ctgccggccc    148800
     cgcaagggct gtgcgatctc gtctgggcgc gcgccgaaat cgccctggcc gacggcgcgg    148860
     tcgtgcgcgg cctggttccg gcgcgctacc cgccgtcggc cgggcaggat gacggcctga    148920
     ggctgggccg ggccacgtgc tggcggccgc tgggccagga cggttacgcc ggcgagggcc    148980
     agaagatgtg gctgaccgac gcgggcgagt tcgcgctgct ggacgtgcgc gccctgcgcc    149040
     agcaggcgcc atgagaatcg ccgacgaacg ggtggcgcgc gaccgcctgc agccgtcgct    149100
     gctcgatcgc ctggtcgatg acgagccatg gcgccgcagc gaggcgcccg aagcggcgct    149160
     gttgacgcac gccgggctgc gcgccgcggt gctgcgcgac ctgcgctggc tgctcaacac    149220
     ggtcaacctc gcctcgtcgc aggatctggc gccgtaccgg cacgtgcccg cctccagcgt    149280
     caatttcggc gtgcgcgcca tggccggacg ccgcatgtcg gagatcgact gggtcgatgt    149340
     cgagacgtcg atccgcgacg ccatcgcggc gttcgagccg cgcatcctgg aatcctcggt    149400
     cgaggtgcgc tgcgtcagcg acacccgcac gctcgagcac cacaatgtgc tcagcctgga    149460
     aatacgcggc atgctgtggt gcgtgccgca cccgcgcgag ttcctgttcc gcaccgatat    149520
     cgacctggaa agcgggcaca tggacctgcg cgacctggga ggggcgtgat ggacgcgcgc    149580
     ctgctcgact actacaaccg cgagctggtc tatatgcgcg agctgggcgc cgagttcgcg    149640
     cgccagcatc ccaaggtggc ggggcggctg ggcatgcacg gcaccgaggt ggccgacccg    149700
     tacgtcgagc gcctgctcga aggcttcagc ttcctggccg cgcgcatcca cctgaagatg    149760
     gacgccgagt ttccgcgctt cacgcagcgg ctgctggagg tggtgcatcc gcactatctc    149820
     gcgcccaccc cggcgatggc ggtggcgcag ttctcgccca gcatgaacga aggcacgctg    149880
     gccggcggct ttaccctgcc gcgcggcacc gtgctgcgcg gcggcctggc gcgtggcgaa    149940
     cagacgccgt gcgagttcat gaccggccac gcgctgcggc tgtggccgct gcgcgtgacg    150000
     gcggccgaac tcaccggcgc gcccaccgac ctgccgctgg cccgcctggg cctgggcgga    150060
     cgcgaggccg gcgtggccag cgcgctgcgc ctgcggctgg aagtctgcgg cggcgtcagc    150120
     ctggaagagc tggacctgga tcaactggtg ttctacctca acgggccgga cgcgcccatg    150180
     cagcgcctgc tggagctgat catgtgccac acggtcgccg tgctgggcca cgacagcgag    150240
     cggcccgtct cgtggatcaa ccggctgccg gccgacgcgg tgcgccacga ggggttcgcc    150300
     gacgaccagg cgctgctgcc caccgacacg cgggtcttcc agggctatcg gctgctgcag    150360
     gagtacttcg cgttcgcgcg ccgctatctg ttcttcagcc tgaacggcct gaagcagggc    150420
     ctgtgcacgc ggcgcgcggc gccggccgcg gcggctggcc cggccggcac ccggcgtttc    150480
     gacctgacgc tgctgctgtc ggccgcagcg cccgagctcg aaggcgcgat ctcggccggg    150540
     aacctggcgc tgcactgcgc gcccatcgtc aacctgtttc cgcgccgcgc cgaccgcgtg    150600
     gcggtcacgc cgcgccacca cgagtaccac gtggtggtcg accgcacccg gccgctggac    150660
     ttcgaggtct acagcctgac gcgggtgctc ggccatatgt cggcgcagcg ccccgaacag    150720
     gagttccgtc cgttctacgg ctcgttcggc gcggacgccg acgattacgg cgcctattac    150780
     tcgttgcggc gcgagccgcg gctggcctcg gacagcgcgc gccgccatgg cacgcgcacc    150840
     agctataccg gcagcgaagt ctatctgtcg ctggtcgatc ggcacgaggc gccgtttgcc    150900
     gatacgctgc gccatctcgg catcgacgcg ctgtgcacca accgcgacct ggcgctgctg    150960
     ctgccgctgg gcggcgccag cgatttcagc ctgcgcgtgt ccgccccggt gggcgcgatc    151020
     aaggtgctgc atgggccgtc gcggccggcc gcggccatgg ccgaccacgg cacggcatgg    151080
     caattgatca gccacctggg gctgcactac cacagcctga ccgacctgga cgagacgcgc    151140
     ggcgcgcaga cgctgcgcga gctgctcaac ctgtacggca acctggccga tccggtggcg    151200
     cgcaagcata tctcgggcgt gcgccacgtg cgggtcgaac ccatgcacca ccgcctgccc    151260
     gtgcccggcc ccatcgtcta cggccgcggc gtgcgcatcg acctgcaggt cgacgagacc    151320
     gccttctcgg gcatcagccc ctacctgttc ggcgcggtgc tggagcagtt cttcgcgcgc    151380
     cacgtctcca tcaacatgat gtcggcgctc accctgtcca cgccgcagcg cggcgccgtg    151440
     gcgagctggc ggccccgcat gggccgccgt cccgcggtct aggcggcgcc gcgtccgccg    151500
     caacgaggaa acccacatgc agacccgcaa cgcccgccgc ctctatcctg tctacgaccc    151560
     cgtgcacctg atcggcaccg tggcccgccg cgaagacgac ggcgcctgga cggtgtggtg    151620
     cgacggccgc ccctggcgcg tgcgccgggc cgccagctgc ctgctggtcc ccgaagaggg    151680
     cgatacggcg ctgatcagcg gcccggatgc cgaacgcgtg tacctgatcg cggtgatcga    151740
     gcaggccgac gcggcccagg ccaccctgga actggaaggc cgcgtcagct tgcgttcgcg    151800
     caccgccgat gtcagcctgg aggcggccgg cgaggtgcgc ctgcgcggcg cgcaagcggt    151860
     gcgcgtcgag accgaggcct tgtcggtcaa ggccggccag gcggcgtgcg cggccgcccg    151920
     catgcattat gtggccgacg aggtcgaagg cgcggtgggc agcatgcggc tggtcggcaa    151980
     ggtctacgag gcggtgctcg accgcctgac gcaactggcc cgcatggccg tgcggcagac    152040
     cagcgaggtc gagcacgtgc gcgccggcac cctggactac caggccgagc agagcgcgcg    152100
     cgtgcatgcg ccctatacga tgctgaccgc cgatgcgctg gtcaaggtcg acgccaagca    152160
     gatccacatg ggttgagcat ggacgcagcg gccaggacgg atcgacacgc ggcgctggcg    152220
     gtgctgccgc ctgccttctg gcaggccctg gcggcggcgc cgcacgggca cgacctgttt    152280
     cacgtgctgc gctggatcga cgcgcgcgcc ggcgcgcgcg cgccgctggg ccgcggcgcc    152340
     tcgccgcgcc acgaaccggt gcgcatgcgg caggagcctt cgctggcttt cgcgccggcc    152400
     accctggccg cggcgcgcgc gccgggcgag ggcgccgcgc ccgagctgtc catctacagc    152460
     ttcggcctgt tcggtcccaa tgggccgctg ccgctgcacc tgaccgagca cgcccgcgaa    152520
     cgccgccagc atcacggcga ccactccctg gccgcgttcg ccgacctgtt ccaccatcgc    152580
     ctgatcctgc tgttctaccg cgcctgggcc gatgcgcagt ccaccgccag cctggaccgc    152640
     ggccaggagc gcttcagcgg ctacgtggcc agcctgctgc acctgggcgc gccgtcgctg    152700
     cgccggcgcg acagcgtgat ggaccatgcc aagtaccaca tggccggcca tctgctgcgc    152760
     cagacccgca acccggaagg cctgtgccag gtgctgcgcg ccttcttcgg cctgcccgtg    152820
     ggggtagacg agttcgtggc gcagtggata aggttggagg ccggccagcg gctgcggctg    152880
     ggggcgggcg gcgggctggg cggcggcgcg cccctgggcg tggccgtgcg cgacgcccag    152940
     cacaagttca ggatccgcct cgggccgctg gactggcagg actacctggc gttcctgccc    153000
     ggttcggccc gcgcgcgcca gctgctgcat tgggtgcgcc tgtatgtggg cgtggagttc    153060
     gcctgggagg tgcggccggt gctgcgccgc gacgcggtgc gcggcgtgcg cctgggcgcg    153120
     gcggcgccgc tggggctggc gtcctggctg ggccggcggc cgccgcgcct gggcgacgcc    153180
     gccgagctgt tgctggacta cgaggggcgc gagcgccagg cggcgcggcg cgcgcaagcg    153240
     tttcatgaaa aggagcaagc ggcatgatcc acgatatgtc atacgacggc cagatactgg    153300
     cctggcccgg ccacgggcag ttccgcgcca ccagcggcat gcgcgggttc cagcatcccg    153360
     gccaggcctg cacgcccgac agcggtccgg tgccgccggg gctgtaccgc gtgctgctgg    153420
     ccgatcgcgg cgtggcgctc gacgacgggc gcggcgtgtg caacctggcg ccggcctggg    153480
     gcatccagca ggtgccgcgc ggcgcggccg ccggcgagtg cgagccttac tgggccaact    153540
     ggggcgagaa ccgcgcgcgc atggaaccgg ccgacgccgc cacgcgcaat cgctgcgccc    153600
     cggcgcgcgg cgggttctac ctgcacgact ccaccaaggg cttcagccac ggctgcatcg    153660
     aggtcgaggg gcgcatcttc gcgctgctgc gctcgtatgc gcgccagcgc ggccgcaacg    153720
     ccatgatcct caaggtggcc tatgtcgccg accgcgccac caacggcggc accgcgggag    153780
     acggccatgc gcgctgatcg ccatgcctgg ctgctggccg cctgcctggc gccggcgctg    153840
     gccgccgcgg gcccgctgcg cgtggagaac cggctggccg aatgcgtgcg ggtgcagccg    153900
     ggcctgcgca gtgtcgagca caacgtggtc ctgcagcggt tcgacctgac ggtcgtgcgc    153960
     cccatcggcg attgcggctg caagtccgcc ctggtcgcct accaggccag cgtggtgcgc    154020
     gaggacggca cgcgcggcgc cagccagtcc ggcgtgttcg gcgccatgcg ctcggggccg    154080
     cgcaccctgc cgctggccag cgacgccgcg ctgctgggcg agcggccggt ggcgctcggc    154140
     ctgggctgcg cgccagccga ctgatttcca acgactgacg gagcaccatg tccgatatcg    154200
     gccgcgccga gctgttcggc aaactcgatt ccctgtccta tcgcgccctg gaggacgcca    154260
     ccgccctgtg caagctgcgc ggcaatccct acgtggagct ggcgcactgg gtgcacgcca    154320
     tcgcgcacgc gcaggacagc gacctgcacc atatcgcgcg cgcgttcgag ctggatctcg    154380
     gcgcgctgca gcaagacctg gtgcgcgcgc tcgaccaact gccgcgcggg gcgggggcgg    154440
     tctcggacct ctccgagcac gtggaccacg tggtggaacg cgcctgggcg ctggcgtcgc    154500
     tgcgctacgg cgctgcgcgc atccgcagcg ggcacctgct gctggcgctg ctgcgcgacc    154560
     ccagcctgcg cggcgtgctg gccggcatgt cggggcagtt cgcccgcgtc gtgccagacc    154620
     tgctgctgca aggcctgccc gagatgacgc gcggctcgcc cgaggcgcgc gccgacgctg    154680
     ccgtggccga tgcgccgccg gatggcggcg gcgcggccgg cgcgctggcg cgctacgcgg    154740
     tggacctgac cgcccaggcg cgcgccggcc ggctcgatcc ggtgaccggg cgcgacgacg    154800
     aaatccgcca gttgatcgac gtgctgatgc ggcggcgcca gaacaatccc ctgctcaccg    154860
     gcgaggccgg cgtgggcaag accgcggtgg tcgagggcct ggccctgcgg ctggcgcgcg    154920
     gcgatgtgcc ggcgccgctg cgcgaggtgg cgctgtacct gctggatatc gggctgctgc    154980
     aggccggcgc cggcgtcaag ggcgagttcg agcagcgcct gcgccaggtc atcgacgcgg    155040
     tgcagggcag cgaacgcccc atcgtgctgt tcatcgacga aatccatacc ctggtggggg    155100
     ccggcggcgc ggcggggacg ggcgatgccg ccaacctgct caagccggcg ctggcgcgcg    155160
     gacagctgcg caccatcggc gccacgacct gggccgaata caagcagtac atcgagaaag    155220
     acccggcgct gacgcggcgc ttccaggcca tccaggtgca cgagcccgac gaggccggcg    155280
     cgcggcgcat gctgcgcggc ctggccggcg ccctgcaggc gcatcatggc gtgctgctgc    155340
     tggacgaggc cgtggaggcc gccgtgcggc tgtcgcatcg ctacatcccg gcgcgccagt    155400
     tgccggacaa ggcggtcgcc ctgctcgaca cggcctgcgc gcgcgtggcg gtcagccagc    155460
     aggccacgcc ggccgcgctg gaagacgcgc gccgccgcat cgacgcgctg gatctcgagc    155520
     tggaaatcgc cgcgcgcgag gcgcggctgg acgccggccc ggccgagcgc gtggcggggc    155580
     tgcgcgagca gggccaggcg gcgcgcgccg aggccgacgc cctggcggcg cgctgggagc    155640
     gcgaagcggc gctggccggc caggtgttcg gcctgcgcga acagctggac gcggccgacg    155700
     agcagtccgc gccggccttg cgcgccgcgc tgcgcgaggc cgccgacgcg ctggcgcgca    155760
     gccagggcga ggcgccgctg atccacccgg cggtcgatgc cgcggccgtg gcggccgtgg    155820
     tggccgattg gaccggcatc cccgtgggcc gcatggtgcg cgacgaagcg caggccgtgc    155880
     tggcgctggc cgacaccctg gagcgccgcg tcgtcggcca gcgccatgcg ctggaactga    155940
     tcgcgcgccg catccagacc gcgcgcgccg gtctgaccga cccgggcaag ccggtcggcg    156000
     tgttcctgct gtgcggcccg agcggcgtgg gcaagaccga gaccgcgctg gccctggccg    156060
     aggccctgta tggcggcgag cagaatctca tcaccatcaa catgagcgag ttccaggagt    156120
     cgcacacggt gtcgaccctg aagggcgcgc cgccgggcta tgtgggctac ggcgagggcg    156180
     gcgtgctgac cgaagcggtg cggcgccgcc cgcacagcgt ggtgctgctc gacgaggtcg    156240
     agaaagccca cgccgacgtg cacgagattt tcttccaggt gttcgacaag gggtggatgg    156300
     aagacggcga aggccgttac atcgatttcc gcaacacggt catcctgttg accgccaacg    156360
     tgggcgcgga cctgatcgcc agcctgtgcg ccgaccccga gctggcgccc gagcccgacg    156420
     cgctggcggc ggccctgcgc gcgccgctgc gcgacgtgtt tcccgcggcc ttgctgggcc    156480
     gcctggcggc cgtgccctat ctgccgctgt cggacagcat gctggcgcac atcgtggcct    156540
     tgcagttcga acgcgtcggc cagcgcctgc gcgagcgcca cggcatggat ttggaagtcg    156600
     agccggccgc cgccgagctg gtggtggcgc gctgcgtcga ggtcgaatcc ggcgcgcgca    156660
     tggtcgacgc catcctgagc cagcgcgtcc tgccgcagat cggccgcgaa ttgctgggcg    156720
     cctccctgca gcaacgcacc tggcgccgcg tgcgggtgcg ggcggtcgac ggcgagttcg    156780
     cctgcgagta cgagtagaac ggatccgcgg cgcgcctggt ccccgcatgg ggatgaggtg    156840
     cctgcccgcg cggcgcgcct gtcccagcgg ggacaggcgc gtcctgccgc aggcgtcagt    156900
     ccgcctggtc cgcgcgcggc gcggccgggc gcaggaaggt gcctcccgcc ggcgcatggt    156960
     cgtgcgcggc cgggccgtcg ccggccgcgt ggcgcggcag cagcgtgtcg cgcaccgggt    157020
     cggcgcgcag cggcgccagc ggatcgtgcg cgggcagggc cgacggggtg gcgtcggcga    157080
     acacgtccgc gccgccatgc ggcgcgtcga acagcgccag cgggtcgccc gccgggcggc    157140
     tgaccgcggc gtcgccggcc ggcagatgcg ccagcggatc ggcggcgttg cgcgcctgcg    157200
     ccgaatccag gtcgaagggg tgcgtggcgg catcggcgat gccgcccacc ggcagggtgc    157260
     cggggccgaa caggccgctg aatatgtcct cggccgcccc ggcgccggct tgcccgcgcc    157320
     ggggcgcatc ggcgggcgtg tccgccgccg cctcgggcag cgctgccggc cgtgcgtcgg    157380
     gcgcatcggg cccgctcacc tccagcgtgt gcgcgcccac gcgcagcgta tcgcccgcct    157440
     ggatggcgcg cacggcgccg ggcgcgagcg ccgcgtcgtt gatgtgcacc gcggccatgc    157500
     cgctcaggtt gtgcaggcgc cagccttgcg cgtcggcgcg cagcgcggcc tgcacgcggc    157560
     atagctggcc gggcgcggcc ggcagggcca ggcaattctc ggcgtcgcgg cccagcgtgc    157620
     cgccgggcgc gtggaaatcc gcccggcgcg cgcttgcgcc aggctcgggg ttgcgtacga    157680
     tcagcgtcag catcatggcg tgggtccgtg ccagggaagg gcgtcagccg gccggcgccg    157740
     cgcgggcgcg ctcgtaggcc ggcccccatt gcggatggcc ggcctcgttg ggttccagcg    157800
     tgaacgcggg atcggcctgc aggatgcggc gaaagcccgc ctcgcacagc acccggtggt    157860
     ccgtgacgca gtaactgaag gcctgcagct tccaggcctc gatgcgcatg gactggggcg    157920
     cctgcgccag cgcatcggcg tgcgccacct ggcggatcac gtcgccatag gcgccggcgc    157980
     tgtatgactg gcggatctgt tgcaggtcgc gctcggcctg gtcgctggct ggctcgccgg    158040
     cgcgctcgga ggtggggctg gcgcagcccg ccagcaggat ggcgcagccc agcagggtcg    158100
     cgtgaaatcg cagagtcatg aacggaaagg tcgtggcggt cttcgattcc cgcgcggcgc    158160
     gttaccgcat gtgtgccgcg tggatggtct ggccatgata tcggcgccgt gcgacagaaa    158220
     taattcgagg ggtaaaccaa tcatgaccaa ttgctggcgc ggcgcgccgc ggacgtaaca    158280
     ggcgtaacca tatcttcgtt gtcataaagg tgccgtgcgc gtcgcttgtc atagcggctt    158340
     tcctcgacat ggaaaacgga cctgccggat ggcgaatcga cgcttgcttg ttgctgtgcc    158400
     cacgcggcgc gcgttgcgcg cggcggcctg gattgccgtc gcggtgctgg ccgccgggtg    158460
     cgcgtccacg gccagccgca aggcggcgcc ttacgcgatc gagctgaagg ccgatccgcg    158520
     cgtcaatccc gatgcctcgg gccggccctc gccgatccag gtcacgctgt acgagctgcg    158580
     ttcgtccgcc gagttcgagg cgcgcgattt cttcaccctg gaaggcgacg cgcaggccgc    158640
     gctgggcaag tcgctcatcg aaaccgatca ggtcatcctg cagcccggcg aaacccgcaa    158700
     gctgtcgtat ccgggcaata ccgaggcgcg cgtggtcggc atcgtggcgg cctatcgcga    158760
     cctcgagcgc agtccctggc gcatcgtcgt gcccctgccg caggcccaga acaccaacat    158820
     ctacaagttc tggcagttct cgcccaacga ggagaccgtg cgcgtcgcgg tgggcggaca    158880
     gggcgtgcaa atcgtcgacc gggagcgttc ctggtggccc ttctgacgcc gcgccgcggg    158940
     cgccggcgtg tcttcatctc ttgaatcgca tatggcactg gacaacaagg tcgtctggtc    159000
     ggagggcatg ttcctgcggc cgcaacattt ccagcagttc gaacggcata tcgaggcgca    159060
     gttgcgcgtg cgcgccgcgg cggcctcggg ctgcggctgg ggctacaccg cgctggagat    159120
     cgatcgcgac gcgctggcgc tgggcaagct ggcgctggcg cgcgccgcgg gcgtgctgcc    159180
     cgacggcacg ccgttcgagt tcgagcgcgc cgacgagggg ccgccggcgc tggacatcga    159240
     cccggccatg cgcgatgcgc gcgtgatgct ggcgctgccg cgccgccgcg ccggcgcctg    159300
     cgaagtggtc tacgaagacg gcgcggatac gctggcgcgc tattgcgtgc atgaaggcga    159360
     gatcgaggac tccggctcgg tgggcctgga gccggcgctg gtgcagctgg gccgtttgcg    159420
     cctgcggctg gttcccgaaa ccgagctggg cgacgaatgg gtggcgctgg gcgccgcgcg    159480
     ggtgctggag cgccgcgccg accaccgcgt ggtgctcgac gagatgtaca tcccgccctg    159540
     gctggccgcc gacgccaatc cggcgctgcg cggctatgcc ggcgagctgt ccgggctgct    159600
     gcaggcgcgc gcagcggcgc tggcgcagcg gctggcgcag ccgggccgcg gcggcgtctc    159660
     cgaagtggcc gacttcctgc tgctggcgct ggtaaaccgc tacgccggcg cgctgtggca    159720
     cgcgcgccag gtgccggccc tgcatcccga acggctgttt cgcgactggc tgatgctggc    159780
     ctgcgacctg gccacctata cctgcgccac gcgcctgccc gaggtgctgc ccgattaccg    159840
     ccacgacgac ctgcaggcca gtttcgggcc gctcatggcc gagctgcgcc gctcgctgtc    159900
     ggtggtgctg gagcagcacg ccgtgcagat cccgctgcat gaccgcggcc agggcgtgcg    159960
     cgtggcgcag atcgccgatg ccgaactgct gcgcagcgcc ggcttcgtgc tggccgtgca    160020
     cgccgacatg ccggccgaga cggtgcgcac gcgctttccg gcccaggtca agatcggccc    160080
     ggtcgagcgc atccgcgacc tggtgcacct gcaattgccc ggcgtggcgg tgcgcgccct    160140
     gccggtggcg ccgcgccaga ttccctacag cgcgggccac gtgtacttcg agctggacaa    160200
     gaacggcgag ttctggcggc agctggagcg caccggcgcg ctggccctgc acctggcggg    160260
     cgagtttccc ggcctggcgc tggagttctg ggccgtgcgc gactgaaccg ggcacaggag    160320
     accatcatgc acgccgccaa tcctcccttt cccgacttcg gcgccgacgc ggcggccgac    160380
     cccggcgcgg ccagccggct gcgcccgcac gagtacgtca tcagcggctc caacccgctg    160440
     gtggcggcgg ccaatccgct gctggacctg atcccgcaga tccgcgccac cacggcccat    160500
     cccgcgccgg ccatgctgcg cgagtacctg gtcgacgaag tgcgccagtt cgagctgcgc    160560
     gcgcaacagg ccggcattcc caacgaaacc atcctgggcg cgcgctactg cctgtgcacg    160620
     gcgctggacg aggccgccgc gctcacgccg tggggcgggg gcggcgtatg gtcggcgcac    160680
     agcctgctgg tgacgttcca taacgaaacc tggggcggcg agaagttctt ccagctgctg    160740
     gccaagctgt cgcagaaccc gggccagcac ctggatttgc tggagctgtt gtactactgc    160800
     ctgctgctgg gcttcgaggg ccgctaccgc gtcatcgaca acggccgcac gcagctcgag    160860
     accttgcgcc agcgcctgct gcgcatcctg cgcggcgcgc gcggcgagta tccgcgcgcg    160920
     ctctcgccgc attggcgcga cacgccggtg cagcaggcgc tgcgccgcct gccggtgccg    160980
     ctgtgggcct acggggcgct ggcggcggcg ctggcgctgg cgttgttctg gggcctgtcg    161040
     tggcgcctgg gcgaacgctc ggatgccgtg ttcgccgcgg tcgcgcggct caagccgccc    161100
     acggtgcaga tcgccccggc gccgcgcccg gcgcccgcgc cccgcctggc cgtgttcctg    161160
     caacccgagg tgcgcgaccg cctggtgacg gtgcgcgacg aggtcgatcg cagcgtggtg    161220
     gtgctgcgcg gcgacgggct gttcgagtcg ggcgcggtcg cggtgcgcga ccgctatgcg    161280
     ccggtgctgg cgcgggtggc cgaggcgctg ggccagacgc gcggcgatat cgtggtgcgc    161340
     ggctataccg acaacgtgcc catccgcacg gcgcgctttc cgtccaactg gcatctgtcg    161400
     caggcgcgcg ccgaggcggt caaggcggtg atcgacgcgc gcctgggcca ggccggacgc    161460
     gtgcgcgcag aagggcgcgg cgaggccgat ccgctggccc ccaatgacac ccccgccgga    161520
     cgctcggtca accggcgggt cgaaattacc gtgatggtgc cgccggcgcc gcatgcccgc    161580
     acgcccgaag aaggagccac gccatgatcc cgcgcctgtt cggatggctg ttctcgcgcg    161640
     gcctgtggag cttcctgggc ctggtggcgc tggccctgct ggtgtggatc gccgggccgc    161700
     tgctggcgat cggcgcgctg cgcccgctgg aaagcgagac cgcgcgcgta ctggtcatcg    161760
     ccgcgctgtt cgccttcgcg ctgctgcgcc tgctgtggcg caagtggcgc gaaggccgcc    161820
     tcaacgccca gctgctgggc cagctgcgcc ggccggcccg tcccgaggcc gaggccgcgg    161880
     ccgagccgcc gccttcggac ctgcgcgaac tggaaggccg tttcgacgag gcggtggagc    161940
     tgttgcgcaa gacgcgcttc gacggaggcg gcgggcgcgg ctggctgcag cgctattcgc    162000
     gccaatacct gtaccagctg ccctggtacg tcatcatcgg cgcgccaggc tcgggcaaga    162060
     ccacggccct ggtcaactcg ggcctggact tcccgctggc cgagcgcttc ggcaaggccg    162120
     cgctgcgcgg cgtgggcggc acccgcaact gcgattggtg gttcaccgac gacgcggtgc    162180
     tgctcgatac cgccggccgc tacaccaccc atgaaagcga ccccaccggc gacgaggagt    162240
     cctggcgcgg ctttctcggc ctgttgacgc gctttcgggg ccgccagccc atcaacggcg    162300
     ccatgctcac cgtcagcatc gaggacttgc tggccgcgtc cgacgccgag cgcgcgcgcc    162360
     acgccgcggt gctgcgccgg cgcctgcagg agctgcgcga gcagctgggc atccatttcc    162420
     cggtctatgt gctggtgacc aaggccgacc tgctggccgg cttcgagcag tacttcgcct    162480
     cgttcagccg cgaagacctg gagcaggtat ggggcttcac cttgccctat gcgcgcgccc    162540
     aggagccgga cttcgacctg tacgaagcct ttcatgccga gtaccggctg ctgcagcgcc    162600
     ggctcgacga tgccctgccc gaagtgctgg ccgccgagcc ggacgaggcg cgccgcgcgc    162660
     tggcctacct gctgccgcag cagttcgccg gcctgcaggc cgtgctgggc catttcctca    162720
     gcgacgtgtt cgccagctcg cgcttcgagg agcgcctggt gccgcgcggc gtgtacttca    162780
     ccagcggcac ccagggcggc gagaccttcg accaggtcac cggccacctc aagcgctatc    162840
     tgcgcatcga aagcgggccg gccccggccg ccgccgagga aggccgcagc ttcttcctca    162900
     agcggctgct gcaggacgtg atctttcccg aggccggcct ggccggccgc aacctgcgct    162960
     gggagcgccg ctaccgccgc ctgcactggg ccggctacgg cctgatcacg ctggcgttcc    163020
     tgggcctggc ggcgggctgg ctggccagct acggcaacaa cgtgcgctat ctcgacgaag    163080
     tggcgcgccg cgtgccgacg gtggacaagc tggggcgcga tatcaagatc acccgctcgg    163140
     gcgatgtgct gggcctgatg cccttcctgg acggcctgtg gtacctgccg cgcgacgccg    163200
     ccttcgagcc ggacgcgccg ccgctgtcct atcgcttcgg gctgtaccag ggcggcaaga    163260
     tgcacgccgc gatgcagggc gtttatcgcg gcacgctcga cagcgtcctg ctgccgcagg    163320
     tggcgcgccg catcgaggcg gcgctgcgcg cggcccgcgc cgacgacctg gagtacggct    163380
     acgaggccct gcgcgcctac ctgatgctgt acgaggccga ccactacgac gccgagttca    163440
     tgcacgcctg gctgctgtcc gacatgcagg gcacgctgcc cgagggctac acgcgccggc    163500
     agtacgacct gatgtcgctg cacctgcgcc agctggcgca gggcggcgtg ctggcctcgc    163560
     cgtttccgcg cgacgaggcg ctggtgcggc aggcgcgcga cgaactggcg cgccacacgc    163620
     tggcgcagcg cgcctacagc cggctgcgcc gcatgctggc cggcgccgac gatcagccgc    163680
     cgaccaccgc ggtgacgctg ggcgggccgc aggccagcgc cgtcttcgtg cgcaagagcg    163740
     gcaagccgct ggcccagggc atcgcggcgc tgtacaccta ccgcggctat tgggacgtgt    163800
     tcaatccgcg cgtcacgcgc gtggccgagc gcctgcgcag cgacgatgcc tgggtcctgg    163860
     acatcgcgcc gccgggcgtg ctggacgagg ctgcgcgcca gcagctcatc gtcgacatca    163920
     agcgcctgta cctcaacgac tacgtggcgc gctgggacgg ctacctggac gacctggcgc    163980
     tggcgccgcg cagctcgctg ctgcaaagca tccagctggc gcgcaccctg tcggcgcccg    164040
     attcgccgct ggtgcggctg acccagggcg tggcgcgcga gaccacgctg ctgcgcgacg    164100
     cgggcggcga cgagcgctcg ctggcggacc aggcgcgcga ccgcgtcagc agcacgcgcg    164160
     aggcgctgga gcagatgttc ggcccgaccg gcccgggcgc ggccacgcgc gccgacgccg    164220
     gcgacggcaa gctggagcgc gtggtcgacc agcacttcga gccatggcgc aggctggcgc    164280
     gcgccgacgg gcagggcggc gcgccgattg ccgccaccac cagcctggtc aacgagctgt    164340
     acacctatct gacggcggcc gacgcggctc tgcgcagcgc cagcccggcg cccgcctccg    164400
     atgtggtgac caagctgcgc gccgaggctg gccgcctgcc gcggcccttg cgcgacgtgc    164460
     tcgacgactt gtccaccggc gcggcgggcg aagtgtccgg cgtggcgcgc gagcggctgg    164520
     gcgaagacct gtacgccacc atcggcctgt tctgccgcca ggccatcgcc ggccgctatc    164580
     ctttcgcgcc cggctcgccg cgcgacgtcg cgcccaatga cctggcgcgg ctgttcgcgc    164640
     ccaacggcat gatggacgag ttcttccaga agaacctggt cagccagatc gatgtgtccg    164700
     aggcgcgctg gcgcttcaag ccgggcatgg acggcacgcc gggccaggcg tcggcgctgc    164760
     tggattcgtt ccagcgcgcc gccgcgatcc gcgacgccta tttcatggcc ggcagcgcgg    164820
     agccggcctt tcgcgtctcg atccgtccgg tggaaatgga cccggccatc acgcaattcg    164880
     tcatggacgt ggacggccag accgtgcgct atgcgcatgg cccgcaggtc gccacttccg    164940
     tgcaatggcc ggggccgcgc ggcgccaacc aggtgcgcat cgagctgacg ccccaggccg    165000
     gcgcggcggg cctgtcggcc agcggaccgt gggcactcaa tcgcctgctc gaccaggccc    165060
     gcgtcacgcg cggcgcctcg cccgagatct cgctggccag cttcgatatc ggcggccgca    165120
     aagtggtgct ggagatccgc gcgggcagcg tcaggagccc ctttcacctg gccgagatgc    165180
     ggggtttttc ctgcccgggc cgttcatgag cggcggacgc gccatgccgg gcgcggaccc    165240
     ggacggcggc gtgggctggt acggcaagat cccggccgcc ggcgacttca tgcgccggcg    165300
     cctgtcgcac gggctggtgg cctggtggga caagtggctg cagtacgggc tggccgcctt    165360
     gcgccagatg cccgccggcg gcgccgagcg cgcctacgcg gccgcgccgt tgtggaactt    165420
     cgccatcccc gccggggccg gcgccggcgc ggtcctgctg ggcggcatgg cgcccagccg    165480
     cgaccgcgtg ggccgcgcct atccgttgag cgccatggcg gtcgtgcccg cgcaggccta    165540
     tcagcccggc ctgctggagg acgccggcga ctactaccgc cagcttggcg ccaccttgct    165600
     ggcggcggtg cggcgcggcg gcgcggccga gcagctggac cgccagctgc aggccatgcc    165660
     gctgcccgtg gccatgccgc cggcgcggcc ggccccggcc ggccaggaca tcctggacat    165720
     cctcaacgcc gggcaggccg gcaatgcgcc actggccggc gcgcgcgggc tggccgcctg    165780
     gcccgagctg ccgttctgtt tcaaccccgg ttcgcacacc agctactggt ggaccaacca    165840
     ggccgatggc gccgccttgc agacgtacgt gcacggcggc gccctgaacg ccacgctgtt    165900
     cctgcgcctg ttcgcggcgc cgccggcgtg gcgcgtgtaa tgcaaggccg cctccggagc    165960
     cctcatgcgc ccatcttccg ccaccgatac cgcgtccgtc ctcgaggccg ccgcgccgcg    166020
     gcccctggac gtggatgggg ccgcacccat gccgccggcg cgcgtgcgcc gggtgctggc    166080
     cgacctgctg gaacagctgg cgcccttgca tgagcgctgg cgcgtgcacg gccgcatcgc    166140
     gccgcggacc gtaggcctgg acggcgacgg gcgggctcgc ctgctggtcg acgccgcgca    166200
     gccggcggcc gatgccgagg cgctggcgca cgcggccggt ttcgccgcct tcgagcagta    166260
     cagcgacgat ccaggccagc cgtgcggacc ctggaccgac atctacggac tgagcgcgct    166320
     ggcctatgcg ctggccacag gcgcggcgcc gccgtcggcc ctgcggcgct gcgtgcgcga    166380
     cgattgcgcg cccttggcgc ggcgcctgga cgagaagcgc tggcaggcgc tggcgcaagc    166440
     catcgatgcc gggctggcgc ccgactatcg cgatcgtccg gcgagcctgg cggcgttcgc    166500
     gcgcctgctg gatgcggccg acaggcaggc cgagccgccg ccgatcgcgc ccgtcgcgcc    166560
     cgccacgtcc gccacggtgg ccgtggcgca ggcaccggcg ccggccacct tgccgtcccg    166620
     ggcgcccgcg cggcgtccgg cgcgcacgtc cgcgctggcg gtgctggctg tcctcgccgt    166680
     gctggccgtc gtcctgtatg ccgccctggg cggccgcgcc ggcgacgagc cggccgcatc    166740
     cctggccgcc gcgcccatgc ccgcgccgac gcccgcgccc gaacccgcgc ccgagcctcc    166800
     agcgcccgcg cccgaaccct cgccggcctc cgagcccgcc ccgttgcccg aacccacgcc    166860
     aacccccgaa tccgtatcgg cgccggcgcc gcaaccggcg cccgcgccgg ccgcgccacc    166920
     gccggccgcg ccgcagccgg tcagcgtacg cgtcgatatc cggccatggg gcgaggtctg    166980
     gatcgatggc cgctcgcgcg gggtcagccc gccgctcaag cagctgagcc tgccgccggg    167040
     gtgctatgcc gtcacggtgc gcaacccggc cggcccggac catcggctcg acctgcacgt    167100
     cgccgcgggg cagggcgccg ccatcgccca tgcattcgaa tgaatcgccg cgccgggtta    167160
     tgctatggcc ttcttcaatc ccgcgccggg acgacccggc gcgtgtactg gcctgaggac    167220
     gacctcgcga gatcccatcc gtgtcgtcca tccatcccgc tcccaccgat tcgcgcaccc    167280
     tggtgccgcg cgccacgcgc atccgcctgg cgatcgcctg gctcgtcacc ctgctgttcc    167340
     tgaccctggg cgaaggcctg ctggccgcgc ccaccgcgcc gctggcgacg ctgctttccg    167400
     tgctcctggt cggcaccatc atcatggccg ccttcgtggt ggtgcgtgag gccgaccatc    167460
     tggccgaaca gttgggcgag ccctatggca cgctgatcct gaccctgtcg gtggtcggca    167520
     tcgaggtcat cctgatcgcc gccgtcatgc tgggcccggg cgagtttccc accatcggcc    167580
     gcgactcgat cttcgcggtg atgatgatca tcctcaacct ggtgacaggc ctgtgcgtgc    167640
     tgctgggcgc ctggcgccac ggcgcgcagg cgtacaacgc gcagggcgcg tcggcctacc    167700
     tggccatgat cgcgctgctg accggcatgg cgctgctgct gcccaatgcc accgtgtccg    167760
     gcgggccggg catgttctcg cccgcgcagg cgattgcgtt ctcggtgctg acggtggcgc    167820
     tgtacgcggc gttcctggcg ctgcagacgg ggcgctgccg ccacttgttc atacagcccg    167880
     ccggcggcgc catggcgatt gccgcgccgg cgagcgcgcc gcgtcccgag gccggccatg    167940
     gcgccggcgg acgccggacc gcgctggtgc gttcgctggt gctgctggcc gcgctgctgc    168000
     ccatcgtgct gctgtcgcac agcctggccg tggtggtcga ctacggcatt tcggccgcgg    168060
     gcctgcccgc cgcgctgggc gggctggtca tcgccatcat cgtgttcacc cccgaatcgg    168120
     tcacggcggt gcgcgcggcc cgcgccaacg aaatgcagcg cgtcatgaac ctgtgcctgg    168180
     gggccttcgt gtccaccgtg gggctgaccg tgccggccgt gctggccatc ggcctgctga    168240
     ccggcaagac ggtggtgttc gggatctcgg cggccgaaac cgtgctgttc gcgctgacgc    168300
     tgttgctcag cctgttcacc ttcatgggcc agcgcaccac gccggtcacc ggcctggcgc    168360
     acctggcgct gttcgccgtg ttcggcgtgc tgctgttcgc gccgtgacgg cgcgccgcgc    168420
     aatcgtccat tcgcattagt ccgcgcgcct gatgccggcc tagtccgtcc gccggcggat    168480
     cgctgctagt cccgtatggc aaacgcgccg ccgttgtgcg acgctagtgc ggcgcggggc    168540
     ggtccggcgc gggcggcatt ctccgggacg ggagtacggc atgggcaagg cgacgtggcg    168600
     acaagtgtgg gaacgggcgc gggcgctggc cggcgcggcg gccctggcgg tgctggccgg    168660
     gtgcgcggcg cccggcgcgc aggatcccgg gcaggcgcgc aacacggcgc gcgaggccta    168720
     catctatgcc tacccgatgc tgtaccacta ccgctccatg tacgagcagg ccatcgatac    168780
     ggcctcgccc gcctacctgg gcggcttcgg cgtgttccag catcgcgccg agccgtacac    168840
     gccgcaaagc gtcgacgtgg ccacccccaa cgtcgacacg ctgtactcgc gcgcctggct    168900
     cgacctgcgc gccgagccct gggtgctgtc gctgccggcg gtgccgaaat cgcgctacaa    168960
     cgcgttccag ctggtggata tgtacaccta caacctggcc tacctgggca cgcgcgccac    169020
     gggtttcggg tcggggcatt acctgatcgc gggcccgggc tggaccggcc ccgtgcccaa    169080
     gggcatcacg caggtggtgc gcgccgacac cgatttcgtc gccgtgctcg gccgcaccgc    169140
     gctgaacggc ccggccgaca tcaaggccgt gcacgcgctg caggcgcgct atggcctgcg    169200
     gccgctcagc gcctacaccg gcacggctgc gccggccggc gcgccgccgg tcgattggct    169260
     gccctggaac gagcagcgcg ccagttccat cggtttcatc gcctatctga accagttgct    169320
     ggcccatacg cagccgcagc cggagtccga agccgacatg atggcgcgct tcgcgcgcat    169380
     cggcgtcgcg cccggccgcg acttcgaacc ggccaggctg gacgcggcca cgcgccgcgc    169440
     catggacgcc ggcatcgtcg atgcccagca ggccatcgag cagggcgccc gccacgccgc    169500
     ggctccggcc acgccggcca gcctgtacgg ttcgcgcgag caactgggcg gcgactatct    169560
     caagcgcgcc gtcgcggcgg ctgtcggcat ctacggcaac acggccgacg aagccatcta    169620
     cctgaccatc ggcgaagacg cgcagggcag gccgctcgat ggcgcgcggg cctacgagct    169680
     gcgcttcgcg cccggccgcc agccgccggt gcggttcttc tggtcgatca gcgtgtacgc    169740
     cttgcccgcg cgcggcctgg ccgaaaaccc catcgaccgc tatgccatcg gcagccgcac    169800
     caagggcatc aagcgcggcc gcgacggttc gctgacggtg tatctgcagc acgacgcgcc    169860
     ggcgcgcgcg catgcgccca actggctgcc cacgccggcc gggccgttcg tcgtggtggc    169920
     gcgcttctat ggcccccagc cggcgctgcg cgacggcgcc tgggtcatgc cggcgctggt    169980
     gccggcgcgc taggggcgcc tcaccacgaa tagcgcacgc cgatgttgcc gtagtaagcc    170040
     tggcgctggt tgccgtccag gtcgaagccg tagcccgccg aggcgtacag ctcggtctgg    170100
     cggttcagcg gcgcggccag gccgatgcgc aggtccatcg aagtcgaccc gtactcggtg    170160
     cggatcgaat cgctcggccc gaacgagacc gattcgccgt ggctgaagcg gtgccagaga    170220
     ttgatgcgcg cgtaggggcg gatcctctcc ggctggtcgg cgttgccctg cagcagcagg    170280
     ccgatgcggc cggtcagcgc gccgccgccg tggtagcgga tggtcgagta ggcgtcgtgc    170340
     gtatcgtcca gcgaggtgta ctggtagacc agttgcgcct gtggctgcag catgatgtcg    170400
     tggcgcggaa agaacgaata accggcttcg gacgaggccg tgaagcccca gccctcgagc    170460
     gaggcggcca ctcctcggtc cgagcgcgag cgccccgtgt agtaattgcc catcagcaca    170520
     ttgtcccagt accagttggt gtgcttgagc cgcgtccagt aaaggcccag gccataggct    170580
     tcgacgcgca gcttgccggc ctgcttgccg tgctcgccct gcacgaagcc atccacgcgg    170640
     ccgtcggcct gcccataggc gccgaacagc ccgaggcggt cgcttaggcc gtcgtcgcga    170700
     tcgcgctcga gcatgtcggc gccggcctgc gcgatccaga tgttgccctt gaagcgcggc    170760
     tccacgtcgc catcccagcg ttgcgtcagg cgctggccga tcacccggcc ccagccggcc    170820
     ttgcgttgcg ccgagttcag cagggcgtat tggtcgccca tccggtcatg gaaggtatcg    170880
     agcatgcgcg cgccgacctg gcgcgccact tcgggcgcca tgaccgcgcc cggggtctcc    170940
     ggacgatagg tggggatggg ctcgcccggc tggtccgggt tggtcgggtc cacgggcggc    171000
     aggatggccg agcgcaggta ccagttctgt tcctgctcgg gtgtctgcgc gccccggtac    171060
     aactggtagt cgtaggcgcc caccaccacg ggttcggaca gcgagaacgc ggtcgccgtc    171120
     gtggtgccgc cgttgcgggt gtcgaccacc aggatgccct gcgcctgggt cgccgcgccc    171180
     gggccgccgg tattcttgat gcgcagcttg ctgctgccgc tggcggtgcc gccatcgatc    171240
     accagcttgt ccgacgggga gtcgtccgcg cccaggtagg tgttcagggc gatggtgccg    171300
     tcgccgctgt agttgcccac ggtcagtgtc ttgtaggcgc cgccttgcgg cgccgcgaag    171360
     tcgatcaggc tgggatcgtt gaccaggttg gtgatggtcg agctgcccgt catgtgccag    171420
     gtggtgtcga tcagcgtgac gtgcgaggtg ttgcccggct cggtgatggc cgcgccggtc    171480
     aggtcggcat tgcgcgccac gaccgtggcc gtggcggcga tgccggcggc gcgcgtgcca    171540
     tgcaggatgg cgggaaaggc gggcgcgtcg gtctggctcg gatcgcgccc gggcacggtg    171600
     acgtcgcgca ggaccgccag ggcgcccgag tcggccacgt gcagccagtt ggtcgcgccg    171660
     tcgacggccg tgccgtccag ttcgacgcgc gcggtgccgc cctcgatgcc gatggcgctg    171720
     ccgcgcaggc tgcgcaggct gccgccgctg acggtggcgg tctgcgcatc gcggtcgctg    171780
     gacatcagca aggccatggc gccgtcgccc tgcgcctgta tcgccgtgcc gtcggccgag    171840
     aacctcgatt cgccggccac caccacggcg tgcgcctgcg cgccgctggt ggcgaccgtg    171900
     ccgcgggtca gcgccacatc ggtgccgtag ccttgcgcga gcacgccata gctttgcgcg    171960
     ccggcggtgg cgatggcggt gtcggccgcc cgcacttgcg tggccgtctc gccgatggtg    172020
     gtcaaagcgt acaggccggc ggcctcgtcg ccgcgcgtct gcaggctggc gttggcgaac    172080
     tccgcctgcg agccgttgat cgcccacagt ccatggctgc cttgcccctc ggtcaggatg    172140
     gtggcgtggc cgccggcgtg cggcgcaacc agcagatggc tggtcggcgc gccatagcga    172200
     tacagataga agcccgtgct gttggcgccg gtcgtatgga tgtcggtatt gccctgcatc    172260
     agcgcctcgc ccacgcccag catgtagaag gcgtcggagt cctggcccgt ggtgctcagg    172320
     ttcaggttcg agcccggcgc cgcggtgaac ttgtcggccg ctgcgtccgg gtaggtcagg    172380
     ctgatggaca attccagcgc ccgcgcatag cgtccgccgc tcgtgcccag gcccagcgtg    172440
     ccgccgctgg ccacgacgac cgaattgttg ttgttgatca gcaggccctt gggcgccatg    172500
     ccggtgccgc tggcattgac gcgcagggtc gcgccgtcgc cgatgctcag gcggttgggg    172560
     gcggcccgcg gcgtatgcgc gaggttgatg ccctggtaag cgttgatggt caacgaggag    172620
     tccgcctgca gatcgatggc tgtgttcgaa ctggacgaag tcaggatgcc cacgccggcg    172680
     gtgggcgatg tgacgttcag cgtgacgacg ctgctcggca ggaaattgat gagcgcgccc    172740
     gcgccgttgg tggcgaagat gccagtgcct gtcgcgttga cggtgatcgg gccggcgccg    172800
     aaattcagcg tggcgctgct catgcgcacg gcggtggcgc cgttgacggt gtcgttgccc    172860
     tgcagcgtga agtcgtcgcc cgggttcaag gtcagccccg gataatcggc ggcatatgcc    172920
     gaagcggcgc agcacgccgc cagccatccc aggtggcgca gcatgcttgc gcccgctgcc    172980
     agtctcttgc ttgctgccat ggcgataccc ccaacgcatg ccggcgcaga ccagaaacgc    173040
     taccggcgga ttggcgcgcc gcggatgcgg ggcgcgggga ccagcgacca gcttgaggag    173100
     ctcaggacgg cgcgttcccg gacgggccgg cgccagcatg gattgttgcg ctttattgcg    173160
     tatctgtatt tgaattttgc gtccctatgt atccaccagg cgcccggcgc gcccgccagc    173220
     gccgcgcttt cccccgccgg ggatcttttg cataatcgtg gcctgcgtcg gccggcccag    173280
     ccgcgtccga ccccgtttca aggccctccg gagttccatg ccccgtctac tctcgcgcat    173340
     ccgagctgtc cgcgcgcggg cggccgcgct gttggcgttg gccggctgtg ccatcctgct    173400
     gggagcctgt accttgccgc cgcccgtcga ccgcaccgcc tcgcacgccc tggatgcctc    173460
     gcaggcgcgc gccacgccac tgggccaggg catcggcgat ctggccgacg cccatcccgg    173520
     gctcagcggt ttccatgcgc tgggcgatgc gcaggacgcc ttcgccgcgc gcatgctgct    173580
     ggcgcgcgcg gccacccgca cgctggatgt gcagtactac atctggcgca acgacatgac    173640
     cggcaccctg ttgctgcagg ccctgcacgc ggccgccgag cgcggcgtgc gggtgcggct    173700
     gctgctcgac gacaacggca tctccggcct ggacgacgcg ctggccgcgc tggacgcgca    173760
     tcccaacgcc gaagtgcggc tgttcaatcc gtttcccacg cgctcgttca aggcgctggg    173820
     ctacctgacg gatttctcgc gcctgaaccg gcgcatgcac aacaaatcat tcaccgtcga    173880
     caaccaggcc accatcatcg gcgggcgcaa tatcggcgac gagtacttcg gcgcgaccga    173940
     cggcgtgctg ttcgccgacc tggacgtgct ggcggtgggg ccggtggtgg gcgatgtgtc    174000
     cgccgagttc gacgcctact gggccagcga gtccgcctgg ccggccggcc cgctgctgcc    174060
     cgcgccgggc gcgcagacac tgcgcgccct ggccgagcgc gccgcgcgca tcgaacagga    174120
     cccggccgcc ggcgactaca tgagcgcgct gcgcgagttg cccttcatcc gcgaattgat    174180
     ggccggccgc ctgccgctgc aatgggcgcc ggcccgcatg gtcagcgacg atccggccaa    174240
     gggcctgggc aaggcgccgc cggccggcct gctgacgcag cagctcagga acatcctggg    174300
     cgagccgcgc cgcacgctcg acctggtgtc gccgtatttc gtgcctaccg aggccggcac    174360
     gcaggcgttc gccgcgctgg cccggggcgg cgcgcaggtg cgcgtgctca ccaatgcgct    174420
     ggaagcgacc gacgtggccg tggtgcattc cggctacgcc aagcgccgca aggcgctgct    174480
     gcaggcgggc gtgcggcttt acgaaatgcg gcgcagctac gccgggccca agccgcaggg    174540
     caggggccga ttcggcagct ccgggtccag cctgcacgcc aagaccttcg gcgtcgacgg    174600
     cgagcgcgtc ttcataggct cgttcaactt cgatccgcgc tcggccaatc tcaacaccga    174660
     actgggcttc gtgatcgaaa gtcccgacat ggcgcgccac atcgccgcca cgttcgacca    174720
     ggatattccc gccgccactt acgaggtgcg cctggacgac gacggcagcc tgtactggct    174780
     ggaacagcgc gacggcgcca ccgtgcggca cgacagcgag ccgggcgtca gcctgtggcg    174840
     gcgcttcagc gtgtggctgt tctcgctgct gccgctcgag ccgctgctgt aggcgcgctc    174900
     aggccagcag cgacacggcc ttgatctgcg cccaggcctg catcccgggc gccagcgcca    174960
     gccggtcgcg cgagtagcgg gtgatgcgcg ccagcagcgg cgtgccgtcg gcgtccaggc    175020
     gcaccatgac atgggccggg ttggccgccg gcgccatctc cagcacgcgc accgccagca    175080
     cgttcaggat gctgccctcg cgcggctgct gcagcgccag gctgacatcg cgcgcatgca    175140
     ccaccacgcg caggcgctgg ccggccggcg cggcctggtg cacgaagcgc agccgcgccc    175200
     gcccgccggg cagctgcagc gtcagcaagg catagccggg gtcgaaaccg gcggcctcgc    175260
     cggtcaccac gaccgaggcg tcgtcggtca tcgccatggg caggtccagc cgcgtcagca    175320
     gcgcgtccag cgggccgctg gccaccgcgc ggccctgctc cagcagcacc aggtgatcgg    175380
     ccagccgcgc cacttcgtcg ggcgaatggc tgacgtagat caccgggatg tccagttcgt    175440
     cgtgcaggcg ctccaggtag ggcaggattt cgcgcttgcg ctgcacgtcc agcgccgcca    175500
     gcggctcgtc catcagcagc aggcgcgggc tggtcagcag cgcgcgggcg atgcccacgc    175560
     gctggcgttc gccgcccgac aggccggccg gcatgcgcgc cagcaggtgg ccgatgccca    175620
     gcagcccggt ggcctgctcc aggtcgacgc ggcgcagcgc gggcggcacg cgcttcatgc    175680
     cgtagcgcag gttggccagc acgtccaggt gttcgaacag gctggcttcc tggaatacat    175740
     agcccagcgc gcgcttgtgc gtgggtacgg cgcggcgcgc cgcgctgtcc agccacacct    175800
     cgccgttgat gtcgaggtaa ccgtcgctga ccggggccag cccggccatg cagcgcaggc    175860
     aggtggtctt gcccgagccc gactggccga acagcgccgt gacgccgcgg ccgggcagcc    175920
     gcagatcgac atcgagggag aactcgggat agtccacccg gaagcgggcg tggatgccgg    175980
     cctggcccgg cgggaaatcg gatggcatgc ggtatgcgct cagagtgccg ccgtggcgcg    176040
     ctggcggcgc gagtacagca acagcaggat gatgaacgag aacacgacca tgccgccggc    176100
     cagccaatgc gcctgcgcat attccagcgc ctcgacgtgg tcgaaaatct gcaccgatac    176160
     gacacgggtc ttgcccggga tgttgccgcc tatcatcagc accacgccga actcgcccac    176220
     cgtgtgggca aagcccagga tgccggcggt cacgaagccg ggccgcgcca gcggcagggc    176280
     taccgagacg aaccggtccc acgggccggc gcgcagggtc gcggcggcct ccagcggacg    176340
     gcggccgatg gcctcgaagg cgttgtgcag cggctgcacc acgaacggca tggagtagaa    176400
     caccgagccc accaccagcc cggcgaaggt gaacggcagc gtgcccagcc ccaggctctg    176460
     ggtcagttgc cccacatagc cgttgggtcc catcgccacc agcaggtaga agccgatcac    176520
     cgtggggggc agcaccagcg gcagcgccac gatggcgccc accggcccct tcaggcgcga    176580
     gcgcgtgcgc gccagccacc aggcgatggg cgtgccgatc accagcagca gcagcgtggt    176640
     cagcgaggcc agttctatcg tcagccagat ggcggcccag tcggcgctgg tcagcgacaa    176700
     gggcgggact cctgcaaggg gttacagctg atagccgaag gacttgatga tagccgcgga    176760
     acggggcgac ttcaggtact cgacgaaggc gcgcgcggtg gcgttgtcct ggcctttctt    176820
     caggatgacg gcgtcctggc ggatcggctc gtgcatcgag gccggcacga tccaggccga    176880
     gccgccggtc agcttgccat ccttgtagat ctgcgagagg gccacgaagc ccagctcggc    176940
     attgctgctg gcgacgaact ggtacgcctg cgagatgctc tgcccttcga cgatgcgcgg    177000
     cgccagcttg tcggccaggc ccagcttggc cagcacctgg gtggcggcca ggccgtatgg    177060
     cgcggtcttc gggttggcga tggacaggtg cttgaaatcg ccttgcttga gcacggcgcc    177120
     ctggtcgtcg acatagccgg cgcgcgccga ccacagcgcc agcgcgccgg tcgcgtaggt    177180
     gaagcgcgag ccgggcacgg tttcctgctc ggcgtccagc ttggccggcg tgctgtcgtc    177240
     ggccgccagg aacacttcga acggcgcgcc gttcttgatc tgcgcgtaga actggccggt    177300
     ggcgccgaag gaggccaccg cccggttgcc ggtgtcttcc tcgaacgcct tggcgatcgc    177360
     ctgcatgggc gcggtgaaat tggcggcgac cgccacctgc acctcgccgg cgagcgcggg    177420
     ggcggcaagc agggtggcgg ccagggccca cagcgtcgga atggcacgga ttttcatgga    177480
     actttgcctt tgtggtgaga aggttcgcgc gcccgtcgca gcaggcccgc atagcgcgca    177540
     gcagagcgtt atgtagtgga atatataacg aaatgcgtcg cgcccacaaa agcaggcccg    177600
     cgccccgccc gcttagcgga ccttggcgtc caggaaggcc cggatcgccg ggatgatttc    177660
     cgcgccgtgc gtctccaggg cgaagtggcc ggtgtcgtag aagcgcacct cggccgcggg    177720
     gatgtcgcgt ttccaggcct cggcgccggc gggcaggaag tacggatcgt tcctgcccca    177780
     gaccgccagc agcggcggct gcctgtcgcg gaaataggcc tggaactgcg gatagcgctg    177840
     cacgttggac gcgtagtcga gcagcaggtc cagctggatc tcggcattgc ccggccggga    177900
     tacctgcagc ccttccagcg tgtagccgtc cggggcgacc aggctggggt cgggcactcc    177960
     ttccaggtac tgccacttga tcgacgcagg ggtgggaaag ccatgcaacg cggcgcggtt    178020
     ctcggccgtc ggcgacgccc agtatcgcct gatcgcatcc cagccttgcg ccaggccttc    178080
     ttcataggcg ttgccgttct gggaaacgag ggcggtgacg cggtccggat gcgcgctcgc    178140
     caggcgccag cccaccggcg cgccgtagtc gtgcaccatc aacgcatagc ggtccagctt    178200
     cagctgttcg gtgaaccggt ccatggtcct ggtgatgttg tcgaacgtat aggcgtaggc    178260
     gtcccgtgcc ggcgattccg tgaagccgaa ggacggcagg tcgggcgcca cgacgcgata    178320
     gccgtcggcc agcgccgcga tcacgtcgcg gtacatgtac gacgaggccg cgaacccgtg    178380
     cagcagcagc acggcgggcg aggcggggtc gcccgcctcg cggtagaaga tcttcacgtc    178440
     gccgacctgc tcatggcgat agtggacggg gcgtggggcg gcgttgccag gcatcatggc    178500
     ctccttggta accattgaaa attgaatttg aaggttacgt ggatccggtg taacctgtca    178560
     atctcaaatt cactagttac gaatatggcg acgcctgcca cgcatccccc gcatttcatc    178620
     gccaacaacc tggcgctgga tttcatcaac agcgcgttcg gcgtcgggcc ggccagccat    178680
     gactgcctgg gcgacgacga gagcgtcctc gcctggctcg aggcggcggg acatgtgccg    178740
     gccggcctgg cgcgcccgcc cgcgggtttg gccgaactgg cccgcgcgct gcgcgaggcg    178800
     gcggcgcgca tggtgcgggc cgcccaggcc gggcagggcg gcgacgcggc gctggtgaac    178860
     caggtcctcg aggcgggccg gccagccagg aagctggcgt gggacgacgg ccagggcggc    178920
     tacacgcttg ccgaatgccc gcgcgaccac agcgccgcca gcctgctcga accggtggcc    178980
     gccgcgctgg ccgatttgct cgccggcgat gcgctgcggc atgtgcgccg atgcgaggcg    179040
     cacgattgca cgctggtttt cctggatgtc accaagtcgc accgccggcg ctggtgcagc    179100
     atggccttgt gcggcaaccg gatgaaggtg gctgcgttcc gttcccgcag gcagggcgcc    179160
     ggctgacgcc gggccgggca tggcgccggc gcgtaccgca aaaggacgcg gccgccccgg    179220
     gggggcggcc gtcatggggc gagaccgacg tcgcgtcgcg gcgctggcta gcgccgctca    179280
     gtgcgcgtcg gttcgccggg caggatgggc aacaggcgtt ggggcccggc gacgctggcc    179340
     tgggcgtcga cgccgaacag ggccaacaag gtaacggcaa actgcttcat gatgggctcc    179400
     ttgcgaggga tgggcggcgg gccgcgatgg cggggttatg cgccggtctc gacgtactcg    179460
     gacgcggccg acgcattgcg cgcctgggcc agttcggcct ggacctgcgc gcgggtggcg    179520
     gcgctgccgg ccagctgggg cgcgggttcc tgcgattcgc caaagaccag ttgccccgcg    179580
     gcgcgcgcga tcgccagttc gtgttgcacc tgcgagcgcg tcaggctgcc gccctgggcg    179640
     ccggcgggcg gatagtccag ctcgccggag ccggcaaagg cgttgaagcc gaacagggcg    179700
     gcggcgagca gggcggcgga cgtgaaggtt ctcatgatgg ctccagaaaa ttatctacta    179760
     ctagatagat ggcgagggaa ataaaaacac cggaaggcgg tggttcatgg actgtatgtt    179820
     atctactagt agatagataa acaagccatg gccccattgt tttttcgtat cccgccgata    179880
     gccgcctcag gcgtaggcga tcagcctgcc cagcgtggcg accgccagcc acagcagcag    179940
     cgacagggcc gcctgcaggc ggccccaggg cggcgggcgg ctgtcccagc ccgccaggcg    180000
     ggcgccccac agcgcgcgaa acagcagggc gttggccacg cccagggcga tgcccgccgc    180060
     cttgtattgc atcagcgcgt tgcccgacag gggcgcggcg tcggcgctga acagcagcgc    180120
     gccgctggcc agctgcagca gcagtccgcc cgcggccagc ggcgtcagca cggccgacac    180180
     atcggccagc gcaaagcggc ggcccagtcc cagcagccgc aggtccagca gcagcatggc    180240
     gcccaccagc agcaccaggc ccagcaggtg ggccaggttg gccgcgggat aggcccagga    180300
     cgagccgcgc atccacgcgc ccagcgcgca ggcttcgagc agcgcggccc aggcaggcgg    180360
     atccatgccg gccggcccgc ttcagcgcag ctctatggtc ttgccatcga cggtgatgcg    180420
     ctcggcccgc acctcgtgcg tgccgtcctt gcgcggataa ccgacgatgg tgaccgtctt    180480
     gccgaccgcc agcgcatcct tggccaggcc gcgcgactcc atgcgcgaaa cgggcgccag    180540
     caccacttcc cagctggcgc cctggtaatc cactttgact tcggcgtgcg ggttgcgata    180600
     gcgcacttcg gtcaggggcg cttcgatggt gagggtctgg tcggcgtcgt aggaactcca    180660
     gccgtggtgg gcccaggccg gcgcggccag cgcggccgcc aggccgccgg cggcgagcag    180720
     gtgtcggatc gtcatggggg ctccgtatcg cgcgaaaacg ccagcccact atagggccgc    180780
     gggcagtgcg ccggcaagcc gttcagaatg tgtaggcggc gctcaggccg atgctgccgt    180840
     tgcgccccgg cgccggctcg taatagcgtt ggttggcttc gttgacgatg accgagccgg    180900
     cgtagcgccg gccgaacagg ttgtccaccc gcgcataggc gttccacgac caggcgccgg    180960
     cgcgccaggc gtagccggcg ctggccgcgg cgacgaagta ggccggcgcg gcttcgctgt    181020
     tggcgtcgtt gacctcgatg cggcccaggt agcgcgcttc gatgccggcc tgccaccctt    181080
     gcggcggggc ccacgacagc gcggcgtaaa gcgcctgcgc cgccacgccc gggatgcggt    181140
     tgccggcccg gatggcgccc ggaccgtcgt cgcgatagcg cgcgtccagc caggtatagg    181200
     ccagctgcgc gcgcgcgtgg cgggcgaact cgccgttcca ttgcagctcc acgccgtcgc    181260
     gccgcgtgcg gccggcgttg cggtacgtgg cgcgcccgcc caggctgccg gccgagacga    181320
     tttcgtcgtc ggtttgcgta tggaatagcg cggcggtcac caggccggcg ccggtgcgcc    181380
     atttgacgcc ggcctccagg ttggtgctga cggctggccg caggccgaag ttcagtcccg    181440
     gggcccggtc gggccggtac gacagttcat tgagcgtggg cgtctcgaag ccgcgtccgt    181500
     acgaggcgta caggctcagg ttctcgttgg ccgcatagcg cagcgccgcc accggcaagg    181560
     ccttgcgata ggtggcgcgt ccgctgtcgt cgccgttgcc cggcgcctgg taatgatcgt    181620
     ccgagtcgaa gcgcaccgtg ctgtagcgca gccccgcgtc cagcgtccag cgctcggcga    181680
     actgccacga ggcctgcagg tacgggtcca ggttgtagac cgtgttggtc tcgtcgcgcc    181740
     gcaacgcgcc cttgacgccc aggccggtgg gcgcggcggg cgggccggtg tagttgtcgt    181800
     agccgcggcg ctgctccttc atggtgtcat aggccagtcc gccgatcagg gtcagcggca    181860
     ggccggccac ctgctggcgc gaggtccagc gcaggtcggc gccgccgtag tcgcggccca    181920
     ggtcgatcac gccgccggcc tgcgtggggc tttgctgcac ggccaccggg atggattggt    181980
     attgcgtggt gcggcgttgt ccgtagtaca gcatcacgcg caggtcgttg cgcgtgtcga    182040
     aggcgcgctc gtacagcagg ccgccctggg tctggcgcac ggtcttgcgc gtatcgaagc    182100
     gctcggccac cggcgcgctg cgcgggtcgt cctcgaattg ctcgcgcgtc aggcccagcg    182160
     gatcctgcgc ggtcaggtcc acgtggttgg cgctcagcgt caggcggctg ccgtcgtcca    182220
     tgcgcaggcc cagccgcgcg ttgcccaggt tcttgcgcgc ggcgctgtgg tcgcgatagc    182280
     cctcggtcgt gaagcgattg aagtccagca cgtaatccag gccgtctgcc gcgctggcgc    182340
     cgcgcagctt ggcgccgtag cgccaggtgc cgaagctgcc cgccgccgcg ctgcccgtcg    182400
     cctcgggcgg atcgctgccc tgttcggtga acacctgcac cacgccgccc gacgaattgc    182460
     cgtacagggc cgagaacggg ccgcgcagca cttccacgcg gccggccgag ccgatgtcga    182520
     tgttcgaggt ctggccctgg ccgtcgggca tggtggccgg gatgccgtcc acgtacagcc    182580
     gcacgccgcg cacgccgaag gtcgagcgcg cgccgaagcc gcgtatcgac agctgcaggt    182640
     cctgcgcgta attctggcgg ttctgcagct gcagtccggg cacgccggcc aagccttcgg    182700
     acaggttgac ctgcaggttg cgcgcgcgca gctcgtggcc atcgaccacg tccacggacg    182760
     cgggcgtatc gagcaccgag gtgccggtgc gcgtgccgct gatgcgcacc ggctccagca    182820
     tggcgggcgc ctcctgcgcg gcggccggcc cgcccagcgt ggcggcggcg cccaggatgc    182880
     gcaggcgtcg cagcgtgttc atcggtgggc cgtcaacagc aggttgcttt ccgagttggc    182940
     cacgccgtcg atgctgcgca ggtcgcgcag cacgcggtcg aaggcgggca ggtcggcggc    183000
     gcgcagctcc accaccaggt cccagcggcc gttggtggaa tgcacctgca gcgcctcggg    183060
     gatgcggcgc agcgccgcga ccacggcatc ggtggccgcg ccgcgcactt cgatcagcgt    183120
     gatggcgcgt atgccgtgct cgtcctcatt gcgcaggcgc accgtgtacc cggccacgat    183180
     gccgctgcgc tcgagccgcg ccatgcggtt ctgcaccgtt ccgcgcgaca cgtgcagctg    183240
     gcgggccagc gtggcggtgg gcaggcgggc gtccgcgcgc agcagcgcca gcaggcggcg    183300
     gtccagggcg tcgagcgcat gatccatggc agtctccagg ccgtttgggc agatcgccag    183360
     ccgtagctgg cgatctgctc catattgcct caggattgcc atttttctgg cttttcgcta    183420
     gccgggcatt tccctaagat ggtctgcagg ccaggcagga ccatcccgca ggagaccgcc    183480
     atgaacatgc cagcacccgc cgccacgcgg cgcgaccgga tcgaggacga actcggcgcc    183540
     cacaactacc agccgctcga tgtggtgctg gcgcgcggca gcggggtctg gctgtacgac    183600
     acggcggggc ggcgctacct ggattgcctg tccgcctact cggcggtcaa ccaggggcat    183660
     tgccatccgc gcatcctggc cgcgatggtc gagcaggcgc agcggctgac gctgacctcg    183720
     cgggccttcc gccatgacca gctggcgccc ctgtacgaag acctggcgcg cctgaccggc    183780
     gcgcacaagg tgctgcccat gaacagcggc gccgaggcgg tcgagacggc gctcaaggcg    183840
     gtgcgcaaat ggggctacga ggcgcgcggc gtgccggccg ggcaggcgga gatcatcgtg    183900
     tgcgccaaca acttccacgg ccgcacgctg ggcatcgtcg gcttttccac cgacccggat    183960
     gcgcgcggcg gctacgggcc tttcgcgccg ggcttcacgg tggtgccgtt cggcgacttc    184020
     gccgcgctgc aggctgccgt cacgccgcgc acggtggcct tcctggtcga acccatccag    184080
     ggcgaggctg gcgtcatcct gccgccgccg ggctatttcc gccaggtgcg caagctgtgc    184140
     agcgaacgcg atatcgtgct catcctcgac gagatccaga ccgggctggg gcgcaccggc    184200
     gctttcctgg ccgaggcgca cgaaggcatc gaggccgatg tcacgctgat cggcaaggcc    184260
     ctgtcgggcg gcttctatcc cgtgtccgcg gtgctgtcga accaggcggt gctgggcatt    184320
     ttccagccgg gccagcacgg cagcaccttc ggcggcaacc cgctggcctg cgcggttgcg    184380
     cgcgccgcgc tgcgggtgct gcatgacgaa ggcatgatcg acaatgcgcg cgagcagggc    184440
     gcctatttca tgcagcgcct gcgcgcgctg cccggcccgg tgcgcgaagt gcgcggccgc    184500
     ggcctgatgc tggcgctcga actcgagccc gacgccgggc cggcgcgcgc ctattgcgag    184560
     cggctgatgg cgcgcggcat gctggtcaag gacacgcacg gccagaccct gcgcctgtcg    184620
     ccgcccttga ttgtcacgcg cgaacagata gactgggcct gcgcgcaact ggcgcacgtg    184680
     cttgcgcatt ccgcgccagg ctcttccgga ggtccatcgt gatcgctgca tcgttccccc    184740
     acggggtcag cctgatcggc gcgcccaccg acatcggcgc gggccagcgc ggcgcttcca    184800
     tggggcccga ggccctgcgc gtggcgggcc tggtgcgcct gctcgagcgg cgcggcctgc    184860
     aagtgaccga tcgcggcaac ctgcagggcg cgcccaaccc gtggcgcccg ccggccaacg    184920
     gctaccggca cctcaacgaa gtcatcggct ggaaccagct cgtgcacgac gccgtcagcg    184980
     ccgagttgcg ccaggagcgc ctgcccatcc tgctgggcgg cgaccacagc ctggccatcg    185040
     gctcgatcag cgcggtggcg cgccattgcc gcgcgagcgg ccgcaagctg cgcgtgctgt    185100
     ggctggacgc gcacgccgac ttcaatacca accggctcac gcccaccggc aacgtgcacg    185160
     gcatgccggt cgcctgcctg tgcggcaacg gccccgcggc actgaccggc atggccggcc    185220
     gcacgccggc catcgaaccg ggctgggtgc gccagatcgg catccgcagc gtggacgaag    185280
     gcgaacgcaa cctggtctac gacgccgggc tggaggtcta cgacatgcgc tatctcgacg    185340
     aggtcggcat gcgcgcggtg atggaggccg ccctggccgg gctggacccg cagacgcatt    185400
     tgcacgtcag cttcgacgtc gacttcctcg accccgagct ggcgccgggc gtgggcacga    185460
     ccgtgcccgg cggtcccacc tatcgcgaag cccagctgtg catggaaatg atcgccgaca    185520
     ccggcctgat gcgctcgctg gacatcgtcg aactcaatcc cgcgctggac gtgcgcaaca    185580
     agaccgccca ggtcgcggtg gacctggtcg aaagcctgtt cggcaaatcc accctgatgc    185640
     gccggcgccc cggcagcgcc tgaacgtgcg cgccggccgc tagtgcctgc cgcgcgcgcc    185700
     ggcctcgtcg gccacttcgg cggcgaacat atagccccag ccatgcaggg cgcggatcgg    185760
     caggggcatc tggtgatgcg ccgccttgcg gcgcaaacgg ctgatcatca cgtccacgaa    185820
     acggctgcgt tgcgcgccct ggtccgctgc gccgggggcg gacaggtcgt cggcgatcag    185880
     cgcctcgcgg ctgatcttgc gctcgggcgc gcgcatcagg cgcgacagga actcgcgctc    185940
     gcccgtggtc aggcccagcg tgcgcccgcc cgggctgacc agcgtccatc cctggttggt    186000
     caaatgccat ttgctgtcgg gcggcgccat ggccggctcc agggcgagcg cctccatgcc    186060
     caggtcgatg cccggctcgg agccgcgcgc aagctcggcg gtctcgggca gaggcgccag    186120
     cgcgacgatg cggcgcagca gggcctgcag cacggccgcc agctccagtc cgctgacgtc    186180
     cgtgggcagg cacgcgtcgg cgccgcacag cagggtgcgg atacggcttt cgctgtcggc    186240
     gaacgcttcc atcgcgatga tccccacccg ccggtcgatg gcgcgcagcc gcgccgcggc    186300
     gatatggatg tcggcaagcg gcgcgctcag tatcaccagg gggcaggcgt gcgccgcgca    186360
     gttgtcgtag acctcgatca gctccgtgca ggctcggatc ttgaagccga gataggcaag    186420
     gtgttccagc tgtttttggt gcgcggcatc gtctctgacc agaaagatga catcgagcgt    186480
     actgttcatg agtggtgctt ccgaatcgac tgaaggccgg gcgcgcggaa aggcgtggcg    186540
     caccggcggc gccgtcaagc cgcacgcgcg caacccgcgc cgggacgcgg caccaatgtt    186600
     gcatttaaac atgcatgttt tcatttgtga atatatattt caaaacatcc ctgcacgcgg    186660
     gatgctcccg tgcgtggccg ccacgcagcg cccgtgccgc cgcgtatagc ctgcttacca    186720
     agcggccggg caaagggggg ccgaatgggg cgcacgggcg gttacagtaa cggttgtgag    186780
     ataagcccgg agacccccct catgccgatc cgcccgttca cgcgcgcctg cctggttgcg    186840
     gcattgggcg ccgtcctggc cggctgcgcc agcaacaccg gccaggcgca ggccgaaggc    186900
     gccgcggccg ccaacgccgc caccagcgcc gattccttcg cccagacgac ctgggagctg    186960
     gtgcgctgga ccaaggccga tggcggctac cgggtcattc cccacggcga caacggcgag    187020
     ccgatcttcc tgaccttttt cgcgcagggc aagcagtacc gggtcagcgg ctttgccggc    187080
     tgcaaccgct acacgggcgc ctaccggctg cgcgacggca agctgcagat caccgcgccg    187140
     gccagtaccc gcatggcctg cccgcagccc gagcgcgccc ggctcgaagc cgactacctg    187200
     cgcgcgctgg cgcagatccg ctcgttcacg ctggacagcg gcggcgcccc gcgccacctg    187260
     acgttcaacg tgcagggcgg cgacgtgctg gatttcatgc gccgccagga tcctcccacg    187320
     ccggaataag ccgcggcgcg ggcgcgtgcc gcgcgggcag gccctaaaat cgctcccgtg    187380
     gcgcggcccg gctgggccgc cggttcctag gagtcctgtc atgtccgcaa tctcgccggg    187440
     gcgcgtggcg ctgtcttttt ccctcttgct ggccctggcc gcctgcgctg ccgatccggc    187500
     cggcggcggc gccagccggg cgcaggcgcc cgagcggcac agcgacatgc tggcccagac    187560
     caattgggag ctggcccgct ggacccgccc cggcggcgcg ctgcggccgg ttccgcatgg    187620
     cggcgccggc aagacggcgc cgatcacgct gtcgttcacg caccagcgcg gcgccgcccg    187680
     gctggccggc tttgccggct gcaacaatta ctcgggccag tacaccatcg ccaacggcct    187740
     gctgatcgtc accgcgccgc cggtgagcac ccgcatggcc tgcgcgaacg ccgacctggc    187800
     ccgcctggag caggattacc tggccggcct caccgccgtg accgccagcc ggctcgacca    187860
     tgacacgcgg ccgcagcggc tgacgctggc gctgcgctcg ggcgacgtgc tggacttcgc    187920
     gcgccgcgcc gatccgctgg ccggtggcca gcccggcgcg gccaagctgg tgtacgtcgc    187980
     gtcgagcaag gcgccttgca gcgccggcgc gggccgggcc cagtgctacc aggtgcgcga    188040
     cagcgcctcc cagccctggc agctgtggta cggggacatc accggtttcg ccttccagcc    188100
     cggcatcgaa taccggctgc gcgtggtgga agtgcgcgac cccaatccgc cggccgacgc    188160
     gtcgggggtg cgctgggtgc tcgaccacgt ggtcgagcag cgcgtggcgg cgccgcgtcc    188220
     agcccccgcg ccgtagcgcc ttggcggggc ggtttactat tacgccctgt ttttccttcg    188280
     ttcgtgcttt tccgccatga ccgccgtcgt caatatcgcc gcctataaat tcgtcagcat    188340
     cgccaacccg gccgacctgc gcgagcccat gctcgaacag gccggccagc gccagctcaa    188400
     gggcacggtg ctgctggcgc cggagggcat caatctgttc ctggccgggg cggccgacgc    188460
     tatcgaaggc tttctgcgct ggctgcgcgc cgacgcgcgc tttgccgacc tgcaggccaa    188520
     gtacagcgaa tccgcgcgca tgccgtttcg caagctgctg gtcaaggtaa agcgcgagat    188580
     cattcgcatg gaccacccgg ccatccggcc cgaagcgggg cgcgcgcccg cggtcgacgc    188640
     cgcgacgctg cggcgctggc tggcccaggg ccgcgacgac cagggccgcg agctggtgat    188700
     gctggatacg cgcaatgcgt tcgaggtgga ggtggggacg tttcgcggcg cgctggactg    188760
     gcgcatcgag cgtttcacgc agttcccgca ggcggtgcgc gacaaccagg ccgcgctggc    188820
     gggcaagacg gtggtcagct tctgcacggg cggcatccgc tgcgaaaagg cggccatcta    188880
     catggccgag gccggcatcg agcatgtcta ccagctcgaa ggcggcatcc tgaaatactt    188940
     cgaagagacc gatggcgccg gcttcgacgg cgcctgcttc gtattcgacg agcgcgtcgc    189000
     gctcgacgcg gcgctggcgc cgcaggcctg aaacggccgg cccgcgtggc gggccggcgg    189060
     cggcgcgctc agcgcacccg catgccgggc tgggcgcccg gccagggttc gagcacgtag    189120
     atcccgggtt cggccttctc gtcggcgtgg ctggcggcca gcaccatgcc ctcggacacg    189180
     ccgaacttca tcttgcgcgg cgccaggttg gccaccagca ccgtcagctt gccgaccagg    189240
     tcctgcggct ggtaggccga cttgatgccc gagaacacat tgcgatggcg tccctcgccc    189300
     acgtccaggg tcaggcgcag cagcttggtc gagccttcca cttcttcgca attgacgatg    189360
     cgcgcgatgc gcaggtcgat cttggcgaag tcgtcgatgg tgatggtgtc ggccagggcc    189420
     tcgccgcccg gcagggcggc cggcgcgctg gcttcggcgg cgggcggctc gaacaggtcg    189480
     tccagcagct tgggatcgac gcgctgcatc aggtgcttga acggcgccac ccgctgcggc    189540
     agctgttgcg cgtcgcccca ggcgaagtcg gcgttcgcgc cgaacagctc gcgcgccacg    189600
     cggctggcca gcgcgggcag caccggcgcc agcatcaccg acagggcctt gaagccggcc    189660
     agcgcgcgcg agcagatgtc ctgcaggcgg gcgcgcgtgg ccgcgtcggc ggcgccgatg    189720
     cccttggcca tcacccaggg ctgcgccgcg tcgaacgcct ggttgatgcg gtcggcatgg    189780
     gccatgattt cgcgcaccgc gcggttgtac tcgcgcgcct cgaaggcggc gcggatcgat    189840
     tcggcctgct gcgcgaactc ggccgccagc gcgtccgtgt cgccgtcgta cgccagttcg    189900
     ccgtcgaagt ggcgggtaat gaaggcggcg gcgcggctgg cgatgttgac gtacttgccc    189960
     accaggtcgc tgttgacgcg cgccacgaag tcttcggggt tgaagtccat gtcctcgacg    190020
     cgcgcgttca gcttggccgc catgtagtag cgcagccatt cggcgtccat gccgatttcc    190080
     aggtagcgca gcggcgagat gccggtgccg cggctcttgg acatcttctc gccgctgacg    190140
     gtgatgaaac cgtgcacatt cagctggtcg ggcgtcttgc gcccggcgaa cttcagcatc    190200
     gccggccaga acagcgcgtg gaagtaaatg atgtccttgc cgatgaagtg cacctgctcg    190260
     gtcgggccgg ccgggtcgag cagcgcgtcg aagtccaggc ccttgaccgc gcaataggat    190320
     ttcagcgagg ccaggtagcc caccggcgcg tccagccaga catagaaata cttgcccggc    190380
     gcgtcgggaa tctcgatgcc gaaatagggg gcgtcgcgcg agatatccca gtcgcccagc    190440
     ttggcctcgc cgtcgtcgcc gcccagccat tcgcgcgtct tggcctgcac ttcggcctgc    190500
     aggtgcttga cgccctggcg gttggcgccg gtggtccatt gctgcaggaa ctcgacgcag    190560
     cgcggatcgg acagcttgaa gaagaagtga tcggacgact tcagtaccgg cgcggcgccg    190620
     gtcagggccg aataggggtt gatcagctcg gtgggcgcat acacggcgcc gcacacttca    190680
     cacgaatcgc cgtactggtc cttggcgtgg cagcgcgggc attcgccctt gatgtagcgg    190740
     tcggccagga acatgccctt gaccgggtcg tagaactgct cgatcgagcg cgtctcgatc    190800
     agtccctcgc tcttgagcgc gcgatagatt tcctgcgaga gcgccacgtt ctcgggcgta    190860
     tcggtgctgt gccagtggtc gaagcggata tggaagccgt ccaggtagcg cggccgctcg    190920
     gcggcgtagc gggccaccag cgcctgcggc gtgatgcctt ccttttcggc cttgagcatg    190980
     atcggcgcgc cgtgcgcgtc gtcggcaccc acgaaatgca ccgtgtggcc cgccatgcgc    191040
     atcgaacgga cccagatgtc ggcctggatg tactccatga tgtggccgat gtggaacgat    191100
     ccgttggcgt agggcagggc agtggtgacg aagagcgtgc gtgacatgtc gtaggaggct    191160
     cagggggaag gaacggacaa gccggctatt ttagggcctt tccgcgcggg cgcccgggcg    191220
     cggccgcgcc ggcgctcgac tggagggggg aaggtatggc ccgtgccggg gggcggcgtg    191280
     cgcgggctgg cctcaggccg ggccaggccg gctgggcatg acggggggct caggcatgaa    191340
     aacgcgccgc caggccgtgc cacggcggcg ctgcaggggc cggcgggacg ccggcgtcag    191400
     cgcacttcgc gggcttcgac gtcgatgacg tcgccgcgtg gctggccgaa cggggcgctg    191460
     gcggcctgga acggacccgg ccgggcggcc tggcgctggc tccagtaggc gcgcacgccg    191520
     aacggcttgc cgcgtacctt ggcgaccagg tacagcacgc ccaccgcgat ggccgtggag    191580
     gccatgaaca ccagggccat catcatcccg atgaggccga ggagggcaaa tagcgcggcg    191640
     ctgaaaaagc ggaacagtgt attgaccatg tagatatgga tgtaaaacca ggctaaaggt    191700
     tcccgcgtat ccgctatcct tcgagtaacg gctcgcgtaa tggcgcgatg accctgggaa    191760
     ccatagtgtg atgagtataa cgatagaaca aatccgcggc gcgttggcgg gcgttgccga    191820
     tccgcagacc ggcctggagc tgaatgtttg tgtaaaagat cgtgacatcc atctggccgc    191880
     ggacccggcc gccctcacga tagagctggg ctatccggcc ggcggcgtgg ccgattccgt    191940
     gcgcgcgctg gccggcgccg cgctggccgc cgcgggcctg ggcgcggtgc gcgtcgcggt    192000
     tacctggaac atcatcgcgc acgcggtgca gcctggcctc aagccattgc cgcaggtgcg    192060
     caacatcatc gccgtggcgt cgggcaaggg cggcgtgggc aaaagcacca cggcggtcaa    192120
     cctggcgctg gcgctggcgg ccgagggcgc gcgggtcggc ctgctcgatg ccgacatcta    192180
     cggccccagc gtgcccgcca tgctgggcct ggccggccgt cccgaaagcc gcgacaacaa    192240
     gaccatggag cccctggtcg ggcacggcct gcaggccaat tccatcggcc tgctcatcga    192300
     cgccgacgcg ccggcgatct ggcgcggccc gatggtcacc caggccctgg agcaattgct    192360
     gcgccagacc aactggcgcg acctcgatta cctggtcgtc gacatgccgc cgggcactgg    192420
     cgacatcgcg ctgaccctgg cgcagaaagt cccggtcgcg ggcgcggtca tcgtcaccac    192480
     cccgcaggac atcgcgctgc tcgatgcgcg caagggcctg cgcatgttcc agaaggtgca    192540
     tgtgcccatc ctcggcgtgg tcgagaacat ggcggtgcac atatgccccc aatgcggcca    192600
     tgccgagcac attttcggcg caggcggggg ccgccgcgtg gccgagcagt acgaggtgcc    192660
     ctggctgggc agcctgccgc tgcagcgcgc catccgcgag cagaccgacg ccggcaaccc    192720
     caccgtggcg gccgagccgg atggcgaggt tgccggcatc tatcgcgaca tcgcccgccg    192780
     ggtggcggcg cgcattgcgg ccctgccgcg cgacatggcg ggcaagctgc ccgccgtggt    192840
     ggtccggccc gcctgacgca tgcgtcggat attgcgtgtc tgccccgctc tcctgttcgc    192900
     gcttgccgcg ggacaggtcc atgccaagct gccggaggtg atcgtcgatc ccggcggcgt    192960
     gccgccggcc gcgctgcagg ccatcaacag cgcggtcgac gccatcgcgc gcctgtccga    193020
     ggaccaggac ggcggcgaaa tcgaccgcct gcgccgccgg gcgcgcgacg cgacgctggc    193080
     cgcgttggcg acgcagggtt atttcacgcc caccgtcacc ctgacgccgg gcaccgacgt    193140
     gggcggcgaa acctgggaca tcgccatcga gccggggccg cgcgcccggg tcgccagcgt    193200
     cgacctgaaa ttcaccggcc gggtcgcgcg cccggaatac gccgcgcgca tccagaagtg    193260
     gcgcgacgac tgggccctga aggccggcca gcccttcatc aacggcgact ggaacaaggc    193320
     caagtccggc ctgctcgacg ccgtgtccac gcgcgacttc ctgctggcgc acatgaccca    193380
     ttcgctggcc gaggtggacg ccgaaaccgc ccaggtgcgc ctgtcggtgg agatcgacag    193440
     cggcccggcg gtgcgcatgg gcgccttgca gaccgacggc ctgcagcgcg tgccggaaag    193500
     cctggtgcgc cgctatgtga agtattccga gggcgcggcc tacgaccagg acaaactcga    193560
     ccagtggcag caggagctgc agtccacggc gttcttccgc ggcgcgttcg tcacgctgga    193620
     ccagggcgcg cgcggcggcc aggacgacgt gaaggtgacc gcgccgggcg cgggcgcccg    193680
     cgcgcccggc tccagcggcc tggcctcggt ggcgccggcc ggcgatgccg aggtggcggg    193740
     cgggccgacg gccgccgcgc ccgtgctcga ctcgcaaggc gagatcaccc tgccggtgga    193800
     cgtgcgcgtg gtcgaggccc cgcccaagcg cctggcggta tcgctgggcg tggacgacga    193860
     ggccggcgtg cgcttcgaga ccatctaccg gcagaacgtc gtgttcggcc agccggtcac    193920
     catggaaacc ggcctgggcg tggaccggct gcgccagcgc gcctacctgg acttcaacct    193980
     gccgcccgac gagcgcgggc gcaaggattc cttcggcctg ctgttcgacc actccgacgt    194040
     gcaggggctg gacgtcacgc gctatgcgct gggcgtcacg cgcctgcagg agcgcaaggg    194100
     cgccggcgac agccgggtcg aatacgagac gcgctggggc ggcctgctgg cgcacgacca    194160
     tgtcaagatc gatggcggcg acgagtacga cctgcccacc gccacgctca cggccgagtg    194220
     gctgcggcgc gacgtcaaca gcaagtacga cccgcgcgag ggcaacctga tcgccgtcgg    194280
     cggcggggtg ggcgccacgc tcgacgatgg ccagccctac atgcgcctgc ggctgcgcgg    194340
     ccagaaatgg tggccgatcg gcaagctgga cgtgctgacc ctgcgcggcg aggtcggccg    194400
     gctctggtcc aacggccgca cccgcgtgcc cgacgacttc ggctttcgca ccggcggcgc    194460
     gcgttcgatc cgcggctacc gctaccagag tatcggcgtg gagcaggacg acgccatcgt    194520
     cggcgcgccc acgctggccg tggccagcgt ggaatacgac cactatttca atgaacgctg    194580
     gggcataggc gtgttcgtcg acgcgggcga cgcggccgaa tccttcggcg acatggacat    194640
     cgccgtgggc tatggcgtcg gcgcgcgcgt gcgcacgccg gccggcccgc tgttcctgga    194700
     cgtcgcgtac ggccagcgcg aacgcgacct gcggctgcac ttctcgttgg ggatcgcgtt    194760
     ttgagcaaga tatggggcgt cgtgcgccac atcctggtct ggtgggtgcc gggcgtggcc    194820
     atgctggccg cgctggcgtg cgggttcgtg ttctggaccg tggcgtcgca aaacggcacg    194880
     cgcctgctgc tcgacaccgt ggcccggcag ctcgacggcg agatcgcggg cgtgcgcggc    194940
     agcgtgctgc gcggcctgcg ggtcgaccgt atccgcctgt cggtggccga cgtggatgtg    195000
     gccgtcgacg acctgcggct ggacgtggcg tggcgggcgc tgggccagcg gctgctgcat    195060
     gtgcgcgagc tggcggccac gcgcgtcgag gtcggcctgc atacgccggc cacgccgccg    195120
     cccgacagcg acgagccgtt cgccctgcgc ctgccggtgg agctggcgct ggaccgtctc    195180
     agcctgggcg aattcgtcct gcgccaggat ggcgagccgc tgcccgtgag cgcgggcgag    195240
     ctgcaggcca gcctggcggc gggccgccac ggcgcgcgcc tgaccctgga cagcctgcgc    195300
     gtgacccatg ccgtgggcac gctgcgcgcg caaggccgcc tcgatgtggc gagcctcgcc    195360
     cagccgtggc cgctgacggc cagcctggat ttgcaggcgc agggcagcgg ccccgaatcg    195420
     ccgctgtgcc tggcgccgct gctcgacgcc agggacaaaa cggccaagga caaggccgcc    195480
     aaggacaagg gcaaggacaa ggacaagggc aaggacaagg gcaaggacaa ggacaagggc    195540
     aaggacaagg gcaaggacaa gggcaaggac gacgccgggg aaaagccgga cgagccggcc    195600
     gacccgtgcg gcctcgcgct gcaggtccag gcgcagggca cgctcgaaca gctggaggcc    195660
     gaactgaccg gcgccggcca ggggctggcc ctggaggcgc gcgccggcct gttgccgcag    195720
     gcgccctttc cgctgcgcac ggccagcctg aaactgacgc gggaggacaa gtccagcctg    195780
     gccgccacgc tggattggca gccgcagccc ggccagcccg gccgcgaccg cgtcgtcgcc    195840
     acgttcgagg ccgagcggct ggacctgcag cgcctggccg gcgaggccat cccgccggcg    195900
     atgctgagcg cgcgcggcgg cctggacgcc gaagtcgacg atctcagccg cctgcaccgc    195960
     gccacgctga cgctggacgt gaccaagggc agcagctgga accgccaccc cctggccggc    196020
     aaggtcgccg ccagcgtgag cgcgctgggc gatcccccgg gggctttcgc cacggccgcg    196080
     ccggcgcagc cgcacgcgct gccgggcggg ctgcgggtcg accagctcga cgtcgacctg    196140
     caactgggcc cgaaccgggt gcgcgcccag ggcaagctgg acgaacgcgc cggcgcgctc    196200
     aagctggacg cgcaggcgcc gcgcctggac gcgttctggc ccggcattcc gggcgcggcc    196260
     agcgtcaagg ccgcgctcga tggcgccctg gcccgtcatc gcggccgcat cgaggccgcc    196320
     tatacgccgg ccgacgcccg cgcgcgcgtg ctgggccgcg cgcgtgcgca ggcgcagctg    196380
     gagttcagcg gcggctgggg ggcggggccg gccgccgagg gcgccgccgc cggctggcgc    196440
     ggctcggtat cgcgcctgac ggccgacagc gccggcttcg cgctggccct cgagcgtccc    196500
     gtcacgctgg cctacgtgcc cgaggcgctt gccccgcaat ggcagtggca ggtcggcgcc    196560
     accaccctgg cgctgacctt ccccgacaag cagcgcgtcg cgctggcgca tgccgcctcg    196620
     cgcggcggcg ccgggcgctg ggaaaccgcg ggccgcgccg acgcgctggt gatcaccgcg    196680
     gccatggtgc gccagatact ggtggcgctg gatcccgagg ccgtggcgcg cgccgagcgc    196740
     gacagcggca gtccggtcaa cgccccggtg ccggcggcgc agcgccgcat ttcgctcgac    196800
     gcctcgtggg acctcaaatt cgccggcgcg ctggccggca aggtccgggt ggcgcggcgc    196860
     gacggcgacc tgcgcattcc gggcgatccg ccgatcccgc tgggcctgcg cacgctggtg    196920
     ctcgaggcca acgccacgcc caccggcggg caggccagcc gcctcgacgc gcggctggac    196980
     atggcgaccg ccaggatggg cgccatcaac ggcaccgcca gcgccacgct gggcggcctg    197040
     gcgctggacc cgcgccagcc gatccgcgtc gccctcgatg ccgacgtgac cgacctggcc    197100
     tggctgggtc tgttcgtcgg cgacacgctg gaggtcggcg gcatgctcaa ggccaatgtg    197160
     cgcgcgcagg gctcgctcga cggcaaatgg aacgccagcg gcacggtcaa cggcgacaag    197220
     ctgcgcgtgg tgcgcatcga cgacggcgtg cggctgatcg acggcacgct gcgcgcgcgc    197280
     ctgcaggacg atcgcgtcat cctggattcc ctgcgttttc cggcctcgct gcgcgtcatg    197340
     ccggccgaat ggcgcacgcg cgagtgggtc agcaccaatc ccgacgccaa gggcggctac    197400
     ctggaggcca ccggccaatg ggagctgtcg gccgcgcgcg gccaggtgcg gctgcaactg    197460
     catcgcttcc cggcgctgca gcgctcggac cgctacggca tggtgtccgg cgtggtgacg    197520
     ctggatgccg cgctgccgcg catctccatc aatggcgaca tcaccgccga cgccggctgg    197580
     gtcagcctgg agatcctgca gggcgtgccg accctggacg acgacgtcaa ggtggtgcgg    197640
     gccggccaga agaacgccca aggcgacggt ccgccgctgc agatcgacat gaacctcaag    197700
     gtcgacatgg ggccgcgctt ctacatcacc ggcatgggcc tggatgccgg cctgctgggc    197760
     tcgatccaga tccgccttca ggaaggaagg ctgaccggct atggcgcgct gcgcacgcgc    197820
     ggcgggggca tcgaggccta cggccagaag ctgcgcctgc ggcgcggcac gctgaccttc    197880
     cagggccggc tggacaaccc gctgctcgac atcgaggcct tgcgcaccgg cgaacaggtc    197940
     gaggcgggcg tgcgggtggc cggcacggcg cagcggccgc gcatcgacct ggtgtcctat    198000
     ccggatgtca gcgacgtcga gaagctgtcg tggctggtgc tgggccgcgg cccggacgcc    198060
     agcggcggcg acacggcgct gctgctgtcg gtcggcacgg cgctgctggg cggcgggcag    198120
     ccgttctaca agcagttcgg cctggacgac gtcagtgtgc ggtccggcgc gatcggcagc    198180
     tccggcagcc tgctgcccga ccgcaccgtg gccgccggcg tcaaccgcga cagcgacgcc    198240
     gacctggcga cgcagttcct ggtggccagc aagcgcttcg ccaacggcat cacgctcagc    198300
     gtcgagcagg cgctggccgg cagcgaaacg gtcgggcgcg ccagctaccg cctggcgcgc    198360
     ggcctgtcgc tggacctgaa ggccggctcg gtcaacggaa tcgcgctggt atatcggatc    198420
     ttgctggatg actgagcgcc aaggcggcgg ccggcggcgg gtagaatacc cttcattcaa    198480
     tcgaggcgcc caaccatgag catcaaaagc gaccgctgga tccgccgcgc ggccgaagcc    198540
     ggcatgatcg aacccttcga gccgggccag gtccgcaccg cgggcggcaa ccgcatcgtc    198600
     agctacggca ccagcagcta cggctacgac gtgcgctgcg cggacgaatt caagatcttc    198660
     accaacatca actccaccat cgtcgatccc aagcagttcg acgagaagtc gttcgtcgac    198720
     ttcaagggcg atgtctgcat catcccgcct aactcgttcg cgctggcgcg cacggtcgag    198780
     tacttccgca tcccgcgcag cgtgctgacg atctgcctgg gcaagagcac ctacgcgcgt    198840
     tgcggcatca tcgtcaacgt cacgccgctc gaacccgaat gggaaggcca cgtcacgctg    198900
     gagttctcca acaccacgcc gctgccggcc aagatctacg ccggcgaggg ctgcgcccag    198960
     atgctgttcc tcgaaagcga cgaggtgtgc gagacctcgt atcgcgaccg cggcggcaag    199020
     taccagggcc agcgcggcgt caccctgccg cgcacctgag cggcggctat tgccaggggt    199080
     cgtacgagcc gacgctccag atatgcccct ccgggtcgcg gcacgaaaag ccgcggccgc    199140
     cgtaatcggc gtcggcaata tcgatcagta tctcggcgcc cgcggcctgc gcgtcccggt    199200
     aggcctggtc ggggtcggcc accaccaggt acacgctttg cgtctccacg ccgccgacct    199260
     cgtcgggctg cttcatgtaa cgggaaaacg gtgtgtccgt caccgacgcc agcatgatca    199320
     tgccgctgcc cagcgtcagc tgggcatgca cgatggtatc ggccgggccg ggcacgatgc    199380
     gttgcgcctc gaacccgaac gcgtgcacca gccattcgat ggcggcgctg gcgttgcggt    199440
     agcgcaggca ggtcacgacg ggtgaggcga cggtggctgg ggctggcatg gcggtctccg    199500
     gttcggcgcg gcgcgttcag ggcgccgcgg cggcgagggc gtcgtagccc tcgcccagga    199560
     actgcaggat gcacacgccg ttgccgtagg ggtcggacag atgcgcgatg cggccccagg    199620
     cgtggctgtg cggcggatct tccagcatag cgccggcggc caccgccgtg gcgaccgccc    199680
     tgtcgcaatc gtccaccacg aaatccaggt gcaccggcgt ccagtggcgc gcgtagtcgc    199740
     gcccctggct cgtgcccgtg gccgcctgcg agccggttgc cttctccagc aggtagatgg    199800
     gcacggcggc gcccgccatc tcgatggcct gcggccccag ccggcgccgc ggacgcaggc    199860
     cgaaggcgcg ttcgtagaac agcgcggccc gcgccgcgtc gggaacgtcg atattgatca    199920
     gtacctgtgc ctgcatggtg tcggctccag tccgggaccg gccctcagcg cgcggccagc    199980
     gggcggatca tgagaatatt ggccagcagg cggccgccca ccagcatcgc gtcgggctcg    200040
     cggccatact cggcgaagcc caggctggcg tacagcgcgt gcgcggcgcc gttgtcggcg    200100
     cccacgctca gcagcacgtg gcgtaccccg gtcatccggg ccgcccgtgc cagcagcgcc    200160
     tcggtcaatt ggcgcgccag gccgccgcgg cgttgcgcgg gtacaacgta aataccccag    200220
     atttcagcct tgtgacgttg tttcattgtg tgcccgcgcg ccacgccgcc gaccccggcc    200280
     agggcgccgt ccacgaaggc gcccagcagc acgtaaccct cgcgcggggc aaggcgggcg    200340
     cgccattgcg cgattgtgtc aacgctttct tcttcgtaac tggacccgaa ggcttcgggc    200400
     gcctcgcgca gggcggccag gcgaacgcgt tgaaattctg cagcatcctc gggcgtcaaa    200460
     gggcgtatgg tggaaagatt cacgtctggc tccgcagcgt acgcgcaggg tggcggcagg    200520
     gttgcgccca atataatgaa gatacgtgaa aagcgcggct gtttcgcggc gcaggagccc    200580
     cagatgttcg gtttccgcag gaaagacacg cagcagtacg accaggaggc gcaggacgcc    200640
     ttcgtcgaac gggtcgccgc ggcggcgcgc gatttcgtgg ccgccgtccc cgccggggcg    200700
     gggctggact actcgccggc cagcatcgcg gcgctcgacg ccgtgctcga acaggcccac    200760
     ctgggcgccc tggcgctgga cccggtgcaa cgggtggggg cggccgccta cctgtacgag    200820
     gtggcgcggc gtcgccacgg cgggctgtac gaggtctgcg acgacgacga tccggtggtg    200880
     ctggtgaccg gcgagcccga gttcgacgtc tgcctgtgcg ccatcgccaa ggtcgagcgc    200940
     cgcatcgacg ccggcccgca ggaagacctg cggccgtttt tcggccgcta cgagcaggcc    201000
     gtcgcggcgc gccggcccga catcattcgc tgacgccgcg cgccggcggg cgcacccgct    201060
     ttcaatccgt cctacaattc cccgaggtcg gcccgctcgt cgggccggtt gcttttttgt    201120
     caccagcccg accccgtctg gcagtacact cgcgtccgtt ttgccttgcc cgcccaggag    201180
     cgcccgcatg aaattccgct tccccatttt catcatcgac gaagactatc gctccgagaa    201240
     cgcctcgggg ttgggcattc gcgcgctggc ttcggcgatc gaggccgagg gcgtggaggt    201300
     catcggggtg accagctacg gcgacctgag ctcgtttgcc cagcagcaaa gccgcgccag    201360
     cgccttcatc ctgtcgatcg acgatgagga gttcgacgtc gattctccgg aagacgtggc    201420
     gggcgcgatc aagaacctgc gcacgttcat cggcgagctg cgtttccgca acgccgacat    201480
     ccccatctac ctgtacggcg agacgcgcac gtcggaacac atcccgaacg acatcctgcg    201540
     cgagctgcac ggcttcatcc acatgttcga ggacacgccg gagttcgtgg cgcgccacat    201600
     catccgcgaa gcgcgcagct acgtggacgg cctgccgccg ccgttcttcc gcgagctggt    201660
     caaatatgcc caggacggtt cgtattcctg gcactgcccg gggcactcgg gcggcgtggc    201720
     gttcctcaag agcccggtgg gccagatgtt ccaccagttc ttcggcgaga acatgctgcg    201780
     cgccgacgtc tgcaacgcgg tcgacgagct gggccagctg ctggaccaca ccggcccggt    201840
     ggccgagtcc gagctgaatg ccgcgcgcat tttccatgcc gaccactgct tcttcgtcac    201900
     caacggcacc tcgacgtcga acaaggtcgt ctggcatgcc aacgtggccg ccggcgacgt    201960
     ggtggtggtg gaccgcaact gccacaagtc gatcctgcac gccatcacca tgaccggcgc    202020
     gatcccggtg ttcctgcgcc ccacgcgcaa ccacctgggc atcatcggac cgatcccgct    202080
     cgacgaattc gacccggaaa acatccgccg caagatcgag gccaacccgt tcgcgcgcga    202140
     ggcgctgaac aagaagccgc gcatcctcac gctgacgcag agcacctatg acggcgtcat    202200
     ctacaacgtc gagatgatca aggaaaagct gggcacctac gtcgacacgc tgcatttcga    202260
     cgaggcctgg ctgccgcacg cggccttcca cgagtactac cgcgacatgc acgcgatcgg    202320
     cccggaccgc ccgcgcagcc aggacgccat ggtgttcgcc acgcactcca cgcacaagct    202380
     gctggccggc atctcgcagg cctcgcagat catcgtgcag gagtccgaga gccgcaagct    202440
     ggaccgcaac ctcttcaacg aggcctacct gatgcatacg tcgacctcgc cgcagtacgc    202500
     gatcatcgcg tcgtgcgacg tggccgccgc catgatggag ccgccgggcg gcaccgccct    202560
     ggtcgaggaa agcatccgcg aggccatgga ctttcgccgc gccatgcgca aggtggcctc    202620
     cgagttcggc aaggacgact ggtggttcaa ggtgtggggc cccaaccgcc tcgcgcccga    202680
     gggcatcggc catcgcgacg actgggtgct ggagtcgggc gaccactggc acggctttgg    202740
     cgacctggcg ccgggcttca acatgctcga cccgatcaag gccaccatca tcaccccggg    202800
     cctggacatg tcgggcagct tcggcgaaag cggcataccg gccgcgctgg tgtcgaagta    202860
     cctggccgag cacggcgtcg tggtggagaa gaccggcctg tattcgttct tcatcctgtt    202920
     caccatcggt atcaccaagg gccgctggaa caccctgctg accgcgctgc agcagttcaa    202980
     ggacgactac gaccgcaacc agcccctgtg gcgcatcctg cccgagttct gccgcggtca    203040
     ccgccgctac gagcgcatgg gcctgcgcga cctgtgccag cagatccacg aggcctatcg    203100
     cgaacgcgac gtggcgcgcc tgaccaccga gatgtacctg agcgacatgg tgccggcgct    203160
     caagccctcg gacgccttcg cccgcatggc gcaccgcgaa gtcgagcgcg tcgagatcga    203220
     ccagctcgaa ggccgcgtga ccggcgtgct gctcacgccg tacccgccgg gcattccgct    203280
     gctgatcccg ggcgagcgct tcaaccggac catcgtgcaa tacctgcagt tcgcgcgcga    203340
     gttcaacgag cgcttccccg gcttcgagac ctacatccac ggcctggccg acgaagaggg    203400
     ccccgatggc gccaagcgct attacgtcga ctgcctgaag gacgccggcg agcagtaaat    203460
     ccgacgcgcc gcgccgcccg agggggcggc ccggcgcggc gttgtcttcg agggagtatc    203520
     ccgtttcgat gttcgatgtc gccgtcatcg gcgccggggc cgccggcatg atgtgcgccg    203580
     ccgtggcggg ccagcgcggc ctgcgcgtgg tgctgatcga tcatgccgcc aagctggccg    203640
     agaaaatccg catctccggg ggagggcgct gcaacttcac caacctgggc gccggcccgg    203700
     ccaatttcct gtccgacaac ccgcatttct gccgctcggc gctggccggc tacaccccgc    203760
     aggatttcct cggcctgttg cgccgccatc gggtgcattg gcatgaaaag catcgcgggc    203820
     aactgttctg cgacgacagc agcgaaacca tcatcgaggt gttgcgcgcc gagtgcgggc    203880
     agggcggggt ggcctggcgc atgccgtgcc gcgtggacga gatcgcccgc cgcgagggcg    203940
     gcggcttcac gctgcgtacc agcaccggcg cgatcgacgc gcgcgcggtc gtggtagcca    204000
     ccggcggcat ggcgatcccg caactgggcg cgaccgacta cgcgctcaag gtggcgcgcc    204060
     agttcggcct gaaggtcgtc gagccgcggc cggccctggt gccgctgacc ttcgatcccg    204120
     cgcaatggca gccgttcgcc gcgctgtcgg gcgtcgccct ggaagtcacg ctgtcgaccg    204180
     ggcagggcaa ggggcgcgcg gcgttcctgg aagacctgct gtttacccac cggggcctgt    204240
     ccggccccgc catcctgcag atatcgagct actggaagcc gggcgagccc atcgtgctgg    204300
     acctggcgcc cggccgcgac ctggccgccg aactgatagg cgccaagccg ggcaaccggc    204360
     agcagctgca taccgtgctg gccggcctgt ggccccggcg gctggccgat acctggctgg    204420
     acgtggccgg gcgcgccgtc ggcgcggacc tggccgccgc gcgcctggcc gacgtgccgg    204480
     accgcacgct gcgggcgctg gcggcgctga tccatgactg gcgcctggtg cccagcggca    204540
     cggccggcta caagaaggcc gaagtgatgc gcggcggcgt cgacacgcgc gccctggacc    204600
     agaagtccat gcaggcgcgc ggcgtgccag ggctgtactt catcggcgag gcggtcgacg    204660
     tgacgggctg gctgggcggc tacaacttcc agtgggcctg ggcgtcgggg tacgcctgcg    204720
     gcaacgccct ctagcctggc gggcacggcg catgcgggca gggccgcgcg cctattgttt    204780
     tggtaaatgg aaatgactat catttgtctt taccaaatgc aaatgccgga gaccgcatgc    204840
     catacgtcct gcctgccctt tcgtatgcct acgatgcgct cgagccgcat atcgatgcac    204900
     gcacgatgga aatacaccat acgcgccatc accagaccta cgtcaacggc ctgaacgccg    204960
     cgctcgaagg cgccggcctg gacagcgagg agccggtcga gcaactgttg cgccgcatcc    205020
     cggcgctgcc gccgggcatc cacggcgcgg tgcgcaacca cggcggcggc catgccaacc    205080
     acagcctgtt ctggaccgtc atgtcgccgt cgggcggcgg ccgcccggat ggacggctgg    205140
     cggccgacat ccaggcccag ctgggcggac acgacgcctt ccaggcggcc ttcacgcagg    205200
     ccgcgctggg ccgattcggc agcggctggg cctggctgac cgtcacgcct gccggccgcc    205260
     tgcgggtcga cagcagcgcc aaccaggatt cgccgctcat ggagggcaac accccgatac    205320
     tcggcctgga tgtctgggag cacgcgtatt acctccagta ccagaaccgc cgtcccgaat    205380
     acatcgaggc cttctaccgg gtggtggact gggccgaagt ggcgcgccgc tacgagatcg    205440
     ccctggccga gctcggccgg gaggccgcat gaatacccac agccgccacc gcgtccgtcc    205500
     ggcgctcacc agcgtcagcg ccatgaccct ggcggtgctg gtggcctgcc tggcctgcta    205560
     ccagctgtgg gagttcctcg accggcgctg gccgcacgtc gccctggcca tggccggcgg    205620
     catggtggcc gccggcgcca ccgcgctggg cgcggtgccg gtgctcttct cccagaccct    205680
     gtcgcagcgc gtgcaggact gcatgttcgg cttcggcgcc ggtgtcatgc tggcggccag    205740
     cgccttctcg ctggtggcgc cgggcatcgc cgcggccggc gcgcagggct acggcccctg    205800
     gggggcgggc atcctggtgg gggcggccat cctgctgggc ggcgcggtcc tgctggccag    205860
     cgacaggctg ctgccgcacg agcacttcat caagggcaag gaagggcgcg cctcgcgcac    205920
     cctgcgccgc acctggctgt tcgtcttcgc catcatgctg cacaacgtgc ccgaaggcct    205980
     ggccatcggc gtgggctacg cgggcagcga cagcctgcgc ggcgcggcgc tggcaaccgg    206040
     catcgccatc caggacgtgc ccgaagggct ggtggtggcg ctggccttgc tggccgccgg    206100
     ctacggccgt gcgttctcgg tggcgctggg catgctgtcc gggctggtcg agccgctggg    206160
     cgccatcgtg ggcgcggcgg tggtgggctg gtcggcggcg atgctgccgt gggggctggg    206220
     tttcgcggcc ggcgccatgc tgttcgtcat cagccacgag atcattcccg agtcgcaccg    206280
     caaggggcat gaggtgccgg ccaccgctgg cctgatgctg ggattcgtgc tgatgatgct    206340
     gctcgatacc gcgctgggct gaggcgccga aacaggggcg gatcgctgcc catccggacg    206400
     ctttgcggca tggcgctttc gatgtatgct ttgcgcgctg tcacgcatgt cgcgggagag    206460
     agcggccgat tgcggctgcc gccgaaggcg caattcgccc ggaatcgctc aggtaaccca    206520
     taccgcgact gcatcgagta gcgcctggcg cgctcgaaac agcactctgg agagacctgg    206580
     cgcggccacc ttcgcggtgc gcaagcagcc caggcgccga aggtgcaaac ccgctcgcgc    206640
     ggggcaactc tcaggcaaaa ggacagaggg gcggaaaatt cgaccggttc ccggacgctt    206700
     tccgcatcgg ggccggcatt ccgtaatcct ggcaatgctg ccgctggagc cctcgcatgt    206760
     ccgcaccgct caaacgcacc cccttggccg aagaacatct tgccgccggc gcccgcatgg    206820
     tcgacttcgg tggctgggac atgccgctgg cctatggctc gcaactggaa gagcaccacg    206880
     cggtgcgcca ggacgccggc atgttcgacg tctcgcacat gctcaacgtc gatgtcggcg    206940
     gcgccgacgc caccgccttc ctgcgccgcc tggtggccaa cgacgtggcc cgcctggcca    207000
     cgccgggcaa ggccctgtac agctgcatgc tgaacccgca gggcggcatc atcgacgacc    207060
     tcatcatcta ctacttcgcg cccgaccaat ggcgcgtggt ggtcaacgcc ggcacggccg    207120
     acaaggacat cgcctggatg cagcgcgtgg ccgccgccga cggcttcgat gtcgcgatcg    207180
     cgccgcgccg cgacctggcc atggtggcgg tgcagggccc caacgcccgc gccaaggtgt    207240
     gggcggcccg tcccgcgtgg caggcggcgt ccgagccgtt ggcgccgttc tcggccgcgg    207300
     ccgtcgaggc cggcacgctg gtggcgcgca ccggctatac cggcgaggac gggttcgaaa    207360
     tcgtgctgcc cgccgacgcg gtggtccagc tgtggcgcga cctgctggcg cagggcgtgc    207420
     ggccctgcgg cctgggcgcg cgcgacacgc tgcgcctgga ggcgggcatg aatctctacg    207480
     gccaggacat ggacgaactc gtccatcccg accaggccgg cctgagctgg accgttgcgc    207540
     tcaaggacga ggcgcgccgc ttcgtgggac gcgatgccat cgagcagttc gccgtgccgc    207600
     gcgccttcgt cggcctgaag ctgcaggagc gcggcgtgat gcgcgcccac atgccggtgc    207660
     gctgcgcgca gggcatgggc gagctcacca gcggcaccat gtcgcccacc ctgggcgtgt    207720
     cggtgggctt tgcccgcgtg ccggtgggcg tgcagcccgg cgacgccgtc gaggtggaaa    207780
     tccgcggcaa gtgggtgccc gccctggtat gcaaattgcc gttcgtgcgt cacggcaaag    207840
     ccgtcgaaca ctcgtaaact cgaggcttcc gcgcggccgc tggccgccgg aggcgcgcaa    207900
     actttctcca ttcccaccga attgccagag gagctcccat gagcctgccc accgatcgca    207960
     agtacaccga gtcccacgaa tgggtccaag ccgaaggcga tgtgttcgtc gtcggcatca    208020
     ccgacaacgc ccaggagcag ctgggcgatc tggtcttcgt cggcgacgtc aaggtcggcg    208080
     ccacgctgaa ggccggcgaa accgccggcg tggtcgagtc ggtcaaggcc gcctcggaca    208140
     tctatgcgcc ggtcgacggc gagatcgtcg cgttcaacga cgaactcgaa gccaacccca    208200
     gcctgatcaa cgaatcggcc tataccgcct ggatcttcaa gatcaagccg gccaacgcgg    208260
     ccgacctgga caagctgctt gacgcggccg gctaccaggc cgtcgccggc tgacaggccg    208320
     caacgggccg gcccgcgggc cggccccgcc tccccgttat ttcgagaaaa ccatgtcgcg    208380
     cgcccctgac acccattccg atttcattcc ccgccatatc ggcccctccg acgaggacca    208440
     ggccaccatg ctggccgcca tcggcgcagc cagcctggat gccctgatcg acgaagtcgt    208500
     gccgccccgc atccgcagcc gcgcgccgct ggcgctgccc gccgcgcgca gcgaaacgga    208560
     tgtgctgcag gacctgaagc ggatggccgc gcgcaaccag atctaccgca actacatcgg    208620
     ccagggttac tacggcacgc acacgcccaa cgtggtgttg cgcaacgtgc tcgagaaccc    208680
     ggcctggtac actgcctaca cgccgtatca gcccgaaatc tcgcagggcc gcctggaggc    208740
     gctgctcaat taccagacca tggtcgccga cctgaccggc ctggacatct ccaacgcctc    208800
     gctgctggat gaaggcaccg ccgcggccga ggccatgacg ctggcgcgcc gcggcagccg    208860
     ttcgtccagc ccggtgttct tcgtgtcgca gcactgccac ccgcagacgc tcgaagtggt    208920
     gcgcacgcgt gccgagggcc tgggcatcga actggtgatc ggcgacgagt cgcgcgggct    208980
     gcccgaatgc ttcggcgtgc tgctgcagta tccgcacagc ctgggcggcg tggccgatta    209040
     ccgcgaactg gcgcaagccg cgcacgcgca gggcgccgtg gtcgcctgcg tgactgacct    209100
     gctggcgctg gcgctgatcg agccgccggg gcaatggggc gccgacatcg ccgtgggttc    209160
     ggcgcagcgc ttcggcgtgc cgttcggctt cggcggcccg cacgccggct tcatgtcctg    209220
     ccgcgatgcg tacaagcgca acatgcccgg ccgcctggtc ggcgtctcga aggacgccca    209280
     gggcaacccg gcgctgcgcc tggccctgca gacgcgcgag cagcacatcc gccgcgagaa    209340
     agcgacctcc aacatctgca ccgcccaggt gctgctggcc gtgatggccg gcctgtacgc    209400
     cgtgtggcat ggcccgcgcg gcgtgcgccg catcgccgag cgcgtgcaaa gcctcaccgg    209460
     cgcgctgcgc gccgcgctgg ccgggctggg cgtgaaagtc gccaacgaca cctggttcga    209520
     cacgctgttg ctggaaaccg gcgtggccac cccggccatc ctggccgccg cggattgcgc    209580
     ccggatcaac ctgcgccagg tcgatggcgc gcgcctggcg gtgtcgctgg acgaaaccgt    209640
     gaccctcgcc gacctgcagg ccctggtcaa cgtgttcgcc gccggcctgg gcaaggacga    209700
     ggtggcgctg ccggcgccgc aggcgtcgct ggacggcatc ccggcggcgg tgcgccgcca    209760
     ggggcccatc ctgtcgcacc cggtgttctc cagcgtgcag tccgagaccg acatgctgcg    209820
     ctacctgcgc aagctggccg acaaggacct ggcgctggac cgcaccatga tcccgctggg    209880
     ttcgtgcacc atgaagctga acgccacggc cgaaatgatc cccatcacct ggccggagtt    209940
     cgcgctgatc cacccgttcg cgccggcctc gcagacgccg ggctatcgcg agctgatcga    210000
     cggcctgtcg gcgcagctgt gcgaaatcac cggctacgac ggcatcagcc tgcagcccaa    210060
     ctcgggcgcg cagggcgaat acgccggcct gctggcgatc cgcgcctacc accaggccaa    210120
     tggccagccc cagcgcaatg tctgcctgat cccggcctcg gcgcacggca ccaacccggc    210180
     gtcggcccag ctggccggca tggacgtggt ggtggtggcg tccgacgcca acggcaacgt    210240
     cgacctggcc gacctgcgcg ccaggatcgc gcaagtgggc gaacgcctgg cggcgctgat    210300
     gatcacctat ccctcgacgc acggcgtgtt cgaggaagcc gtgaccgaaa tctgcgacgc    210360
     ggtgcacgag gccggcgggc aggtctacct ggacggcgcc aacatgaacg ccatggtcgg    210420
     cgtggcgcag cccggcaagt tcggctccga cgtctcgcac ctgaacctgc acaagacctt    210480
     ctgcatcccg cacggcggcg gcgggccggg cgtgggcccg gtggcggtgc gcgcgcacct    210540
     ggcgccctac ctgccgggcg tgctcgacgc ccagggccgc ctggaccccg aggccaaggt    210600
     cggcccggtc tcggccgcgc cgtatggctc ggccggcatc ctgccgattc cctacgtgta    210660
     catcgcgttg atgggcgccg agggcctgcg ccgcgccacc gaggtggcca tcctcaacgc    210720
     caactacatc gccgcgcgcc tgcgcgacca ctacccggtg ctgtatgcgg gccgcaacgg    210780
     ccgcgtggcg cacgagtgca tcctggacgt gcggcccctg aaggaaacca gcggcatcag    210840
     cgccgaggac atcgccaagc gcctgatgga ctacgggttc cacgcgccga ccatgagctt    210900
     cccggtggcc ggcacgctga tggtcgagcc caccgaatcc gaaggcctgg ccgagctgga    210960
     gcgcttcatc gaggccatga tcgccatccg cgccgagatc gcacagatcg aaagcggcga    211020
     acgcgaccgc gacgacaacg tgctgcgcaa tgcgccccat acggcccaga tgctgctggc    211080
     cgaggaatgg caccacgact atccgcgcca gcaggccgcc tatccggtgg cgtcgctgcg    211140
     cgagaacaag tactggccgc cggtggcgcg ggtggacaac gcctatggcg accgcaacct    211200
     ggtgtgcgcc tgcctgccgg tggaagccta cgcgtaagcg gtgcgcgctc atggcgcatg    211260
     acgaggagcc ggcccccgca tggggactgg caccggcaag atttcatggc gtctgcccgt    211320
     gcgtgtgcct gtccccgctg ggacaggcac actgccgtac gccatccggg gtgcctgtcc    211380
     ccgcaggggg actggcaccg gcaagatttc acggcgtctg cccgtgcatg tgcctgtccc    211440
     cgctgggaca ggcacattgc cgtacgccat ccggggtgcc tgtccccgca tggggactgg    211500
     caccggcaag atttcatggc atctgcccgt gcatgtgcct gtccccgctg ggacaggcac    211560
     actgccgtac gccatcgact cttgccggcg atcacgccga aggcgtgagt cccagccgct    211620
     cgtagtgttc ctggtagccg gcgacgtggc gctccatgcg gcggcgggcg gccggcgcgt    211680
     cgccggcgat gacggcgtcg actacgcggc ggtgcgactg caggatgagg cgccgggtgg    211740
     gttcgggcgt ttgcccttcg cggctggtcg ccgccaggat caggccggcg atggacacga    211800
     tgaacgcgcg caacaggtcg ttgtggcagg cgtcggccag cgcgaagtac cagcgcacgt    211860
     tgagatccag gaactgttcc acgcggggca gggcctcctg cagcaggtcg gtcgcctgta    211920
     tcagcgcctg caggtcttcg ggcgtgcggc gcagcgcggc gagttcggcg atggtcggct    211980
     cgatggcgac gcgggcttcg atcatctcct gcagcgagat gccgcgcgcg cgggcaaaca    212040
     gcgccacggg gcgggccagc gcgtcgttgg ccggcagctt gacgaccgag ccgccatagc    212100
     gcccctggcg ggtttcgatc aggccttcgc tttccagcac acgcagcgcg tcgcggaccg    212160
     cggcgcggct caggccggtc tcttcggtga gctcccgttc cgaaggcaag gccacgccgc    212220
     tggggcgggc gccgctgagg atctgttcgc gcagggcgtc ggccagcagg tcgcgcgaac    212280
     gcacggcctt gatcggaccc agcggattag ggtttgtctc tacggttttc atcgctgcag    212340
     ccattgtaca gcgtttggtt atccatataa tggtcaacca ttgaactttt aatcgagcat    212400
     catggctgca gtctcttctt ccgtgccgcc caccccgctg ggcggcgtgc gcgtgctgga    212460
     cctgtccaag gtcctggccg ggccgctgtg cacgcaatac atggccgaca tgggcgccga    212520
     cgtgatcaag gtcgaagcgg ccgggcaggg cgacgatacg cgcggctggc cgccgttcca    212580
     ggatggccag gcggcggtgt tcctcagctg caaccgcaac aagcgcagca tcgcgctgga    212640
     cctgaagtcg gcgcacgggc gcgccgtggt gcagcggctg gccgcctggg ccgacgtggt    212700
     ggtccacagc ttcggtccgg gcgtggcgca aaagctgggc gtcgattggg aggccctgtc    212760
     cgaaatcaat ccccgcctcg tgtactgcgc catctccggt ttcggcccgg tcggcagcct    212820
     gagccacggc aaggggttcg atgtggtgct gcaggcgttc tgcggcatga tctcgatcac    212880
     cggcgagacc gagggcggcg cggtgcgcag cccgttctcg ccggtggacc aggccaccgg    212940
     cctgcatgcc ctgatcggta tcctggcggc cttgcgccag cgcgacgcca gcggccgcgg    213000
     cgtcaccgtg gacgcctcgc tgttcgatac cgcgctcggt ttcatgggct acttcatgca    213060
     gggttactgg gcccgcggca ccgagcccgc gcgcgcgggc gccgggcacg agtcgctgtg    213120
     cccgtaccag gatttcgcga ccgccgacaa gcccatcatc ctgggcatcg ccaacgatgc    213180
     gctgtggcgc gccttctgca ccctggccgg gcgtcccgaa ctggtcagcg acccgcgctt    213240
     tgccaccaac gcgcagcgcg tggccaaccg cgcgcagacc ctggcggcca cgcgcgaact    213300
     gctggcggcg cgcacgcgcg gcgaatggct gcccgcgctc gagcaggccg gcatcccctg    213360
     ttcccccatc catacgctgg ccgaggtcga tgcgcatccg cacacgcgcg aatcgggcat    213420
     ggtgttcgac taccccgaga ccggcgccga taccgggccg ctcaagggcg tggcccagcc    213480
     ggtgcgcttt gacggcatgc gcctgaccac gcccaagcgg ccgccgagcc tcaatcagga    213540
     ctgggcgtcg gtgctggccg acgccggcta ctccgatccg gaagtccggg atctattgca    213600
     acagatggcc tgaaagagcc atcccactcg tacaaggaga catgatgaat gttttgatac    213660
     gccgcgccct gtgcgccgcc atcgcctcgc tggcggccgc cgccgcgcac gccgcctatc    213720
     ccgaacagcc ggtccgcatc gtggtggcgt tcgcgcccgg cagcggcacc gacaacgttg    213780
     cccgctacta cgcgacgcgc ctgagcgagg aactgaagca gcccttcgtc gtcgagaaca    213840
     agcccggggc caacggcagc atcgcggcca cgcaggtggc ccgtacgcag cccgacggct    213900
     acaccctgtt cctggggtcg aactccacgt tgtcggccgc gccgttcctg ttcaagaagc    213960
     tgccgtacga gccgctcaag gatttcacgg ccgtcgcgcg cctgtccgat atcccgtcca    214020
     tgctggtggt cggcgccgat tcgccgatcc gcgatttcga ccaattcatc ggcaaggcgc    214080
     gcgccgagcc gggcagggtg acctgggcca acgccaatac ggcccacctc gccgcaggca    214140
     tggcgctgac caagcaggcg cagctggaca tgatttcggt gccctacaag agcagccctc    214200
     aggcgctgac cgacgtgatc ggcggccagg tcacggccat ggtcgtcgat acctccgcgg    214260
     gcaccgcgtt cgtgcagcag ggcaaggtgc gtgcgctggc ggtgaccacc gcccgcccgg    214320
     tggcggccat gcccggcgtg cccagcatga gcgagcgctt tcccggcatc gacgtctact    214380
     cctggctggg catcgtgggc cctgccggca tgcccgacga ggtggtgagc gtggtcaacc    214440
     aggccatcct gaagatcaac gccagcgagg acacggtccg cttcctgcgc gagaacgccg    214500
     gcgcggaacc gccgccgtcc tccagcccgg ccgagttcac gcagttcatg cacgcgcagc    214560
     tcgaggtgtg gcgcaagctg ttgcgcgacg ccaacgtgga acccatgtga gccagcagga    214620
     gagccgcatg tccgcacccg cctgcgtgtc cgagttcgtc cgctacgacg tcgacgcggg    214680
     ggtggcccgc atcacgctcg accggccgga tcgccgcaac gctatcgacg ttcccatgcg    214740
     tgcggccctg ctggccgcgg tccaggccgc cacggccgac ccggcggtgc gcgccgtcgt    214800
     cctgaccggg gcgggcggcc atttctgcag cggcggcgac gtctcgacca tgcgcggcgc    214860
     gtccatgagc gccgagcagg ggcgcgaccg gatggcgccg atcggcgcct gcgcgcgggc    214920
     cttgctggaa atgcccaagc cggtgatcgc cgccgtcgac gggatcgcct ttggcggcgg    214980
     cttcggcctg tgcctgtgcg ccgacctggt gctggccacg ccggcggcgc gcttttgcct    215040
     gtcgttcatg cggatcgggc tggtgcccga tttcgccgcg gcgttcacct tgccgcgcct    215100
     ggtcggcctg cagcgcgcgc gccagctgat ctacaccgcg gccgagatcg atggccgcca    215160
     ggcgctggaa tatgggctgg tgagcgagct ggtcgatgcc ggcaggctgg cgccgcgcgc    215220
     cgcggaggtg gccacggcca tggccggcat gcccgccacg gcgttcgccc tgaccaagca    215280
     ggcgctgctg cgttccagtt cgagcgaact ggcggccatg gtggagatgg aaatgacctc    215340
     gcagggcgtg gccttcaaca ccggctacca ccagcaggcg gtggaacgcc tgctggagaa    215400
     aaagccgccg ctgtattcct ttcccgcccc gacggcctga aggcgcgatg gcggcccggc    215460
     cggccgagcc ggcgcgggct gccgccgcgt tcaacgcgcg gcgtagacct cgtcttcgaa    215520
     gttcccgacc atctgcatga aggtattgac catgatggag aggttctcgc ggcccacgcc    215580
     gccctcggcg ctgaggtcca tgcgcagcac ggcctggttg tcgtcgtcca ggtaggcgcg    215640
     cgtccagcgg tatttctggt tccaggcatt gagcgccttg agcgaggtct tgcgcttgcc    215700
     gaaactggcc ttcatgctca cgtccatgca ctcgtcgtcg tcgatgcaat acagctcggc    215760
     gcgcaggtcg cgcaagggca ggccgttggc gtcgatgacg atcaccgggc cggacgcgcc    215820
     ttcctcggtc gtgctgtcgt agccgccttc ggccaggatg gacgtcagca ggccggcgtt    215880
     gacgctgcgc aggctgtcgc cctcggtggc ccaggcggcg gcgtcggcgg cctcctgggc    215940
     ggcctcggcc gccgctgctt cggcggccgc ttccacggcc tcggaggccg cctcggcgct    216000
     catcgccgcg tcgtcctcgt ggttgtgctc gtcgtcgtcc aggctggcgc tggcgctgtc    216060
     gtagaggttg tcgaacagct cgttgaccgg cacgtcgcgg ccgttcagct tggccacccc    216120
     ggccgcatag gtgaaggtgc cgaccagctt gtcgccgtcg ttgcggccga tgttcaggat    216180
     ttcggccatg ccggcgaagg cgtcgatggt ctcgtcggct tccttggcgg cttcctcggg    216240
     tgtcttgccc tggctggtct cgtagtggat cgccaggtcg cgcaccatcg gcttggatac    216300
     caccatcttg acgtcgatcg ccttgactgc ctcttcgaga tactcgcgcg gcgtcagctc    216360
     gccgctcgtc gttgccggct tgaccaggac gatcgaggac atcaggctgc tttcgccctt    216420
     ctcggtcctc caggccacgg gacccaggct cagcgagggg ccgccggcca gcaggcggcc    216480
     gccgttctcg atcagcatcg tgagctgctc gtccttcagg ccctcgtcgg tttcgccggt    216540
     ggcgaaatag ccacgcagca gctggttgta gccatcgctg agcgccttga gcgcctggcc    216600
     gtccagccgg ctggccttca cgttcagttc gccgctgcca aagggtatct tgttgaccgt    216660
     cagggggccg gtcttgtagg cggcttcgat gtcgatgtaa tcgccatcct cggtggccag    216720
     ggcgcgatag ctcaggtcgt ccagcgagat atcgagcgat tcgcgcttgt cgatcatcgc    216780
     gatgcgcttg atggccatgg tgctttcgcc cagcgtgaag ccatgcttgc cctggtggct    216840
     gcgcatgtcc acgctccagc cggtggcgct catctgcgta tcctggtcgc catcggcggt    216900
     aaagcgcacg tactcggcgt ccaggcgcgc cgtgcccgag cgggtggcgc gctggaaggt    216960
     gccggtgagc gtggcgccgc tgaacgacag cgttacgtcg tcctcggtga aatcgatggg    217020
     cgccaggccg ctgcgggtgc tggcgttgcc gctgtaggac acgatggtgt cgctccacag    217080
     cggggcggcg ttcttggtca gttcgaacag cggcttgacc agctcggtcc gggccagctc    217140
     ggcgtgcacg aacgccattt gcggcaggaa ctggccgctt gccagggcag aacgggggaa    217200
     ggggccgtgc tcgaagcggg cgtcgaactc cgtcgagccc agcggcaggg gcgtgaccgt    217260
     gccggattcc tccttgatgt cctgggacag cgacaggccg tagcgggcct gcgtggtgaa    217320
     gaagccgcgc tcgtacttga gctggtcgac gcgcagcgtg tagccgggca ccaccgcggc    217380
     cagcttctcg ttcagcacgc ccagccgctg ctgcgtttcg gtctcgatcc gcttgcccgt    217440
     ataccaggtg ccgcccagcc agccgccggc cagcaccacg atcacgccgg cggtgatgcc    217500
     tatgctcttc ttcatcgtat ggattaccta aagggttgtt tttccgccgg gccatccccg    217560
     ggcaggactc tgccctcggg atggcggcga gcccgcgcaa aacgggcgcg ccgccgcgaa    217620
     cgggcggcgc gcgggacggc gctcagccgc ccaggatgct gcccagcagc tggtcggcgg    217680
     gcatcttgcg gccgttcagg tccaccgtgc cggcggcgta gtggaacttg ctgacgatgt    217740
     tgtcgccctc gttcttgccg aggttcatca tctcggccat gccggccagc gagctgacct    217800
     gctggtcggc cgcggcggcg gcctgctgcg cgtccatgcc ttcctggctt tgcaggtagc    217860
     cgaccatcag cgccttgatc atgggcttgg acagggtggc ggaggcgtcg atcgactcga    217920
     tcgcctggct gaagtagtcg accgccatga ggtcgctgga ggcgggcttg ctcagcgcga    217980
     ccctggcgtt gaaaacgctt tcgccctggg ccgtcttcca ttgcaccggg tcgagcgtga    218040
     gcaccggctt gccggccagc agcgtgtcgg cctgcgccat cagcagcttg cgcatctcgg    218100
     cgttgtcggg caccgggtcc ttgccctcgg cctgcagctt gatggccttg ttgtattcgt    218160
     cggccaccac cttgatcgcc gcggcgttca ggcgctcggc cttgaatacc gcccggccgt    218220
     tgcccagcgc gatgccgttg taggtgatct cgccggcgcc gtagctgatt tcgccgttga    218280
     tgaattcgtc ctgctcgccg atcctggcgg cataggccat gtccgccacc gtgaggtggg    218340
     catcgccttc cggttgcttg acttccaggc gcttgaccga cagggcgctg tcgccgatcg    218400
     acaggccgga cttgcccatg cggctgtcca ccgtcacggc caggccgtcg agcgtgaaca    218460
     gcagcgggcc gccgtcgtcg tccgcgctgg cgtccagcgc caggctgtcg gccttgagcg    218520
     agccgatcgc cgcctgcgtg gcgcgctggt agctgccgtc gaaggtcgcg ccgctgaacg    218580
     cgaacttgcc ttcgtcgccg ctgtagtcga tggcggccag cccgccggtg ctggtcgagt    218640
     cgccgttata ggcgaccacc gtgtcgctcc acagcggcgt ggcgcccttg gtcacttcga    218700
     agactttctt gaggtcttcg gtgttggcca cttcggcatg cacgaacgcc agctgcggca    218760
     tcagcttgcc gcgcgccagc gcgccgggcg cgaacgggcc gtgttcgata cgcgcatcca    218820
     cttccacggt ggcctcgggc ttgccggttt cctccgactt gccgacttcc acgccgtagc    218880
     gcgcctggga cgtaaagaag ccgcgctcca gcttgagctg gttgatgcgc acgggaaact    218940
     cggggaaagc ggccgcgagc tgggcgttga tttcgttcag gcgggtctgc gactccgttt    219000
     cgatacgctg gcccgtatac caggtgccgg ccagccagcc gcccaccgcc acaatgatca    219060
     cgcccgtggt gaccgctacc gatttcttca tcttctatgc cttatggaag tgcggccatg    219120
     ccacgcgcac gggccgctta tatgcgtagc ccgaaggctg gcggcgagta tagcgagcgg    219180
     cgtggccgga gcgggcgaaa catattacaa aagacgacaa aatgttcaaa aacagcggga    219240
     caggccgcaa aagcgcggcc aagcgcctag atggcgtcga gcggatagac aggccggcgc    219300
     acatgccgga actcgacctg gccatagtcg gaagtggtca cgcccacacc ggtgcattcg    219360
     atgacatggg tggccatatc ggcaaagccg gcgcgccaat gcacgcgtga cttcaacgcc    219420
     acgtagcgct tttgcagcgg gtcgatgccg gccgacagca ggcaattgat gtcgaaaggc    219480
     tcctggtggc gcgacaccac cacgatctcg accttgccgg tgtcgagcac gacggtcagg    219540
     cccgtgtcgt tgcgcacgcc gcggtacatg gggccgcggt tcaggtatac gccgtcgaac    219600
     agcagcttga cccgggcggt caggtgcagg ggcgggctgg cctggcgcag cgccggcatc    219660
     gccaccttgc cgcccagggg caaggtcacg gtggcgccca cgccggccgc cgcggcctgc    219720
     tgcgcggcct gcgggtcgca gatggcgtag aacgccacgt tctccaggcc ctggtccagg    219780
     atctcggcca gcaccgcggt ggtgtccatg gtgccgcccg aaccggtatt gtcgtagtgg    219840
     tcgagcagca ccaccggtcc gttctcgatg gccttggcgc gcgcgatggt gggcgccagc    219900
     ggctcggcgt ggaacaccca gtcggcgcgt ccgcgccagg cggtctcgag cagctcgtcg    219960
     cggtactgct cggcctgcgc caggttggca tcggtgcaca ccaccgcgct cagccccgcc    220020
     tcgcggatgt cggcatgcgg aaagccgacg aacaccgagg cggcgatcac gccttcggac    220080
     tccagcgcct tgcagcgcgc ctgcagcgat ttgttgggtt cggcatgcgt gccctggcgc    220140
     atgatgtgcg gcagcatcgg cttgttggcc cagctcatga cgggcttgat ctcgccgcgc    220200
     agcgtgcggg cgatggcgtt ggccgcgcgc agcccggcgg cgcggatatc gacgtgcgga    220260
     taggtgtgaa agcccgagat gacggtagcg tggcgcacga tgtcgtcgta gatgttggcg    220320
     tgcatgtcca gcgtcacgcc caccgggatg gccggggcga tgtcgcgcag gcggcgcagc    220380
     agatcgcctt cggcgtcttc cacgccttcg gccaccatgg cgccgtgcag gtccagcagg    220440
     atggcgtcga agccgccgcg gcgcgcctcg tccagcacca ggccgcacag gcgctcgtac    220500
     gtggcgcggt cggtcggcgc gctgggccag gactccgccg ccaccggcac gacgatttcg    220560
     gcgccttcgc ggcgtgccac ctcgatatag ccgcccaggc cgctgtcggt gttctcgtag    220620
     gcgcgtatgg cgcgctcgcc ggccaggatc tcggggctgc cgcggaaaaa ccgctccagc    220680
     ggggtgggaa cgggcgagaa cgtattggtc tcgtgcttga tcatcgccaa cagccaacgc    220740
     atggtgtgct ccttgtcgtg cgcaattcct ggcggcgcgc cccggtcagg cgggcagcgg    220800
     gcggaaattg cggaaatccc agccgcggcc cggcgcggcg tcgatcaggg cgcgggtata    220860
     cgcatggccg ggccgggtca gcaccgtctg cgccgcgccg gtctccacca ccttgccatg    220920
     ctgcatgacc gcgatggtgt cgcacacctg cgccgccacg cgcaggtcgt gcgtgatgaa    220980
     cagcacgctc acgccggtac gttcgcgcac ctgctcgatc agctccagca cctgcgcctg    221040
     caccgataca tccagcgccg aaacggcttc gtcggccacc agcacttcgg ggtccatgac    221100
     cagggcgcgc gcgatgcaaa ggcgctggcg ctggccgccc gagaactggt gcgggtagcg    221160
     ccgcatcacg tcgggaccga ggccgaccac gcccagggtg cgggcggcgc gcaccagcgc    221220
     ctgcgcgcgc ggcatgccga agttgagcag gccctcgatg atggactcgc ccaccgcgcg    221280
     gcgcgggttc agcgaccggt aggggtcctg gaacacgatc tgcaccttgc gccgcagcgg    221340
     acgcaggccc gcgccgctca ggcgcgcgat gtcggtttcg cccagcagca tgcggccggc    221400
     gctgggctcg atcaggcgca cgatgcagcg cgccaccgtg gacttgcccg aacccgattc    221460
     gccgacgatg ccgaggatct cgccgcgccg cagggtcagg tccacctcgc tggcggccac    221520
     caccgtgcgc gtcgcgccga agagcgagcg ccgctcggcg taggtgcggc ccagcccggt    221580
     gatgcgcagc accggttcgc cgcctggcgc ctcgcgctgc gtcggcacca ggctgggcac    221640
     cgacgacacc aggcggcggg tgtagttctg gctcggccgc gccaggatct cgtcgcgcgt    221700
     gccggcctcg gtgaggtcgc cgcggttcat gacgacgata cggtcggcga tctcggccac    221760
     cacgccgaag tcgtgcgtga tgaagagcac ggcggtctgg tgcctgtcct gcagttcgcg    221820
     gatcagcgcc aggatctgtt tctgcgtcgt gacatccagc gccgtggtgg gttcgtcggc    221880
     gatcagcagc ttgggttcga ggatcagcgc catggcgatg acgatgcgct ggcgctggcc    221940
     gcccgagagc tggtgcggat acgcgtcgta gatgcgctcc acgtcgggca ggtgcaccga    222000
     gcggaacatt tcgagcacct tggcgcgccg ttgcgcgcgc ggcatgcggc ggtgcaggcg    222060
     cagcacttcg tcgacctggc tgcccacccg gtgcaccggg ttgagcgcgg tcatgggctc    222120
     ctggaacacc atggccatgc gtgtggcgcg cagttcgcgc cgccgccgcg cgctggccgt    222180
     gacgatgtct tcgcccagca cgcgggccga gccgccggag acctccagga tgccctcggg    222240
     cagcaatccc atgaccgcca gcgacgtgac cgacttgccc gacccggatt cgcccaccac    222300
     gcagaccgtc tcgccggcgt gcacgtccag gctgaggttg cggaccacgc ggttgcccgc    222360
     gccgcagacg ctcaccgaca ggttgcggat cgccagcacc gcggcgctgg tgtcgccggc    222420
     cggagggtag ggggcgtagg gcatcgctca ggtcctccgc gtcattttcg ggtccagcgc    222480
     gtcgcgcagc gcgtcgccca ggatattgac gctgagcacg gtcagcgaca ggaacaggcc    222540
     gggaaacagg atcaggcccg gcagcatgcg gaagtacatg cggccctcgg acatgatgtt    222600
     gccccacgag gcgatctcgg gcgggatgcc ggcgcccagg aagctgagta tggcctcggt    222660
     cagcatggcc gaggcgaaca cataggtgcc ttgcacggtc agcggcgcca cggtgctggg    222720
     caccaggtgg cgccacagca gcaggggcag cggcgtgccc agcgccagcg cggcttcgac    222780
     atagggttcg ccgcgcacgc tgaggatctg gccgcgcacc agccgcacca cgcggggaat    222840
     ctccgggatg gtgatggcca ccagcaccgt ggccaggctg gcgccggtca ccgacaccag    222900
     ggcgatggcc agcaggatgc cggggatggc catgacggcg tccatggtgc gcatgatcag    222960
     gccgtcgagc gtgcggaacc agccggcgat gacgcctatc accaggccca gcgtcacgct    223020
     gaccagcgcc gcgcccaggc cggccaccag cgatacgcgc gcgccataca ccacgcgcga    223080
     ccagatgtcg cgcccgaacg catcggtgcc gaacagatag tcgccgaaag gcggcttcag    223140
     gcgcgcgccc ggatcgatgg cggtcgggtc cacggtgccc agccacggcg ccagcagggc    223200
     cgcgcccacc accagggcca gcaccgccag cgcggccagc accggtgcgc cggagaattc    223260
     gcggcgcacg cgccgccacg cgcctgcctg gggcggtccg ttctcgggca gggcgccgtc    223320
     ggcgacggca tcgctatgcg tgggcatcgt caatacctga tgcgcgggtc gaacaccgta    223380
     taggcgcagt cgaccaccag attgatgaac acgtagacga acgcgaagaa cagcgtcagc    223440
     ccctggatca cggggtaatc gcgcgccatc acggcctcga ccaccaggcg gcccaggccg    223500
     ggaatgttga acaccgactc cgtcaccacc acgccgctga tcagcagcgc cacgcccacc    223560
     ccgatcaccg tggcgatggg caccgcggca ttgcgcaggg cgtggcccag cagcacgccg    223620
     gtctcgccca gccccttggc gcgcgcggtg cggatgaagt cctcgcccat gacttcgatg    223680
     atgctggtgc gggtgatgcg cgcgatcagc gccacataca ccgtggacag cgccagcgag    223740
     ggcaggacga ggcggtgcag gtaaggccag aatccctgcg ccagcggcgt gtagccctgc    223800
     acgttgaacc agcccagctt gatggcgaag gcccagatca gcacgtagcc ggtcacgaac    223860
     accggcaccg agaatcccag caccgaaaag cccatcacgg cgcggtcgag caggcggccg    223920
     cgccgccacg ccgccaggat gcccaatgga atggcgaccg ccagggtgaa cgccagcgtg    223980
     atcaccgcca ggctgagcga gggctccagg cgctggccga tcaactgggt gaccggcacg    224040
     ccggacatca gcgaagtgcc catgtcgccg cgcaccagcc tgccggtcca gatgaagaat    224100
     tgcttgacca gcggctggtc cagtcccatg acctggcgga tctgggcaat gcgttcgggc    224160
     gtggcggcgt cgccggccat gatgatggcc ggatcgccgg ggcttgcgcg caggatcgcg    224220
     aagaccacga ccgccaccat gatcaggacc ggtatggtgg ccaacagccg gcgcgcgatg    224280
     aatgccagca tggaactccc tcgggttgcg cgggcgggcc aggcccgccc tgggcttcaa    224340
     ggcgccttct tgacgttcca gaaggcgaac accggcgcgt gcaccaggcc gctcagcttg    224400
     gtggtgtaga cggtgggcac ggacatctgg cccagcggca cgtacaggcc ctcgtcgatg    224460
     ccgatgcgtt gcgcctcctc ggccagcttc ttctgctcgg cggggtcgga gctcagggcg    224520
     aacctggtgc gcaacgtctc gatttccgga atgtctggcc agccgaacca ggcgttgtcg    224580
     ccattggccg ccgccggggc cgagcgcacc gggtccatga tgtcggtggc gtaccagttg    224640
     gtgttgtgga tgttccagcc gccttgcgcc ggcgcggcct tggaggcgcg ccgcgtggcc    224700
     acgctttgcc agtccatcgc cgccaggttg acgttgaagc ccgccttgcg cagcgcctgc    224760
     gccatcacca cgggctgggc gctgagcgtg ccgacgtcgg tggcgtgcat caccaggatg    224820
     ggcgtgttgt cgtagccggc ctccttgagc agggcgcgcg ccttctcgat gttggacggc    224880
     accaccatgt ccttgccgat gtcggtctcg aacggcgtgc cgcagcccca cagcgaggcg    224940
     caggtctgcc agtacttcgg gttgcccacc agcgccttca tcacgtcttc ctggccgatg    225000
     gcgtacatgg cggcctggcg gatcttcctg ttgtcgaagg gcgggtactt gaagttgaac    225060
     cggtacatgg tgaagtagcc caccggactg agcgcttcct ccttcagtgc cggattgccc    225120
     tccaccatgg gcagcaggtc gtacgggaac tgctcgacga agtcgatctc gccgcccagc    225180
     agggcgttgg ccgtggtcag ggcgtcgggc atgacgttcc actcgacccg gtcgatgtgg    225240
     accgccttgc cgccggccag gccgctggct ggctcctggc gcggcacgta gtccgcgttc    225300
     ctgacgtata cggtcttcac cccgggcttg aactcggcca ccttgaacgg gcccgagccg    225360
     gtcatgtcgg taatgggctg gccgatggga atgtcggcga tgcgcttggg catcatgaag    225420
     gcggccgtgc cggtgggctt ggacagcgcg cgcaaggcga gatccgtggg ctctttcatg    225480
     acgatgcgca aggtctggtc gtcgacggcc tcgatcctgt cggtgaactt catcagcgtg    225540
     cggcccatgc cgtcgccgcc cgcccagcgc ttgatcgacg cgacgcagtc ctcggcggtc    225600
     acgggcttgc cgtcgtgcca cttctggccg gggcgcagcg tcatggtgta ggtcttgccg    225660
     tcgggcgaga cttcccactt ttcgagcatc tggggctgga tcttgttgtc ggcgtcggtg    225720
     gccagcagcg tgtcgtagat catgtagccg tgccacgtcg tgatgtatgc cgtggtggcg    225780
     tgggggtcgg tcagccgcag gggcgagtgc atgaccgcct tgatgacggt ttcggcgccg    225840
     gcgccctggg ctgccaggag catggcgccg gccagcgcgg cgatgcggac ggacttcagc    225900
     atggatgttc ccctttctga gtgaagccgg cggcgccagg gcgccgccgt tgtcgtcgga    225960
     aacgcgccgc cgggggcgcg cgaggatcaa gctgtgaccg tgggccggcg tcggacgcgg    226020
     gtccacaagg ccccattctg atgcccggtg gcgggcctgt ccatggttgt tttcttgcgt    226080
     ccgcgcgcgc cgggggaggg gtggcgcatg gcggcgaggc cggtccgccg gcgggccggc    226140
     ctcgggaata cccgcatgcc cgttcgaggg cccgggccgt ggcgcgccta cttggccacg    226200
     ggcatggtga actcggcgcc cttgccgatg ctgtcgggcc agcgctgcat cacgctcttg    226260
     tagcgcgaat agaagcgcac gccttcctcg ccgtaggcat ggtggtcgcc gaacagcgag    226320
     cgcttccagc cgccgaacga gtgccatgcc atcggcaccg gaatgggcac gttgatgccg    226380
     accatgccca ccttgatctg gcgcgcgaag gcgcgcgcga tgccgccgtc ggacgtgaag    226440
     caggacacgc cgttgccgaa ttcatgggcg ttgatcagtt ccaccgcggc ggcgaagtcc    226500
     ggcacgcgca cgatgcacag caccgggccg aagatctcct cgcgatagat gttcatggcg    226560
     ggcgtgacgt ggtcgaacag cgtgccgccc aggaagaacc cgccttcgtt gccgggcacc    226620
     tgcaggccgc gcccgtcgac caccagcgtg gccccgcagg cctggccgtc ctcgatgtag    226680
     ccggtaacct tggcgcggtg ctgcgcggtc accagcggcc ccatctcggc gtcggcctgc    226740
     atgccgtcct tgaccaccag ggcgcgcacg cgcggtgcca ggcgggccac cacctcgtcg    226800
     gccacctcgc ccaccgccac cgcgaccgag atcgccatgc agcgttcgcc cgccgagcca    226860
     taggccgcgc ccatcaaggc gtcggtgacc tggtccaggt cggcgtccgg catgaccacc    226920
     atgtggttct tggcgccgcc cagggcctgc acgcgcttgc cgcggcgcgt gccctcggcg    226980
     tagatgtatt cggcgatcgg cgtggagccg acgaacgaca gcgcctcgac ctgcggatgc    227040
     gcgatcagcg cgtccaccgc ctgcttgtcg ccctgcacca cgttgaacac gccgtcgggc    227100
     aggccagcct ccttgagcag ctcggccagg cgcagcgcgg ccgaggggtc gcgctcggac    227160
     ggcttgagca cgaaggtgtt gccgcaggcc agcgccaccg ggaacatcca gcacggcacc    227220
     atcatgggaa agttgaacgg ggtgatgccc gccaccacgc ccagcggctg gcgcatgctc    227280
     cagttgtcga tgccgccgcc gatctggtcg gtgtactggc ccttgagcag gtgcgggatg    227340
     ccgcaggcga actccaccac ctcgatgccg cgcgtcacct cgcccttggc gtcggagaac    227400
     accttgccat gctcggcggt gatcagcgcg gccagctcgt cctggtgctc gtccagcagg    227460
     gccttgaact tgaacagaat gcgcgcgcgc ttgagcggcg gcgtttccga ccaggccgga    227520
     aacgccgccg cggcggccgc cacggcggtg tcgacgtcct gcgccgaagc cagcggaatc    227580
     gagctggaga cctcgccggt ggcggggttg aagccttgcg tgtagcggcc gttgcggcct    227640
     tcgtacggct ggccgttgat gaaatgcgga atggtcttca tgggtatggt ctgttgcgtg    227700
     gcgggtgccg ggtcaggcga tttccttgag caccttgccg atgccctcga agagctcgcc    227760
     gatctgcgcc tcgtcgatga tcagcggcgg cgagacggcc aggatgtcgc cggtatagcg    227820
     caccatcagc ccgctgtcga agcatttgcg gaaggcttcg gcggcgcgcg cgcccggcgc    227880
     gtcggggcgc gaggccagct cgatgccggc caccaggccg atgttgcgca cgtcgatgac    227940
     gtgcggcgcg ccttgcaggg catgcgccgc tttctcgaaa gcgggcgaca ggtcgcgggc    228000
     gcggccgaac aggtcgtcgc gccggtagat gcccagcgtg gccaggatgg cggccgccgc    228060
     cagcgggtgg gccgaatagg tgtagccgtg gaagaactcg atgccgccct gcacgccgtt    228120
     gacgatggcg tcgtggactt cgcgcttgac cgccacggcg ccggccggca ccgcggcgtt    228180
     gctcacgccc ttggccatgg tgatgatgtc gggcgtgacg ccgaagtgct cggccgcggt    228240
     gggcgagccc agccgcccat aggcggtgat cacttcgtcg aagatcagca ggatgccgtg    228300
     ccgcgcggtg atttcgcgca ggcgctgcag gtagcctttg ggcggcacca gcacgccggt    228360
     cgagccggcc atgggctcga cgatcaccgc ggcgatggtc gacgcgtcgt gcagcgccac    228420
     gatgcgttcc agttcgtcgg ccaggtgttc gccccaggcc ggctggccct tggagaacgc    228480
     attgtgctcg aggctgtgcg tatggggcag atggtccacc gcgggcagca gcgcgcccga    228540
     gaacgtcttg cggttggccg atatgccgcc caccgaaatg ccgccgaagc ccacgccgtg    228600
     gtagccgcgt tcgcgcccga ccaggcgggt gcgctgcgcg tcgccgcgcg cccggtggta    228660
     ggccagcgca atcttcagcg cggtgtcgac cgattcggaa ccggagttgg tgaagaacac    228720
     gcggtcgatg ccggccggca tgaacgaggc caccgcggtg gccgcctcga acgcaagcgg    228780
     gtggcccagc tggaagcccg gcgcgtaatc catctcgccg gcctggctgg cgatggcctg    228840
     cacgatctcc gggcggcagt ggcccgcgtt cacgcaccac aggccggccg tgccgtcgag    228900
     gatctggcgg ccatcggtcg aggtgtagta catgccctcg gcacgggcca gcaggcgcgg    228960
     ctgggacttg aactgccggt tggcggtaaa cggcatccag agatgcgaca ggtcgggcgg    229020
     gctggcgggg gcattcatga gggtcgctcc agaggtaacg cctgcggtgt gcgccgaccg    229080
     cgcgtgcggt ggccgggcag gggacgagat cgattctggc ccgcctgcca gggaatgaaa    229140
     atatacaatc gacgtaaata ccgctaactg tgtagttgga ttctggctaa ctgtacagaa    229200
     atctacctgg cagaccttcc gtgatcgatt tccaacccgt gcgcggccgc gcgcaggcgc    229260
     cttcgctggt cgagcaggtc gtgcaggcgt tcagcagcgc catcgcccgg caagagttgc    229320
     ggcctggcat gcccgtgccg tcggtgcgcg agttcgcgcg ccagcacggc atcagcacct    229380
     ttaccgtggc cagcgcctat agccggctgg ccgcgcaggg ctggctggct gcccggcccg    229440
     gatcgggcta ccgggtcgcc tcgccgcagg cggccgcgcc gcgcgcgggt accccggggc    229500
     aatggtcgcc gccgcggctc aacgacagtt ggctgctgtc cgatatctat gccgaccact    229560
     ccatcccgat caagtcgggc tgcggctggc tgccgcccga atggctgcac gaagagggcc    229620
     tgcaccaggc gctgcggcac ctgggccggg tgccggcgct gcgcattgcc ggctatgggc    229680
     atccctatgg ctacgcgccg ctgcgcgaga ccatcgccgc cggcctgggc gcggccggca    229740
     tgccggccga ggccgaccag gtgctgctga cgcaaggcgt cacgcacggg ctggacctgg    229800
     tcatgcgcac cctgttgcgc cccggcgata cggtgctggt cgagcagccc tgctacgcca    229860
     atctgctgca gttgctgcgg ctggcgggca tgcgcgtggt cagcgtgccg cgcggcgtcg    229920
     acggcatcga ctgcgaggcg ctcgacgccg ccgcgctggc gcaccgtccg cgcgccttgt    229980
     tcgtcaacac ggtgctgcag aaccccagcg gcgccagcct gggcatggcc aacgcgttcc    230040
     gcgtgctgca ggcggccgag cgccacggac tgtggatcgt ggaagacgat atttcgcgcg    230100
     agctgatgcc cgccattgcc cccttgctcg cggcgctgga cggcgcgcag cgcgtggtct    230160
     acctgagcgg ctactccaag gccatcagcc cgtcggtgcg ggtcggctac atcgtggcgc    230220
     accgcgacct ggtgcgcgac ctggcgcgca ccaagatggc ggccgggctg acctcgcccg    230280
     agatcatgga gcgcgtggtg caccaggtca tccgcgaggg gcgctaccgc gcccatgtgc    230340
     tgcgcacccg cgagcgcctg gggcaggcgc atgcgcaggt cgtgcaggcg atggacgagc    230400
     atggcctgca actgtgcgcc cgtccccagg ccggtctgtt cctgtgggcg cggcccggcg    230460
     gggcctggcg cgagcgcggc gccaatgcct tggccgagct ggcgctcaag gacggtatct    230520
     ggctggcgcc gggatcctat ttcgacgcgg ccgacgcgga catcccgtgg ctgcgcttca    230580
     acgtggcgta ttcggacgcc gcggcgctgt ggcggttcct gcgcggcgcg ggggcgagcg    230640
     ctcagcccgc cacgcgctcg tattccacga agtcgtagcg caggccgttc tcggccggtt    230700
     gcgccgcgcg ctgcgtttcg cgccactgcc cggccggcag cggcgggaag aaagcgtcgc    230760
     cctcgatctc ggcatgcacc tcggtggcca ccacgcgctg cgccagcggc agggcctggg    230820
     cgtagatctg cgcgccgccg atgacgcagg ccacggcggc gtcgccgcag gcctggatgg    230880
     cggcgttaag cgagcccacc accacggcgc cggcggcgcc ataggccggg ttgcgggtga    230940
     tcacgatatt ggtgcgcccc ggcagcgggc ggcccagcga ttcccaggtg ttgcggccca    231000
     tgatgatggg atggccgagg gtcgtgcgct tgaagtgcgc caggtcgccg ggcagcttcc    231060
     agggcagggc gttgtcgcgt ccgatgacgc ggttggtcga ataggcgacg accaggctga    231120
     gcaggggagt ggcgggcatg ggcaagggcg tgaggcgtcg tcgggccgct cagaccgcca    231180
     tgggggcggt cagcggcgcg tggtgctggt agccgctcag cgtgaaatcg cccggctcga    231240
     cctgctccag ccattgcggc tcgtacttgc cggtcacggc gaaatcggga atgcggtccg    231300
     acagcaccag ctgcggggcc ggatagggct cgcgcgtcaa ttgctcgcgc agcatcggca    231360
     ggtggttttc gtagacgtgc gcatcgccga tgaaatagct gaaccagcgc ggcttgtacc    231420
     cggtcaggcg gccgaccagg tgcagcagcg ccgcgccctc ggtcaggttg aagggcgtgc    231480
     ccaggccgac gtcgttggag cggatgtaca ggcacagcga gatttcgcgc gtgccggcat    231540
     tgggcaggaa ctggtagagc agatggcagg gcggcagggc catttcctcg atctgcgccc    231600
     agttccagcc atggaacagg atgcggcggt cgcccggcga ttggtggatg gtgtccaggc    231660
     actggcgcaa ctggtccacc gccttgtaca gcagcacgtg cggcgcgccg ttttccgcga    231720
     cctcggccac ttgccggtag ccgcgcgcca gcgcgtcggc cacctggccg ccggcgctgc    231780
     gcggcagcag cttgtaggcc ggccaatggc gccattggac gccgtagacc gggccgaggt    231840
     cgtcgggacc ctcgcggtac gggttggcca gccattgctc gttctcgttg gcgttctggt    231900
     cccagacctt gcaacccagc gcgcggaact gcgcggcgct gcgcgtggcg cgcaggaagc    231960
     ccaccatttc gccgatggcg gacttgaacg ccagcttctt ggtggtgacg gcgggaaacc    232020
     cctgctgcag gtcgaagcgc agcgccgcgc cgggcagcga gagcgtgcgc acgccggtgc    232080
     ggttttcctg ccaggcgccc tggtcgagaa tggattggac gaggtctaga tattgtttca    232140
     tcgtggtgac ggcgggccgc ggggtgtctg cgcggcccgg tttgcggctt gggttacgcg    232200
     gcttgggtat cgacgatgtc caccgagaag ctgagctcgg cggttttttc cagcatggcc    232260
     gaggccgagc agtacttctc gtgcgacagc tgcacggcgc gttcgaccgc ggcgcgcggc    232320
     agtttgctgc cggtgacggt gaacgcgaaa tggatgcgcg tgaaaacctt cggatcggcg    232380
     tcggcgcgtt cggcctgcag cttgacgctg cagccggtca cggcgtggcg gccgcgcttg    232440
     aggatcagca ccacgtcata ggcggtgcag ccgccggtgc cggccagcag catttccatc    232500
     gggcgcggcg ccaggtcatg gccgccgcca tcgaccgcgc cgtccatcac ggccacatgg    232560
     ccgctgcccg tgctggccgt gaacagcatg cccgcagggc cgccccaatc gatcgtgcat    232620
     tccatctgca tagtcctgta gcggtgggcg cggccttgcg cgccatcaaa aagcgatcat    232680
     acccgttgcg tacaatggtt ggcggagaac cccgcccgcc gacagggcgg cgcgactttc    232740
     cagggagtat ccatatgtcc acctccagtt ccgcttccgc gctcggccgt cgcgccggcc    232800
     cgctcgatgg cctgatcggc gaaatcgacc gcgccttgcg cgtgctttcg ggcgccgcca    232860
     ccgccgcccg gccgtatccc gcccaggcgc ccgaggcgcc ggatgccttg tccgagcgcg    232920
     agaggcgcca tgccgccggc ctgatgcgcg tcaatcacgt gggcgaagtg tgcgcgcagg    232980
     cgctgtatcg cggccaggcg gccgcctgcc gcgaaccggc cgcgcgcgag ctgctgcgcc    233040
     aggccgcggc cgaggaagtg gatcacctgg cgtggtgcaa cgagcgcctg cgggagctgg    233100
     gcagccgccc cagcctgctc aacccgttct ggtacaccgg ctccttcgcg ctcggcgtgc    233160
     tggccagcta cgccggcgtg ccgcgcaatc tgggtttcat ggccgagacc gagcgccagg    233220
     tcgaggcgca cctggacggc cacctgcgca ccttgccggt gcaggaccgg cgctcgcgcg    233280
     acatcgtgca gaaaatgaag gaagacgaag cgcagcaccg cgccagcgcc gagcgcgccg    233340
     gcggcgtgcc gctgcccgcg ccggtgcgcg gcgcgatgcg ggcgatgtcc aaggtcatga    233400
     cgtccaccgc ctattggctc tgaaatgggg acaatctgcc catttatggt gcattgcggc    233460
     aaaaagcgcc gcccaggctt ggggcggcgc gccccggccg cttctaaatg cttgaaatct    233520
     ctagggtaat cccgcaaggg ttttcccttt cggcattaac ccgcttcacg ctgcagccca    233580
     atatcgacgc gggtttcgcc gtgagccgcc cagacggtgc ggcaaaaatc caacgaccgg    233640
     gggccggatc cgggcaatgc aaaaaatttc ttgcatcgca caaaagaatc ctctactatt    233700
     tgcacatcgg atgttgaaac gcagacggtg cggtgccaga accgccggcc caaggccagc    233760
     aaacatggat accccgactg ccgcgatttc cgggtcgcaa ggcctgacgc aatcccgaca    233820
     tgccacggtt gtctcctcca ccctcctcct ttggtggatt tagcccgaga tcgcaagatc    233880
     tcgggctttt ttttcgccgc gacgcgcggc gcgcaggggg caggccgggc gctcatccgg    233940
     cttattggtg ttttccctga actttccccg ctgcacgagg gcggaaagct ctacaatcgc    234000
     ctggacggtt ccagaccggc aagcccggcg ggccgagacg ttactttctg tactggcgac    234060
     ttgcacttca ttattgctgc catatatggg cgttacacct gcggccgata atggcggact    234120
     cgtctccata gaccaaccta aggtgactct gtgacctggc tgtacatatg cgtggtcgca    234180
     ttcatggtgg ggggactcat cgtggcgtcg gagcgctggc atggcgcgtt taccggcgat    234240
     agcgacctca acaagccgca ggcttcgcac acgcgggcaa cgccgcgcgt gggcgggctg    234300
     gcggtcctgg ccggctcgct ggccggcctg ctggtgctcg gccccagcaa catgacgctg    234360
     acctggctgt ggccggcgct gttcgtggcg gcgctgcccg tgttcgtggc cggcctgctc    234420
     gaagacatta ccaaggacat cggcgccagc aagcgcctgc tcgccgcgtt cgcctcggcg    234480
     gcgatcgcct ggtggctgct gggcggggtg agccgcgtgg gcatcgcgcc ggtcgactgg    234540
     gtgctgtcgt tctggccggt gtcgctgatc ttcaccatgt tcgcggtggg cgggtgtacg    234600
     cacgcgctga acatcgtcga cggcatgaac gggctggccg gcatgatcgc caccctgatg    234660
     gcggtgtcga tcagcctggt ggcgctgcag gtcggcgaca tgcccatttt catgatcgcc    234720
     gcggcgctgg cttcggccac gctggggttc ctggtctgga acttcccgtt cggacgggtg    234780
     ttcctgggcg atggcggcgc gtacttcctc ggcttcatgc tggcggagct ggccgtgctg    234840
     ctggtggtgc gcaatccgtc ggtgtcgccg ttctacgcgc tggcggtgct gttctatccg    234900
     gtattcgaaa cgggcttttc gatctggcgg cgccgcttca agcgcggcgt gccggtcgac    234960
     cagccggatg ccctgcacct gcatcagctg gtgttccgcc gcctggtgcg cgtgacgttc    235020
     agccgcggcc gccgccatgc ggtgccggca ttgtgcaatg ccctggcctc gccctacatg    235080
     tgggtgctgg cgctcatcgg cctggtgccc gccaccatct ggtgggacaa cgcctggttc    235140
     ctgtgcgcca gcctggtcgt gttcgccgcg gtctacacgt ggctgtacat gcggctggtg    235200
     tcctggcgcc gccccggctg gctgctgctg ccgtccgtca ttcgaacgca ctgatccatc    235260
     gtggcccccg tgcccgcgcg cggggtgcta caacgctaca aacacgttca aactacatac    235320
     aattccgtag ccgtcacacg gttgataggg agatttatct tgcgcattga tgatgtgaaa    235380
     ctggccgttg tcggcctcgg atacgtgggg ctgccgctgg ccgtggagtt cggcaagaag    235440
     cgcccggtga tcggcttcga tatcaacgag cgccgcatcg ccgcgctcaa ggccggccac    235500
     gatcacaccc tggaagtcga ggacgacgaa ctggcccagg ccgcgcagct cagctacacg    235560
     gccgagcgcg ccgacctggc ccaggccaat gtgttcatcg ttaccgtgcc cacgccgatc    235620
     gacgagtaca agcagcccga cctcacgccg ctggtcaagg ccagcgagac catcggcgcg    235680
     gtgctcaagc gcggcgacat cgtgatctac gaatcgaccg tgtacccggg cgccaccgag    235740
     gaagactgcg tgccggtgct cgagcgcgtg tcgggcctga agttcaacca ggacttctac    235800
     gccggctaca gccccgagcg catcaacccg ggcgacaagg cgcaccgcgt caacaccatc    235860
     aagaaggtga cctcgggctc gacgccggaa gtcgccgagc tggttgacca gctgtacaac    235920
     gagatcatca cggccggcac ccacaaggcc tcgagcatcc gcgtggccga ggccgccaag    235980
     gtgatcgaga acacgcagcg cgacgtcaac atcgcgctga tcaacgagct ggcgctgatc    236040
     ttcaacaaga tgggcatcga caccgaggcc gtgctgcagg ccgccggcac caagtggaac    236100
     ttcctgccgt tccgtccggg cctggtgggc gggcactgca tcggcgtgga tccgtactac    236160
     ctgacgcaca aggcgcagtc gatcggctac caccccgaga tcatcctggc gggccgccgc    236220
     ctgaacgact cgatgggcgg ctacgtggtc tcgcagctgg tcaaggccat ggccaagcgc    236280
     cgcatccacg tcgagggcgc gcgcgtgctg ctgatgggcc tgacgttcaa ggaaaactgc    236340
     cccgacctgc gcaacacgcg cgtggtggac atcgtgcgcg agctgggcga gtaccacgtc    236400
     gacgtggacg tgtacgaccc gtgggtggac ccggccgagg ccgagcacga gtacggcatc    236460
     acgccggtgg ccaagccggc cgccggggcg tacgacgcgg tcatcctggc ggtgtcgcac    236520
     caccagttcg tcgagatggg cgccgaggcg atccgcaagt tcggcaaggc cgagcacatc    236580
     ctgtacgacc tgaagtatgt gctggccccc gaccaggccg acctgaggct gtaagaagga    236640
     actccatgac gaatcgcttt gagaccacgt gcgcgcagtt gcgggcccaa ccccagaaat    236700
     ggctggtgac cggctgcgcc ggcttcatcg gctcgaacct gctcgagacg ctgctcgggc    236760
     tggaccaggc ggtggtgggg ctggacaact tcgccacggg gcaccagcac aacctggacg    236820
     aggtgcgcgc ggcggtgacg cccgagcaat gggcgcgctt caccttcatc gaaggcgaca    236880
     tccgcgacct ggcggcctgc cagcgcgccg tgcagggcgt ggaccgggtg ctgcaccagg    236940
     ccgcgctggg ttcggtgccg cgttcgctga aagacccgat cacgaccaac gaggtcaaca    237000
     tcggcggttt cctgaacatg ctggtggccg cgcgcgacgc gcaggtccag gcgttcgtct    237060
     atgcggcctc gagctcgacc tacggcgacc atcccgacct gcccaaggtc gaggagcgca    237120
     tcggcaatcc gctctcgccg tacgcggtga ccaagtacgt caacgagctg tacgccgacg    237180
     tgttcgcgcg ctcgtacggg ttttccagcg tggggctgcg ctacttcaac gtgttcggca    237240
     agcgccagga cccggacggc gcgtacgcgg cggtgattcc gaagtggacg gcggcgatga    237300
     tcaagggcga ggacgtcgtg atcaacggcg acggccagac cagccgcgac ttctgcttcg    237360
     tggagaacgc ggtgcaggcc aacctgctgg cggcgatggc cgcaccggaa ggcgcgaacc    237420
     aggtctacaa cgtggcgtac aacgcgcgca cgacgctgac cgagctgttc gagcacctgc    237480
     ggcgcgcgct ggccgggcag ggcgtgtcgt acgagaaggc gccggtgtac gcggaattcc    237540
     gcgccggcga cgtgcgccac tcgcaggccg acatcggcaa ggccggcaag ctgctgggct    237600
     acgagccggc ctacgacatc ctgcgcgggc tggaagccgc catgccctgg tacacgcaat    237660
     tcctgcgttg atttgaaagc catccgccgc aaactcgacg cgattcatcc ggaccaccaa    237720
     cgcattttca agggtgcgtt ccgggtggcc gtcttcctga tactgggcaa ggccgccggc    237780
     gccatcaagg agatggcggt ggcgtaccgc tatggcgtca gcgacgccgt cgacgcctac    237840
     cagttcacca tgaccatggc cacctggctg ccggtcacca tcgtgggcgc gctgtctgtc    237900
     gtgctgatcc ccgtgctggt gcggctgcgc cgcgcgggcg gacacgagcg cgaccggttc    237960
     gtgcgcgaac tgcagggctg gtcgctggcc gcgggcctgg ccctggcgct gctgacctgg    238020
     atggcctggc cccatgtgct cgactggctg ggcggcgggc tgtcgggcac cgtcgacggc    238080
     atgacgcacg agctgctcct ggccttcgcg ccggtggccg ccttgctgct gatggccggc    238140
     atcagcgcgg cgcgcctgcg ctcgcacgag cgccatgtca ataccctgct cgacagcgtg    238200
     ccggccgtga cgacgctggc ctgggtcatg ctggcggcct cggccgacag cgtgggcccg    238260
     ctgctgtggg gcaccctggt gggctacgcg atccaggccg cctggctggc ctggctggcc    238320
     gcgcgcgccg acggcggatt ctggggctgg ccggcgttca cgctgcgttc gccgcactgg    238380
     ccggagctgg ccgccgccgc cggcgtcatg ctggtcgggc aggtggccat gagtttcgtc    238440
     ggcccgctcg accaatacgc ggcggccaat ctgggctcca acgccaacgc cacgctgggc    238500
     tacgccagcc gcctgctgtc gctggtgctg ggcatcggcg cggtgtcggt ggggcgcgcc    238560
     gcgctgcccg tgctggccga tgtgcaaagc cgcggcgatg gcgcgcgcgc gcgcgccatg    238620
     gcgctcaagt ggtcggcgct gatggtcggc gccggcgcgg ccgccgtggt ggtgggctgg    238680
     ctgctggcgc cctggggcgt ggcgctgctg ttcgagcgcg gcgccttcac cgccgaaaat    238740
     acccaggccg tggcgcaggt gctgcgctgg ggcctgctgc agctgccgtt ctatttcggt    238800
     gtgctgatcc tggtgcagct gctggccagc cagaaccgct accgcatcat ggcgctcatc    238860
     gccgtggcga acttcctgct caaggcggtg ctcaatacgg tgctggcgcc gcgcatgggc    238920
     accgcgggga tcatgctcgc caccagcctg atgtatctgc tgtcgttcgc ctgctatacg    238980
     gtcgtggccc tgcggccggc gccaggcgcg gacggcggcg acgacgacag ggagaaacgc    239040
     tgaatgcccg ggcccgccga acgtcccttg cgcgtactga tcttcatcca ttctctgcac    239100
     ggcggcggcg ccgagcgcgt ggccgccgat ctcagcgccc actgggcgcg cgatggccgc    239160
     gcggtcatgc tggtgacgca ggccgatgcg tcgggggacg tctacccgct gcatccgcag    239220
     gtcctgcggc gtacgctgga tacggcgggc gagggcggcg gctggcgcgg ggtgctggcc    239280
     aacctgcggc ggatccgcgc cctgcgcgcg ctgatcaagg atttccagcc cgatatcgtg    239340
     ctgggcatga tgacgacggc ctcggtgctg gcggtgctgg ccgcgcgcgg cctgggttgc    239400
     cgcgtcgtgg ccaccgaaca tacccatccg ccgtcgcagg cgctctcggg catgtggctg    239460
     cgcctgaggc gctggaccta tccgcgcgcc gcgcgcgtgg tggcgctgac gcgcggcacc    239520
     gccgactggc tgcgcacgca tgtgccgggt tcgcggctgg cggtgatccc caatccggtg    239580
     cactggccct tgccgcgcac cgaacccgtg ctcgtgccgc ccgccgacgg ccggccgcgc    239640
     ctgctggcgg tcggccgcct gcatccggac aagggcttcg acgtgcttat cgacgcctat    239700
     gcgcgcatcg cgccgcgata ccccgattgg gacctggtga tcctgggcga gggcgacgag    239760
     cgcgccgcgc tgcagcgccg ggtcgacgag gccggcctgg cgcagcgggt ggcgctgccc    239820
     gggcgggccg gcaacgtggg cgactggtac gcctgcgccg ccctgtacgt gctgacctcg    239880
     cgtttcgagg gattgtccaa tacattgctg gaatcgatgg ccagcggcct gatgccggtc    239940
     agcttcgact gcgacaccgg gccgcgcgag atcgtgcgcc ccggcgtgga cggcgtgctg    240000
     gtgcggccgg cgggcgacgc cggggccatg gcccaggcgc tggccgccgc catcgacgac    240060
     gagccgggcc ggcgcgccat ggccgcccgc gccatcgacg tgcgcgaacg cttctcggcg    240120
     cgccatgtgc tggacctgtg gcaacaacta ttcgatgatg cgctgagcca ggcgaagtag    240180
     ccgccgctcc cgtcgtcgtc acgatcatcg tgggaaactg aacatcatgt gcggaattgt    240240
     cggaatctgg ggtcccttgc gggacaaggc caatgtgctg gccgaaagct gccggcgcat    240300
     ccgccaccgc ggccccgaca gcaatggcta ttgggaagac gccgaggccg acctggcgct    240360
     ggcgcatgtg cgcctggcca tcctggacct gaccgaggcc ggccaccagc ccatggtgtc    240420
     ggcctgcggc cgctacgtca tcgttctcaa tggcgagatc tacaaccaca tggagttgcg    240480
     cgagcgcctg cagcaggacg ggctggcgcc ggcctggcgc ggccactccg ataccgagac    240540
     ggtgctggcc tgctttgccg gctggggcct cgagcagacc ctgcaggccg cggtgggcat    240600
     gttcgccatc gcgctctggg accgcgccga gcgcaagctg gcgttgatgc gcgaccgcat    240660
     gggcgagaaa ccgctttact acggctattc gcaggccaac ctgctgttcg gctcggaact    240720
     caaggcgttc atgccggtgc ccggcttcgg ccgcgagctc gatcgcaatg ccctggcctc    240780
     gttcatgcgc cacaactaca ttcccgcgcc gcagtcgatc tacgccggca tccgcaagct    240840
     gccgccgggc gcctgggtcg agatcgacgc ggcgcagatg cgccgtggcg agttgcccga    240900
     accccaggtg tactggtcgg cgcgccgcgc ggccgaccag ggcctgggcg accggcgccg    240960
     cttcgagtcc gacgcgcagg cgatcgacgc gctggagcag gtggtgtcgc aggcggtgcg    241020
     tggccagatg ctgtcggatg tcagcctggg cgcgtttctt tccggcggca tcgactcctc    241080
     caccgtcgtg gccctgatgc aggcgcaaag cgcgcagccg gtgcgcacct tcgccatcgg    241140
     ctttcacgaa aagggctata acgaggccga gcacgccaag gccgtggcgg cgcacctggg    241200
     caccgagcat accgagctct acgtcaccgc cgaggatggc ctggccgtgg tgccgtccct    241260
     ggcagacatg tacgacgagc ccttcgccga ctcgtcgcag atcccgacct cgctggtcac    241320
     gcgcatggcg cgccagcacg tgacggtggc cttgtcgggc gatggcggcg acgagctgtt    241380
     cggcgggtat tcgcgctatt tccgcgtcga caactggtgg cgcaaatgcg ccgccatgcc    241440
     cgggccgctg cgccatctgg cgggcgcggc gctgcgcggc tcggccgcgc tgccgggggc    241500
     cggcgcctgg cgcggcaagg tcggcaagct gggcgagctg ctcggcgccg acacgcgcgg    241560
     cgagttctat cgcctgttcg tctcctactg ggccgatccg ggccgcgtgg tgatcggcgg    241620
     cacggagccg ctgtcgccgt tcgagcaacc gatggagggc tccaccttcg acgccatgat    241680
     gaagctggac acggtcacct acctgcccga cgacatcctg gtcaaggtcg accgcgcggc    241740
     gatggccgtc agcctggaga cgcgcgtgcc gctgatcgac catcgcgtct acgaattcgc    241800
     ctggcagctg ccgttcgaat acaaggtgcg cggcggcacc ggcaagtggc tgctgcgcca    241860
     gttgctgtac cgccacgtgc cgcaggccat ggtggatcgg cccaagcgcg gcttcgccgt    241920
     gccgctggcc gcctggctgc gcgggccgct gcgcgactgg gccgaggcct tgctggaccc    241980
     ggcgcgcctg cgccaggaag gctggttcga gcccgagccc atcctgcgca aatggcgcga    242040
     acacctgtcg gggcaccgca actgggacag ccatctgtgg ggcgtgctga tgatgcaggc    242100
     ctggctggac cgctatcgcg ccggggccgg cgatgaggcc ggccgccgat gaagatattg    242160
     ttgctggtca gttccatgca cgccggcggc gccgaacggg tcgccgccac gcttgccaat    242220
     ggctgggccg cgcgtggcga ccagatcacg ctgatgccca cctactcgtc caagggcact    242280
     tgtttttatc cgctgtccga cgatgtcgaa ctgctgtggc tggccgatcg ggccggcacc    242340
     cgctcgggcg gcgccgtggc ggcatggcag cgcctgcggg cgctgcgcgc cgtggtgcga    242400
     gagcgcgcgc ccgacgtggt ggtgtccttc ctgaccaacg tcaacgtggc ggccatcctg    242460
     gccacccggg gcctgaagac gccgctgatc gtgtgcgagc gcaccaaccc tgtcgtcgat    242520
     accagcatcg gccgcgtatg gcgcgtgctg cgccgcgtcc tgtaccccct ggccgacatg    242580
     gtcacggtgc aggccgacgc gacggtcgag ccgttcgcgc gccaggtgcc cggcctcaag    242640
     cagttgtgcg tgattcccaa tccgctgccg cccgagctgt tcgacgccac gccggccgcc    242700
     ggcagcggcg ccgcgccggc cgcgcgcaag cggctcatgg cgatggggcg catggtgccg    242760
     gacaagcggt tcgatctgtt gatcgacgcc tacgccggcc tggccgacga attccccgac    242820
     tgggacttgt ggatctgggg cgagggcccg cgccgcgacg acctgcaggc gcaggtcgcg    242880
     gcgcgcgggc tggccacccg catccatatg cccggccgca ccgccgcgcc ctgggacgag    242940
     ctggccaagg ccgatgcatt cgtgctcagc tcggcggtgg aggggtttcc caacgtgctg    243000
     ctggaagcca tgtcgctggg cttgccctgc gccgccttcg actgccccag cggcccggcc    243060
     gaaatgacgc gcggcggacg cgacgccctg ctggtgccgg caggccagcg cgacgcgctg    243120
     cgcgatgcgc tgggccgcct catgcgcgac ccggagctgc gccgcgacct gggccggcgg    243180
     gcggcgcagt cggtgcgcca gcgctatgcg ctgccggcgg tgctggcgca atgggatgcg    243240
     ctgttcgagc gcgtgcgggg cggcgcatga cgcggatcct gcgcgtcatg cacgtgatca    243300
     ccggcctggg ccagggaggc gccgaatccg tcctgttccg gctcgccacc tggcctgacc    243360
     agcgggtgcg gcacagcgtg atctcgctga ccgacgaagg cgtctatggc acgcgcctgc    243420
     gcgccgccgg ggtgccggtg catgcactgg gcatgccgcg cggccgcgtc acgctgggcg    243480
     gcatgctggc cctgcgcgcg ctgctgcggc gcgaacgtcc cgacgccgtg cagacctgga    243540
     tgtaccacgc cgacctgatc ggcggcgtgg ccgcgcggct ggccgggatc cgcgcggtcg    243600
     catggggtat ccgcaattcc ggcgaacatc tcgatcgcag cagccgttcc gcgcggctgg    243660
     tgctcaagct gtgcgcgcgg ctgtcggcgc gcctgccggc ggccatcgtg tgcgcggcgc    243720
     aggatgcggc cacgcgccac cggcggcatg gctacgacgg cgcgcgcatg gtggtgatcc    243780
     ccaatggcta tgacctgtcg cgctacgcgc ccgatgcgca ggcgcgcgag cgcatgcgat    243840
     cgctgtgggg cgtggccccc gagacgccgc tggtcggctg cgtggcccgc tgggatccgc    243900
     tcaaggacca cgccaacctg ctggccgcgt tgggggggct ggtgcgcgag gggcgcgacc    243960
     gcgggctgca gtgcgccctg gtcggccgcg gcatgtcgcc gggcaacgca ggcctggccg    244020
     cgctgatcga tgccgaaggc ctgcgcggcc gcgtgctgct ggccggcccc agcgacgacg    244080
     tgccggcggt catgaacgcg ctcgacctgc atgtgctgtc gagttgcgcc gaaggctttc    244140
     ccaatgtcgt ggccgaggcg atggcctgcg gcacgccctg cgtggccacc gatgtcggtg    244200
     acgccgccta catcgtcggc gacaccggcg gcgtggcgcc ggcccagcag ccggccgcgc    244260
     tggcggcggc gatcgaggcc gcgctggccg ggatcgccgc gcgtgggcgc gacgcggccg    244320
     gcgccgccgg ccgccagcgc gtgctggccg agttcgacct gcgccgcatg gtcgagtcct    244380
     acgaggccgt gtggcgccgc atttccggag aacgcgcatg acatcgccgc gccgcctgct    244440
     gttcgtcgtc aacaacccgg ccttcttcct gtcgcaccgg ctgccgctgg ccgaggccgc    244500
     gcgcgccgac ggctacgagg tgcacgtggc gaccatggac ggccccagcg tgccggatat    244560
     cgtggcgcgc ggctttgtcc atcatgccat tccgatgacg cgcagcggca agcagccgct    244620
     gcaggagctg cgcagcgtgt gggcgctggt gcgcctgttc cggcgcctgc ggcccggcct    244680
     ggtgcatctg gtgaccatca agccggtgct ctacggcggc atcgccgccc ggctggcggg    244740
     cgtgcccgcc atggtggcgg ccatctccgg gctgggtttc gtgttcgtgg caggcggcct    244800
     gaaggcgcgc ctgctgcggg ccgcggtcgg ccgtctctac cggttggcgc tgggccatcg    244860
     caacagccgc atcgtgttcc agaacaccgc cgatcgcgat gtgctggcgc gcctgggcgc    244920
     cgtgcgcgcg gagcaggtgg tcatgatccg cggttcgggc gtcgacctgg gccaataccg    244980
     cgtcgtgccg gagcccgcgg cgccggtgac ggcgctgatg gccgcgcgcc tgctgcgcga    245040
     caagggcgtg cgggaattcg tcgaggccgc gcgcctgctg cgcgggcgcg ggctgtccgt    245100
     gcgcatgcag ctggccggcg gcgtggatcc cggcaacccg gcgtccatca cgccggagca    245160
     ggccgcgcaa tggcaggacg aaggctgcgt cgaggtgctg ggcgagcgca aggatatcgc    245220
     ggccctgtac ggcgcggcgc acatggcggt gctgccgtcc taccgcgaag gcctgcccaa    245280
     gtccctgctg gaggccgccg cctgcgggcg cgccgtggtc accaccgacg tgccgggctg    245340
     ccgcgacgcg atcgaccccg atgtcaccgg cctgctggtg ccgccgcgcg acgcgccggc    245400
     cttggccgac gcgatcgccc ggctggccga ggacgcgtcc ttgcgccagc gcatgggcgc    245460
     ggccggccgc gcgctggccg agcgcgagtt cggcatcgag gatgtatgcc gccgccacct    245520
     ggccatttat cgcgcgctgg cgcgctgaac cgttcctagg gctgcttgcg cagcgcgtcg    245580
     atccagtagc gggtcgaggg gtcctgctgg ttcacctcgc tcgacgggtt ctccagctcg    245640
     cggatgatat tgcgcgccag cgccttgcca tattccacgc cccactggtc gaacgggttg    245700
     atcccccaca gcacgccctg cgcgaacacc ttgtgttcgt acatggccag cagcgcgccc    245760
     agcgcgtggg ccgacaggcg cggcagcatg atcagcgtgg acgggcgtcc gcccggatgc    245820
     acgcggtggt gcgccaggat ctcggcctgc tgcggatcgg actcgaccag ccgcgcttcc    245880
     ttgagcgctt cgtcgaacgg cttgccgcgc agcagcgccg cgcgttgcgc caggcagttg    245940
     gcgatcagca gcttgtggaa gtggtcgtag ggatggtcgg cctgctcgca gacgatgaaa    246000
     tccaccggcg cgccggccgt gtcctggtgc agccactgga agaaggtgtg ctggcagtcg    246060
     gtgcccgtca tgccccagac cacggggccg gtgggaacgc cggccggcga gccgtcatgg    246120
     ccggcgacct tgcccagcga ctccatctcc agctgttgcg cccacggcac caggtgcgtc    246180
     aggcgcgaat cgtagggcgt gatcgccagc gagccgtagc ccagcacgct gcggttggcc    246240
     acgcccgcca gcgccatctg cagcggcgcg ttgcggcgca tcggcgtatg caggaaatgc    246300
     tggtccatgg cggccgcgcc ggccagcagt tcgtccagcg cgtcgcagcc cagcgccagc    246360
     gccaccggca acccgatggc ggaccacagc gaatagcggc cgcccaccca gtcccagaaa    246420
     cggaagatgt gctgcggcga aatgccgaaa tccagcgccg cgtcgacgtt ggcggtgatc    246480
     gccacgacct gccgcaccgg gtcggccacg ccggcgttgc gcaaccagtt catggcgact    246540
     tcggcgttgg cgagcggctc ggtcgtggtg aacgacttgg acgccacgat gatcagcgta    246600
     tcgtgcgggt cgagatgatg cagcgcgtcg gcgaccgcat gcgaatcgac gttggaggcg    246660
     aagcgcactt cgcgcttgag gccgttgtgg cgcagcgcgc gcgtgaccat gcgcgggccc    246720
     cagtcgctgc cgcctatgcc caggtgcagg acatggcggt aggcgccgcg catgtcggcg    246780
     tcctgcacga agcggcgcag cctgtcgcgc tcgcccagga tggcgccggc caccggcgtg    246840
     ggcggccggg cggcgcgcag cgccgtgtgc caggccgggc ggtgttcggt ccagttggct    246900
     gggccgccgt cgaacagctg ggcgcgggcg ttgtcgaaat cctgctgcgc cagcaggtcc    246960
     tcggcggcgc tgtcgaggtc gtcggagtgc gcctgggcgg tcaggtccac ccgcagcccc    247020
     gccgcttcga tgacgcgcaa ccgggcgccg cggcgcgacg agtggcgcgc cgcgtcggcg    247080
     aacgcgagcc aggcggaact ggagggcagc ggtgtaggca tgggtggtca gaagggcagt    247140
     ttggcttgcg gagccagccg cagcagctgc tggcggaatt cctgctggat gcgggccagg    247200
     cccggctcgg tctccgcctc gaagcgcagc acgacgacgg gggtggtatt ggaggcgcgc    247260
     gccagcccga agccgtccgg gtattccgcg cgcacgccgt ctatcgtaac cagccggctg    247320
     gcgctggcga actcgccctg ctgctgcagg gcggcgatca gcgcatgcgg ctcgccctcg    247380
     gccatttcca gcttgagctc gggggtcgac agcgcctgcg gcagggcctc cagcgggcgc    247440
     gacgcatcgg tttcgcggga gacgatttcc agcaggcggg cgccggtgta caggccgtcg    247500
     tcgaagccgt accagcgctc cttgaagaag atatggccgc tcatctcgcc ggccagcggc    247560
     gcgccggtct cggccagctt ggccttcacc agcgaatggc cggtctgcca catcagcggc    247620
     acgccgccgc tttgctcgat ggccacgccc acgtgccggc tgcacttgac gtcatagatg    247680
     atggtcgcgc cggggcagcg ggccagcacg tcgcgggcga acaggatcag ctggcggtcg    247740
     ggccagatga tctggccgga cttggtcacc acgcccaggc ggtcgccgtc gccgtcgaag    247800
     gccaggccca gctcgcagtc ggtgctggtg acatgggcga tcaggtcctg caggttgcgc    247860
     ggttcggccg ggtcgggatg gtggttggga aacgtgccgt cgacctcgca atagagttcg    247920
     tccacttcgc agcccagcgc gcggaacaat tgcggcgcca gggcgccggc cacgccattg    247980
     ccgcagtcga cggcgatctt catggggcgc gccagcttca cgtccgacac gatgcgctcg    248040
     atataggcgg ggacgacatc gagctggcgg cgttcgcccc aggtgcccgg cgccgcagcc    248100
     ggcgccagca tggccgggcg cagcgcctgc acggccgggc cgtacagggc ctggccgccc    248160
     atcatcatct tgaagccgtt gtactgcggc gggttgtggc tgccggtgac cgccacgccc    248220
     gagcccgtgc cctgggtgtg cgccgcgaaa tagaccagcg gcgtgggcac ctggccgata    248280
     tccagggtat ccacaccgcc ttccatgatg ccttcctgca gcgcgccggc caggtcgggg    248340
     ctgctcaggc ggccgtcgcg gccgaccacc agggcgccga tgccctgcgc gcgggcgctg    248400
     gcggccaggg cacggcccag cgcccgggcg aataccgggt cgagctggtc gggaaccgag    248460
     ccacggatgt cgtacgcctt gtagaccgat gcgggaaagg ggtgcgccac ggaaatcctt    248520
     gtccaatgct gaagcggcgg gcgcaagtcc gccgcgggtt gtgtccgccg gccgccggcc    248580
     ggccatgacc ggaattatcc ccgatttcgg ccccgtcccc cgcgccgcgc ccgatttcgg    248640
     tgcgtccggc ctcggcgcgg tgccggccag gcccccggcg agggcgcgca tggccggcgc    248700
     ggcgtaggaa taagcacggc acgaaaattg cataagccag aaggtgatac gcttatcgtt    248760
     attgacgaac ttgaacggga ggtggccgat gagcgccgat atttcgttcg tctcgacacg    248820
     ccggcgcatg gcgccgggcc gggtcgacct gactgccggc ggcgaacgcc ggctggatat    248880
     ccccgtgcac gcgggcatcg acggcagcgt cgaggccggc cgtgcctggg agcgctgtgt    248940
     ctggcgcgcc gcgcgggtgc tgatcgccga atgcccggcg ccgcgcctgt ccgcccgcct    249000
     ggaggcaacc ctgcgcggcg tggcggtgcg catcgcccgc gatcgcggct ggcgcggcat    249060
     cggcacggtc gtgttctcgc tggacgtggg cacgggcatg ttccgcatga tcgaggcgcg    249120
     cctgtgcggc ctgcagcaag gcgggccggc ggccgatgcc gcttccggcg gccacgcgct    249180
     cgaagtgcgc atcagcgcct gcgccgacag cgggcggcgc ggcgcgcacc tgcttaccta    249240
     cggcgcgacc cggggcgagg cgttgcggcg cgcctaccag gcgctggcca agctgcccgg    249300
     cctggcccag gccgaccgcg ccttcctgat ggaccgcatc gcatcgcccg ccttctgctc    249360
     gggcctgacc ggctcgcaac tggaccgcat agccagctga ggggcgagcc ggccctggcc    249420
     gcgtgccact acaataagcc gattccgtat cgcgggcccg gcggggcccg ccgcagcgag    249480
     cgcgccgaac catgaccttg ccaagcgaat tgcgggccct gctgggcccg tcccatgtgc    249540
     tgaccggcga cgacgccgag ccgttcctgc tggactggcg ccggcgctat cgcggccgcg    249600
     cgctggccgt ggcgcggccg ggcagcgccg aggaagtcgc ggcggtggtc cggttgtgcc    249660
     aggcgcatgg cgccccgctg gtgccgcagg gcggcaacac cggcctgtgc ggcggggcca    249720
     cgccggacga cagcggcagc gccgtggtgc tgtccaccac gcggctgaac cgcgtgcgcg    249780
     ccatcgatac cgacaacgac acgatcacgg tggaagcagg ctgcgtgctg caggccgtgc    249840
     agcaggcggc cgagcaggcc ggccggttgt ttccgctcag cctggccgcc gagggcagct    249900
     gcaccatcgg cggcaacctg gccaccaacg cgggcggcac gcaggtgctg cgctacggca    249960
     atgcgcgcga actgacgctg ggcctggaag tggtgaccgc cgaaggcgag atctggaacg    250020
     gcctgcgcgg cctgcgcaag gacaacaccg gctacgattt gcgcgacctg tacgtgggca    250080
     gcgaaggtac gctgggcatc atcaccgccg ccacgctcaa gctgtttccc ttgccggtgg    250140
     caacctgcac cgccttgctg gcgctggaca gcatcgatgc ggcggtcgag gtgctgtcgc    250200
     gcgcgcgcgg cggctttggc gcctcgctta ccggtttcga actgatggcg gccgattgcc    250260
     tgcaggccgt cacccggctg tttccgcaac agcgcctgcc gttcgacggc gccagcgcgg    250320
     actcgccctg gtttgccttg ctggagctgt ccgacagcga aagcgaagcg catgcccgcg    250380
     cgcgcttcga ggcggtggtg ggcgcggcca tcgaggacgg gctggtcgcc gacgcggcca    250440
     tcgccgagaa cctggcgcaa agccaggcgc tctggcacct gcgcgagagc attcccttgg    250500
     ccgaggccga gctgggcaag tcgatcaagc acgatgtgtc cattcccatc tccgccatcg    250560
     ccgccttcgt gcaccagacc aacggcctgc tgcaggggcg tttccccggg gtgcgcaatg    250620
     tgatcttcgg ccacctgggc gatggcaacc tgcattacaa cgtggcgcgc gggccgggcc    250680
     agaccgaagc cgacctgctg gggctgcagt cgcaggtgta cgacgcggtg cacggcagcg    250740
     tgcaggcgtt cgcgggctcg atcagcgccg agcatggcgt ggggcagctc aagcgcgatg    250800
     aattgccgcg ctacaagagc gccgtcgagc tggccctgat gaagcggctc aaggcggcgc    250860
     tcgatccgcg cggcctgctc aatcccggca aggtcctgca ggcctgacgc gccccgccgc    250920
     catgaccgcc gcgcccgcca accggcattt ccgcgtcctg atcgtcgagg acgatctcac    250980
     catcgcggcc aacctgtacg actacctgca ggtgcgcggc ttcgtgccgg acgccgccta    251040
     cgatggccgt tcggcgctgg ccctgctgga cgaacacgct ttcgacgcca tggtgctgga    251100
     cgtcgggctg cccggcatgg atggccatgc cgtgctgcac gcgctgcgcg tcgagcggcg    251160
     cgccgccttg ccggtgctga tgctcaccgc ccgcgacggc ctggacgaca agctggccgg    251220
     cttcgcgcat ggcgccgacg attacctgac caagccgttc gcgctggccg aggtcgaggc    251280
     gcgcctgctg gccctgatcc agcgctcgcg cggcgccgtg gtcgatagcc tgcgcagctt    251340
     cggccccctg cagttcgaca gcgccacgcg cgaggtcgcg gtgcacggca aaccggtgca    251400
     cctcacccgc aagtgcggca tgatcgtcga ggtgctgctg cgcgatcccg gccgggtggt    251460
     ctcgcgcgag caactcgaaa acgccctatg gggcgacgac ccgccgtcct cggacgcctt    251520
     gcgcagccag gtgcatctgc tgcgccgcgc gctggccgat gccgggttcg acggcatcga    251580
     aaccgtgcac ggaacgggct ggcggctggc gctgccggcg ggtggcgcat gagtgcacgg    251640
     cctgtttccg gcaatggatc gggatcgctg acgcagcgcg tcgtgtgggc attgaccggc    251700
     agcgtggcgc tgttcgtcac cgccctggtg ctgctgtcgt acctgacgtt cgacaagatg    251760
     gaagacgatc tcgtcaacga catcctgtcc accgagaccg accgcctgat ccagcacgtg    251820
     gccgccgacg accacttcct gcccgaccgc ggggcgcgcg aactgggcgg cgcgatgcgc    251880
     gcctggctgg tgcgcgcggg cgccgcgcag tccgacttgc cgcagccgct gcacggcctg    251940
     ggcgtcggca tgcatctgct cgagcccggc gccgaaacct ggcacgtcat ggtggccgat    252000
     gtggaggacg cgcgtatcta cgtgctctat gacgccaccg acaacgaggc ccgggtccat    252060
     gatttcggcc tgttcgtgct gggcgtgggc gccatctgca tcgtggccgc ctatggcatc    252120
     tcgcggcggg tggccggcgt ggcggtcggc ccgctggtcg agctgacccg ccgcctggcc    252180
     aactgggcgc cgggcgcgcc cgacctggcc gtcacccgcg acgacgaggc gggccgcctg    252240
     atcgaggcgt tcaaccgggt ccagaaccag gtcgaccgtt cgattgcgcg cgagcgcgag    252300
     ttttcggtca acgtcagcca cgaggtgcgc acgccgctgg cggcgatccg ctccgacagc    252360
     gagatgatgc tgctggccgc cgggctggac gagggcctgc gcacccggct ggtgcgcatc    252420
     gtggccaacg tggacaacgt gtcgacggcg ctggagagcg cccgggccat ggcgcgcgac    252480
     gagccgcgcg cgcccgagcg cgtcgatctg gccgcctgca tggacgacgc ctggcgcggg    252540
     ctggaggtca acgccgaagc ggccggcctg gcgttcgcca accgcattcc ggccggcagc    252600
     gcgcacgtgc tggaccgcta cgccatgctg accgtgctgt gcaacctggt gcgcaatgcc    252660
     atcgaacacg cggctccggc cacgctcacg gcggcgctgc gccccgatgg cgccctcgaa    252720
     ctgcgcgacg atggccgcgg catcgccgcc gaagagctgc cgttcgtgtt ccagcgcttc    252780
     tacagcgggc ggttgcgcga tagcgccgac aacggctcga acgaattgcc gcgcggcctg    252840
     gggctggcca tcgccaagcg cgtgtgcgac atgcagggct ggcagctttc ggtcgattcc    252900
     gagcgcgacg gcccggcgcg cggcacgcgg ttcgtgctgc gctttacctg atccggattg    252960
     cattcgtcca tctggtggac gattttggct acacaaaatt tgacatcgat ttgacgccca    253020
     acaggtatgc ttgcgcgtct ttttttgcaa cgaggcggac gaggccctgg ccctcccgcc    253080
     gccgacgagg aatcccgtgc gcaggctgac catacgtttc gcgatcgcca tcctggtcct    253140
     gctgacactc agccggctgg gcctgtccgc ctggcaatgg gaccgcgtcc aggccgccgg    253200
     cggcctgggc cccatcatgc tcggcggcct gcgcatggac ctgcgcctgc tggccctggt    253260
     cctggccttg ccggccgtgc tggcgccgtg gttcgggcac cgcgcctggg ccgccagcgc    253320
     cacggcatgg tggtatcgcg tctggtggat gctgtttgtg ttgctggaag tatccacgcc    253380
     gcagttcatc gccgaatacg acacccggcc caaccgcctg tatttcgagt acctggtgca    253440
     tccgcgcgaa gtcgcctcca tgctgtggga aggctacaag ggcgtgctgc tggcatcctt    253500
     cgtggtgctg gtgctggccg cctggctggc cgtgcggctg tttcccaccg gccgccagga    253560
     cggcttcatg aagtggtgga agcgcccctt cgtcaccctg gcggtgctgg ccgtggtggt    253620
     gctggccgcg cgcggcaccc tgcagcaccg gcccatcaat gcctccatgg tggccttcag    253680
     cagcgacgcc atggtcaaca cgctgccgct caattcgctg ggcaacgtgc tggacgcggc    253740
     ctatcgcctg caggacgagc gctcgtcggc cgccttgtat ccgcccatga aaaccgagga    253800
     gatgaaccgc atcgtgcggg cggcggccgg gctggaagat ccgccgctgg acgcccgcta    253860
     ccccagcctg cacaagcaga cggccaccgt gcgccgcgac aagccgctca acctggtgat    253920
     catcctgcag gagagcctgg gcgcgcagta cgtgggcagc ctgggcgggc gcgacctcac    253980
     gccccagctg gatcgcctgg ccaaggacgg ctggatgttc aaccgcgcct atgccaccgg    254040
     cacgcgctcg gtgcgcggcc tggaggcggt caccgcgggc ttcctgccca ccgtggccga    254100
     ggcggtgctg aagctgccgc gctcgcagac cggcttcttc accctggccg acctgctggg    254160
     ccgccacggc ttccattcgc gcttcatcta cggcggcgaa gcgcacttcg acaacatgcg    254220
     cggcttcttc ctgggcaacg gcttcaacga ggtgatcgac cgccagtcgt tcgtcgatcc    254280
     ggtgttcgtg gggtcgtggg gcgcgtccga cgaggacatg ttcaaccagc tcgatcgcct    254340
     gctgcgcgcc gacgacggca agtccacctt cacgctggcc ttctcggtca gcaaccattc    254400
     gccgtgggaa tatccggcgg ggcgcatcga gccggtgggc gacccggcct cggtggacaa    254460
     caccgtgcgc tacgccgact gggccatggg ccagttcttc gacaaggcca ggaaggcgcc    254520
     gtactgggac aacaccgtgt tcctggtgat cgccgaccac gattcgcgcg tgtatggcgc    254580
     caacctggtg ccggtgcggc atttccagat cccggcgctg atcctcggcg gcacggtccc    254640
     gccgcgcagc gacgatcgca tcgtgagcca gatcgacatg gggccgaccc tgctgtcgct    254700
     gatcggcctg gacaacgtca accccatgct gggcgcggac ctgacccagc gcgaccccaa    254760
     ccgggccatc atgcagtatg gcgacaactt cggctacctg aagggcgatt cgctgctggt    254820
     catcgagccc ggcaaggacc cgcgcgagta ccgctatacg gcggcggcgt ccatgcgcga    254880
     cgagaagtac atccccatcg acatcgaccc ggcgttgcgc gacgaggcgc tggccttcgc    254940
     cctgtggccc agctgggcgt accgcgaaga gcgctacaag ctgccgaagt aggcccgcaa    255000
     ggaaaaaagg tgcctgtccc ggttgggaca ggcaccttcg tcacccgcgg ggcgttgtgg    255060
     gcccgcggga gatggtgccg ggggagccag gcaccggagg ggattacttg gcggccagca    255120
     cggttcccac gcagtcgccg aagccgatgc ggggatagcc gggcttgctg cattcggcgc    255180
     gcatgatgat ctggtcgccg tcctgcagga aggtgcgctg ttcgccccag ggcaggtcga    255240
     gcggctgctt gccgccgttg gtcagctcca gcagcgagcc cgcctcggag gcttgcgggc    255300
     cggacagcgt gccggtgccc atcatgtcgc cgggttgcag gttgcagccg ttgaccgtgt    255360
     ggtgggccac cagctgcgcg atgttccagt aggcgtcgcg gaagttgctg cgcgacagca    255420
     gcgccggctg cgcatgcttg gcgcgcgact gctcggtcga gatcagcact tccatctgca    255480
     cgtcgaacgc gccgtgcgcg cgattctcgg ccgattccag gtacggcagc ggctgcgggt    255540
     cggcggcgtc gcgcgtccac gcggcgcgga agggctccag cgcttccagc gtgacgatcc    255600
     agggcgaaat cgtggaggcg aagttcttgg ccaggaaggg gcccagcggc tggtattccc    255660
     aggcctggat gtcgcgcgcg gaccagtcgt tcaggatgca caggccgaac acgtgcgatt    255720
     cggcttcgcc cagcgcgatg cgctcgcctt gcgcgttgcc gcggcccacg aagatgccca    255780
     gctccagttc gtagtccagc cgctggcacg ggccgaactg cggcgcctcg ccttcggccg    255840
     ccggacgggt ctggccgacc gggcgcgcaa agcgctggtc cacgccgatg ctggaggcgc    255900
     ggccgtgata gccgatgggc acccacttgt agttgggcag cagggggttg tcggggcgga    255960
     actgcttgcc cacggcggtg gcgtggtgca ccgagatata gaaatcggtg tagtcgccga    256020
     tgtgcgccgg cgtggtgtat tcggcctcgg cctgcgccac cagcagcggc tcgatgcgcc    256080
     cctgcagggc cgagcccgtg cgcagcgcgc gcgacagcgc caggcgcagc gcgctccagt    256140
     gcgcctggtc gagcgccatc agcgcgttga gccgttcgcc ctggcaggcg gccagcgcgg    256200
     ccgcggcggt gccgtcgaac ggcgcctggg cggccagcgc cgccaggtcg acaatggcgt    256260
     cgccgatcgc cacgccgggg cggaacgggt cctgcgtacc cttgcggcgg aacgcggcga    256320
     acggcaggtt ctggatcggg aacgaggtgt cggcggcgtt ggcgctggca acccagcttt    256380
     gcagggctgg atcgtgggtt tcgttgagct tgctcatggc tgcttgtctc tgcttttgaa    256440
     tcggaaaatg gccgggccgc aatgcccaac ggcgatgaac atcgcgctca tcgccgctgc    256500
     atgccggcgc cggggcgtcg cgggctcagg cctgttcggg gtcgaagtgc ttctgcaacc    256560
     cctgccagca ctgatagtag tcatcctggc gctggggcga agccagggcc tgcgccgtgg    256620
     ggcggatcac gcggcgcgtc tcgaacatga aggccatggt atcgcgaatg tagtgggcct    256680
     ggctggtatc ggcatggctg gctttctcga aggtgtcggc gtccgggcca tggccgctca    256740
     tgcagttgtg caggctggcg ccgcccggcg cgaagccttc ggccttggcg tcgtagacgc    256800
     cgtggatcag gcccatgaat tcgctggcga tattgcggtg gaaccagggc ggacggaacg    256860
     tgttctccat cgccaggatg cgcggcggga agatggcgaa atccatgttc gcggtgcccg    256920
     gggtgtccga gggcgaagtc agcacggtga agatcgacgg atcggggtgg tcgtagctga    256980
     tcgagccgac cgtgttgaag ttgcgcaggt cgtacttgta gggcgcgtgc gtgccgtgcc    257040
     aggccaccac gttcagcggc gaatgggcga tcggcgcgcg ccagaagccg ccggtgaact    257100
     tggcgatgag ctcgaaatcg ccctcgacgt cttcgtacca ggccaccggg atctggaagt    257160
     cgcgcgcgtt ggccaggcag ttcgagccga tggggcccag ttccggcagg cgcatggccg    257220
     tgccgaagtt ctccagcatg tagccgcgcg ccacgtcgtc gagcagttcg acgcgcaggc    257280
     gcacgccgcg cgggacgacg gcgatttcat agggttcgat gtcgatcagg cccagttcgg    257340
     tggccaggcg caggcggccc tgctgcggca cgatcagcat ttcgccgtcg gcgttgtaga    257400
     agaagcgccc ctgcatcgag cggttggctg cgtacaggtg gatgcccacg ccgctttgct    257460
     cctcggggcc gccgttgccg ccccaggtat gcatgccgtc gatgaaatcg gtgggcgcgt    257520
     ccggcatcgg cagcgggctc cagcgcaact ggttgggcgt gaccggctgg cggccgaagt    257580
     cgctcagcca gcgctgcgcg ccggcgaacg gcgcgaacgg caggtgctgc acgcccggac    257640
     ggatgcggta cagccaggag cggcgattct cggcgcgcgg ggcggtgaag gccgtgccgg    257700
     acagttgctc ggcgtacagg ccgtagggac agatctgcgg cgaattgcgg ccggcgggca    257760
     gggcgccggg cagggcttcg gtggcgcagg cgttgccgaa gccggtctga tattgcaagg    257820
     acatggatgc ctcctggcgg tgcggcctgg ttcggcgcgg tggccgtccg ggcttttttt    257880
     cgtgggggcg gcgcgcggga agcggccgtg gaaaaagcgc gttcgagcca ttctgcgcaa    257940
     aattgcccgc tatggctacg ggaatgcaaa aatagtggct ataactttcg tgaataatgg    258000
     tgctccatgg cggaactgcg caacatcgat ctcaacctgc tggtgatctt ccagcgcctg    258060
     ctgcaggagc gcagcatctc cgccgtggcg cgccagctcg acctgtcgca gccggcggtc    258120
     agcaatgcgc tgcggcgcct gcgcgcggcc tgcggcgacg atctgttcgt gcgcacggcg    258180
     cagggcatgc agcccacgcc gcatgccgag cgcctgggcg ggccggtggg cgaggcgctg    258240
     gcgctgctgt cgcatgcgct ggacgccacc caggacttcg agccgcaggc cagcacacgg    258300
     cgctttcgca tcgccatgtc ggatgtcggg gaaattcatt tcatgccgcg cctgatggac    258360
     cagtgcgcgc gccatgcgcc gggcgtgcgc atcgattcgc tgcgtctgca gggcgccgac    258420
     ctgcagcgcg agatggacgc cggccgggtc gacctggcga tcggcgcgtt cgccgacctg    258480
     ggcggcgccg tcatgcagcg catgctgttt cgccagggct acgccacgct gtatcgccag    258540
     gggcatccca gcgcgcacga gggcatgagc ctgaaggcgt tccgggccgc gcatcatctg    258600
     gtggtgtcgc acgccacccc ttacgggcag gtgaaccagt cgctggagcg cgccggcgtg    258660
     acgctgggcg agcacttcag cgtgccgcat ttcgcggcgg tgccgtacat cgtcagcacc    258720
     accgatctgc tggccacggt gccgcagaaa ctggcggcca gcgccgcccc gcatttcggc    258780
     ctgggcttgc tgacgccgcc cctgcgcatg cccacgctgc agaccaacct gtactggcat    258840
     cggcgcttcc agcgcgacag cggcagccag tggttgcgtg cgctgatcgt gcaggcgttc    258900
     gccgacgcgc cctgaacggc cggctcaggg cgccggcggg gcgacgacgg actggcgcgc    258960
     gtgctccagg gctgcgcgca gcaccgccat gtcgccgata tggttggcta gcagcaggat    259020
     cagcgcggcg ttcagctcgc ggctctgttc gtcgctgagg tcgcggtgcg tgtctatcag    259080
     cgcttcgtag aaattgtcgg ggcccgccag gttgggcgtg gtgatcaggg gcatgatggg    259140
     ctcctttacg cgcggccgat ggcgcgcgcc agcgcccgcc ggacggcctg ggcgtcgaag    259200
     gcgcgaaagc gcgccgcaat gtgttggtcg gggcggatca ggtagcaggt gccgggccgg    259260
     gcgtcgtagc ggcgggccag ccagccttcg ctgtcctcga ccacgcgcac ccctgcgggc    259320
     gcggcggccg gcgcggcgcc ggcgtcgcag accaggatgg gctgcacggg cacctcgccc    259380
     tgctgcagcg cccgcagcgc gtccagcata tcggcccgcg gcgtctcggc gccgcagaac    259440
     agcgccagcg cgaacccgcc atcgagctgg gacagccacc agccgggctg cgcgtccgcc    259500
     cgtacgggcg cgtccagcgc cacggcgccc ggccgcatcg tgccggcata ggggtcgctg    259560
     tcgggcgtgt tcagcggcga gtcggcgtag gcggccggca ccgacaggcg gccgctgttg    259620
     accagcgtgc gcgcgaacgg atgctggcgc gccaggttga gcacggcgtt gcggaaggtg    259680
     cggctgactt cgctcttggg cgtgatgaag tcggtcgagc gcgatgagtt caggatgttc    259740
     tcgtcggcgg cgtattcgcg ctcggcggcg tagctgtcga tcagcgattc gggggcgtgg    259800
     cccgccagca ccagcttcag cttccaggcc aggttctcgg cgtcctgcac gccgctattg    259860
     gcgccgcgcg cgccgaacgg cgagacgcgg tgggccgaat cgccggcgaa caccacgcgc    259920
     ccatggcgga aatggtccat gcgctcgcag gcgaaggtgt agacgctcac ccactccagt    259980
     tcgaagtcgg cgtccgggcc cagcagggcg cggatgcgcg gcagcacgtt ctcgggcttg    260040
     acggcctcga cagggtcggc gttccagccc agctggaaat cgatgcgcca gacattgtcg    260100
     ggctgcatgt gcagcaggac cgactgattg gggtggaagg gcgggtcgaa ccagaaccag    260160
     cgctcggcgg gataatcggc cgccatcttc acgtcggcga tcaggaagcg gtccttgaat    260220
     acccggccat gggtttccag gtccagcagc ttgcgcaccg gcgagcgcgc gccgtcgcag    260280
     gcgaccagcc agtcggcatg cagggcgtag gcgccgtcgg gcgtgtcgac cgtgacctgc    260340
     acgccatcgg cctgctgcgc cacgcccacc accttgcttt tccagcgcag ctcgatgccc    260400
     ggctgggcgc tggccagttc gtgcaggtag ccctcggcgt aatactgctg caggttgatg    260460
     aaggccgggc gccggtgccc gggctcgggc agcaggtcga agcgccagac ttcctggtcg    260520
     cggaagaaca ccttgccgac gttccacgat acgcccttgt cgaccatgcg ctggcccacg    260580
     cccaggcggt cccagatctc cagcgtgcgc ttggcgaagc agatggcgcg cgagccggtc    260640
     gacaggcggt agtcgtcatc cagcaccacg acccgcaggc cttgccgcgc caggtccagc    260700
     gccgtggtca ggcccaccgg gcccgcgccc accacgatca cacagtgccg ggccggcgtg    260760
     tcgcgctgct ggtcggcgca tttcgtatag gcgaactcga tcgcctggta gtcgatgtct    260820
     cccacgactg tctcctgcgt ggcgggtatg tcttggtctt ttgttcatgc agggcgcgcg    260880
     gccggcgcaa aggccgccgg ccgggcccat cgatgcggcg cggcggtcag ccttcgagct    260940
     gctgccacat ctcgatgtcg cgcttgtcgg tccagatgcg cggatcgtag tggccggtcg    261000
     cctcgtcgta ggcgcgcgag acgttgaacg gcatgcagtg gtcgaagatc acccactggc    261060
     tgtagcgcgg cttcatgaaa tcgtagacct cgcggtaaat cgtcttgagg tccttgccat    261120
     cggccacgcc gcggttgacg gcggcgtaca ggtcggtcag gaaggcgcgc gtgccggcca    261180
     ggccctggcg cacttcggtg gcgctcttga gcgccgggcc gcggcccggg accattttct    261240
     cggcctcgaa gcccgccagc gcgtccagcg tggccggcca ttcgcggaaa tagcagtcgc    261300
     cgcagtacgg ggtggattgg tactcgacca ggtcgccggc gaacaggatc ttctgctcgg    261360
     gcagccaggc gatggtgtcg cccttggtat ggccgcggcc gacctgcagc agcttgactt    261420
     ccaggttgcc caggtcgacc gtcatttcgc ccttgaacgt catggtgggc cacaccaggc    261480
     cgggcgggat cgattcgacg ttgcggaaca ggcgcgggaa gcggccgatc tcgctggcct    261540
     tgtcctgttc gccgcgctcg gcgatcaggt cgtaggtgtc gcggctggcc aggatttcct    261600
     gggcgccgta ggccgaggcg ccgaacacgc gcacggcgtg gtagtgggac agcaggatgt    261660
     acttgatggg cttgtcggtg acttcccgca cgcggcggat cacgtcctgg gccatgacgg    261720
     gcgtggcctg ggtatcgacc accatgaccg cgtcgtcgcc gacgatgatg ccggtgttgg    261780
     ggtcgccttc ggccgtatag gcgtaggcgt tgtcggagag tttttcgaac gaaacgacct    261840
     tgtcttccag gtcggcatgc gaggcgaatt gtttgctcac ggtgggctcc ttccacttat    261900
     acgaatgcgt ggaaggaaat atagcgcggc gtttgttttt gtgcaatacg tttgctatag    261960
     acgaatttcc tagcgtttct ggcagctcgg acagaaatac gtggcgcgct ggccctgcac    262020
     caggcggcgg atcggcgtgc cgcacacgcg gcagggcagg ccggcgcgct cgtagacggc    262080
     ggcgtgaatg gcgaaatacg cgcccggctc gccgctggcg ccgacgtagt cgcgcagcgt    262140
     gctgccgccg gaatccagcg cgtccgacag ggtggcgcgg atggcggccg ccagccggtc    262200
     gcagcgcgcc gccgagacgc gctgggcggc cgtgcgcgga tcgatgccgg cacgaaacag    262260
     gctttccgat gcgtagatgt tgcccacgcc caccacggcg tcgccggcca gcagggcctg    262320
     cttgatggcg acccggcgtc cgcggaagta ggcgtgcagc cagcgcccgt caaagcgcgg    262380
     gtcgaacggt tcgatgccca ggcgggccag cagcgggtgg gcggcgatcg ggccggcctc    262440
     gtcggggtgc cacagcaccg cgccgaagcg gcgcggatcg tgcagccgca ggacggcgtg    262500
     gtcgaatacc cagtcgacgt ggtcgtgctt gcgcggcgcc tcctgctcgg gcacccggcg    262560
     cagcgatccg gacatgccca gatgcacgat ctgcacgcca tggtcgaagc gcagcagcag    262620
     gtatttgccg cgccgcccgc attcgagcac ggtgcggccg gccagcagat cgggcagggc    262680
     gggtggaatg ggccagcgca tgcgcgcttc gcgcacgacc aggcggcgta gcgtccggcc    262740
     cgttatgacg gtgtcgattc cccgtcgggt ggtctcgact tcaggcagtt ccggcatgag    262800
     ccagtgtaag atcatcaatt gcgtgtacga agattgtgcc atcaaccgga cgggccgcgt    262860
     gaagttgtcg ctcaaacaca ttaatttcgg agtagccgcg ctggcgctgg cgttggcggg    262920
     cttgcagtcc ctacctgcgc aggccgccga ggtgcgtccg cgcgatgcca ccggcccgcg    262980
     cctgatccag ccgagcaagc agcccgagac cgaagtcatc cgcctgcggc cggggcaact    263040
     gccctatgtt tcgcttaccg ccgacatctt ctatcgcatc gtcggcgccg aactggccgc    263100
     acagcgcggc atgtacggca ccgccgccgc cacgctggtg acgctggcgc gcgagacggg    263160
     cgatccgcgc ctggcccgcc gcgggctgga gttccagctt gccgggggca acctgccggg    263220
     cgccctggat gcggcgcgcg cctggtccag cctggcgccc aacgatatcg aggccagctc    263280
     caccgagctg gcgctggccg ccgccaacgg cgagacctcg gggctggcga cggcgctgcg    263340
     caagcgcatc gacacggcgc gcgacaagcc ggcggccatc gtgcaggcca tgggcgtgct    263400
     cagccgcctg aacgaccgcc gcctggcgct gcgcatcctg gacgaatcgc tcagcgacag    263460
     cgcccgcaag ctgcccgccg cccacctggc cttggccgac gtggcgcagg ccgccggcga    263520
     ctacccgcgc gccgccaacg aagcctacgc cgcgctggcc gccgacccca agtccgaggc    263580
     cgccgcgcag cgcgtgctcg aatacggcgc caaggtcgac gccacgcgcg cgcagcacca    263640
     ggcgcgcgcc ttcatcaacc gcaatccgga cgcgcgcaag ctgcgcctga tgctggccgg    263700
     ccagatcgcc gacggcggcg actacgacgg cgcgctggcc gagctgcagg cgatggcgcg    263760
     gcgctcgccc gaggatttcg acctgatgtt catgcaggcc cagctggcct acaaggcggg    263820
     acgcctggac caggcgcgcg gctacctgca gcaatacctc gacgtgcaga accagcgcca    263880
     gatggccacc gcgccgggcg ccaccgacgc cggcgccgcc gcggccgacg cccacgtgct    263940
     gctgtcgcgc atcgccgaag accagggccg ctacgacgag gccatccgcg agctgggccg    264000
     catcgacgac ccggccatgc gctattcggc gcacatgcgc caggccacgc tgcgggcccg    264060
     ccaggggcgc atcgacgacg cgctggccat ggtggaccgg gccgatccgc aggacgacga    264120
     agagcgcacg ctgggcgtgc tgaccaaggc gcagatcctg cgcgacgccg accaggtcga    264180
     tcgcgcggtg gctatcctgg tggcggccga caaggccatg cccgacacgg tcgagatcaa    264240
     gtacgaactg gccatgctgt acgagcgcca ggggcgcatc gaccagctcg agcgcctgct    264300
     gcgcgaagtc atcgcgctcg accccgacca tgcccatgcc tacaacgcgc tgggctacac    264360
     gctggccgac cgcaaccagc ggctgcccga ggcgctggac ctcatcaccc aggcgctcga    264420
     gctgtcgccc gaggatccct tcatcctcga cagcatgggc tgggtcaaat tccgcatggg    264480
     cgagccttcc gccgcgatcg agtacctcaa gcgcgcctat gcgctgcgcc ccgaggccga    264540
     catcgccgcc cacctggccg aagtgctgtg ggtgcagggc gagcgcgaca gcgccaccga    264600
     actgctgcgc accgcctacg ccaaggatcc caagaaccgc gccctgctcg acacgatgcg    264660
     ccgcctggag gtgcgcccgt gagcgcctgc ccggcgccgc gctcgccctt ccgctggctg    264720
     cacgcattca cgctgtgcct gctgctggcc gtgctggctg gctgcgtcag cgtgcccaag    264780
     cccatggccg gcgcgggcga ggacgtgttc tcgcgggtgg gccggttcgc catcaccgtc    264840
     acggagtccg acggcaagca gcaggccgtg cagggcggtt tcgcgtggcg cgacgatggc    264900
     ggcagctatc tgctggacct gaccaatccg ctgggctcga ccgaggcgcg cgtcgaaggg    264960
     cgccccggca tggccgtcct gacacgcgcc aatggcgagc gcctggcggc cgagcatccc    265020
     gatgcgctgg ccgaggacgc cctgggcagc ccggtgccgg tgacggggct gcgcgactgg    265080
     ctgcgcggcc gcctgatggc cggcgcggcc ccggatggcc tggagcgcga cgcgcaaggc    265140
     cgccccacgg ccttcgagca ggacggctgg aacgcgcgcc tgagccgcta cgacgcgcaa    265200
     ggcccgcaac tgctggtgct gcagcgccag gagcccggcc gccgcatcct ggtgcggctg    265260
     gtgattaccc agccctaggc gggcggcggt ctagaatagg ggcatcccca gcccctcgct    265320
     tccgccgtga cgctctacga cgtacccgca cccgccaagt tgaacctgtt tctgcacgtg    265380
     gtgggccgcc gcgccgacgg ctaccatctg ctgcagaccg cgttccgctt catcgacctg    265440
     gccgacaccc tgcatttcga agcgcgcgcc gacggtgcca tcggccgcgc gtacgaactg    265500
     cccggcgtgg ccgagtccga cgacctggtc gtgcgcgccg cgcgcagcct gcagcgcgcc    265560
     accggcaccc gccagggcgc gcagatcggc ctgcacaagc gcatcccgca gggcggcggc    265620
     ctgggcggcg gatcgagcga cgccgccacc accctgatcg ccctgaaccg gctctggggc    265680
     accggcctgt cgcgcagcca gctgatgcaa ctggcgctgc cgctgggcgc cgacgtcccg    265740
     gtcttcgtct tcggccagtc ggccttcgcg caaggcgtgg gcgaagacct gacggccgtg    265800
     gcgctgccgc cggcggccta tctggtggtg cagcccgacg ccggcgtgcc cactgccgcc    265860
     attttttccg accccgattt gacaagggat tgcgcttcgg tcacaatagc ggactttctt    265920
     gctttgccaa ctttctgctt tggcaggaat gatctggagc cggtggtgtt gcggcggtat    265980
     cctgaggttt caggggctgt tcgctggctt ttcgagcacg gtttgcgtgt tcggatgtcg    266040
     ggatctgggg cgtgtctttt cgccgaattt cccaccctgc cggaagccgt tttggcacaa    266100
     gaggaaataa ccgctacaat gcgcgtcgct ggaaaaacaa ccagccacac gcatcccggg    266160
     ttccggttgg tacaggctag tactggattg actgaacatc cgttgcggaa ctggattgca    266220
     agctagttgg ggagtcgcca agctggttaa ggcaccggat tttgattccg gcatgcgaag    266280
     gttcgaatcc ttcctcccca gccaaaccaa tacataaaaa agctgttgaa cgcgcccgtc    266340
     agacactggc tccagttcag cagctttttt gttttacgag attttcagcg cgcacctgcg    266400
     tacgtgacct gaaaccgacc actgcatcaa catcatggca aacgacagct tcatgatttt    266460
     cacgggcacc gccaacacgc ggctggccgt ggacgtagtc aaccacctcg acatgtcgct    266520
     gggaaaaatg accgtcggtc gtttctccga tggcgaggtg atggtcgaga tcaacgagaa    266580
     cgtgcgcggc aaggacgtct tcgtgctgca gcccacctgt gcgcccacga acgacaacct    266640
     gatggaaatc atggtgatgg tcgatgccct gcgccgcgcc tcggccggcc gcatcaccgc    266700
     cgccatcccg tatttcggct atgcccgcca ggatcgccgg ccgcgctcgg cgcgcgtggc    266760
     gatctcggcc aaggtcgtgg ccaacatgct gcaggtcgcc ggcgtcgacc gcgtgctgac    266820
     catggacctg cacgccgacc agatccaggg tttcttcgac atcccggtcg acaacatcta    266880
     tgccggtccg atcctgctgg gcgacatctg gcgccgcaat ttctcgaacc tggtggtggt    266940
     gtcgcccgat atcggcggcg tggtgcgcgc ccgcgcgctg gccaagcagc tggaagccga    267000
     cctggccatc atcgacaagc gccgtccgcg cgccaacgtg tcggaagtga tgaacatcat    267060
     cggcgaagtc gacggccgca cctgcatcat catggacgac atggtcgaca ccgccggcac    267120
     gctgtgcaag gcggcccagg ccctgaaaga ccgcggcgcc ggcgccgtct acgcgtattg    267180
     cacgcacccg gtgctgtcgg gcggcgccat cgagcgcatc gagacttcct cgctggacga    267240
     gctggtcgtc accgacacca tcccgctgtc cgagcaaggc caggcctgcg gcaagatccg    267300
     ccagctgtcg tgcgccgcgc tgctgggcga gaccattctg cgcatttcca acgccgagtc    267360
     ggtcagctcg ctgtttgccg actgatcggc gcccgtattc ccgaatttgt gcgccgctgg    267420
     tcgcggcggc gcgcaaaaac cacgcagcgc atgtcgcgcc gcgtgtctta accggcgatc    267480
     cattcgccag attgtttgga gttttccatg aaattcaacg ccactgcgcg tagcgtccag    267540
     ggttcgagtg cgagccgccg cctgcgccgc gcgggccgcg tgcctgccat cgtttacggc    267600
     ggtaccgctg cccccctgaa catcgaactg gatcacaacg agatctacca tgccctgcgc    267660
     aaggaagaat tccacgcgtc gatcctgaac atggtcatcg agggcggcaa gaccgaagaa    267720
     gtgctgctgc gttcggttca atggcacgcc tacaagccgc aagtcatgca cgtcgacttc    267780
     cagcgcgtcg atgccaacca ggccctgcac accaaggtgc ccctgcactt catcaacgcc    267840
     gaagtgtcgc cggccgtcaa gctgagcggc gcgatcatct cgcacgtgct gaccgaactg    267900
     gacatcacct gcctgccggc gctgctgccc cagttcatcg aagtcaacct gggcgacctg    267960
     ctgggtggcg gttcgatcca cctggccgac atcaagctgc ccaagggcgt gacgttcaac    268020
     gcccacggcg gcgacaccaa ccccctgatc gccgctgcgg tcgtcaaggg tggcggtgcc    268080
     gctgacgaag gcgacgctgc cgccgagcaa cctgccgcct gagtgcgcca gggcgcggcg    268140
     gcgaccgtcc gccgcgggct cgtgcccgac gtccccgaaa ccctgcgcat gcgatttgca    268200
     tgcgcagggt tttgtacttt acaaatacgc gtcccgatgc atacgccacc atgtcagatc    268260
     ccattcgcct gatcgtcggg ctgggcaacc ccggccccga ctacgaaacg actcgccaca    268320
     acgccggttt ctggctcgcc gaccacctgg ccgacgacct gcgcaccgcg tttgcgctgg    268380
     agaaagggtt cttcggcatg ctcgccaagg cgcgccacgc gggcgagaac gtcgtgctgc    268440
     tcaagcccat cacctacatg aaccgttccg gccagtccgt cggcgcggtg gcgcgcttct    268500
     acaaactggc gcccgaacag gtgctggtgc tgcatgacga actggacctg ctgccggggc    268560
     aggtcaagat caagcagggc ggcggccacg ccggccacaa tggcctgaaa gacatccagg    268620
     ccgcgctggg cagccccaat ttctggcgcc tgcgcatcgg catcggccat ccccgcagcc    268680
     tcggcctggc gcagcaagtc gccgacttcg tcctgcaccc gccgcgccgc gaagaacagc    268740
     agcagatcga tacggtcatc gaccgttgcc gcgccgtcgt gccggcgatg ctggccggcg    268800
     atttcgcgct ggccacgcgc gagctgcacg gcgccaacgg ggcttgagcg acgtgaccac    268860
     ggcgcggcag ggcgcggcgc gcgccacgac gtttcgccag gacctggccg attgctggcg    268920
     cttcctgcgc cggcccaccc tgagcggccg cctgcccggg cggcgcgccg acagcggctg    268980
     ggccagcgac tggcggcccg gcgtcggcgc ctcgcgcctg ctggcctggg ccgcggtgct    269040
     gtgggccctg aacctgttcg cgctcggccc catcgccgtc accgtggccg gcgccggcgg    269100
     cgccatgcac cggctggatc cggccaacat cccctggctg accgccatac tatgggcgcc    269160
     cctggtcgag gaactgctgt ttcgctacgg cctgcgccgg cccgcgcagg cgctgtggtt    269220
     ctgccccatg gtgctgcccg ccatcctgtg gggcgcgcag ggctggacgc tggcgctcgt    269280
     cgccgtggca gtctggctgg cgtggctgtc gctgcgccga ggacgcgcct cgctggccgg    269340
     ctgggacacc agctggcgcc gctactacag ctaccgtttc gggctggtgt tccatctggt    269400
     ggcgctcacc ttcgccgcgg tccacctgaa caacttctcg ctcagccaga cccccgtatg    269460
     gctgctgccg ctgctggtgc tgccccaatg ggccaccggc ctggtgctgg gatggatgcg    269520
     ggtgcggcgc ggcatcggcg cggcgatcgc gctgcacgcg ctgttcaacg gcggcccggt    269580
     actgatgatc tggctgctga tgacactgat gccggccggc gcctgaaggc agggcgccgc    269640
     cacaggcggt aaactgcacc gttaacgctt tgattacaca tacttagaca ggaattccat    269700
     ggctctgcaa tgcggcatcg tcggcctgcc caatgtcggc aaatcgacgc tcttcaacgc    269760
     cctgacccgc gccggcatcg ccgccgagaa ctatccgttc tgcaccatcg agcccaacgt    269820
     gggcgtggtg gaagtgcccg acccgcgcct ggacaagctg gccgagatcg tcaagcccga    269880
     gcgcatcctg ccggccaccg tcgaattcgt cgacatcgcc ggcctggtgg ccggcgccag    269940
     ccagggcgag ggcctgggca accagttcct ctcgcacatc cgcgaaacca acgccatcat    270000
     caacgtggtg cgctgcttcg aagaccccaa cgtggtccac gtcgccggca aggtcgaccc    270060
     catcgccgac atcgaagtca tcgagaccga actggcgctg gccgacctgc agaccgccga    270120
     gaaagccctg caccgccact ccaagaccgc ccgttccggc gacaaggacg cgcagcgcct    270180
     ggtgaccgtg ctggagaaat gcatcgccca gctcaaccag gccaagccgg tgcgcggcct    270240
     ggacctcagc gacgaagagc aggccctgat cgcgcagctg tgcttcatca ccgccaagcc    270300
     cgccatgtac gtgggcaacg tcagcgacga cggcttcacc gacaacccgc tgctcgagcg    270360
     cctggccgag ttcgccaagt cgcgcaacgc gcccatggtc gccatctgcg cggccatcga    270420
     atccgagatc gtcgacctgc ccgaggaaga ccgccaggcc ttcctgtcgg acatgggcat    270480
     ggaagaaccc ggcctgaacc gcctgatccg cggcgccttc accctgctcg gcctgcagac    270540
     ctacttcacc gccggcgtga aggaagtgcg cgcctggacc atccccatcg gcgccaccgc    270600
     gccgcaggcc gccggcgtca tccacaccga cttcgaacgc ggcttcatcc gcgcccagac    270660
     catcgcctac gaagacttca tcgcctgcaa gggcgagcag ggcgccaagg aagccggcaa    270720
     gatgcgcgcc gaaggcaagg aatacgtggt caaggatggg gacgtgatga actttctgtt    270780
     caacgtctga cgatttttgc tggatctcgg ttgcgctcag tagcgcttgg tggacaggtt    270840
     ggcccgttgt aaatcaatgg gttgcgtaaa caatacggtc tgctgagcgt tcctattgtt    270900
     catcgaggtc cagaaaattc gggggcagcg ttgggggtac tcgtgttcaa ccgtgggggt    270960
     acttttcccc gcagtggagt ccaacgatgc ccgaaaacct actcaccgac ctcaaggtca    271020
     ggtcggccca atcgaccgat cgagattgga aactatcgga cggcgggggc ttgttcctgc    271080
     tggtcaagtt caccgggggc aggctctggc ggtggaagta ccgcctgcaa ggcaaggaga    271140
     acctctttgc cattggcggc tttcctcagg taagccttgc ggaggcgcgc gctgcccgcg    271200
     agaaggcgcg tgccttggta aagcaaggca tccatcctgc ccatgaacgg cggcaggtca    271260
     agcagcgcaa cctggaggcg ctggaggaac gcaagcgcgc acgtgaaagc tcgtttgcca    271320
     aggtggcgca agcgtatctg gccgagatca aaccggtctt cgcgctcagt tcctatcgta    271380
     cgaaagagtc ccgcatcaga aagtatctgt cgcccaagtt cgatgggatg ccgatgagcg    271440
     acattggcgt caagcagatt cgcccgctgc tggaggaatg caaagcccac ggcgcgtggg    271500
     cagccatcca cgtcaagggc gacctgtcag ccatcttcga gttcgcggtg gtgcgagggc    271560
     tggccgaggc aaatccaatt cccagcctgc gtgggctgct gcgcgtgccg ttcagcgaga    271620
     gcaaggcggc gatgacgcga gagcaaatcc agaagttcta tcaggagttg cgcggctacc    271680
     ggggctatcc ggaaacctct ttgtgcctgc ggctgattgc gctgacagcc tgccgtccag    271740
     gggaagcggc ggatgccgag tgggacgagt tcgactttgc ggatgcattg tggcgtcggc    271800
     ctgcagcgaa gatgaaagcg cggcgtgacc atgtcagtcc gttgcctgtg caggccattg    271860
     ccgtgctgaa ggatttgcag tgcatcacgg gcggtggccg ctatctgttc ccgcaccgga    271920
     gcggcaaggg cttcactacg cccaaccgac tcacctacgc catgcgtgac atgaatctgg    271980
     ggcggggtac gacgccgcat tgctggcgga cgaccttttc gacctgggcc aatgagaacg    272040
     gataccggcc tgatgcgatt gagcggcagc ttgcccacgt ggaaagcaac aaggtacggg    272100
     cgacgtacaa caaggcgctg ctgctggatc agagaaggac gctgttgcag gactgggcgg    272160
     actatctgag tgctgcggag ggtagcggcg cggcatagcg acgatttggc cgggtgtcgc    272220
     aaaacgaatg gacggggcgg ccttttcctt ttctggatag ggccgttgtc ccttgagggc    272280
     cgttcccttg ccatttgtct ttgcccccaa ggctggaagc tggaaatggg taaataatgg    272340
     aataaatagg gtaatttttt aaatattgtc ccatttttag gattgatgtc gcccttcctc    272400
     cccggtcagc catgccagcc ccccacgagc ggtcctatgt tcaggaaatg gggtagtcaa    272460
     acaccgttaa tgaggcattt ttagagacaa tgccccattt aatggctatg attaccccat    272520
     ttacatagcc tgggcttaca tttccatgca ctcgctcaca cccgagtacc ttgccgcgct    272580
     tcgcttcgat ggcacccagg ctgccacgtt gcgcacactg ggcgagtacc agggcaagca    272640
     gcaactctac gctgcgcagt cgccagaagc cctcaagggg ctacgtcaga tcgcggtggt    272700
     ggagtccacc gagtcatcca atcggctgga aggtgttgtc gtagcgcctt cgcggttgaa    272760
     gtctctggtc ctccgcaacg caatgccaaa gaaccgttcc gaacaggaga tcgccggcta    272820
     ccgtgatgcc ctggcgctga tccacgagtc cgccacgcac atgcccttca gcgagggtgt    272880
     tgtgctgcaa ttacataccc tgctgtaccg ctacatgccg caggcgggcg ggcgctggaa    272940
     ggctaccaat aacgacatca tcgagcgtca ctcagacggc acttcgcgtc tgcgcttcca    273000
     gccggtagct gcgcatctta cgccgatggc catggctgat ttgacagggc gctacgcctc    273060
     cgcgctggat cagcacctgg ccgaccccct ggtgctggtg ccgctggcca tgctcgactt    273120
     cctgtgcatc caccccttcc ccgacggcaa cggccgcatg tcccgcttgc tgaccctgct    273180
     gctgctctac cacttcgact atgcagtggg tcgctacatc agcttggaac gcatcttcga    273240
     ggaaaccaag gaaggctatt acgagacgct ggaagccagc tcgcagggct ggcaccaggg    273300
     gcagcacgac gtcaaacctt ggctcgacta cttctggggt gccttgctgc gggcctatcg    273360
     cgagttcgag gagcgtgtcg gcaccatcga gcgggggcgt ggcagcaaag gtgaccgggt    273420
     gcgggcggag atcctagggc gcagccagcc gttctcgatt tccgagattg aagaagcctg    273480
     cccgggcgtg agtcgggaca tggtgcgatt ggtgttgcgg gcaatgaaat cagagggatt    273540
     gatcgaatcg actggcaagg ggcgaggtgc gaaatggatc aagcgagcgt aaggggaaca    273600
     cgatggaact gattgacaac atcagccgct tgctgggtga tgatctcaag caaaccattc    273660
     ggccaggggc gcggctgaag atcgcggcct catgcttttc aatgtatgcc tacgaggcct    273720
     tgaaatccga actggaaaaa atcgacgaac tggacttcat cttcacctcc cccacttttg    273780
     ttgctgacga agtcacagac aagatccgca aagaacgcag ggaattccat atccccaagc    273840
     tcgaccggga acgcagcctg cacggcagcg agttcgaaat tcaattgcgc aaccaactca    273900
     ctcagaaggc ggtcgccagg gaatgtgccg actggatgcg gcgcaaggca aaatttcgaa    273960
     gcaaccgcag caaggcgccg atgcagcaat ttgcctgcgt ggaggctggc ggagcccata    274020
     gcgcctatgt gcctctgcat ggcttcacag ctgtcgatct gggttacagc cagggtaacg    274080
     ccgtttccaa tttggtgaac aaggtcgagg ccccttttgc gaacacctac ctcagtctgt    274140
     tcgatcaaat ctggagtgac cccgaaaaat tggaggatgt gactgcccaa atctgtgagt    274200
     acatcgcgtc cgtctatcag gaaaattcgc cagaaagcat ctactttctg atgctctaca    274260
     acatcttcaa cgagttcctc gacgacatcg acgaagacgt gttgcccaat gaccgcaccg    274320
     gctatgagga caccctgatc tggaacaagc tcttcaacta ccagagggat gcggcaaccg    274380
     gcatcatcaa caagctggaa acctataacg gctgcatcct ggcagacagc gtcggcttag    274440
     gaaagacctt caccgcgctg gccgtagtga agtattacga gctacggaac aagtccgtcc    274500
     tggtgctgtg tccgaaaaag ctggcggaca actggctcaa ctacaaccgc aatctcaaga    274560
     ccaacatctt tgcccgcgac cgcttcggct acgacgtgct gtgccatacc gacctgagcc    274620
     gcaccagcgg cgaatccttc ggtacaccac tcaaccgcat caactggggc aactacgacc    274680
     tcgtcgtcat cgacgagtcg cacaacttcc gtaacaacga cgccttcaag gatcgggaga    274740
     cccgctacca gaagctgatg aacaaggtca tccgcgaagg tgtgaagacc aaggtgctga    274800
     tgctctcggc cacgccagtg aacaaccgct tcaccgattt gcgcaatcag ctcgcgttgg    274860
     cctatgaggg agactccgag aacctcggca agaagctgcg caccagcaag tcggtggaag    274920
     aagtctttcg caatgcgcag accgccttca atgcctggtc caggctcccg ccagaggaac    274980
     gcacgcctcg ggcgatcctt ggcgcactgg acttcgactt tttcgagctg ctggacagtg    275040
     tcaccattgc gcgctcgcgc aagcatatcc agaccttcta cgacaccaag gacatcggcc    275100
     atttccctga gcgtcgcaag cctttgtcat tccattgctc gctgacttcc cgctcggacg    275160
     tgatgggctt caacgagatt ttcgagcacc tgtccaggct caagctcgct gtctatgccc    275220
     cggtcagcta catcctgccg agccgcttga ggaagtacga agagatgtac gacacgcagg    275280
     ttccaggtgg tgcaggaaaa ttcaggcaag ttgaccgcga aaagagcctg caggctctga    275340
     tgacgaccaa tctgctcaaa cgtctggaaa gctccgtcca gtcattccgt ctcacgctgc    275400
     aatccctgca gatcaatcac cagaacacgt tggcgaaaat cgcggtattt aaccagagcg    275460
     gcatcgctgc cagcgtgggc gatctgaccg aggtactgga aagtatcgat gcagaagaag    275520
     atgacccatt cgaagggctg gatcagggtg gcgatgtggg cggcaaggtc aagatcagct    275580
     tggccgatat ggacttgccg tcatgggagc accacctcaa ggtcgatctc gccaacatcg    275640
     acgcgttgct ggcttcgatg tcgaggatca cccccgctga cgatgccaaa cttcagcacc    275700
     ttaaggaact tgttcaggga aagatcacca acccgatcaa ccccggcaac aagaaggtgc    275760
     tgatcttcac tgcttttgca gatacggcag actacctcta cgccaatcta gcgcccgacc    275820
     tgctggctca ccagcaactg cattccggca agattacggg cagtgaccgg cccaagtcca    275880
     cattgcccaa agcatatgac ttccaggaac tgctgacgct gttctcgccg cgctccaaag    275940
     aaaaagctat cgtgctgccc aacgagtcgg cggaaatcga cctgctcatt ggcaccgact    276000
     gcatttccga gggccagaac cttcaggatt gcgactacct catcaactac gacatccact    276060
     ggaacccggt gcgcatcatc caacgctttg ggcgcgtgga tcgcatcggt tcgcccaata    276120
     gcagcattca attggtgaac tactggcccg atatttcgct ggacgaatac atcaacctca    276180
     aggagcgtgt cgaaaaccgg atgatgatcg tagatgtgac cgccaccggc gacgacaacg    276240
     tcatttccgc gcaggccaac gacatggcct accgcaagga gcaactgcgc cgcttgcagg    276300
     aagaagttat cgagttggaa gacctgaaga ccggcgtctc catcaccgac ctgggcttga    276360
     acgacttccg catggacttg ctgaactacg tcaagaccca tggagaactg cataggtccc    276420
     ccaacggcct gcatgccgtc gttccggcca accctgacct gggccttgcg cctggtgtca    276480
     tcttcaccct gcgcaatcgc agctcgggcg tgaacccgcc cgcacacttg ccccaacaca    276540
     accggctgca cccctactac ctgatctaca tcagtcaggc aggcgaggtg atccacgacc    276600
     acaccgaggt caagcgcctg ctcgacctgg cgcgttcgtg ctgcaagggc caggcagcac    276660
     cgattgcgga tgcctgccaa cagttcaaca aaaccacggc ggacggccgc aagatgcagg    276720
     cgtactccga cctgttgaac caagccatcc gctcgatgat cgaggtgaag gaagaaaagg    276780
     atctggacag cctgttcacc ggcggcaaga ccacggcgct cacgggcacc atatccgggc    276840
     tggacgactt cgaactcatc agcttcctcg tgattcagga ggttggatga gtgcgctgat    276900
     cgcttacccc aaacaggccg ccttcgggcg cgttctgccc aagaacaaga tctacgagca    276960
     cggcggagcc aacacccggc tcaaagactt gttcgtcaaa caggtggaac aggtcatctg    277020
     gcagtacaag ctggccccgg agacactgca tgtgcctgcg cgccccggcg taccggaaat    277080
     ccagatcttc agcatccagc tcaaaacgcc ggaactgcac gccgatgtgc tgcgctgcat    277140
     cgacggggcg atcccgttcc ccattgtgtt cgaactgact ttcgacggca gaacgcagat    277200
     ggtcgccgcc tacaagcgcc cgaacgaagc cgacgccagc cgctgtgtgc tctcgggcta    277260
     ctttgcatcg gactggctgc caatggatag cgaacgcacc gcgatgcccg tggccttgca    277320
     tctgggcggc ctgtacgagc aattgctgca ccgcctgatc ccgctgtcag cgcggccaca    277380
     ggaaacactg gccgagctgg tggcgcgcgt cgaacaggca caagccaagc agcgcgagct    277440
     ggataagacc acggcgcggc tggccaagga aaaacagttc aaccgcaagg tggagatcaa    277500
     tgccgaactg cggaagctga gaaccgaact gaacgggtta aagtaaccac gaattgagag    277560
     ccatgcttct gacacgacaa gcatggctct gagaaaggag aaagataatg gccacagcca    277620
     agctgcttag acaacttatt aaaactggaa ctgaaggcaa tcaggacgct ttcaagcgtg    277680
     tttccgaaca gttgattcac gaggagcgca ccaagaatca ccatttgctg gcgaatgatc    277740
     tggagagaat tctctatggt cgccgtaatg ccggtggggg agccaactcg ctgctgagtg    277800
     atcgcatacc taaagataaa gagcgcaacc tgcctctctt acagatcaaa gaggcagtcc    277860
     ggcgtatgga agacgtcgta ttgtcagatg aaaatgcatc cttgctgaat gagttgctgc    277920
     aagaacacca tcgagcggaa gcgctgcaaa gctatggtct gtatcccgcg gatcgcctgt    277980
     tgttttgtgg tccacctgga tgcggaaaaa cgttaacggc ggaggtgctg gccagtgagc    278040
     tgggcttgcc gctggccata gtccgtattg atagcgtggt gtcttctctt ctcggggaaa    278100
     cggcagccaa tctgaggcag gtctttgact ttatagccac cgtgccgatg gttgtcttgt    278160
     tcgacgagtt cgatgcgttg gccaaggagc gtgccgatac tgctgagcat ggcgagttga    278220
     agcgggtggt gaatgctttc ttgcaaatgc tggatgccta tgaaggtaaa agcatcctgg    278280
     tggccgccac caaccacgag cgtatcctcg acgccgccat ctggcgccgg tttgatgagg    278340
     tattggtctt tgagtcgccc aatctggaac agttgcggcg gctgttgagc atcaagctgc    278400
     gtggattgcg ccgtgaattc gagattgagg atgcccgcat cacgagcctg ttcaaaggta    278460
     tgagtcatgc cgatgtggag cgtgttctgc gtcgggcagc caaagacatg gtgctgactg    278520
     gaaaagagtt tctcagtgaa cgacatctgc aatcttccat acgtcgtgaa gatgcccgca    278580
     gggcacgtat acaggggagc taattcgtca tggaggagaa ctttccgcat ctgaatatac    278640
     aacgagaagc gccagtcaat gaaaagcgct cgggaaaccc accgaagcca tttattcccg    278700
     atgatattcc tgctcatgga cgcgggctgc tgaccaagct aggcaatgcc aaagaagaag    278760
     ccaatgaaga tgtaggtggg tttgatgagc gccggctttt ccgcttcacg gtgcagaaag    278820
     gattcaaccc ggatgatctg agaaagattt ccaccgaaat cgaatttgtc agccaggaag    278880
     acgaaaccat tgtcatcggc ttcgccacaa atgccgcact ggcgcagttt gaagcccgtc    278940
     tttccagtat ggctgctggt gagcacgtta ccaataaaga agtgatctat gccctgcaaa    279000
     gtgtggatgg ctggagttct gaaaatcgaa aaggctgggc gctgaagcag caaggcttcc    279060
     ctgatcggga tgagttcatg ctggatgttg agctatggcc gctggaagac agtcatcagg    279120
     cgaggcaaca agcctggcaa gcgtttgaag gctggctggc agaacaacgt atcgagaagc    279180
     tggatcagat caagaagcca gagctgacgc tgtaccgtgt acgctgcaca gccgcacagg    279240
     ctggcatgct gcttcagcat agggatgtgc gatccattga cttgccgccg aactttgcgc    279300
     tggagcgatc ggtcgtcttt caggatattc agaagattcc tgatatccag gctccttcag    279360
     cgcaagcacc aggcgtggtg gtgctcgata gtggtattgc cgatggccat ccgctgctga    279420
     aagtcgctgt cggcgaggcc aagagcttct tgccgggcga aggcccgcac gatgaaaatg    279480
     ggcacggcac acatgttgcc ggtctggctc tttacggtga ctttgaaaaa cacctgcgtg    279540
     ctggcacctt tgtgcccacc ttgcgcttgt acagcggcag aattctcgac aaaaacaatg    279600
     agaacaccac gggttttgtg gaaaaccaga tagaagaagc cgttcgctac tttgtaagag    279660
     agcatggttg caaagtgttc aatctgtctt tcggagatgc caacaagccc tacttgggcg    279720
     gacacctgaa aggcttgtcg gtgacgttgg ataccctctc gcgggaactg ggtgtgctgt    279780
     ttgtggtgtc ctctggcaat catcgaatta atgagcgctc tccggatggt ttggaatggc    279840
     gtgatcagta cccgacctat ctttcgaatg acgactggcg gctcatcgaa ccagcaccgg    279900
     cattgaatgc gctgacggtt ggtagtctgg cgcgccacaa ccaaaccttc aacagccagt    279960
     accattctgc agaccctgca gaactaccga ttgcgcagcc ggatcagcca tcgccattca    280020
     ctcgcagcgg ccattctgtc gatggtgcta tcaagccgga actgacggca tatggcggaa    280080
     actgggcaat caatacacgc gccaactacg cattattgga cagaactgct gggctgggtg    280140
     ttgtatcgac caattaccag tttgcaggcg gccatccttt tatggtggat gtaggcacca    280200
     gcatggctgc accccaagta gcgcatctgg ccgcttccgt actgcatgag cacccggatg    280260
     ccacagccaa tttcgtgcgt gctcaactct gtctgaacgc tgtattgccg caggccagcc    280320
     aacaactgct ggatcagcat aaggcactta aacgtgcgtg tggttatggg caggtggatg    280380
     aaactgcact acatcgctcg ttggaaaacg ccgtcacgct gattacggat ggcaagatcg    280440
     agaacaagcg gcaccacttc tacgaaatac ccgttccgcc ggaattcacc agcggtggca    280500
     aaaaacgcct gcgggaaatt gccgtcgcac tggcctatac gccgcctgtg cgctcaacac    280560
     gcatcaagta ccgcgctaca cgtattgact tcaggctggt cgctgcgcgt gaccttgaac    280620
     acgtcacgac catgttcaac aaggcgacca gaaaggaaga ttaccagagc atcaaggagc    280680
     tggctggcgc cagcattggg caggtggctc gcagcaaagg gacggttcaa gccgatttct    280740
     ggtggttcat acaattccag aaagattccg cactacgaac aaaaaagctg tttgtggtgg    280800
     tcacgcgcaa tgactttccg tggggtgaaa acctgtgtga cagcgaagaa agctattcgc    280860
     ttttggtcag cctgcgtgac aaggagaacc ttctggctca actctatacc caaatcaagg    280920
     cacgactgga tgccagggtt ccgccattgc gtgttcgtgc ctaaaggctg tttgcccgca    280980
     cataaagcaa aaatttcaag aggttgttat tcgtggataa gttaaaaatg cactcgccca    281040
     acctgaccga agacaatatc gcgcgtatcc gcgatctgtt ccccggctgc gtgaccgagg    281100
     cgcgaggtga ggacggctgt gtgaagctgg cggtggactt cgaccagctc aggcaggaac    281160
     tgtccagttc catcgtcgag gggccgcagg agcgctatca cctgaactgg ccgggcaaac    281220
     gcgaggcgtt gctgacggcc aatgcaccga ttgccaagac tctgcgcccg gtgcgcgagg    281280
     aaagcgtgga cttcgatacg acgaagaatc tgttcatcga aggcgacaac ctagatgcct    281340
     tgaagctgtt gcaggagacg tatctcggca aggtgaagat gatctacatc gacccgccgt    281400
     acaacacagg caatgacttc atctacgagg acgactttgc ggaggatgct cgcacttttc    281460
     ttgttcgctc caatcaagtc gatgatagcg gagtgcgttt agttgccaac acagatacaa    281520
     atggacgctt ccactcggac tggctgtcaa tgctttaccc acgtatcaaa cttgcgagaa    281580
     ccctgctatc cgaggatggt gtgatatttg tgtctgctga cgacagcgag attgcaaatc    281640
     tcattcggat ttgcgacgaa atatttggcg aagccaattt tgttgccaac tttatctggg    281700
     aaaagcggac gaatagggag aacagaaagg tggtttcgtc tcgtcacgat tatgtcgtgt    281760
     gctacgcaag aaaccaaatg ccaggcacac ggactctcaa gcagcttccg atgtctgcga    281820
     aggctctggc gaactacaag aatcctgaca acgacccgcg tggactatgg aaatcagacc    281880
     cggcccatgc gcaagctggg cacggaacta aggatcagtt ctacgttttg acggcaccaa    281940
     atggcaagaa acatgaactc gaaagcgggc gttgctggct ctatacagag aaggtgatga    282000
     ataaagagat cgccgatgga aagatttggt tcggcaagga cgggaacggt gttcctcgta    282060
     tcaaaacgta tctcgatgca aaagaacggg gacttacgcc cgagagcatc ctctttgcag    282120
     aagaggtcgg tacgaacgaa agcgcaaaga acctgctgaa agaactcttt tccgggcgtg    282180
     ccgtgtttga cacaccaaag ccggttggac tgatccaaac actcattcaa ctttcatgtg    282240
     acgaaggcat cattctggat tttttcgcgg gatctggaac gacggctgag gccatttttg    282300
     aattgaacac aatggacgga cgtgagcggc gctttattct tgttcaactg cctgaggctc    282360
     ttacagcgga tagtgaggct tataaagcgg gctacaggga cattgcccat gtcgggatgg    282420
     aacgtatccg tctcgcaggg aagagcttca agggtgacac gggttttcgc gtactgaaga    282480
     tcgacacatc caacatggcc gatgtgtatt actcccccga cgcgctggac aaagccaacc    282540
     ttgacctgtt cgtggacaac atcaagtccg accgcacggc agaagatctg ctgttccagg    282600
     tgatgctgga ctggggcgtt gatcttgccc tgcccatcga gaagaaggcc acccagggca    282660
     aagacgtgtt tttcgtggac ggcaatgcgc ttgtcgcctg cttcgacgcg catggcggcg    282720
     tggacgaaac cttcgtcaag gagttggcta cgcacaagcc gctacgcgtg gtgttccgcg    282780
     acgccgggtt caaggacagc gccgtcaaga tcaacgtgga gcagatcttc aagctgttgt    282840
     cgccatccac cgaagtgaag agcatctgag ggggccgcga tgaagctgaa attcaagacg    282900
     caggcctacc agactgccgc cgtacaggcg gtggtggact gcttcaaggg gcaggttcca    282960
     catcacggcg gcattcgcta ccggctcgat cccggcagcc agaaagtagc cccagagagc    283020
     ccgcaagcgg cgctcgcgct ggaggccgct tcgcctgaag ctgcagcgga aaaggaagcc    283080
     gcgtttcgca acgccgactt cacgctgtcg gaaactgcgc tgctggacaa catccaggcc    283140
     gtccagcggg ggcagaacct gccgttgtcg gatacgctgg tcaagaccaa ggttgccaag    283200
     gtcaatctcg acatcgagat ggagaccggt acgggcaaga cctactgcta catcaagacc    283260
     atcttcgagc tgaacaagct gtacggctgg agcaagttca tcattgtcgt gcccagcgtc    283320
     gccatccgtg agggcgtggc caagtcgttg gagatcacgg ccgagcactt cctggaaacc    283380
     taccgcaaga aagcgcgttt cttcatctac aactccaagc aactgcacca cctggagagc    283440
     ttctcgtcgg acgcgggcat caacgtgatg gtgatcaacg tgcaggcttt cgcctcgcgc    283500
     ggggcggaaa accgccgcat ctacgacgtg ctggacgact tccagtcccg caggcccatc    283560
     gacgtgatca gcgccaaccg tccgatcatg attctggatg agccgcagaa gatggaaggt    283620
     gcggcgacgc tgaaatcgct ggaggcattc aaggcgctga tggtgctgcg ctactcggcc    283680
     actcacaaga ccacccacaa caagattcac cgcctcgatg cgctggacgc ctacaaccag    283740
     aagctggtga agaaaatcgc cgtgcgcggc atcgcggtga aggggctggc ggggacggct    283800
     ggctatctgt acctgcaatc cattgagatt tcgagcaaga agccgcccga ggcgcgcatc    283860
     gagttggagc acaagctcgc caatggtgac atcaagcgcg tggtgcgcaa gctcggcaag    283920
     ggcgacaacc tgttcgacct gtcgggcggg ttggatcagt accgcaacta cgtggtgacg    283980
     gatatcaacg ccaacaccga caccctgagc tttactaatg gcgtggagct gacggttggc    284040
     gacgccaccg gcgatgtgac cgaggcggcg ctgcgtcgca tccagattcg tgaggccatc    284100
     aaggcgcact tcgacaagga acaggcgttg ttccaacaag gcgtgaaggt gctgaccctg    284160
     ttcttcatcg acgaagtggc caagtaccgc gactacacgc aggcggacga aaagggtgaa    284220
     tacgcccgca tctttgaaga ggaatacacg cagtacctga acgagatgct cgatctggac    284280
     gagacggcct acgtcaagta cctgaagggc attccggtgg acaagaccca tagcggctac    284340
     ttttccatcg acaagaaaac caagcggttg gctgacccga cggttgccgc gcgcggcgag    284400
     aacgctgggc tttcagatga cgtggatgcc tacgatctga tcttgaagga caaggagcgc    284460
     ttgctgtcgc tcgccgagcc ggtgcgcttc attttttcgc actcggccct gcgcgaaggc    284520
     tgggacaacc cgaacgtgtt cgtcatctgc gcgctcaaac acagcgacaa caccatctcc    284580
     cgacgtcagg aggtggggcg tggcttgcgg ctgtccgtca accagacagg cgaccggatg    284640
     gatcacccgg ctaccgttca cgaagtgaac gtgctgaccg tggtcgccag cgagagctac    284700
     aaagacttcg ttgccgcgct gcagaaggac atcagcgatt cgctttctga acgtccgcgc    284760
     gtggcaaacg aggaatactt caccggcaaa gtgctgaaaa cggcgaccgg agatgtgccg    284820
     gttacaccgc aactggcgaa gcaaatctac cgttatttgg tcaagaacga ctacacagac    284880
     gattcagatc ggattgcggg tgcgtatcac gatgccaaga aggccggaac gctggccgac    284940
     ctgccagacg aattgaagcc gcacgccgcg caggtgtacc agctgatcga cagtgtgttc    285000
     agcgccagcc aattgcccga cattggcgac gaccgcaaac ccaagaagaa cccgctcaac    285060
     gccaatttcg acaagcagga gttcaaggcg ctgtggaacc gcatcaaccg caaggcggcc    285120
     tacagtgtcg atttcgactc ggacgagctg gtgcaaaagg cggtcaagga gatggacgcg    285180
     gctctgcgcg tgaccccgtt gcaatacacc atccaggcag gcgaacagat cgaccaggtg    285240
     actggcgagg cgctaaagcg tggagacgga ttcaaggttg ccgagacaca gaccgaatac    285300
     aacaagcagt cgattcattc agcggtcaag tacgacttga tcggcaagct ggcagaaggt    285360
     actcaactga ctcgccgcac ggtggcggaa atcctcaagg gtattaacct cgcggttttt    285420
     gcacagttca agacaaaccc tgaaagtttc gtcgccgagg ccacgcgact catcaacgag    285480
     cagaaggcca cggtcatcat cgaacacctg gcctacgatc ccgtcgagga caagttcgac    285540
     ctcgacatct tcactgccgg gcagaccaag caggacttca gcaaggccga tgacaagctc    285600
     cagcgacaca tctacgacta tgtgctgacg gattcgaagg tggaacggga gttcgtgaaa    285660
     gagctggaca cagcaaatga agtggtggtc tatgccaagt tgccacgcgg cttccttatt    285720
     cccacgcccg tgggtgacta caacccggac tgggcgatca gcttcaagga aggcgctgtc    285780
     aagcacatct acttcgtggc ggaaaccaag ggctccatgt cctcgatgga cctgcgtgag    285840
     atcgagaaga ccaagatcaa gtgcgcccgc aagttcttcg atgagatgaa ccgccgctac    285900
     gccccagaga acgttaagta cgacgtggtg gacagtttcg gcaagctgat ggaggtggtg    285960
     aagtagcggc gccaagctgt ttattttccg agataaacag ccgtaacttg cagccgttcg    286020
     tgcccaagct ctcggctgat ggtttgtcgt gctgcggtat cctgggttcg ctgtgtatcg    286080
     ctcagcgtcc tgacgggtgg ccctcccgct gcgggtgcag gccaccccat cagagtctca    286140
     tagcggcttg cgcgtactga tgacgaaggc catgcgtatg gttgaggccc gccgccttgc    286200
     actgtccatc gtagacgtgc cgttgctgga tgtaggtctt gtgtggcggg atcaatgacc    286260
     cggtagccgc ctgacggtgc gctgcctgga gcatgtcgcg ttgctctacg gtggtgatgg    286320
     gcaccgttcg cttccggccg cccttggtcc acgatccctt gagggcgatg tgatcacccc    286380
     gatccgcata gcagggctgg aacttgatcg cttcctcccg acgcaatccg aaggcggcct    286440
     gtaactgaag gttcacgcgc acgtggacat cggtgacctg ctcaagactt gcgcccaatt    286500
     cgcgggcctt gctgatgttg gtcacatagc ggcgctcggc cacgccgagt tgcgtgttgt    286560
     ccgccggcag gatgcctgcc gttccgatct tctcggccca ccagcgcagg tgagagagcc    286620
     gattcttgat ggtgccggac gacaaacctt cgccttgcca gcgttccagt agcgcctgga    286680
     cgtgcttgcc cttgagagac gaatctttca tctgccggaa accggcctct cgtagttgcc    286740
     gcgcagtcaa cgcgagagag cgcatccggt cggcctgtgt gttgtggctg ccgtcacggt    286800
     tacgctggca aagctgccgc agcgtatagg tcaagtcgtc catcttgcga cctccaagca    286860
     aagcgtcata ctgcgttgtc ctgaaactca gtggttagtg ttggtgccag ctcgccaagg    286920
     cgagatcccg tgagggaaag ggcatggtgt tcaggagaca ccagagcctc gaatgaggcg    286980
     tccgtcttgc tccctgctgg aagcccggac ggaggtacta caagacgaag gtgatgcgaa    287040
     cgtggacgag tcctcctatg aagtgagtgg gatgagaaat gcagcgggag ccctgtgcgt    287100
     cgcgcacagg caattgccgc aaaggacagt gcgccaggtg gcgcagtagg gatgagatta    287160
     aacagacgaa gaaggctccg cccttgggta gggccggtat gcggtcggag cctgggcata    287220
     cctggggtgg ctccaccctg tcgggccagc gcttgcggga acctgcgctg ttggggggcc    287280
     gatgtacgaa gcccatcggt cttggcaact gcccggtcag tgtagggcgg ccatcatcat    287340
     gtctgccgca cgcaatagga ttcggcattc gcccgcattg ttgctggcgt gtgcggggcc    287400
     gtcactgcgg ctggcagtga cggcccattt cgcggcagca tttactacgc aggatgcggc    287460
     tgtcatcccc tggtctgcat tgcctgcgct gcaatgtccc cagcgttcgt cgaggcgttc    287520
     agcatcttgc ggatatgggc gatgtgcgcc agggcggttt cacgcgatgc cggttgcgca    287580
     gtcggtactg gggggtcttc ggtgcgtggc gcaccagcag gccgattctc tgcagcccgt    287640
     ggggcggcag aagtctcctt gcgtcctgcc cacaagcgga actcacccgc aaatacacgc    287700
     ttcaccaagg cgaagaagta ggctacgaga ttgcgtacgg tgccgctctg gctgcgcgct    287760
     tgcaactcgt cgagtacttc ctggcggtgc tgtggcggaa gccgccgcaa ggctgcctgc    287820
     acgtcctttt gctgatctgc ctgggcattg ctcaggcaag gcggcaagct caccgactgc    287880
     gatgccggat cgccgttgcc ctcgcgcgcg cggtacgtac gttctttttt atacatatac    287940
     gtcttatacg tactgccctg ctcagccgtc atgtggcgag cgtgcccggt ctgttgcgga    288000
     acaagcgtgg tgccagcgga atcgtcaaac aatggcagtg ggtcggctgc ctcgctcgcc    288060
     tgcgacggcg gcgtaggggg caaatcatcg tcatcgtggc gctgatcgtg ggtcgcaata    288120
     gaagcggctt caggtgcctg cgccagcgtt gcttgaatgt ggacggccac gcgatccacc    288180
     tggttgtttt cgttgccgat agaaccttgc agtagcgcag gcaggctggc atcgagcgcg    288240
     caggcctgct ggaagtgcag ggcgctttcg tgaacctgat acagctcgct gagcacatgg    288300
     ccggtcagag ggtcgcggtg ctggcccacc agactgatcc accccgtcaa ccgaagcacg    288360
     atgagaacgc gccgggccgt ctcgtacccg gccctctgcc ccagcggggt ggaagtgaga    288420
     tagcggcgca actgccccag gtttgccagt gggctgatgc cctcggcaga gcgcagcatg    288480
     cgcagaacct gccagccatt gcgctccaat ggcgtgaggc gggcatcgag catgagcgag    288540
     gccggcgtag tgaacagggc atcttgcccc agcgagttgt ggcgggtgtg gtggtctgcc    288600
     atgagagttc tccaaggtct gagccacagc ggcccgttcc cctgcatctc accgcgtacc    288660
     ctctcggcag tcagccaaca atgcggtctg cgccataccc gttttatctg gcaggtgcag    288720
     cgctggcgcc ggcatccaga ctgatttatc atcccgatac ccctatgggg gtacaactgg    288780
     gggtacttcc aacgattccc gcaaaggccg tggcccgatt tccccgcgaa acctagcatt    288840
     cacggccttt ttccgaccga tcaacgttta aacgtgtgat caacgtctga cgattttttc    288900
     gaaacccagg acagtccgcc agcgcctggc ggactgcgtc agcccttggg catcaaaggg    288960
     ctgcgcatcc cgttcgctca taggcatcct agaaccggat gctcaggtcg gcccttactc    289020
     catggtcttg cgccgagccg gcgatctggc cggcgtagct cagtccgaag cgggtgttgc    289080
     gcgccaccgc caggtccacg cccagttcga tcaccgcgct gtcctgggcg atgggcgcgc    289140
     cggccacggt aaaggcgtcg cccgccgaga acgcatgacg tgcctggggc gtggtgtcgc    289200
     ccatggcgtg gcgccatccc gccgtggcgc gcaccgttcc ctgtgccgcc ccgctgccga    289260
     gcgcgtgttc ggcgcgcagc cccagcgtgc tgaaggtggt ttccgtgttg gcgctgcccg    289320
     ttgtcagcgc ggcggcgccg ccgctttcgc ggtagccatc ggtatgcagg cgcacgtagg    289380
     ccaggctggc gaacggctcc aggcgcgttg tgtcgttcag ttcgatgccg tagcccagtt    289440
     cgccgaaggc ctggaaggtg ccgccgccat agtcggcccg caggctgtcg ctcagtcccg    289500
     ggatgtccac cgagcgccgg gtgcggatgt cgtgccagga gtaggccagg ccagtgcgca    289560
     cgcccagggc gcccgattgg gtgccgccgt acaggccaag gtggtagttg tcgctgcggc    289620
     ccgaggaggc ccggtcgcgc gccttggcgt ccgtctggct gtacccggcc agggcgccca    289680
     cccgccagtt gcccatcagc cgatccgcgc cgatcagcac cccgccgacg ttgcgctcga    289740
     ggcgggcggc gttgccgtcg ctgtcggtcg aaccccagga gccgaacgcc tgcgaccagg    289800
     ccgccgggcc gtcatgggtc gccgcaacgg cggtcggcgc gccgtccgcg gcgcgcgcac    289860
     tcacggcggc cgtggacgcc ccgggcgccg caaaggctgc ccgcacgcgg tccttggcgg    289920
     catcgcgcac aaagcggctg tcctcgatca aggccgtctt ggccgaggcg tggatttcgc    289980
     ccgagagtgc gtccaggctg gcgcgcacca ggggcgcgtc atcgggcagt tgcgcaaccg    290040
     cgtcgtagac cgcatggccg gcggccacgc cgatgctgtc tatgccctgg gccgtggcgt    290100
     actggttgtc cgtcaacgcc atcgaggcga agctgcggtc gttgcgcgcc agcgccaggc    290160
     cgaccgtacc cgcgccgtag tcgtagcgca gttcgggcgt caggaaggcg aagtcggagg    290220
     agacggtatc gaaccggccc gatagcgcgc cgccggtcgt gagcagcgta taggtcgagc    290280
     gcagctggta ctgcccggtg gcgccgacgt gggcgaccgc gccgccctgg atcgtggtat    290340
     tgcccgtgac ggccacctgg tcgctgcgcg tgccttgtgg gtcgacttcc acttcgaagc    290400
     gcgacccctt gtcgaggacg aggtcgccgt ttaccgtcag cgtgccgacg gagttgcccg    290460
     gcgccagcgt gccgcccgag gccaccgtca cctgcgagcc cgcgcccgag ccgaccgtgc    290520
     cggagccgcc gagggtcgcg ccggcttgca catcgagcga gccgcccagg acgccgccgc    290580
     catggcgatc gccgacgcgc agcgtgccgg cactgaccgt ggcgtgcccg gtaaagctgg    290640
     cgctgtcgcc ggtcagcagc aggctgccgg cgccttgttt atggaatcgg cccgtaccgc    290700
     tcaaggtccc cgcataggcg gcggcctgcg cgtcgtccag cacaaagatc ccgttcgcgc    290760
     cgatggccac gtcgcccgcg aaccggctgc cggcgctgcg tagcggcccg gtatcgaccg    290820
     cccagtcctg ggtattgcgg cctgccaggg ccagtgagcc ggcgccgagt ttgcgcatca    290880
     ggccggagcc cgagatgtcc ccggcgaaca cgccgtccgt cgcttgctgg aacgccactt    290940
     cgccgtcgtt ggcgatattc ccgcggatcg aggcggtatc tccgatgagc acgccttggc    291000
     gcacccgcgt tccgccggcg tagaggttgg ctccggccag gcgcagcgtc ccggcgccgg    291060
     tcttgaccag ggcgccagtg ccgccgatcg gcccggtggc cgccagcgtg gtgccggcgg    291120
     cgacatcgaa gcccccgttg ccggccaggg tgatgttccg gccgatggcc atgtcggctg    291180
     tcgtggccag cgtgccgccg ctcagcagga tcccggcgcc cgttgcgccc aggttcctgt    291240
     ccgaagcaat ggagaccgcg ccgctcagga tgtgcgtgct gccttgatag ctgttgttcc    291300
     ccgagagcac cagcgtgccg gcgtcggtct tggtgattcc gccgctgccg gtaatctccg    291360
     tggcgatctc ggcgctgttg gccagtacgc ggatttcggc attgccgtcg ccgcgctcgg    291420
     agccgtcgat cacgagctgg cccgaacctt cgagtcggta gccgtcatcg acgaattgca    291480
     ggcccttgaa ttgctgcatg cctgcgaccg tgatcgtgcc gccaccgaag ccgcccggct    291540
     gattcttgaa cacggcttgg ttgcccgccc agccggccgc aacctcgccg ttccggttca    291600
     gccactgtgc gttcgcgctg ttccaggcgc catccccccc ctgccagtgt tgcagcgtgt    291660
     cgtgtccgag cgcggcgatg aacagatcga cattgccgcc gccggcctgg atctcgaagt    291720
     gcgccggatc cgagaaaacc ggtgtcgagc cgatcgacag tccagtgccg gaaagcgtgc    291780
     cgccataggt catcaaccgg tagtagccca ggcccggtac gccatcctgg gcggtatcgc    291840
     tgcttgacct gaggttgagc gcgccgttga gcgtcagatt gcctgtgacg ttgacgcggc    291900
     tgccgatgcc ggatgccggg tcgctggatg taccggggcc gcccagctga taatcgagga    291960
     tggagccgtc atgcagggtc aggtcgccgt tgaccgtcaa cgtgccgatg gaagattggc    292020
     ccggggagag agtgctgccg tgctggatgc tcgtattgcc gaccgtgccc gagccgctga    292080
     gtctcgaagc gccaccgatg tcaatgatgg cctcgagagt accgttcact tgcagggtgc    292140
     tttggccggt gacgaacgca gtggggaggg cgttatgggc accgttcagg atcaccgttc    292200
     ctgtcggacc gctgcttatt ttcacgccag cccgaccatt gatgctccct tccagggtca    292260
     acgagctggt ggtggaaatg gtgccgcccc catcgatcca ggtgtcggcg taaagggtga    292320
     gcggggccgt cgcctccagc gtccccccgt tgagggtcag ggggccggta cccaggttcc    292380
     cgctttgcgc aatgcgcagt gtgcctgctt cgatcaccgt cccgccagcg taggtgttga    292440
     cgcctgagag cgtcaggctg cctgggccgg ttttcgtcag tgcgccgctg ccggagacga    292500
     tgccttgctg cgtcaacgag gcgccgctgg cgacgtcgaa ggcaccgttg cccgcgccaa    292560
     gcgccgtggc gcggttcatg gtgatgaagc ccgttgtccg cagcgtgccg ccgttgaaaa    292620
     ccagggcgcc attgggattg cccaggttgg cgttagccga gatgccgagc acgcccgcat    292680
     cgagtgtcgt gccgccggtg taggtgttct cgccgacgag cgtggtggcg ccgacgccgg    292740
     cgtggacgac cgcgacgttc tgcaaaatgg cgggggcaaa ttcgtagtcg ccggcactat    292800
     ggttgaagat caattgtccc gtgacgttgt cgtccggcgt ggcccagacg tacgggctat    292860
     cgagtgtgcc gggcgcattg ccgatctcca acctgccgcc gtcaagcgcc aggccttggg    292920
     tgcccgtgcg cagggttcct ccgccgcgca gcaggactgc tccgttgtgc catacacgga    292980
     agtttccgta gccgccggtc acggtgccgc cgtcgatggt caaggtagaa atggcggaac    293040
     tgccgcggtc gttgccgata gaggtctgat tgcctactgt caggctgccg gcgctgcgca    293100
     cgatcagatg gccgatctcc gatggaagcg ttcccaggcc caggatcagg tgctcggcac    293160
     gcgctgcgtc atggatctct gctgtgccgc cgttgcggat ggacacggtc gtggctgcgt    293220
     cgggtacggc gcctggcgtc cagttcgctg ccgcggacca gtttccttcg tcgaccgccc    293280
     attcggcggc agagacggcg cctgatgtaa acgccagcgc ctgcgtcgcc atgaaaatcg    293340
     tcgcccgttt gcgtgccgac ccgctttttc cccggccttt cgccgtttcc ggagccgcct    293400
     gcatgacgcc ttgcgcgcgg ttgaatacga ggcggtggtt gcggttcata cgtgtccttg    293460
     ccggctggga tgggagcctc ggcgccaggg caggaggcat gcgcaatgcg cgtatgtatg    293520
     tctgctttct acgtgcgcaa gcagatgatt cattgcgccg gaactctatc aaaacactct    293580
     cgcaccaata tttggttgag gcggtggccg gtgcttttcg cgatttattg cgcggaaagg    293640
     aacaaaacgc tccaaaacca acccgcatgg ccggcgccag cgtcgcggcc tcaagtgtta    293700
     aatttcggcg aacctgcgga aaaccacatc cagccaggcg agcgcacgtc ccgctgtttc    293760
     gtaccttgcc gagccctcga tatgtccata ccgtccgtgc gctatgccga tcttgtcttc    293820
     cagcccgatt tgcgcgccgc cacgcgggac gacggcgcca agctgagcct gacccggcaa    293880
     gagcgcgccc tgatcctgca gttgaccgag cggccgcatc aactcatcac gcggcagcaa    293940
     ctgctggagg gcctgggcga tctggcgggc gagctgagcg agcgcaatat cgattacctg    294000
     gtcaaccggc tgcgcaagcg gctgggagac aatgcccgca cgccgcgctt tatcgccacg    294060
     cagtatggtg aaggctatat atgggtggcg gacccgatcg cggtcgcgcc ggtgtcggcc    294120
     ttcctgctga tcggcccggt ttatggcctg ggcgaaaacg aacaggccgc cgccgtcgtg    294180
     aagcgcctcg gcggccacat cggccaggcg ctgcacggca gccgcaaggt gctgtgcctg    294240
     ccgcaatggc ggttcgagcc ggagacggca agccatatcg cccatagcct ggaaatcagc    294300
     ctgtggcccg aagacggcca gctgcatatg gcgctggtgc tcaaggacgg ccgcagcaac    294360
     acgccgatca ggccgtttcg cttgaccgtg cccctggcgg gggaaaacgc cgaactcgct    294420
     gccttcgcgc aatcgctggc cgatgccatc tgggcgcatg ccgcgctgcc cggcggagaa    294480
     ccgcccaacc cgaccgaccg gcccttgttg ctgcgcctgc acgatgcagc cgtcctggtc    294540
     acgggcgata tcgaaagctg gcgccacaat gcgcagcggc tgcgcgcggc ccatgcggac    294600
     aatccggacg accccgcgtt ggcggtgctg ctggcgctga accgctatac cgagctgatc    294660
     caggggccgc tatcgccgga tacgccgccg ctgaccgatg tgcaatggcg cggcattgaa    294720
     gacgatatcg agcaattggc gctcggcgcc ttggcaaagg cccgaagcga accgatgctg    294780
     ttgctgggca tcgcaaaggt gctgtgcttc atcgatcggg gctacctgaa gctggccgcc    294840
     acgctgaccg aggaggcctt cgaagccagc acggcctttg ccgccgcctt caccatgaaa    294900
     gcgctcactc tggcctgcca aggggagatc gaccgcgcgg tcgatctcta cgatcgggcg    294960
     atcgagctcg ccgagacggg gtcccagttt catatctatc tcttgatcct caagggcagc    295020
     gcattgctgg ccgccgaccg gcgcggcgag gtggcccaga tggtcgccga actgtccgcg    295080
     ctcgatcctg cgagccgggg atgggtcggc ttgatctttc tttctcccaa gtccaagcgt    295140
     acgccgccgg cgctcgccat gatccccaag gaagcgggcc ggcgcatgct cacctacctg    295200
     caccggacca ccgcgcggca attcgagcgc cggcatcatc agaagaacgt cctgcatggc    295260
     ctggccattc atctggcccg cgtccacggc gcggatgtca ttccatcgcc gctgcgggaa    295320
     tactttccga agcgcttcgc cgacgcgtca tgaaaaaggc cgccaagcgc ggcgccggcg    295380
     gcgcgccggc cgggagcgct cgcctattgc cgggccccga tatcgtcgac gattttctgc    295440
     cacttggctt cctcggcttc caggaactgg cccagtccct cgggcgagga cgggcgcaac    295500
     tccacgccca tggtcaccat ctgcgacatg aactccggat tgcgcaggac cgcctgggtg    295560
     ctttggttca agcgcttgac cacgtcggcg ggaacgcccg gcggggccag caatgcatac    295620
     cagatgctgc tggtgacgtt gggcaggccg gcatcgttgg cggtggacag gttcggcatg    295680
     aagtccggca tgccggcctc ccgcgtcgtg ggcaggtcgg gcatgagcgt actgcgcccg    295740
     gcgctggtga ccgccagggc gcgaaccttg cctgattgga ccagcggcgc cagatggccc    295800
     accgtgctca gcaacagctg tatttcgccg ctcatgaggg caacgctggc aggagccgct    295860
     cccttgtagg ggatgcgttg catgtccagg cccgcggcgc gcagcatgta tgctgtttcg    295920
     agataggtat tgctggccga cgttccgtag ttcaattgcc cgccgtgcgc cttggcatag    295980
     tcgatgaatt cctgcagggt cctggtcggc agcatcgggg caatggcgat cgcgaccggc    296040
     gcctcgccga tcatggaaat cggcgtgacg tcatcgcgga ccttgaattt cgcctcgctg    296100
     aacaggcttg ggttgaccgc gtgcgtcgat gtggccaggt aaatggtgta gccgtccggc    296160
     tttgcgttct tgatggcctg ggaggccagc aggctgtcgg cgccggggcg attctcgacc    296220
     acgatcggca cgccgatctc ggcgttcagg tatttcgcga acgcgcgcgt caacacgtcg    296280
     gagccgccgc cggcggcaaa ccccaccacc aggctgatcg gcttgctcgg atagctgtcg    296340
     gcggacgcgt gcagcggcag cagggcactg attgcggccg cggctgcggc aagtattctc    296400
     ctgtacatcg ccatctcctc tgttcccgga tgaaggatcc aatcgcagct tgagtcgccg    296460
     gtacggcagg ggcgttccca gcttgcggat agggcgcttc gattgcttga atagtcatat    296520
     gagcgcgaag tgaatttatc ataaaattga atgggtaatc attcaatttt catggccagg    296580
     gcccggccgc cacaggcatg ggcagttgcc tgggtgggct ttcatagggg aaagagcctc    296640
     gcgcggcgat ttgtggccgt gatggaggcg gtgccgtatg cgtattgaat ggctaaccat    296700
     tcatgtcgtg tggcccggcc tggtggtccg ggcgggaggg gcgggagggc cgggccggac    296760
     tgtggcgtcc ggcggccagg ctcaggcggc gcggccgcgc cgtgcgcgct tcttcggttc    296820
     cgtgcccgcc gcgcgggagg cgccgtcgtc cgattcgccg gcgagatgga cgggccggag    296880
     ttcgccggcc cggcgcagtt cttcatatcg gctgctgccg cgcggcagca gcaggtcttt    296940
     ccaggcggca tggatcgcct ggtcgagata ctcatccagc gtgacgatgc gacgcaagcg    297000
     ccaatgcttc aggggccatg catgcgccgc aatgatgatg cggtacacca gcagctccac    297060
     gttggtgggc gccaggtagc ccgcgcgtat gcaatccgtg gcgcatgctt cgataagcct    297120
     gttggtgtcg agttcgagct gcttcatctg ctcgatgtat tcgggcttga gagacttggt    297180
     ctcgcggtag gtcagcagca cggcttgctg gttggcggcc atgacgcgcg tgtaggcatc    297240
     gatggcgcgg tacaggcgcg cgatgggatc ttcgacgccc agcaaggccg acggcacttc    297300
     ttccttgttg cgctggacga tgtgctgcag cgccaggaac agcaggtcct gcttgtccgg    297360
     cacgtactgg tacatcaggc cggcgctgac gccagcctcc tgcgcgatgt ccttgaccgt    297420
     ggcggcgtgg taccccatgc gcgaaaacag cttgatcgcg gcttttacca gttgcgcgcg    297480
     gcgtcgtgtt accagggagg agtcgtcgac ggaatggggc atgttggggt ggggctcctg    297540
     cggcgccgcc gtgggcgccg cggtggactg acggcctgca gtggtggcct ggccgctgac    297600
     aacaacggcc gccgggtctg cattatggag ccatgttcgc cccgccgcca agccgggcgg    297660
     ggttgggcca tggccctggc gtattgtcgc tgcgcccggt tcggaccggg gcgccgcctg    297720
     caggcaggcc gttgcaggcg acctgcgcct acctgatctc cgaatccacc gcgaataccg    297780
     cctgcgagcg gtagcgctgg atgacgtcgg gcagggattc gctgccgccg cccttgcgga    297840
     tcagccagta gttgatggcg gccatgccga ccaggaactc cttgcattgc tgcctggcgt    297900
     cgatgatggc ggaataggcg agatagatga cctgggcctg catgcgggcc ggggccttgt    297960
     agaagccgcc gatgacgttg gagacgacac gcatgagcag gtccttctcg ccttcgaaat    298020
     cgcctttgtc cacgcatgcc cagtaagcct cttccttgcc gctgggcacg aagctgtcca    298080
     cccattggcg gtagtccttg tcggcgacga tggacatggc catgcgctgc agcgcttcgt    298140
     ggtcggcctg ctcgagcgga tgcgcggcgc agaagtcgca cagggcgcgc acttccttga    298200
     acagcgactc gtggccccgg ccgatattgt tgtagctgtc catcaggcgc tgcaggttgc    298260
     ggcggaattc ctggatctgc gattcgccgc cttcgatgct gtcgagcagg ggatagatct    298320
     ggtagttgta ggcgcagatc gcgttgatgt agtcgctgat ggcctgcgtg gtgttggcca    298380
     tggcgtccat cagtacgttg gcccgcttgg ggtcgagttc cagcgatttt tccaggcgct    298440
     ccaggccgcg gctgacggag gcctgcaggg ggacggtgtg ccggacgatt tccttgacgt    298500
     aggccgtcga caggttgccg agcgccgatt ggaattcgtc gacggttacg gcgcgcacgg    298560
     attcgtcgag ctgccggcgc ttggtttccc gggtcttgag gcgctggttg atcaggaagg    298620
     tgatggccga ggccagaatc gccaggctgg tggcgacgtc gacaccgaat tgaattttcg    298680
     acaaatccat ctgcaagaat tcccgttttt atttcacaat gtaaacaata tcaacatatc    298740
     acgtttttat ttcgctcaat gaaaaagggc gtccggactt gcctgttacc aactggtccg    298800
     ccggggccgt gctggccgct gggggcggga tggataatta ccactggtaa tattcatata    298860
     tccgaatccg catattccgc ctgcgcgcaa tcgcagggca cgccgctcaa tatgaatcgc    298920
     aatctctggc tgttgtcggt cctgcagggc ctgttcctta ccaataacgt tactttcatc    298980
     gccatcaatg gcctggtcgg gttcgcgctc gcgccgtacg gctggatggc gacgctgccg    299040
     gtcatgggtt atgtggtcgg gggggcgctg tgcacggggc cggtcgcgtg gacgcagaag    299100
     cgctacggcc gcaagggcag cttcatgctg gggctgctgg tggcggccgg ttcggcgctg    299160
     ctgtgcgctt tcgcggccta tataggcaat ttctggttgc tgtgcgccgc gaccgcgatc    299220
     gcgggctatt actcggccaa cgggcagctt taccggttcg cgtcggcgga gctggccgcg    299280
     cccggcgcgc gcgagaaggc ggtgtcgctg gtgatggcgg gcggcctgct gggggcggtg    299340
     gtggggccca acctggcttc gttcaccaag gaattgttcg tcacgccgtt cctgggcgcg    299400
     tatctggcgc tggccgtggt ggcgctgctg gcgatggcgg tgctggcgcg catcgagttt    299460
     ccggaggtgg cgcagcgcgc cagcgcgaat ggtgggcggc cgttgtcggt gattgcgcgc    299520
     cagcccgcgt tcatcgtggc caccggggcc ggcgcgctcg gctacggggt gatgaacctg    299580
     ctgatggcgg ccacgccgtt ggcgatgcag caccatggcc tgccgttcgc ggatgccgcg    299640
     ttcgtgctgg agtggcatgt catcgggatg ttcgcgcccg gcttttttac cggccatctc    299700
     atcaagcgtt tcggcgtgct gcccatcatg ggctggggcg ccgcgctcaa tctggtctgc    299760
     atcggcgtgg ccctttccgg ggtggagctg caccatttca cggtgtcgct gttcctgctg    299820
     ggggtgggat ggaacttcct gttcaccggc agcacgacgc tgtcgctgtc gacctatacg    299880
     gccgaggaga aagaccgggc gcaggccgcc atgaatttct gcgtgttcgc ggtgatggcg    299940
     gtgacttcgc tgacgtccgg gatgctggtg acgacccggg gatggaccgt gctgaacgtg    300000
     ggatcgctgg tgccgatgct gatgatatgt gtgggcctgg cgtggctggc gtggcgcaag    300060
     gcccccagcc gggcggccgt gggctagcgc ccgcgcccgc cggccaggcg ggttgcttct    300120
     gtgcgcggcg ctttcaggaa gcgagctgtc cgcgcacggc gcggtaggag gcgcccagca    300180
     gcagcttggc gctttcttcg gcggcggcgg catcgcgcgc gcacactgcc tcgagcaggc    300240
     gctgccagtc gcccacggac tcgcgccggc gctgctggct ctggaagctg agcgacttgc    300300
     cgcgcacgga ggttttccag agcatctggt tgctcaggcc ctcgtacatc gtgcccagct    300360
     gtttccagcc tactgcctgt atcagcaatt gctgggtctc gatggagacc ttcgcatagg    300420
     acgccggcga ggtggatggc ttgtcggcga gctggcgcag gcgttccacc tgttggcgca    300480
     gctgcgccag gatttcgtcg tcgccatgtt cggccacccg gcgcgcggcc agtccgagca    300540
     gctgcgcgcg gatgcagaag atttcttcta tttcatcggc gcggatctcg cgcacgcgcg    300600
     ccccgaagcg gggcacgcgt tcgatgacgc cgcggcgctc cagggtgctg atggcctcgc    300660
     gcacggtggt gcggctgacc gcgaatcgat cggacagcgt ttcttccttc aggcgttccc    300720
     ccggctgcag cacgccggtc tggatcgact gcatcagccg gtcggcgacc tgttcaggca    300780
     gcgacttcga cgttcgtccc agggggagtt cttctatatc ggccgactgt ggttggcgag    300840
     tcattgaggt gcggtcagga agaaagggcc atgatggaga gcggatagta tatcccgcgc    300900
     ccatgcgcgg atgcctcatg cggcaagggt cggcaggtcg cggcgcgccg agatcgcggc    300960
     ggggtcggtg cgtatctcga tgagcgcggc ccggccgctg gcgcaggccc gttcgaacgc    301020
     cgcggggaag tcgtcgtggt gcgccacgcg ctcggcatgg gcgccgtagg cgctggcgag    301080
     cgcgacgaag tcggggttgc gcagcgaggt gcccgacacg cgcccggggt aatgcatttc    301140
     ctggtgcatg cggatggtgc cgaacatgcc gttgttgacg acgatgaaga ccacggcggc    301200
     gtcgtgctgg atggcggtgg ccagttcctg gccgttcatc atgaagcagc cgtcgccggc    301260
     gaagcagacc acggtgcggg ccggcgccgc cagcttggcg gcgatggcgg ccggcacgcc    301320
     gtagcccatg gcgccgttgg tgggcgcgag ttgccggcgc tgcggcgaat actggaagta    301380
     gcggtgcacc cagccggcgt agttgccggc gccgttggtc acgatggcgt tctgcggcaa    301440
     gtgctggttg agccaatgca tgacctgcgc caggtcggtg tcgcggcggg acggggcgac    301500
     ggccaggtcg gtccggtagt cgtccgccag ctcgcgcagc caggcgtcgc agcgggcggg    301560
     cgggttgtcg caggcatcca gttgcgccgc gaaggcctgc acgtcggccg cgatgggcag    301620
     gtcggccgga tagacgcggc ccagttcctg cggatcggga tggacgtgga tcaaggtctg    301680
     gccgggatgc tccggcgtga tgagcgcgta gctgtccgtg gtggcgtcgg ccaggcgcgc    301740
     gccgacgacc agcagcaggt cggcctgccg cacatggcgc gccaggctgg gcgcgatgcc    301800
     cagcccgatg tggccggcat agcaggggtg gcggttgtcg aagcgatcct ggcgccggaa    301860
     cgccgtggcc acgggcaggc cggcgcgctc ggcatagcgg gtgatggcgg cgctggccgc    301920
     ctcgttccag ccgccgccgc cgacgatcag cagcggccgc cgggccgccg ccagcagttc    301980
     gtgcagccgc ttcatgtcgg cgctggttgc gcaggcgcgg gcgatgcggt ggggaacgcg    302040
     gtcggcggcg tgcgccgtcg cccgcaggac gtcctcgggc agggccagca ccacgggccc    302100
     cggccggccc gacagcgcga cctggtgcgc ccgatggacg aattccggga tgcgctgcgc    302160
     gtcgtcgatg ctggccaccc acttggccat ctggccgtac atcctgcggt agtcgatctc    302220
     ctggaaggcc tcccgttcgg ccacgtcggc gcccacctgg ccgacgaaca gaatcatcgg    302280
     tgtcgagtcc tggaaggcgg tatgcacgcc tatgctggcg ttggtggcgc ccggcccgcg    302340
     cgtcacgaag cagatgccgg gcttgccggt cagcttgcca taggcttcgg ccatgaaggc    302400
     cgcgccgccc tcctggcggc agacagtcag ccggatggcc tgcgcatcgt cgcgcagggc    302460
     atccagcacg ggcagatagc tttcgccggg cacgcagaag gcctggtcca cgccgtggac    302520
     cttcaacgca tcgaccagga tacggccgcc ggtacgggcg gcaagagtcg gattcatgat    302580
     tttctggatg ggcagtcttg cgacaatcgg cacggcagtg ggggcggccg gggccgcccg    302640
     ccgggctgcc gtcagttgag gttgatgtgg gcggtgcgga tgaccttgcc ccatttgtcg    302700
     acttcttccg cgatgtaggc gtcggcctgc gccggcgtgc gcgcgacggc ctcgccgccc    302760
     agcttggcca gttgcgccac gaagtcaggg tcggcggaaa tcttcttcag ggcgtcgttg    302820
     taggcctgca ccgtcgcgtc gggcgtcttg gccggcgcca gcagcgtgaa ccatcccagc    302880
     acttcgaaat ccgggtagcc gctttccgcc atggtcggcg tatcgggcag gaagcgcgag    302940
     cgcgtcttcg acgtgatggc cagcggccgg accgtgccct gctggatgtg cggcagcatc    303000
     acggcgatgt tgtcgaacat catgggcacg cgtccggcga tcaggtcggg cagggcggcc    303060
     gcgctgccct tgtagggcac atgcatgatg tcgacgccgg cctcgtcctt gaacaattcc    303120
     gccgccaggt gctggcccgt gcccgggctg gcggacgcga actccacctt gcccgggttg    303180
     cgcttcaggt aatcgacgaa gtcgcgcagg ttggtggcct gcatgccggg attgacgacc    303240
     aggacatagg gcgtcaccgc gaccatgccg acggcgcgaa agctcttgac ggtgtcgaac    303300
     gactggttgg tgtagagcga ggcattggtg gcgtggctgc tgggggcgaa cagcagcgtg    303360
     ctgccgtccg ggtcggcctt ggccaccgtc gccgcggcca ggttgccgct ggcgccggcg    303420
     cggttctcga ccacgaccga gcggctcagt tcgccgccca gccgttgcgc caccaggcgc    303480
     gcgatgacgt cggtcgtgcc gccgggggga aagccgacca tcatgcgcag gggttgctgc    303540
     gcacaggcca cgccggccca caggggcatg gccaccaggg cgagcgcgag cgccgccttc    303600
     tcgaatatcc gctgcatgtc ttgtctccgt atataagtgt tgtatggcgc ggtgcgccgg    303660
     cgtgcgcgtg gtcaggacac ggcggcgatc gcgctgcgcg cggcctgctc gtccagcggg    303720
     gcgtcctcga tcacgtagcc ggacggctcg cccagcatgg agcagcgcat catgtggcgc    303780
     ggcttgctct ggtcgaaatc cggcagcgcg atgtgcaagg tgcagcggtt gtcccacatc    303840
     acgatgtcgt tcacgctcca acggtgccgg tagacgaact ccggcgacgt ggcatggcgg    303900
     ttcaggaagt ccaggatcgg acggctttct tcttcggtca tgccgacgaa cgtgcggacc    303960
     cggtcgctga cgaacaggca tttgcggccg gtttcgggat ggatgcgcac gaccggatgg    304020
     gcgatgggcg ggttgcggcg cttgagcgcg gcggtctgct ccggatcgcg gcggtcgaac    304080
     cccttgatca ggctgatgtc gtgcacggcg tgcaggccgt cgacgaagcg cttgaacggc    304140
     gcgctgagcg attcgtaggc ctggtacatg ttggcgaaca tggtgtcgcc gccgaccggg    304200
     ggcttttcct tgcacatcag taccgagccc ttggcgggcc ggtcggtata gctgaggtcg    304260
     gagtgccagt tgcggccggt gttgcgggtt tgcgaaggct tgccgtcgcg cggcttgttc    304320
     gtcaccagca ggacttcggg gtaatcgggg tcgcggtaat agggcacgct gtcgttgcgc    304380
     tcgacgtcgc cgaaatggcg cgtgaaatcg atcagttgcg gggcgttcag gtcctggccg    304440
     gggaagacca gcaccaggtg ttcatgccag gccgcgcgca gcctggccag ttgttccggc    304500
     tgcagcgcct gccgcaggtc gatgcccgat accgccgcgc cggccgcgta gccgagcggg    304560
     cgaaccgtga tgtcgctcat gtctgtgtct cctcgggcgg ccgggggagg gccgcgatgt    304620
     cacgcgccgg attcacgcgt ccggaaatca tagtccgtat cttgcacatt gtcgacatcg    304680
     acaaaaaaca atgtgcaatg tgcgggaaag aagcaaggca aggaacgcga cgagggcgcg    304740
     cccggaacgt cggcgaggac gcgctatttg cgggcgggaa tggcggggag gagcgcggcg    304800
     tcggcggccg gcggcggtgc gcggctggcg gggccgcgtg aaggggtgga gagggggcgg    304860
     caggcatggc gctgccgccc gccgtcttac tgcgggcggt tggcgtccag cacgcagagc    304920
     gccgccatgt tgatgatgcg gcgcacggtg gcgctggagg tgacgatgtg caccggcgcg    304980
     ttggcgccca gcaggatggg accgaccgcc acgttcttgc cggccaccgt cttgagcagg    305040
     ttgtaggcga tgttgccgga gtccacgttg gggcacacca gcaggttggc cgaacccttc    305100
     aggggagagt cgggcagcag gcgcaggcgc agcgattcgt ccagggcgca gtcgccgtgc    305160
     atctcgccgt cgatctccag gccgggggcc tggcggttga ccagctccag cgcgtggcgc    305220
     atcttggcgc ccgaggccga gctgcccgag ccgaagttcg agcgcgacag cagcgccacc    305280
     ttgggcgcca ggcccaggcg ctgcatttcc tcggcggccg ccacggtgta ctcggcgatc    305340
     tgctcggcgc tggggtcttc attgacgtgc gtgtccacca gggccacggt gcgctcgtcc    305400
     agcagcagga tgttcatcgc cgcgtaggtg gtggcgccgg gctttctgcc gatgacctgg    305460
     tcgatgaagc gcaggtggtc gtggaagccg ctgaccgcgc cgcagatcat gccgtcggcg    305520
     tcgcccaggt gcaccatcat ggcgccgatc agggtcaggc ggcggcgcat ttccacgcgc    305580
     gccatctcct tggtgatgcc gttgcggcac atcatgtccc agtaggtggt ccagtactgg    305640
     tggaagcgct cgtcgtattc cgggttgcag acctcgacgt cctggcccag gcgcaggcgc    305700
     aggccgaatt tctcgatgcg cgacagcagc acctgggggc ggcccaccag gatgggcttg    305760
     gcgactttct cgtcgacgat gacctgcacg gcgcgcagca cgcgctcgtc ctcgccctcg    305820
     gtgaacacga tgcgggcccg tccgccgtcg cgcacgatct gcttggcctg cgagaacagc    305880
     ggcttcatga aggcgccgga gtggtagacg aactgctgca gctgctcggc gtaggcgtcc    305940
     aggtcggcga tgggacgcgt ggccacgccg ccctccatgg ccgccttggc caccgccggc    306000
     gcgatgcgca cgatcaggcg cggatcgaac ggcttgggaa tcaggtagtc gcggccaaac    306060
     gaaatgtcat aggtgccgta ggccgcggcc acgacctcgt tctgttcttc gcgcgccagg    306120
     ttggcgatgg ccaggaccgc cgccttttcc atctcgcgcg tgatcgtggt cgcgcccacg    306180
     tccagcgcgc cgcggaagat gtacggaaag cacagcacgt tgttgacctg gttcgggtag    306240
     tccgaacggc cggtggccat gatgatgtcg tcgcgcaccg cgtgcgcggc ctcgggcagg    306300
     atctcggggt tggggttggc cagcgccagg atcagcgggt tggccgccat ggtggccacc    306360
     atctcgggct tgagcacgtt gccggccgac aggcccagga acacgtccgc gccctcgatc    306420
     acctcggcca gggtgcgggc cttggtcttg cgggcgaagc gttccttgtc ggcgtccatc    306480
     agcttcttgc ggccctcgta gaccacgcct tcgatgtcgg tgacccagat gtgctccagc    306540
     ggcagtccca ggtccaccag caagtccagg caggccaggg cggcggcgcc ggcgcccgag    306600
     gtcaccagct tgacgtcctc gatgcgcttg ccggccacgg ccaggccgtt gaccacggcc    306660
     gcgcatacgg tgatggcggt gccgtgctgg tcgtcgtgga acaccgggat cttcatgcgc    306720
     tcgcgcagct tgcgctcgac cgtgaagcac tccggcgcct tgatgtcttc caggttgatg    306780
     ccgccgaagg tggcttccag cccggcgatg atctccacca gcttgtccgg gtcggtctcg    306840
     ttgatctcga tgtcgaacac gtccagcccg gcgaacttct tgaacagcac cgccttgcct    306900
     tccatcaccg gcttggaggc cagcgcgccg atgttgccca gccccagcac cgccgtgccg    306960
     ttggtgatca cgcccaccag gttgccccgc ccggtgtagc ggaacacatt ggccgggtcc    307020
     tcgacgatct cctcgcaggc ggcggccacg cccggcgagt aggccaggct gaggtcgcgc    307080
     tgcgtgacca gcggcttggt ggccgtgacc gagatttttc cgggatgcgg ataggcgtgg    307140
     tagtccagtg cggcttggcg gtcggtgtct ttcatgtcgt cctcgaaggg tggcggcgcc    307200
     ggtgtgcggc gcccggcctg ttacgcatgg cccattctag gcacaagata taagcaaact    307260
     attttgtttt aagatatagg cataactttt aagtgatatt actgcgttcc gtccctatga    307320
     ctggttctcc ttccgtcgac gccgccgaga tcgtccgccg gctcacttcg cgcctgaaaa    307380
     tgcgccacct gcagttgctg ctgcacgtgc ggcagctggg atcgctgacg cgcgtcgcgc    307440
     agcagttgtc caccagccag ccggcggtca ccaatgccct ggccgaactg gaggacatgt    307500
     tcggggcgcc gctgttccag cgcaccgcgc gcggcatgac gcccacgccg ctgggcctgg    307560
     tggtgctggc ccgcgccgag gccatcatcc acgacctgcg ccatctggtg gacgacatgg    307620
     gggcatccgc gtcgggctac acggcgcgcc tgcacctggg cgtgacgccg tttgtctcca    307680
     gccgcctgat cgcggcggcc atcgggcgcg cgcagcgcgc cgaccatcgg ctggccgcca    307740
     gcgtgcacga cggcatcagc ggcaagctgc tggccggcct gcgcgaccac agcctggatg    307800
     tggtggtggc gcgggccggc ccggcgctgg acgtcgaggg cattgtcttc gagccgctgt    307860
     acgtgcagca gccgcgcctg atcgccagcc gccggctggc cgcgcggctg gcccgccgcg    307920
     cgctcgactg gagcgccctg gccgagctcg actggatcct gggcgtgccg cagaccgcca    307980
     tgcgcgacca ggtcgccagc ctgttcatgc aggccggcat ccggccgccc gccgccacca    308040
     ccgaatgcca ttcggccaag ctgatcggcg aactgatcgc cgccagcgac cgggccctgt    308100
     cgatcgtgcc ggccgacatc gccgacgaac tggtcagcgt ggccggcgtg gccatcgtgc    308160
     cgttctcgtt cacctggcac ctgccgccga tcgccgtatt catgcgccac gaaagccagg    308220
     gcagcgcgcc ccaccggctg ttcgccgagg ccctgcgcga agagtgccgg cacgcccggg    308280
     ccggctgaac agggcgtttc cctggtccgc gcgcataggg ggatacccta ggcgacggcc    308340
     gccccctgtc cacgcgtgcc cagcgctggc aaggctttgc atgagagttc taataaaggc    308400
     aatgcttttt taagaatatt gatatggttg gaatgctccc ccctatctag aatgcgccgc    308460
     aggtcgttgc ggcccggcgt gcccggtccg cgccgacagc ggccgggccg atggcccgtt    308520
     ctcactggaa ggggattcaa tgctttcgta cacattgcga cggctgctca tgaccttgcc    308580
     cgtcatgctg ttcgtcgcgc tgttcgtctt cggcctgctg gacctcgcgc ccggcgaccc    308640
     ggccgccctg ctggccggcg aggacgccac gccgcaggac atcgcgcgca tccgcgccac    308700
     cctgggcctg gaccagccgt tcctgcagcg cttcgcggaa tggggctgga acgtgctgca    308760
     tggcgacctg ggcacctcgc tgttcaccgg cctgccggtc agccacatga tcggccagcg    308820
     gctcgttccc acgttttcgc tgatgctgat gacgctgctc gtctcggtcg tgatcgccat    308880
     ccccatcggc gcgctggcgg cctggaagca caaccgcctg caggaccgcg gcatcatggt    308940
     cctggcggtg ttcagcttct ccgtgccgtc gttcgcggtg ggctacctgc tggcgtggat    309000
     cttcggcctg cagctgcgct ggttcccggt gcagggctat gtgccgctgg ccaccggttt    309060
     ctgggcctcg gtgcacaccc tggtgctgcc cgccctggcg ctgggcagcg tctacgtggc    309120
     gctgattacc cgcatcacgc gcgccacgct gctcgaaacc ctgtcgcagg actacatccg    309180
     cacggcgcgc gccaagggcg tgggcaaccg cggcctgctg ttccggcacg ccctcaagaa    309240
     cgcggccgtg cccatcatca ccgtcatcgg cagcggcgtg gccctgctga tcagcggcac    309300
     cgtggtgacg gaaaccgtgt tctccatccc cggcctgggc cggctggtgg tcgacgccat    309360
     cctgcggcgc gactacccgg tcatccaggg ggtgatcctg ctgttcagct tcatgtacgt    309420
     gctggtcaac ctgctggtcg atctgctcta tcgcgccttc gacccgagga tcaaatactg    309480
     atgagcaata ttgccggttt tctcaagcgc cacccgacca cggcggtggg cggcgggctg    309540
     ctcctgctgc tgttcctgat ggcggtctgc gcgccctggc tgggcacggt ggaccccacc    309600
     gcgctctcgc ccatccaccg cacccgcgcg ccgagcgaac agttctggtt cggtaccgac    309660
     ctgctcggcc gcgacgtgta ctcgcgcgtg atctacggcg cccgcgtctc gctgatcgtg    309720
     gggttcaccg tcgccgcgct gtcgaccgtg atcggcgtgg tgatcggcct ggccgcgggt    309780
     ttcgtgcgct gggtcgatgc ggtggtcatg cggatcatgg acggcttcat gtcgattccc    309840
     accatcctgc tggcgatcgc gctgatcgcg ctgacccgcg cctcgctgca gaacgtcatc    309900
     atcgcgatca ccatcgccga agtgccgcgc gtggtgcgcc tggtgcgcgg gctggtgctg    309960
     tcgctgcgcg agcagccgta tgtcgaggcg gcggtggccg cgggcgccag ccgcctgcgc    310020
     atcgtcgcgc ggcatatctt ccccaacacg ctggccgccc tgatggtgca ggccacctac    310080
     atctgcggcg tggccatcct ggccgaggcc agcctgtcgt tcatcggcgc gggcgtgccg    310140
     ccgtcggtgc cgtcgtgggg caacatcatg gccgaaggcc gggcgctgtg gcagatcaag    310200
     ccgcatctta tcgccttccc cgcggtgttc ctgtccatca cgatcctggc gatcaacatg    310260
     ctgggcgacg ggttgcgcga tgcggtcgac ccgcgcatgg ccaagaggat ctgatcgatg    310320
     accacaacga cgacacaaag ccggcgcgtg ctggagctgg aaaacctctc gatcgccttc    310380
     ggccgcggcg tccatacgtt tcacgccgtc aagtcgctga gcctgcacgt ggaccgcggc    310440
     gagacgctgg ccatcgtggg cgaatcgggt tcgggcaaat cggtgacctc gctggcggtg    310500
     atgcgcctgg tcgagttcgg cggcggacgc atcgaaagcg ggcgcatgac cttctatcgc    310560
     ggcgcgggcg aggcggtgga cctggcggcc gcctccgagg acagcatgcg cgccatgcgc    310620
     ggcaacgacc tgggcatgat cttccaggag cccatgacct cgctcaatcc ggtgttcacc    310680
     gtgggtgcgc agatcgtgga ggccatccgc ctgcaccagg cctgcgacgc cagggcggcg    310740
     caggcggcgg ccaagcgcat cctggaccag gtgcgcattc ccgattcggc cagcatcctg    310800
     ggccgctacc cgcacgagct gtcgggcggc atgcgccagc gggtcatgat cgccatggcc    310860
     ctgtcctgca agccggcgct gctgatcgcc gacgagccga ccacggcgct ggacgtgacg    310920
     atccaggcgc agatcctgca gctgatccgc gaactgcagc gcgagatgga catgggcgtg    310980
     atcttcatca cgcacgacat gggcgtggtg gccgaagtgg ccgatcgcgt gctggtgatg    311040
     cgcaagggcg acgtggtcga gaacaacgac gtgcacggcc tgttcaatgc gcccagccat    311100
     ccctacacca aggcgctgat ggcggcggtg ccgcgcctgg gcgccatgca gggcacgacg    311160
     gcgccggcgc gcttcgcgct gctgagcgac gcgcaggccc gccacgaggc cgagccgccc    311220
     gccgtggcgc catcggacaa ggtggtgctg cgggtgcgcg acctggtgac gcgcttcgat    311280
     gtgcgcggcg gcattttcgc gcgggtcaag aagcgcgtgc atgccgtcga acaggtcagc    311340
     ttcgacctgc atgccggcga aaccctgtcg ctggtgggcg agtcgggctg cggcaagaca    311400
     tcgaccggcc ggtccctgct caggctggcc aagaccacgc gcggccagat cgagttcgac    311460
     ggcaagccgg tgcgccagga ggatcccgcc tcgctgcgcg ccctgcgccg caacatgcag    311520
     ttcgtgttcc aggatccgtt cgcctcgctc aacccgcgca tgcgcgtggg cgattgcgtc    311580
     aaggagccca tgctgatcca caacctgtac agcggggcgc aggccgaccg cagggcggcc    311640
     gagctgttcg agcgggtcgg cctggacgcg gccatgatgc agcgctggcc gcacgagttc    311700
     tccggcgggc agcggcagcg catctgcatt gcgcgcgcgc tgtcggtcga ccccaaggtg    311760
     ctgatcgccg acgagtcggt gtcggcgctg gacgtgtcga tccaggcgca gatcgtcaac    311820
     ctgctgatcg acctgcagcg cgacctgggc gtgagctatc tgttcatctc gcacgacatg    311880
     gcggtggtcg agcggatcag ccaccgggta gcggtgatgt acctgggcca gatcgtcgag    311940
     atcggcccgc gccaggccat cttcgagaac ccgcagcacc cctatacgaa gaaattgatg    312000
     caggccgtgc cgatcgccga ccccggcgcg cggcgcagca tcacgctcga actgagcgag    312060
     ttgcccagcc cggctcggcc ggtgggcgac gagcccgtcg tcaagccgct ggagcaggcc    312120
     ggaccggggc atttcgtggc gcggcaccgc atcggcggcg cgtattaggg ctggcgggcg    312180
     tccgtcggga cgccgcccgg cccgggatcg tttttccttt atctgggaga tagacaatgg    312240
     atcgtagaag tttcctgctg gcttcctccg ctacggcggc cgcctgggcc ttgcccggca    312300
     tgtcctgggc cgcgccgggc aagagcgcgt tccgctgggt gccgcaggcc gacctggcgc    312360
     tgctggaccc gatgttcacc accgtggcga tgacccaggt gcacgcgcaa ctggtgttcg    312420
     acaccttgtt cggcctggat tcgcagtacc tgcccagccc gcagatggcc gccggccata    312480
     ccagcgaaaa cgacggcctg ctgtggaaga tcaccctgcg cgacggcctg gcgttccatg    312540
     acggctcgcc ggtgcgggcg caggatgccg tggccagcat caagcgctgg tccaagcgcg    312600
     acctgatggg ccgttcgctg atgcaggcga ccgagtcgct gaccgcgctc gacgacaaga    312660
     cgatccagtt caagctgagc aagcctttcc cgctcatcct gcacgcgctg ggccgccagt    312720
     ccggcaacat ggcgtgcatc atgcccgagc gcctggcctc gcagccggaa accgaggcgg    312780
     tcaaggaaat ggtgggcagc ggcccgttca ccttcgcggc cgcgaaatgg gtgtccggct    312840
     cgcgcgtggt gtacgagaag ttcgccggtt acgtgccgcg caaggacgac cgcaagcccg    312900
     acttcgccgc cggtccgaag atcgcccatg tcgacgaagt gcactggcac atcatccccg    312960
     accgcgctac cgccatcgcc gcgctgcagg ccaacgaggt cgatggcgtc gagatggtcg    313020
     acagcgactt cctgcccatc ctgacccagg accccaacat caagctggtc aagcgcagcc    313080
     tgcccaccat aggcgtgatg cgcttcaacc acctgcatgc gccgttcaac aacgtggaaa    313140
     tccgccgcgc ggtgctcagc gtggtgaatc agaccgaata catgaccgcc atgaacggcg    313200
     ccgatttccc ggagtactgg agcgaccgct gcggcgtgtt cgtgcccggc tcgccgatgg    313260
     acagcgacgc cggcatggag aagctgaccg gcaagcgcga tatcgagaag gcgcgcgccg    313320
     ccatcaaggc cgccggctac aacggcgaga aggtggtgct gctcgatccg gtcgattttc    313380
     ccacctggca cgccgccgcg ctggtgacgg ccgacctgtt caagcgcctg ggcttcaacg    313440
     tggacctgca gaccatggac tggggcaccg ccgtgcagcg ccgcaacaac caggagcccg    313500
     tgtcggccgg cggctggagc gtggcgttca ccggcaatac cggcccgaac aacctggatc    313560
     cggccggcca cctgcccatg cgcggcaacg gcaagcaggc ctggttcggc tggcccacca    313620
     gcgagcgcct ggagcagctg cgcatcgact ggttcaacgc gcccgacctg gacgcgcaga    313680
     agaagatctg ccgcgagatc cagctgcaag tgttcgagga cgtgccgtac attccgctgg    313740
     gcgccaccta tccggtctcg gccctgcgca gcgaatggaa ggatttccag ccccagatgt    313800
     cgctgttcta cacgctgcac aaggcttgag cggaaccgga gattttcatg agcagtaacg    313860
     ccccgaaagt ggccatcctc ggtttccacc tggagtccaa cgccttttcc ccgctgtccg    313920
     tcgaggcgga cttcctggcg caatgctggg agcagggcga ggacatcacg cggctggcgc    313980
     gcggcgccag ccgcctgccc agcgaagtgc cgggcttcta tgcccgcatg gacgagctgg    314040
     gcgcgtggac gccggcgccc ctgatcgtga tcggcgcgcc gccgggcggt ccggccagcg    314100
     ccggtgtgtg gcggcgtttc ctggcggaag ccgagacgcg cctgcgggcg gccttgccgg    314160
     tcgatgccgt gtacgtggcc aatcacgggg cgtcctccgc cgaggggcag gacgataccg    314220
     aaggcgagct gatgggccgg ctgcgggcca tcgtcggccc gggggtgccc atcgtcgcca    314280
     gccacgacct gcattgcaat gtgtccgagc agaccgtgca ggcgcttgac gggctgatct    314340
     cctatcgcac caatccccac gtcgaccagc gcgagcgcgc cgcggacgcg gccgatatga    314400
     tccacgagat tctgggcggc acgcgcatgg tgtcggccta tgtgcggctg cccctgacgc    314460
     cgccgtcggt gaccttgttg acttccagcg gtccctatgc cgatctggtg gcgctgggcg    314520
     cctcgttgat ccagaagccg gacgaaggcc ccatcgccaa tgtctcggtg tgctcggggt    314580
     tcgtgttttc ggacctgccc aagtgcggcc tgacgatcac cgtcaccgcg cgcggcgacc    314640
     tgcaggccgc gcgccgcgcg gcgctgcgga tcgcgcgggc cggctgggcc gaccgcaagc    314700
     gctacgtggc caacacggtc gaggtggcgc gcgcggtcga gctggcgcgc gccgcgggcc    314760
     agcccctgtt gttcgccgac gtggccgaca acccgggcgg cggcggcggc ggcaacacgg    314820
     cctggctgct gcgggctttc cacgaagcgc gcattcccgg cgtggtgctg ggcgtgttcg    314880
     tcgatccgga actggccgcg caagccgcgc agctgggcga aggcgccgag ttcgacgcgg    314940
     tgttcaaccg catcgaaacc gactatgcgc ggcgctatca ggcgcgcgcg cgcgtgctca    315000
     ggctgaccga cggcgagggc atggggcggc gcggcatcct gcgcggccgc aagttctcgc    315060
     tgggggcgtc ctgcctgctg gagctggtcg actcgggcat gcgcgtggtg gtgggcagcc    315120
     tgcgccggca actggccgag ccggccatgc tggagatgca cggtatcgac atcgcgcggg    315180
     ccgggcatgt ggtggtcaag agccgcgggc actaccgcgc ggggttcgac gagttcttcc    315240
     cggacgatcg catccacgac gtcgacagcc tgggcctgac cacgcccaac ctcaagcaga    315300
     tcgccttcaa gcgcctgccg cggccggtct ggccgctgga cgacgcggcc gcctggcagg    315360
     agccggactg ggccgagggg ctgtagcggc gttcgcgccg cgggcgactg tgcggggcgc    315420
     ctgtccccgc ggggacaggc acccgggcct ctccgcgggg acaggcaccc ttgcaccctt    315480
     cacagcgcgc ccgagccgcg cccggcggcc agccaggccg ggtcggcgta ggaggcgtcg    315540
     atgcgcgagg ccagcgcctg cacgaagcgc ccgacgctgg cgggcagttg ccggccggcc    315600
     atggtctgga tgtgcatgat gcgctggtgc agctcgctgt tggccatggg gatggacacc    315660
     agctcgccgc gctcggtggg cgtcatgacg gtcaggtcgc ccgagaagct gatcgcgccc    315720
     cattgctggc agcaggtctg gatggcgccc tggttgttgc aggtcatcgc gatgttcagt    315780
     tcgatctttt catgcatgca gcacaggtcg atgaagaagc gattggtgct gcccggcccc    315840
     atcagcacca ccggatagtc gccgatgtcc tgcatggaca gcatgtcgcg gccggccagc    315900
     gggtgctgcg gcgccatcac ggcgaacagc ggcatgcggc gcgcgtattg cacgtgcaca    315960
     tcctgcggcg gggccaggtt gtagctcagg ccgatatcgt cctcgccctc gcgcacgcgg    316020
     cggttgatct cggacgactg caggatattc agctcgaagc gcaccgtcgg ttcgatttcg    316080
     cggaactcgc cgatgacgcg tggcagcagc tcgcggccga acgcctggtt ggccgagacg    316140
     cggatcagtt tctgcccgat ctggctcagc tcgcggatct ccgcgcgggc ccgctcggcg    316200
     tccagcgagg cgcgccgcgc ataggccttg agcaattggc cggcctcggt cagcaccatg    316260
     ccgcgcgcgt ggcgctcgaa cagctgggcc tggtgctcgt cctccagttt gcgcaccatg    316320
     cggctgaccg ccgacggggc gacatgcagc ttctgcgcgg ccagggtcag cgagccggcg    316380
     tcgacgactt ccagaaaata gcgtagggcg gtattgagca taatgaaggc atattatgcg    316440
     gatactgatt ttcggtgcgg taaacttgtc cggatattca agcgcaaaat gtgattgcgc    316500
     cgccgctcgc gagacacgcg cgagtttgtc gatggccgcg gcgcgcgata agcatatata    316560
     tacggatgat caagaagcga tatttggcca ccgccgtcgt ggcgctggcc gtagcggtcg    316620
     cggcggcgct gtatgcccgc caggacgagc ccgaacattt cgacgaagtc gtgttgcagt    316680
     gcctggacga ccaggcgatg agcacggtgc ggcggaccgg cagcgtcgac ggcatactgc    316740
     ccgcctgcca gcccgagttg gcagaggtgc tgggcgagga cttcggggcc gtcgacgagc    316800
     ccacgctgcg cgcggtgctg gcgacggtgg ctgccgccaa tttcgccgaa tatggcagct    316860
     cgtccgcggt cgcctatgag gcgatcgaga aatcccagca cctgaattgc gggaacctgg    316920
     tgttcctcat gggttatctc tacggcggcc tgaaggaaaa aggcatacgt ccgataggcg    316980
     tggacggcgg cgcggtcggc aaccacgcgc agatcatgta caaatcgggc aataacaggt    317040
     tgctgctcga tccgaccacc ggcgtggtcg cggcgattac cttcaacaag ctgatgagcg    317100
     gccagcccgt gcccgaggag caggtcaggg tgttccgggt caaggccaaa accatcgact    317160
     ctttccgcga cagagtctat cgcgcggtcg tcggcggcgg atatctgcct tccgatttga    317220
     tgtacatgca cgaatcgctc tgggagctga aaaccaaggg cagcagttcg gtgtacttca    317280
     cgcctggcgg catcacggta cgaaagaagt tggcacaggc cgctggataa tgtcgggcgg    317340
     cccgcgaaaa agccctccag cggagggctt tttttctgag gcggccggta ttcagcttgc    317400
     ctgctgcata ttccgggcgt gcgccaccag ctggtccagc gccgcgcccc agccgtcgtg    317460
     gaaacccatg tcgctgtgct ggcggcagcc ggcctgcgtg ccatgcatgg cggtggccgt    317520
     gtagcgcgtg ccctggtcgt ggggttcgat gcggatgacg gcggtgaagg ccggtacgtc    317580
     gccgccgccg ccggccggcc ggaagccggg cagcagggcg ttggtccaga ccagcctgct    317640
     gccttcgacg atttccaggt agcagcagtc gtgggtgtgt tcttcgccct cgggcgagcg    317700
     catcacgaaa cggaagcgtc cgcctgggcg caggtctacg tcgcagcgga cggtctgcca    317760
     gggcgccgga gtaagccagt gcttgatgtg ctcgggctgg gtccaggcct gccagaccag    317820
     ggcgggaggc acatcgatgg tgcgttcgag gacgaggtcc agcttggggt cgggctgtgt    317880
     ggaatgctgt cgggtcatcg cttctgctcc ttcagatcct gtagatacag gtcgagttgg    317940
     tcgaggcggc gctcccagat cgcgcgttgc cgggtcatcc agtgttccgc catgcccagc    318000
     ggttgcggcg caagggtgta gatgcgcacg cggccgcttt tccgggatcg caccaggccg    318060
     cagcgctcga ggacgtccag atgctgcgag aacgaaggca gggccatgtt gaatggccgc    318120
     gccagttcgc tcatggcggc ggacccctgg cacaggcgct cgagtacggc gcgccgggta    318180
     gggtcggaca aggcctggaa gacctggctg agctgggcag cttgattggg catgccatcc    318240
     agtctagggc ggctcttata cttaggtcaa cacctaaata ttgaacgaca ggcgatatcc    318300
     aatgtcgtag aaaagtgctt tcttctcgtc tgaaatatca gcaagagctt acttccgagc    318360
     gtcgcgggat tcccttatgc tcgaacgggt cgcgcggcca gggggcgcga atgcgggttc    318420
     gttccctgat ttgttacgat agcggtattc cggcgcactg cgtccggacc tcaggctcgc    318480
     cgacgttcca cccccaatcg aaatcctgcc ctggcccatg cttggccatg gcgggcgcca    318540
     gccacccgcc gcgcggagca ggcggagcag gcggatcggg cagggcggcg cgggcgcgta    318600
     tgcgactgtc cgcttcggcg cggcaggctt tctcaggaac attccaagtc gaggtctcga    318660
     cggggcagca atgaaaacgt ggttcaagcg aattgtgatt ggcctggtgg tgttggttgt    318720
     cgtggccgtc gtcggcctgg ccatcttttt gctgacattc gatcccaacg cctacaagta    318780
     caagctggaa gaggcggtgc aggcgcgtta tgagcgcacg ctgaacatcg aaggcgagat    318840
     cgaactgtcg ctgtttccgc gcataggcct ggcggtgcag ggggtatcgc tgtccgaacc    318900
     gaacagcccc gacgtcttcg cctccatcga cagcatgcgg ctggcggtgg cggtgtggcc    318960
     gctgctgtcg aacagcctgg tggtcgatca cgtcaccatc aacggcttca aggcgcgcgt    319020
     catccgcggc aaggacggcc atttcaactt cgagaacctg gtcggcggct cggtccagag    319080
     caccgacgtg cccggcaacg ccgccgaggc caccgccggc gcgatcaccg gcacggcgca    319140
     ggccatcgtc aacggcaccg tcagcacgcc caagagcatg cagatcgata tcgccggcct    319200
     ggacctgaag gatggcgaga tccagctgca ggacgccatg agcggcatgg ccgtggccat    319260
     caccaagctg aacgcggcca ccggccgggt gacctataac cagccgttcg acgtcagcct    319320
     gtcggcgcgg gtcgagggcg gcaacccgcg cctggacgcc ggcctcacgg gccaggcgca    319380
     actgacgctc gatccgctgg ccaagcgcta tgcggcgcag aggctggacc tgcgcatgga    319440
     agggcggctg cccggcgcgc aggccaagag cctggccgcg cgcggcaatg tggcgttcaa    319500
     tggcatgacc tcgtcgctcg acgtggccgg cctggaaatc ctgttccagg gcgatatcgt    319560
     cgacacggcc accaagctga ccaatgtcga ggccagcgtg gcgatgccca agctggccgt    319620
     ggacccgcac aagaccgagc tgcagatcga caagctggcg gtgcgcgcca agggcgccat    319680
     gcccggcggc cccttcgagc tggcggtcga cgcgcccgcg ctgaacattt cgcccaccaa    319740
     cgccagcggc gacgccttga gcggacgcgt gcgcacccag gaactggacg ccagtttcgg    319800
     cctgaacggc atcagcggca acgctggcga gctcgacatc aaggaggcga agctggacag    319860
     tacgctcaag cagggcgagc gggtggtcaa gtcggcgttc gcctcgccgg tcacgctgaa    319920
     cctgctgcag cgcagtatcg gcctgtcggc gctcaagggc gacgtcaaca tcaccgatcc    319980
     cgggttgccc aagggcagcc tgcagatccc ggtcatcggc agcgtcaatg ccaacctgct    320040
     caaggaccag gccaatgcca ggatcaacgc cgtgctcgaa ggcggcaagt tcgacctgag    320100
     cgccgatatc gtggcgttgt cggcggtgcc gcgcgtgacc ttcgcgctgg ccgtcgatac    320160
     gctggatctc gacaagctgg cgccgccggc aggcgccagc gcgccgccca agccggccgg    320220
     cgatggcaag caggacgaat ccaagccgcc ggccaagccg cagcccgcgc cggcgccggc    320280
     cgcggccgat gacagcatca acctgtcggg cctggtgggg ccgaccgcca gcggcaccat    320340
     caagatcggc cagctcgtga tgcgcggcct gaaggccgag caggtggcgg cgaacatcaa    320400
     gctggaaaag ggcaagctgg acatctccac cctgaccgcg gcgctgtacg gcggcaagct    320460
     gggcggggtg atgtcggtgg acgcggtcaa cggcaaccag ctggtggcga agatgtcgct    320520
     ggccggcatc gccatccagc ccctgctttc cgacctggcc ggcaaggaca ccctcagcgg    320580
     cacgggcagc ctggcgttcg acctcaagac ggccggcgcc aatacctacg ccatgaagag    320640
     cggcctggcc ggcaccatgc aggtgcggct gcgcgacggc gccatcaagg gcatcaacgt    320700
     ggcgcagacg ctgcgcgaat tgaaggcgat gttccgcggc gaggcgcacg accccaccgt    320760
     gcaggacgac cagacccggc agaccgattt cacctcgctc gaaagcgacc tggtgttcaa    320820
     caagggcgtg gccaccgtca agcgcctgga catggccgcg ccgctgctgc gcgtcaacca    320880
     gggcaacccg gccaacatcg atttcgtgcg cagcgagctg gatttcgtgg cacgcgtgcg    320940
     cgtggtcaac acgtccaccg gccaggacgg caaggacctg gccgaactgc gcaacctgac    321000
     catcccgctg ctgatcaccg gcccgttcga caagcccgtc tacacgctgc agtggcgcga    321060
     agtagccggc gaagcgctca agcgcggcct ggaaaagcag ctcaaggaag cgctgaccgg    321120
     cggcgaaggc gcgtccggca gtccggcgaa gaatatcgac aaggcactca aggggatcct    321180
     gggcaaatga gcaccaccgc ttatcaaccc atcgccgaat gcggcgcaac cacgcagtcc    321240
     gaagcggctg cctaccagaa gcgctggctg gtggccaacg acgcggggca gtggctcaac    321300
     cgcgacctgt gcccgcgcct ggccgaggta tcggtcgagc tgcgcatggg ttacctggta    321360
     ttgaaggcgc cgggcatgct gcggctggat attccgctcg acgtgatcga ggacgacgac    321420
     agcgtgcgct accagatgct ggtgggcgag cagacggtcg acgtggtgga cgaaggcgag    321480
     ctggcggcgg cgtggatatc caaccacgct ggcgtgccgt gccggatcct gaaagtgcac    321540
     cccgacatgg ccgaggtgcg ctggccgtcg taggccgcgc tcaggcgctg cgcgcgcggc    321600
     gccaggccag cgcgccgtgc gtcgccaggc cggctgccag gccccagaag gccgagccta    321660
     tgccccagaa gctgatgccc gaggcggtgg ccagcaaggt aaccagcgcg gcttcgcgcc    321720
     gttgcgggtc ggccatggcg gtcgtcatgc cgcccatgat ggcgcccagc agcgccagcc    321780
     cggccagcgc ggcgatcaat gcgcccggca gggcctggaa gaacacggcc acggcgcccg    321840
     cggccacgct cagcaatacg taggtcaatc cgtaggtggc cgcggccacg tagcgcctgc    321900
     ccggatcggc atgggcttcg gggccggcgc acagcgccgc gatgatggcg cccagcgtca    321960
     cgctgtgggc gccgaacggc gccgccagca ggccggccag gcccgtcagg ccgaccagcc    322020
     gcgaggcggg cggccgatag ccggccgcct gcaggatggc caggccgggc aggttctgcg    322080
     aggccatggc caccacgaac agcggaatgc ccaggctgat ggcggcctgc caggtgaacg    322140
     atggcgtggt ccagacgaat tcggtccagg cccattgcac gtggcccagg cgcagcaggt    322200
     ccaggctgct ggccgcggcc aggcccacga ccagcaccgc cagcaccgcg aagcgcggcg    322260
     cccagcgcct gcccagcagg taggccgcgc acatcgacag gaccagcacc ggctgggccg    322320
     caatgctgcc gaaaataccc atgccgaaat tgagcagcac gccggccagc atggccgcgg    322380
     ccagctcggc cggaatgcgc cgcacgatgg gatcgatcca gccgaacacg ccgcaggcca    322440
     gcgtcagcgc cgcggccagc acgaaagcgc cgaccgcctg gtcgaacggc acgcccacca    322500
     gccccgtgac cagcagggcc gcacccggcg tggaccaggc aaacacgacg ggcatgcggc    322560
     tgcgcaggct gatcagcgcg ccgcccacgc ccagcgccag gcagatcgag cccagccacg    322620
     atccgatgcg ggcggcgtcc aggccggcgg catggccggc ctgcaccatc agcaccgccg    322680
     tgccgccgaa gctgaccagc accgcgacca gcccggcgac gatggccgac aacgaaagcg    322740
     cgccggtgac aggccggcgc gccgcgaggg gggaggaggc ggagtcggcg ccgttcatgc    322800
     ggcaccggtc aggcgacggt acttggccat cagttgttcc tgcccttcct gccattgggg    322860
     atgcagttcg atgcactcca ccgggcagac caccttgcat tgcggttcgt cgtggtggcc    322920
     gacgcattcg gtgcagcgat caggatcgat gacgtaatag tccgcgccca tggaaatcgc    322980
     ttcgttcggg cactgtggct cgcaaacgtc gcaattgatg cattcttcgg tgatcttgag    323040
     ggccatggcg ggtcaggcgg ggggcggaca ggccgattgt agcccgcccg cgcggatgcc    323100
     tcaggcgccg ccctgcgcgg actgctcgcg gcgttccttg gccttggcct gcagccagcg    323160
     ctcgacggac ggaaagacga acttgctgac gtcgccgccc agctgggcga tctcgcgcac    323220
     gatggtgccc gaaatgaact ggtattggtc ggacggcgtc atgaacatgg tttcgacgtc    323280
     gggcagcagg tggcggttca tgccggccat ctggaactcg tactcgaaat cggacaccgc    323340
     gcgcaggccg cggatgatga cgcggccgtt ctggtcgcgc acgaaatcct tcagcaagcc    323400
     gccgaaactg tgcacctcga cgttgggata gtggcccagc acttcgcgtg caatatccac    323460
     gcgttcctcg atggtgaaga acggcttctt gttgcggctg tgtgcaatgc ccaccacgac    323520
     cttgtcgaag agcgtggccg cacggcggac caggtcttcg tggcctcggg tcagcgggtc    323580
     gaacgtgccg gggtaaacag cgatgatcat aggggctccg taccttttgt tcagtggctt    323640
     gcaccatcct ccaatgccgg attattcatc gatttgcgca ttgcagcaaa ttggaagagg    323700
     cgatagtgca cggcgccggc cttgccctcg cgcagcagct cgaatccggc cggcggcgcc    323760
     ggcgcggttt cggactcgac atagaccagt ccgtcctcgg ccagcacggc gggcagcagt    323820
     ggccacaggc gttccagcca gccctggccg aacggcggat cgagcaggac caggtcgaaa    323880
     cgcgaggcgt ccatgcgctc gatcacctgc atggcgtcgc cggcatggat gcgcaccgcg    323940
     cccgcctgca gcttgtcgcg cagcgtccgc aaggcggccg ccgcgccgcg gtcgcgctcg    324000
     accatctgca cctggcccgc gccgcgcgag gccgcctcga aacccagcgc tccgctgccg    324060
     gcgaacaggt ccagcacccg cttgtcggcg aattcgccgc cccacaggtg gttgagccag    324120
     ttgaacagcg tctcgcgcac gcgatcgggc gtggggcgca ggcccggcgc gtcggcaacg    324180
     ggaatgagtg tgcggcggta aaggccgccc acgatgcgga tgggtttgct gcccgggcgg    324240
     gatggtttca agaacgggga cctcctgggc gcaatagtag cgtcccccgc ggggacggat    324300
     gtagggaaac gaatatactt ttgcccatgt tcagcttctt caagaaaaaa tcccctccgc    324360
     ccgccgcgcc ggcccagccc gcgccgccgc cggaggcagt ggacgcaggg tcagccgcac    324420
     ctgcgaagcc tcaacccgcc gagccgcaac cggccccgat gccagccccc cagcccgagc    324480
     cgcagcccga gccgcagccg caacaaccgc ccgagccggc gccgccggcc atggcgtcgc    324540
     cgcctgtcgc cgagccgcag ccaccggtcg ccgagccgca gccaccggtc gcggccgcgc    324600
     ccgaggcgcc ccgcaaggcc tcgtggctga gccggctcaa acagggcctg tcgcgcaccg    324660
     gccagaacat cggcgggctg ttcgtcggcg tgaaggtcga cgagaacctg ttcgaggaac    324720
     tggagtcggc gctgatcatg gccgacgcgg gcatcgaggc caccgagaaa ctgctggccg    324780
     cgctgcgcgc gcgcgtcaag aaagagcgca tcgacgatcc ggcgcaggtc aagacggcgc    324840
     tgcgccaatt gctggccgac catctgcggc cgctggagcg gtccttcgac ctggggcggg    324900
     cccagcccct ggtggtcatg atcgccggcg tcaacggcgc gggcaagacg acctcgatcg    324960
     gcaagctggc gcataccttc cagcgccagg gcgccagcgt gctgctggcg gccggggaca    325020
     ccttccgcgc ggcggcgcgc gagcaattgg tcgaatgggg cagccgcaac aatgtgaccg    325080
     tgatctcgca ggatggcggc gatccggccg cggtggcgtt cgactcggtc aatgccggac    325140
     gtgcgcgcaa cgtgggcgtg gtgatggtgg atacggccgg ccgcctgccc acgcagctgc    325200
     acctgatgga agaattgaag aagatccgcc gcgtcatcgg caaggccgag gccagcgcgc    325260
     cgcatgaagt gctgctggtg gtcgatggca acaccggcca gaacgcgctg gcgcaaatcc    325320
     gcgccttcga cgccgccatc accctcaccg gcctggtcgt caccaagctg gacggcaccg    325380
     ccaagggcgg cacgctggcg gccgtggccg ccggcagcca gggcgtgcgg cccatcccgg    325440
     tctattggat cggcgtgggc gaggggttgg aggacctgca gcccttcgtg gccgacgagt    325500
     tcgccgccgc cctgctggcc gactgaacgg ggttcgcgcc tgcccgcaac gccgcccgtc    325560
     cgggcggcgt tgtcatttcc agaacggctt ggcgtgcgcg agctggtcga acgcttcctg    325620
     ggcctgcggc gtcaggccgt cgagccgggc gccgatccag cccaccgcga accaggcctg    325680
     cgggtgcgcc tgcagcgccg cctggtagta atcgcgcgcc accgccagat cgttgatctc    325740
     gcccagcagg tcctgcacgc gggccagttg cttgcgatag gtgcgcagcc gggctgccgg    325800
     cagcagggat tcggcgaacg acaggccgta gcgcaggcgc ttgacccgtt tgcgcagctc    325860
     gtggcgcgcc tccagctcca gcgcgccgaa gcgcaggcct tcgtcgatga ccttgagatg    325920
     ccagcggcgc agccggccgg taaggcgctt gcgcagggcg ggcggtgcgg cctcggcggg    325980
     cggcgccagc ggaatgatgg tggggctggc cgccgcggcc tcggccgtgg cggccggggc    326040
     gggcgggggc ggcacgtcca ggctccaggc cagcagctcc agcagccagc cctggaaggc    326100
     gcggtcggcg gccagcgact gggcattgtc gttggacggc gcggcctcgg cgggcagggc    326160
     gggcatgccg gcgcgcgcca gcaagggcat gatggtgtcg gccagtacat cctggtcgcg    326220
     cgccatgccg aacgcgctga aatgcgtacg ggcgccctgc gcgagggttt cggacgggtc    326280
     ggcgatccag ccgtcgaaca ggcgccaggc cgagcgcagc cgccgcacgc ccacgcgcag    326340
     ctggtgcacg tgttcgggcg tgccggcgcg atagacgccc agggtgtcca cctcggccag    326400
     cacggcggcg ttgcgcgcga tgtggtccac gcattcggcc gctaccgccg ccatggcctg    326460
     catgggggtc atcgactcgt ccagcttgac cgcgccggcg ttgcgcggcg cccagaagcc    326520
     ggcgacggcc tgctggtcgc gcgttgcccg cgcggcgtca tcggcctcgc ccggcgcggc    326580
     ggccaggtcg tgcgccaatt gcgccagcgc atcgccccgt tcggatttgc tgcgcgcatc    326640
     cagcaccagc ccgtggcgtt gcagccagct gcgcgccatg gcgaagatgg ccgcgggccg    326700
     gcccgaaacc agttcgaact ccagttcgga gatcggcagt tcgagcgcgc cggcgcgcag    326760
     cacgcccgtg tcgtaggcca gctcgacggt gccatgccgg ccgcgcacct tgcagaacag    326820
     ccgttgcacg tcggtttcgt agcgcagccc cagctcgccc ttgatggccg tcagcgcggc    326880
     ctgcgcctcg gtgccggcgt agacggacag gtccagcacc ggtccggggc gcgggtggtt    326940
     gatctccacg cggctgatgg cattggcgcc cggcatcttc agcgtctgca cccagtcgcg    327000
     cccttcctgg cgcagccgga tcgcgatgcg ggcgcgcgcc agctcgcggc cgggggtgtc    327060
     gaaatacatg gcgtgcaggc ggatgcgcgc ggcctgccgc tgctggatct gctgctgcac    327120
     cgccgcccgc gccgccgccg ggacgtgcag cttcaattct tgttctgaca tgatcggacc    327180
     cgccgagccg aaagcctagg atagtaccca aagctaaccc ggaaattgat gacgggtcat    327240
     atttcggtca tgggaggggc gctgcggggg ggggcatggg ggtgcctgtc cccgcgggga    327300
     cagataccgt cttggcaggc tagtgttcat ggcgtatgac agtgtgcctg tccccgcggg    327360
     gacaggcaca cttgccggtg ccagtccccc tttggggaca ggcacgcggc gtcagaggat    327420
     gcgcttgcgg gcctgggtga tgacgatttc ggcggcgacg acgacgatga agatggcggc    327480
     cagcaccagg gcgacgcggt cccactggaa caggttgagc gcggtgtcca gcgccatgcc    327540
     gatgccgccg gcgccgacca ggccgagcac ggcggattcg cgcacgttga tgtcccagcg    327600
     cagcagcacg atggaccaga acgaggggcg gatctgcggc cagtagccgt accacagcac    327660
     ggcggccttg ctggcgccgg tggcggtcag cgcctcgatg gggccgcgct gggcttcttc    327720
     gatggcttcg cccaccagct tgccgacgaa accgatggag cggaacgcga tggccagggt    327780
     gcccgccagc gcgccaggac cgaagatggc gatgaacagc agcgcccaca ccagcgagtt    327840
     gaccgagcgg ctggagacca ggatcaggcg cgccagcatg ttgatggtgc ggctgggcgt    327900
     gaggttgttg gccgccagca ggcccaccgg cacggccatc ccgaccgaca ggatggtgcc    327960
     cagcgtggcg atgtgcagcg tttcgaccag cgcggcgtgc accccctcgg ggtagtacga    328020
     ccagtcgatc ggccacatgc gccgcagcag gtccgccatc tgttcgggcg cgtcgtacag    328080
     gaactcgggg atcacctcca cgctgcgcac ggcctgcacg atggcggcca ccagcagcag    328140
     gtacagcatg aagcgcagcg ccttctggcc gccgctgtag cgctgccagg tgcgcggatg    328200
     gcccggttcc aggctcgtca cggaggtgtt cattcgtcca cctccccttt gcgcgccagc    328260
     ggcgtggtcg agcccaggcc ccgggccgcg gtgaagcggc gttgcaggat gcgttcgaag    328320
     cccatgttgt ccaggaatac cttgcgcacg aagcccgcca ggatttcacc cagcatgatg    328380
     atggcgatca gcgtcagcag gatggccgcc acgaagtcgt agtcgaagcg ctggaacgcc    328440
     gagaacagcg tgccgccgat gccgccggcg ccgacgatgc cgaccatggt cgaattgcgc    328500
     aggttggagt cgaactggta ggtggcaaag cccacgaagc gcgcgaacac ctgcggcagc    328560
     acgccgaaaa tgatgacgtt gccgaacgag gcgccggatg cccgcacggc ctcgacctgc    328620
     ttgagcgaga tctcctcgat cgcctcggtg aacagtttgc cgatgaagcc gatcgaggcc    328680
     acggtcaggg ccaggatgcc ggccagcgcg ccaaagccca cggccttgac gaacaggatg    328740
     gccacgatca ccgggtgcag ggcgcggcac agcgccacca gcgcgcgcgc gggccaggag    328800
     gcccaggccg gcatcaggtt gcgcgcgccc agcaggccga tgggcagcga cagcaggatg    328860
     cccagcaccg aagccagcac ggcgatttcc aggctttcgg cgatgccctt ccagagggtg    328920
     tcgggtttct cgaaattggg cgggaacatg cgcgccagga aggtcgccgc atggcccagg    328980
     ccggtttcga agcgcgccca gctgaaatcc agctgggcgg cggcgtagaa ggtgtacagc    329040
     accaccagca gcacgccggt cttggcgcgc cacgacagcg agaaaggacg gcgcgccatg    329100
     tttgccgtgc gcacggtcac tccagccaag actcgcctcc gtagatggtc ttgagcatgg    329160
     tggcgtccag ccccttgccg tcgccgtcgt agacgacatg gccgcccgac atgccgacga    329220
     tgcggttggc gtagcggcgc gccagttcga cgtcatggat gttgaccagc acggggatgc    329280
     cgttgacgct gccctgttcg gtcagcagtt ccatgatctc gaccgaggtc ttggggtcca    329340
     gcgacgaggt cggctcgtcg gccagcagca gttgcggccg ctgcatcagc gcgcgcgcga    329400
     tgccgacgcg ctggcgctgg ccgcccgaca gggcgtcggc gcgctggtcg gcaaagccgg    329460
     ccaggcccac cgtgtcgagc aattgaaagg cgcgttcgat gtcggccgga tcgaagcgcc    329520
     gcatccaggc attgagcgcc gaggtgtagc ccagccgtcc ggtgagcagg ttctccatca    329580
     cggtcaggcg ctcgaccagg ttgtactcct ggaacaccat gccgatgcgc cggcgcgcgc    329640
     ggcgcagcga ctggccgcgc acgcgggcca ggtccaccgt gccctcggcg tccttgagca    329700
     cgatttcgcc gctggtcggc tcgatcagcc ggttgatgca gcgcagcagg gtgcttttgc    329760
     cggtgcccga cggcccgatg atggccgtca ggccctggcc cgcgatatcg agatcgatgc    329820
     cgttgagaac cggcttgccg gcccggtatt ccttcaccag gccggtgatg cgcagagacg    329880
     tcgccatgct tactgcttgc ccttgctctt ggcggtttcg cggtcgtagg ccgcgcggtt    329940
     gaacttctcg ccgccggatt cggccacttc gcgcacgatg gcccagtcct tctggtaggt    330000
     caccggatag aagcggtcgg ccccgtcaaa cgcctttttc atttcgtcgg ggaagcggta    330060
     gtcgtagaag cacttgagca tcttgtcgcg gaaggccggc tccaggtcgt gcgcgtaggc    330120
     aaacgacgag gtcgggaatt tctcgctgcg atagatcacg cggaaatcct cttccttgac    330180
     ctggccgcgt tcggccatgc gcttgaacac gtcggaggcg accgcggcgg cgtcgtagtc    330240
     gccggagttc acgcccatga ccgactggtc atgcttgccc gagaagatga ccttgtagtc    330300
     cttgtcgggg gtcaggcctt ccttggggaa cagggcgacc ggcgccatgt ggcccgagtt    330360
     cgacgacggc gcggtgtgcg ccagcttctt gcccttgagg tcggtcagct tctggtaggg    330420
     gctgtccttc ttgacgatga cgatcaggtt gtagccctgg aattcgtccg cgtagccctt    330480
     gacggcgaac ggaaccgcgc cggcgatgtt cacggcgaag gcggtcgggc cggtcgagaa    330540
     gccgcccacg tgcagccggc ccgagcgcat ggcttcgatt tcggccgcgt tgctctgcac    330600
     ctggtagaac accacgcgct tgccggtgca ctcgctcagg tgcttggtga agggcttgaa    330660
     gatgtcttcg tagacggcgg gatcttccac cggcgtgtag gtgaagacca gcgtcgatgg    330720
     cgttttcagc ttggacttgt cggtcggcgt atcggcgacc agatccttgt tcgcatcgca    330780
     atacatattg tccagatcgc cgcgattcga acacgcggcg tcggccgcct gcgcggcgta    330840
     ggaaccgaaa atcagggcgg tcacggcggc ggcttgcaac aggcgcttgg ctcgcatggg    330900
     cgtctcctcg gagtgcgttt ggtatatgaa ttgtcacgcc attcaaacac aaacgagcct    330960
     atccgcgcac tcggtgaagt ccctgtcttt cttttcgtct tttgttcgtt ttgttcgttt    331020
     tgttttcttt tttgtttcga acgcttcaat tgccgcgata gcccagcttg cgcgagattt    331080
     cctgggcgca ggccagcagc ggccgggcga tggcgccggt gaaggaggcg tcgaacaggc    331140
     cggtcggccc caggctggtc agcgccagca cgatgccgcc ggtgtggtcg aacaccggca    331200
     ccgacagggc gtccacgccg ggcagggggt tgcccagcgc ccgggccatg ccgtgcacgc    331260
     ggatgtcggc cagcatggcg tccaggttgg cgcgggtcgt cttgcgcggc gtcaggctgg    331320
     cgatgaccgc agcgtcgccg tcttcgcggg cgatgtagtg ctcggccacc ttggggggca    331380
     gccaggcggc gaacacctgg ccggtggccg tgtgcagcat cgacatcacc gtgcccttgc    331440
     gcatgttgac atgcaccggg tagctggcct cggtgatgtg gatcatggtc gggccgtgcg    331500
     agcccagcac cgcgatgccc agggtgtggc cgatctcgga ttgcagcttg tcgacttcgg    331560
     gcagggccac ccgcacggga tcgagccgct gcaggctgac caggcccatc tgcagcgcga    331620
     acggccccag ttcgtactgg ccggtcaccg tgtcctgctg gaccaggccg acccgggtga    331680
     agctgaccag gtaggggtgg gccttggccg aggtcatgcc ggcggcgccg gccaggtcgc    331740
     gcagcgtcag ggggcggccg gcgtcgacca gcgcggccag cagcgggaag ccgacctcga    331800
     ccgactggat gctgcggcgg ccgtcgttgc ctggcgcggc ggcgggcttg gcggtggatt    331860
     tggcggcgga catggcgctt atccccggtt cgccagcagg cgctcggcca tttcgacgaa    331920
     gccgtcgccg ccgcgcgcgg ccgcgacgaa cgccgggcga tgctggatgc gatgcagctg    331980
     cgactggatg ttggccacgc cgaccgagat cgggaagaac ttgaacatcg gctcgtcgtt    332040
     gggcgaatcg ccgatgaaca gggtgtgctg cagggccgaa tcgatgttca ggccgaattc    332100
     gcgctcgaac agggtgcgcg tcatggtcag cttgtcgtag tcgccgaacc agccgttgac    332160
     gtggatggag ctgaccttgg cctgcgcccc ggcttcgtgg aagatctcga cgatgcggcc    332220
     gaccgcgccg tcgggcaggg ccgggacgtc ttcgcagaaa tcgatggcca ggtccgccac    332280
     ccggtaatcc tggtcgctgg ccacggcggt gcccggcact tcgcgcagca cccgttcgcg    332340
     gatggcctgc agcgcctgcc ggttggccgc gcgggtggcg gcgtcggccc agtaatgcgc    332400
     gttcatgcgg cgcgccgagc ggtcgtaggc gtagtagaac gcgccgtttt cgcccacgac    332460
     ggcccgcacc ggccacatcc gcgcgatgtg gtcgcaccag ccggcgggcc ggccggtgat    332520
     cggcaccacg acgatgccgg cctgttccag gcgctccagc gccgcgtagg cgccggccgg    332580
     caggcggcct tccgtggtca gggtgtcgtc gatgtcggtc agtacgatgc gtaccgacgc    332640
     ggctaccggg gctggcatgg ccgcaagcgc ttgcatgggg ctcctcgagg ggatttgtcg    332700
     ttatcggggc gcgattctca agcgcgaagt ttaccgtgcg cgcgcggccc ggcgccgcgc    332760
     ggggcgcgac cgcgccaagg gcgctaaaat tgcagctttc cagcctggac gcgcccgatt    332820
     catgtctgcc cagatttcct cgctcaacgc cggcgccgcg ccggaatctt tcggcatcgc    332880
     ctcggtgccc gagatcattg ccgaattgcg ggcaggccgc atcgtcatcc tggtcgacga    332940
     agaagaccgc gagaacgagg gcgacctggt catggccgcc gagttcgtca cgcccgaggc    333000
     catcaatttc atggtcaccc acggccgcgg cctggtgtgc ctgaccctga ccgaagaacg    333060
     ctgccggcag ctcgacctgc cgctgatggc cagccgtaac ggcactcgat acggcaccaa    333120
     tttcacgcaa tccatcgagg cggccgaagg cgtggagacc ggcatttcgg ccgccgaccg    333180
     cgcccgcacc atccaggtcg cggtggcgcg cgacgcccag ccgtccgatc tggtgcagcc    333240
     cggccacatc ttcccggtgc gcgcggtgcc cggcggcgtg ctggtgcgcg ccggccacac    333300
     cgaggccggc tgtgacctga ccgccatggg cgggctgacc ccggcggccg tgatctgcga    333360
     aatcctcaaa cccgacggca ccatggcgcg cctgcccgac ctggtcgaat tcgcgcgcga    333420
     gcacaagctg aagatcggca ccatcgccga cctgatccag taccgcagcg agcacgaatc    333480
     catcatcgcg cgcatgggcg agcggatgat gcagactccc tggggcgatt tccgctgcat    333540
     cgcctaccgc gacgacgcca cgcgttcgcc acatctggcg ctggtacacg gtaatatcga    333600
     tcccgagcgc gagacattgg tgcgggtgca cgagcccgcc tcgctgctcg acgtgctgga    333660
     tacgggcgcc agcccgcaca gctggagcgt gggccaggcg ctgcatgcca tcgccgcctc    333720
     gccggccggc gtgctggtgc tgatgaactg ccagtcgtcc accgaacacc tgtttggcca    333780
     gatcgccaac tgggccggcc ccgccgagcg cgcggccgcc caggaaggcg accgattcgg    333840
     gctgcgcacc tacggcatcg gtgcgcagat cctgcgtgat ttgaacgtgg gccgcatgaa    333900
     actgctggcc cgtccccgca agatgcccag catggcgggc ttcgccctca ccattacggg    333960
     ttacgattgc gcccctccga acctacgcaa cgactgaaca aggccgacac atgaatccct    334020
     acattcttac ccccgacctg aacggcgaag ggctgcacat cggcatcgtg cgtgcccgtt    334080
     tcaacgaaga aatcggccag gcccaactgc aggcctgcct cgaagagctg ggcaagctgg    334140
     gcgtggacga gcgcgacgtg atggtggtca gcgtgccggg cgcgctggag ctgggcgtgg    334200
     ccctggcgcg catggccgaa agctatgaat tcgacgcgct gatcgccctg ggcgcggtca    334260
     tccgcggcga aacctatcac tttgaagtgg tcagcaacga gagcgccgcg gccatcagcc    334320
     gtatcgcgct cgaaaccggc atccccgtgg ccaatggcgt gctgaccgtc gataccgacg    334380
     agcaggcgca ggcccgtgcc gccggcaagg gcgccgattg cgcccaggtg gccgtggaaa    334440
     tggccaacct ggcggcggcg ctcgagccgg aagaagacga cgaagacgaa gacgacgagg    334500
     acgaagattt tgacgacgaa gaagacgacg gccgctgata acgcggtgca ggcccgcgcc    334560
     aacgcgcgca gcgcgcggcg ccgcgcgcgc gagttcgcgc tgcagggcgt gtacgcgtgg    334620
     ctgttgcgcg gcggcgaggg tacccaggac gccggcgaaa tcgacgccca cctgcgcgat    334680
     gccgaggatt tctccgaggc cgacgcgcag tggttcaaga cgctgctgca cggcgtgctg    334740
     cgcgaggcgc cggtgctgcg cgagcggttc ctgccgtaca tcgaccggcc gctggccgag    334800
     ctgtcgccgg tcgagcacgg cattctgctg ataggcagct tcgagctgat gcaccatgtc    334860
     gaagtgccgt acaaggttgc catcaacgag gcggtcgaac tggccaagtc gttcggcggc    334920
     accgacggct tcaagttcgt caacggcgtg ctcgacaagc tggcggccga cgtgcgcacg    334980
     gccgaagtcc aggcggcgcc gcggcgctga ccttccgcgg gcgcgcccgc gcggcgcgtc    335040
     cgttcgcgtt tgctggcagg agtcgccttg gcgtccgagt tcgacctgat cgcgcggtat    335100
     ttcaccaggc cggctcccga tggcgtgctc ggcgtgggcg atgactgcgc gctgtttccc    335160
     gtaccgcccg gccagcaagt ggccaccagc accgacctgc tgatcgaagg gcggcacttc    335220
     tttcccgacg tcgatccgca ggcgctcggc cacaaggcgc tggccgtcaa tctttccgac    335280
     ctggccgcca tgggcgcgcg ccccgtcggc tgcctgctgg ggctggcgct gcccggcgtg    335340
     gacgaagcgt ggctggcggc gtttgcgcgc ggcttccagg cccttgccga tacgcacgcc    335400
     tgcccgctga tcggcggcga cactacccgc gccccgcaag ggctgctggc catcagcgtt    335460
     accgtgttcg gcgccgtggc gcccggccac gcgctgcgcc gcgccgccgc gcagccgggc    335520
     gacgatgtct gggtttccgg ggagctgggc gcggccgata tcgcctaccg cctgctcgat    335580
     cgccaattgc ccgccgaccc cttgcgcctg gccgccaccc gcgcggcgct ggagtggccg    335640
     cggccgcgtg tcgagctggg catggcgctg gccggccttg cgcgcgccgg catcgacatt    335700
     tcggacggcc tgctgcagga cctgggccac attcttgccg ccagcggcgt ggcggccgaa    335760
     ttgcgttacg acgcgctgcc cgtcgcggcc gcgctggccg gcctgccggc cgagaccgtg    335820
     cgccgcgccg cgctgggcgg cggcgatgtc tacgaacttt gcttcaccgc cgacccggcg    335880
     catcgccagg ccatcggaca ggcggcgcac ggcgcgggcg cgcccgtcag ccgcattggc    335940
     cgcatcctgg cgggacaagg actgcgcgtg ctggacgccg atggcgcgcc gctgggcgaa    336000
     ctgccgggcg gcttcgatca tttctccgac gcaacggacc agccggcccc cggccgccga    336060
     ccatgaaccc gcccgacgcc aaccccgacc cgacttcgat gcaggcgcgc acgcgcgtgt    336120
     cctatcccag ctggagctgg gtgcgcgcca ggcccgcgcg cctgctggct ttcggcctgg    336180
     gcagcggcct gttgcgcccg gcctcgggaa cctggggcac cttgctggcc tggctgagct    336240
     ggttcgtctt cgcgccgctg gcgcccgact gggcgctggg catgggcata gccgcggcgt    336300
     ttgcctatgg ctgcctggcc tgcggacagg ccggccggga actcggcgtg tccgaccacg    336360
     tcggaatggt atgggatgaa atcgtggcgt tctggctggt gctgtggctg gtgccgcaga    336420
     ccgtggccgc ccaggcgctg gcgttcgtcc tgtttcgcgt attcgatatt gccaagccgc    336480
     cacccatcaa gtatttcgac gcgcgcatca agggcgggtt cggcgtgatg tgggacgata    336540
     tcgtagccgc cgcctatacc ttgctggtca tggcgattct ggtccgcatg ggagtattca    336600
     catgagcttg cacgacaccc aggggcgcgc cggcctggcg cccacgccgc tgacggcggc    336660
     cgccatccag gggctggcgg aaatggtcgg agaagcgctg ttgcggcgcg actggatgat    336720
     gggcaccgcc gagtcgtgca ccggcgggct gctggccggc gcggtcacgt cggtggccgg    336780
     ttccagcgac tggttcgagc gcggcttcgt cacctacagc aatgcggcca aggtcgccga    336840
     gctgggcgtt tcgggcgaga cgctcgatca ctatggcgcg gtcagcgagc ccgtggcgct    336900
     ggaaatggcc aatggcgtcc tgcttgccac gccgtcggcg caagtcggcg tgtccaccac    336960
     gggcatcgcg ggtccgggcg gcgccacgcc gggcaagccc gtcggcatgg tgtgcttcgg    337020
     cttcgccatg cgcgcccacg gcggcatcac ctcgcgcgcc atcacccatg tgtttcccgg    337080
     cgatcgcgcc caggtgcgca acgcctcggt cgagttcgcg ctgcgtggca tcctggaatt    337140
     cctgggagag ccggtcaatc gaggctgact ttctcgggtg cctgtccccg ccggggacag    337200
     gcacctggac acccagattc aacgtgtgcc tgtccccctg cggggacagg cacacgttga    337260
     atcctgcttc gggggcaggc accctgagaa gtcagcgggt gccagtcccc cttcggggac    337320
     aggcacccgg ggggttacgt tcttaccgcg ttgatggcgt cgcgcaggcc gcgcgcggct    337380
     tcgccggcgg cctggcgcca gtcttcgccc gtgctggcgt acaggatggc gcgcgacgag    337440
     ttgatcatca tgcccgcgcc ggcgctgttg gcgcccgcct gcacggtggc gttgatgtcg    337500
     ccgccctggg cgccgatgcc cggcaccagc agcggcacgg catcgccgat gcgctggcgc    337560
     accgccgcca gttcgttggg gaaggtcgcg ccgaccacca ggccgcactg gccgttggcg    337620
     ttccacttgt cggccaccag gcccgccaca tgcaggtaca gcggctggcc gtcggccatt    337680
     ttcaggaact gcaggtccga gccgccaggg ttggacgtgc ggcacagcac gatgacgccg    337740
     cggtcgcccc aggccaggta cggctcgacc gagtccaggc ccatgtaggg gctgaccgtc    337800
     agcgcgtgcg cctggtagcg ttcgaatgcc tcgcgggcgt agttctcggc ggtcgagccg    337860
     atgtcgccgc gcttggcgtc cagcacgatg ggcaggtcgg gatgctgcgc gcggatgtgc    337920
     tggcacaggg cttcgagctg gtcttcggcg cggtgcgcgg cgaaatacgc gatctgcggc    337980
     ttgaagctgc acgcgtacgg cgcggtggcg tcgacgatgt cgcggcagaa ctggaagatg    338040
     gcgtcgggct tgccttccag ttcgcgcgga aagcgcttgg ggtcggggtc cagtcccacc    338100
     tgcagcaacg attggctggc gctccaggcg tgttcgagtt tcttcaggaa tgtcatggcg    338160
     aggtcagtgc agtttgaccc tgggacgggt gcgccgcatc aacaggcgcg ccagggcaag    338220
     cgtggcggtc cgcgaaatac cgagcaccgc gcggtggtgc atcaggtgca gactcatgta    338280
     catcaggcgc gccagtgtac cgcttacgaa caggccgcgc ccggccagct tgcccatcag    338340
     gctgcccacc ccggacccct ggcccagcga aaccagcgag ccgtggtcgt ggtacgcata    338400
     ggcctcggtg ggttcggcgg cgttgcgcag gcgggccgtc agcttgcgcg ccaggtagtc    338460
     ggcctgctgg tgcgccgcct gcgcgcgggc cggcacggtg cgtccgtcct tccagggcgc    338520
     cgcgcagcaa tcgcccagcg ccaggatgtg gggatcgggg ctttccaggc gttcgttgac    338580
     ttccagctgg cccagccgat tgagcggcag gcccagttgc cggaacagcg gcggcccttc    338640
     gatgccggcg gcccacaggc acatcgtggc ctcgaagcgc cggccgtcgg cggtgacgac    338700
     atggtcggcg ccgacttcgg ccacccggca atcggtttcg acgcgcacgc ccagctcggt    338760
     caggcgggcg tgggccgcgc gcgagatctt ctcgggcagg gccgacagaa tgcgcggcgc    338820
     gccttcgacc agcgtgatga ccaggtcgcg gtcggcgcgg aaattgggca gtccgtaggc    338880
     gctgaccaca tggctggcct cgatcagctc cacggccagt tcgacgccgg tggccccgcc    338940
     gccgacgatg accaggtcca ggcgcgccga ggggtcgtga accttgcgca ggtccacctg    339000
     caccatggcc ttgagcatgg tcaggcggaa ctgctcggcg ttctcggtgg tgtccagggt    339060
     aacggcgtgt tcggccgcgc ccggcgtatt gaagaagttg gaagtgctgc ccatggccag    339120
     caccagcgta tcgtacgaga gttcgcgcgg cggcaggacc tgctggccgg acgggtcggc    339180
     caccggcccg acctggatct ggcgccgctc gcgctcgatg ccctgcaatt cgccttgcgc    339240
     gaacgtgaag ttgcacatgt tggccagcat caggtaggac aggccttcct ggtggatgtc    339300
     cagcgtgccg gcggcggctt cgtgcaggga gggtttccag atgtggaaag ggcggctgtc    339360
     gaccagcgtg acgcgctcgc gcccgtgggc gcggcccagc ttggcggcca gttcgaggcc    339420
     gccggcgccg ccgcccacga tgaccacgcg atgaggggaa cctgtattcg gggtctgcgt    339480
     catgcggcaa gtatagagtg gcccggcgcg cttggaaacg gcggcgccgc cgctcagtcc    339540
     aggacgaagc ggctgatgag caccgccacc cagaccgcca gggtgaacag cagcatcagc    339600
     atgaccgcgg cgctgccgag gtccttggcc cggcccagca ggggatgggt ctccaccgac    339660
     agggcgtcgg ccagcgcctc gatggcggaa ttgagcagct cggccaccag caccaggatg    339720
     accgaggcga tcaggatgaa gacttcgtcg gtggtgcggc ccaggaagaa tgccgcgggc    339780
     accagcagga tggccaggac cagctcctgg cggaacgccg cctcgtattt gatggctgcc    339840
     ttcagccctt gcagcgagta gcgcagcgcg ttgagaatgc ggcgcaatcc gcctgtgctc    339900
     ttgaaggggg agggatgagg ggtatgggcc atggtcggat tgtgcggcgt ctagggttgg    339960
     ctggccgcgt ttttaacaga tatgtgttgc ccgcgtgagc cctgcggccg cctgccgcct    340020
     tcaggcgggg gcggcccggc gcaggctgcc gaagcgctcg gcgaactgcc gggtgaagac    340080
     ggcgccgaag aagaaaatct gcgctgaata atagatccac agcagcagcg cgatcagcga    340140
     acccgccgcc ccgtacgccg ataccgccgc gccgcgtccc aggtacaggc cgatgcccca    340200
     tttgccggcc aggaacagcg ccgcggtcac gatcgcgccg ggtatcacgt cgagccaggg    340260
     aatgcgcttg ctgggcagca gcttgtagac cacggcgaac agcgcggtca ccaccgcgaa    340320
     cgaaaagagg ttcgacagcc agtcggccgc catcgcgaag gccgatgtgc tccatagatc    340380
     gccgtagtat cccttggccg cgcccagcgc cgcgttgagg gtcagcgaaa gcagcaggaa    340440
     cagcgccagc accagcacca ggccgaatga cagcatgcgg ctgcgcacca gtccctgcaa    340500
     accgctcttg tcttccttga cgtcccacag ttcgtccagg ctggccttga gttcggcgaa    340560
     ggccgtggtg gcgctgaaca ccagcacgca tatcgacagc agcgcggcca gccagccgct    340620
     gcccgattcg tgcgcgctgg ccagcaccgt ctggatcacc tcggcgccgc gctcgccggt    340680
     gaggtcgcgc acctggctga acagttccga gcgcacggcc tcttcgccaa agaaggcgcc    340740
     ggccaccgcg atcaccagga tcagcatggg cgccagcgag aacaccatgt acagcgacag    340800
     cgccgccccc ttgctggaag cgcgatggcg cgaccattcg cgggccgaat cggtcagcag    340860
     cgcgccgatg tcgcggaggt ggggcaagcg gatctggcgt ggcaagcgca tggcctcggg    340920
     ttggatggga cagcttggtg gcggaagtat cgaccgtggc cggccgcggt tcgaggaggt    340980
     cttccggact tcatgacgtc gtgcgcaatt ctcataggaa agcacggcta ttcaggaaag    341040
     ctcttgttgg gcctcggact tcatccggca ttcattatga cgtgggcttt ggatactgcg    341100
     caaatccccg catggctcgt gcctgatccc gccgggacgc ggtcgtttcc ttcgcgtcac    341160
     cggcgtcgta cggcaggcgg gtcggtttgt tcaacttctc ttttggtggc acatgtatct    341220
     cgatagattc cgtcaatgtc cgtcttcctt gcagatcccg cgttccgcgt ggcgcctgca    341280
     tgcgctggcc gcagccctgg cgctggccgg catggcccgg ctggcgcccg cggcggcgca    341340
     ggcgccgcag ccgcccgtgg ccggcgcgcc gcatgcgcag gacgccgggc aggaaggaga    341400
     gttcgaccac cgggacaaca cgctcattgc agtctttgac gacggcgtcg gcatcaatct    341460
     cgacgacgat cccgacgagt tcggcgagac ggcgcccccc acgctcaagg acatccacat    341520
     ctcggtggag cacaagaacc cgatgagcaa gccggccatc ggggggtgcg tgtcagcggc    341580
     gccggccgcg cgctgacgct ggccggctcg accatcgatg ccaccgaggg cggcattccc    341640
     gcagtggtac ggcgcggcgg cacgctggag ctggatggcg tcaccgtggc gggcggggca    341700
     gggatggagc cgatgacggt ctctgacgcc ggcagccgcc tgagcgtgcg cggcggcgtg    341760
     ctgggcggcg aagcgccggg cgtcagcctg gtccgggccg cgcaaggcgg ccaggcgagc    341820
     atcatcgacg cgacgctgca gagcatcctc gggcccgcgc tcattgccga cggcggctcc    341880
     atttccgtcg ccggcggttc gatcgacatg gacatgggcc cgggattccc gccgccgcct    341940
     ccaccgcttc ccggggcgcc gctggccgcg catccgccgc tcgatcgcgt tgccgcggtg    342000
     cacgccggcc aggacggcaa ggtgacactg cgggaggtgg cgctgcgggc tcacgggccg    342060
     caggcgacgg gcgtctatgc gtatatgcct ggcagcgaaa tcaccctgca gggaggcaca    342120
     gtcagcgtgc agggcgatga cggggccggc gtggtcgccg gcgcgggcct gctcgacgcc    342180
     ttgccgcccg gcggcacggt gcggctggac ggaaccacgg tgtcgaccga tggcgccaac    342240
     accgatgccg tgctggttcg cggcgacgcg gcgcgcgccg aggtcgtcaa caccgtgctg    342300
     cgcaccgcca agagcctggc cgccggcgta tcggcccagc atggaggccg cgtcacgctg    342360
     cggcagaccc gcatcgagac cgcgggcgcg ggggccgagg gcatctccgt gctgggcttc    342420
     gagccgcagt ccggctccgg cccggccagc gtcgacatgc agggcggcag catcaccacg    342480
     accggcaacc gcgccgccgg catcgcgctc acccacggca gcgcccgcct ggaaggcgtg    342540
     gcggtgcgcg ccgagggcag cggctcgagc gccgcgcagc tggccaacgg cacgctggtc    342600
     gtcagcgcag ggtcgctggc ctcggcccag tccggcgcga tcagcgtgac cgacacgccg    342660
     ctgaagctga tgccgggcgc cctggccagc agcacggtct cggtccggtt gaccgacggc    342720
     gccacggcgc aaggcggcaa tggcgtgttc ctccagcagc attccaccat tccggtggcg    342780
     gttgccctcg agagcggcgc cctggctcgc ggcgatatcg tcgccgacgg caacaagccc    342840
     gtcgatgccg ggatctccct cagcgtggcc agcggcgccg cctggcacgg cgccacccag    342900
     gtgctccagt cggccacgct gggcaagggc ggaacctggg tcgtgaacgc cgactcccgg    342960
     gtgcaggaca tgtcgatgcg cggcgggcgg gtcgaattcc aggcgcccgc gcccgaggcc    343020
     tcttacaaga ccctgaccct gcaaaccctg gacggcaacg gcgtgttcgt gctgaacacc    343080
     aacgtcgccg ccgggcagaa cgaccagttg cgggtcaccg gccgcgccga tggccagcac    343140
     cgcgtgctgg tgcgcaatgc cggaggcgag gccgacagcc ggggcgcccg cctgggcctg    343200
     gtgcataccc aggggcaggg caacgccacc ttccggctgg ccaacgtcgg cgaggcggtt    343260
     gacctgggca cgtggcgcta cagcctggcg gaggatccga agacgcatgt ctggagcttg    343320
     cagcgcgcgg gccaggccct gtcgggggcg gccaatgccg ccgtgaacgc ggcggatctt    343380
     tccagcatcg ccctggccga gtccaacgcg ctggacaagc gcctgggcga gctgcgcctg    343440
     cgcgccgacg ccggcgggcc atgggcgcgt acgttcagcg agcgccagca gatcagcaac    343500
     cgccacgccc gcgcctacga ccagacggtc agcgggctgg agatcggcct ggaccgtggc    343560
     tggagcgcgt cgggcgggcg ctggtacgcc ggcggcctgc tcggctacac ctatgccgac    343620
     cgcacctatc ccggcgacgg tggcggcaag gtcaagggcc tgcacgtcgg cggctacgcc    343680
     gcctatgtcg gcgatggcgg ctactatctc gacaccgtgc tgcggctggg ccgctacgat    343740
     cagcaataca acattgccgg caccgatggc ggccgcgtca ccgccgacta ccgcacaagc    343800
     ggcgccgcat ggtcgctcga aggcgggcgc cggttcgagc tgcccaacga ctggttcgcc    343860
     gaaccgcagg ccgaggtcat gctgtggcgc acgtcaggca agcgctatcg cgccagcaat    343920
     ggcctgcgcg tcaaggtgga cgccaacacc gccacgctgg gccgcctggg cttgcgcttc    343980
     ggccgccgcg tcgccctggc cggcggcaac atcgtgcagc cctacgccag gctcggctgg    344040
     acgcaggagt tcaaaagcac gggcgatgtg cgcaccaatg gcattggcca tgccggcgca    344100
     ggccgccacg gccgcgtgga actgggcgcg ggcgtcgacg ccgcgttggg caaggggcac    344160
     aacctctatg cttcgtacga gtacgcggcg ggcgaccgga tcaacattcc gtggtcgttc    344220
     cacgccggct accgctacag cttctgagcg agctccaatg aaaaaccccg ccaggcgaac    344280
     ctggcggggt ttttttcggg aaggccgccg cggcaagccg cggcggtttc ggccgggaag    344340
     gcgggactta gaagtccatg ccgcccatgc cgcccatgcc gccgggcatt gccggagcag    344400
     cagcgggctt gtcttccatc agctcgacca cggcggcttc ggccgtcagc agcaggctgg    344460
     ccaccgaagc ggcgttctgc agcgcggtgc gggtgacctt ggtcgggtcc agcacgcctt    344520
     gctcgaccag gtcgccgtac tcgccggtcg cggcgttgta gccgtagttg cccttgccgt    344580
     tgagcacggt gttgaccacc acgctggctt cgtcgccggc gttggtgacg atggtgcgca    344640
     ggggctcttc gacagcgcgc aggatcagct tgatgccggc gttctggtca gccgtgtcgc    344700
     ccttcaggcc agtgatggcc tgcttggcgc gcagcagcgc aacgccaccg ccaggaacca    344760
     cgccttcttc caccgcggca cgcgtggcgt gcagggcgtc ttcgacgcga gccttctttt    344820
     ccttcatttc gacttcggtg gcagcaccga cgcgaatcac ggcaacgccg ccggccagct    344880
     tggccacgcg ctcttgcagc ttctcgcggt cgtagtccga ggtggcttcc tcgatctggg    344940
     cgcggatctg cttgacgcgc gcttcgatcg acttgccgtc gccggcgccg tcgatgatcg    345000
     tggtgttttc cttggccact tcgatgcgct tggcctggcc cagatcctgc agcgtggcct    345060
     tttccagcga catgccggtt tcttcggaga tcaccgtgcc gcccgtcagg atggcgatgt    345120
     cttccagcat ggccttgcga cggtcgccga agcccggggc cttgacggcg gtggtcttca    345180
     ggatgccgcg gatgttgttc acgaccaggg tggccagcgc ttcgccttcg acgtcttcgg    345240
     cgatgatcag cagcggacgg ctcgacttgg cgacttgctc cagcacgggc agcaggtcac    345300
     ggatgttgct gaccttcttg tcgtagatca ggacatacgg atcgtccagc gcggcgactt    345360
     gcttttccgg gctgttgatg aagtagggcg acaggtagcc gcggtcgaat tgcatgcctt    345420
     cgacgacatc cagttcgttt tccagcgact tgccgtcttc gacggtgatc acgccttcct    345480
     tgccgacctt gtccatcgcg tcagcgatga tctggccgat cgaggcatcg ctgttggccg    345540
     agatcgagcc aacctgggcg atttccttgc tggtggtgac cggcttggac agtttcttca    345600
     gctcttccac ggcggcggcc acggccttgt cgatgccgcg cttgaggtcg atcgggttga    345660
     agccggcggc gacgtacttc aggccttcct gaacgacggc ctgggccagc acggtggcgg    345720
     tggtggtgcc gtcaccggcg ttgtcggagg tcttggaggc aacgtccttg accagctggg    345780
     cgccgatgtt ctcgaacttg tccttcagtt cgatttcctt ggcgacggac acgccgtcct    345840
     tggtcaccgt cggggcgccg aacgagcgct ccagcacgac gttgcgaccc ttggggccca    345900
     gggtggtctt gacggcgttg gcgaggacgt tcacgccgcg cacgatgcgc acgcgggctt    345960
     cgtcggcaaa cagaacttgc ttggcagcca ttgttagctt ccttagagaa ttcggttacg    346020
     caattactgg atcacggcga ggatttcgtc ctcgcggatg acgagcagct cttcgccatc    346080
     gaccttgacg gtctggccgg cgtacttgcc gaacaggacc ttgtcgccag ccttcaggtc    346140
     gaccggcagg atcttgccgt cttcggtctt cttgccgggg ccgacggcca cgacttcacc    346200
     ttgatccggc ttttcggcgg cgctgtcggg aatgacgatg cccgaggcag tcttgcgctc    346260
     gttgtccagg cgtttgacga tcacgcgatc gtgcagggga cgcagggcca tgaggaactc    346320
     ctgtttctaa agaaaagaag aaaaatgatc ggtatttggc gc                       346362
//

If you have problems or comments...

PBIL Back to PBIL home page